METHODS AND COMPOUNDS FOR RESTORING MUTANT p53 FUNCTION

Abstract
Mutations in oncogenes and tumor suppressors contribute to the development and progression of cancer. The present disclosure describes compounds and methods to recover wild-type function to p53 mutants. The compounds of the present invention can bind to mutant p53 and restore the ability of the p53 mutant to bind DNA and activate downstream effectors involved in tumor suppression. The disclosed compounds can be used to reduce the progression of cancers that contain a p53 mutation.
Description
SEQUENCE LISTING

The instant application contains a Sequence Listing, which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Sep. 18, 2020, is named 44727-705.601 Sequence Listing.txt and is 2,578 bytes in size.


BACKGROUND

Cancer, an uncontrolled proliferation of cells, is a multifactorial disease characterized by tumor formation, growth, and in some instances, metastasis. Cells carrying an activated oncogene, damaged genome, or other cancer-promoting alterations can be prevented from replicating through an elaborate tumor suppression network. A central component of this tumor suppression network is p53, one of the most potent tumor suppressors in the cell. Both the wild type and mutant conformations of p53 are implicated in the progression of cancer.


INCORPORATION BY REFERENCE

Each patent, publication, and non-patent literature cited in the application is hereby incorporated by reference in its entirety as if each was incorporated by reference individually.


SUMMARY OF THE INVENTION

In some embodiments, described herein is a compound, the compound comprising: a heterocyclyl group comprising a halo substituent, wherein the compound binds a mutant p53 protein and increases wild-type p53 activity of the mutant p53 protein.


In some embodiments, described herein is a compound of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the Y atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof, wherein the compound is not a compound of Table 1.


In some embodiments, described herein is a compound of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent, wherein at least one of R3 and R4 is alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


In some embodiments, described herein is a compound, the compound comprising: a heterocyclyl group comprising a halogenated substituent, wherein the compound binds a mutant p53 protein and increases wild-type p53 activity of the mutant p53.


In some embodiments, described herein is a method of treating a cancer, the method comprising administering to a subject in need thereof a compound of Formula (I):




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the Y atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically acceptable salt thereof;
    • wherein the compound has an SC150 value for p53 Y220C of less than 1 μM as measured by a homogeneous time-resolved fluorescence (HTRF) assay.


In some embodiments, described herein is a compound of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • A is a linking group;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, heterocyclyl, or halo, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent; wherein at least one of R3 and R4 is alkyl, alkylene, alkenyl, alkenylene, alkynyl, alkynylene, aryl, heteroaryl, or heterocyclyl, each of which is substituted with at least halo;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is independently —C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof


In some embodiments, described herein is a compound of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • A is a linking group;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, heterocyclyl, or halo, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is independently —C(O)R23, —C(O)OR23, —C(O)NR23R24, —OR23, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof, wherein the compound is not a compound of Table 1.


In some embodiments, described herein is a method of inducing apoptosis in a cell, the method comprising contacting the cell with a therapeutically-effective amount of a compound of the disclosure that binds a p53 mutant, wherein the compound increases the ability of the p53 mutant to bind DNA, wherein the cell expresses the p53 mutant.


In some embodiments, described herein is a method of treating a cancer, the method comprising administering to a subject in need thereof a therapeutically-effective amount of a compound of the disclosure.







DETAILED DESCRIPTION

The present invention provides compounds and methods for restoring wild-type function to mutant p53. The compounds of the present invention can bind to mutant p53 and restore the ability of the p53 mutant to bind DNA. The restoration of activity of the p53 mutant can allow for the activation of downstream effectors of p53 leading to inhibition of cancer progression. The invention further provides methods of treatment of a cancerous lesion or a tumor harboring a p53 mutation.


Cancer is a collection of related diseases characterized by uncontrolled proliferation of cells with the potential to metastasize throughout the body. Cancer can be classified into five broad categories including, for example: carcinomas, which can arise from cells that cover internal and external parts of the body such as the lung, breast, and colon; sarcomas, which can arise from cells that are located in bone, cartilage, fat, connective tissue, muscle, and other supportive tissues; lymphomas, which can arise in the lymph nodes and immune system tissues; leukemia, which can arise in the bone marrow and accumulate in the bloodstream; and adenomas, which can arise in the thyroid, the pituitary gland, the adrenal gland, and other glandular tissues.


Although different cancers can develop in virtually any of the body's tissues, and contain unique features, the basic processes that cause cancer can be similar in all forms of the disease. Cancer begins when a cell breaks free from the normal restraints on cell division and begins to grow and divide out of control. Genetic mutations in the cell can preclude the ability of the cell to repair damaged DNA or initiate apoptosis, and can result in uncontrolled growth and division of cells.


The ability of tumor cell populations to multiply is determined not only by the rate of cell proliferation but also by the rate of cell attrition. Programmed cell death, or apoptosis, represents a major mechanism of cellular attrition. Cancer cells can evade apoptosis through a variety of strategies, for example, through the suppression of p53 function, thereby suppressing expression of pro-apoptotic proteins.


Oncogenes and tumor suppressor genes can regulate the proliferation of cells. Genetic mutations can affect oncogenes and tumor suppressors, potentially activating or suppressing activity abnormally, further facilitating uncontrolled cell division. Whereas oncogenes assist in cellular growth, tumor suppressor genes slow cell division by repairing damaged DNA and activating apoptosis. Cellular oncogenes that can be mutated in cancer include, for example, Cdk1, Cdk2, Cdk3, Cdk4, Cdk6, EGFR, PDGFR, VEGF, HER2, Raf kinase, K-Ras, and myc. Tumor suppressor genes that can be mutated in cancer include, for example, BRCA1, BRCA2, cyclin-dependent kinase inhibitor 1C, Retinoblastoma protein (pRb), PTEN, p16, p27, p53, and p73.


Tumor Suppressor p53.

The tumor suppressor protein p53 is a 393 amino acid transcription factor that can regulate cell growth in response to cellular stresses including, for example, UV radiation, hypoxia, oncogene activation, and DNA damage. p53 has various mechanisms for inhibiting the progression of cancer including, for example, initiation of apoptosis, maintenance of genomic stability, cell cycle arrest, induction of senescence, and inhibition of angiogenesis. Due to the critical role of p53 in tumor suppression, p53 is inactivated in almost all cancers either by direct mutation or through perturbation of associated signaling pathways involved in tumor suppression. Homozygous loss of the p53 gene occurs in almost all types of cancer, including carcinomas of the breast, colon, and lung. The presence of certain p53 mutations in several types of human cancer can correlate with less favorable patient prognosis.


In the absence of stress signals, p53 levels are maintained at low levels via the interaction of p53 with Mdm2, an E3 ubiquitin ligase. In an unstressed cell, Mdm2 can target p53 for degradation by the proteasome. Under stress conditions, the interaction between Mdm2 and p53 is disrupted, and p53 accumulates. The critical event leading to the activation of p53 is phosphorylation of the N-terminal domain of p53 by protein kinases, thereby transducing upstream stress signals. The phosphorylation of p53 leads to a conformational change, which can promote DNA binding by p53 and allow transcription of downstream effectors. The activation of p53 can induce, for example, the intrinsic apoptotic pathway, the extrinsic apoptotic pathway, cell cycle arrest, senescence, and DNA repair. p53 can activate proteins involved in the above pathways including, for example, Fas/Apo1, KILLER/DR5, Bax, Puma, Noxa, Bid, caspase-3, caspase-6, caspase-7, caspase-8, caspase-9, and p21 (WAF1). Additionally, p53 can repress the transcription of a variety of genes including, for example, c-MYC, Cyclin B, VEGF, RAD51, and hTERT.


Each chain of the p53 tetramer is composed of several functional domains including the transactivation domain (amino acids 1-100), the DNA-binding domain (amino acids 101-306), and the tetramerization domain (amino acids 307-355), which are highly mobile and largely unstructured. Most p53 cancer mutations are located in the DNA-binding core domain of the protein, which contains a central β-sandwich of anti-parallel β-sheets that serves as a basic scaffold for the DNA-binding surface. The DNA-binding surface is composed of two β-turn loops, L2 and L3, which are stabilized by a zinc ion, for example, at Arg175 and Arg248, and a loop-sheet-helix motif. Altogether, these structural elements form an extended DNA-binding surface that is rich in positively-charged amino acids and makes specific contact with various p53 response elements.


Due to the prevalence of p53 mutations in virtually every type of cancer, the reactivation of wild type p53 function in a cancerous cell can be an effective therapy. Mutations in p53 located in the DNA-binding domain of the protein or periphery of the DNA-binding surface result in aberrant protein folding required for DNA recognition and binding. Mutations in p53 can occur, for example, at amino acids Val143, His168, Arg175, Tyr220, Gly245, Arg248, Arg249, Phe270, Arg273, and Arg282. p53 mutations that can abrogate the activity of p53 include, for example, R175H, Y220C, G245S, R248Q, R248W, R273H, and R282H. These p53 mutations can either distort the structure of the DNA-binding site or thermodynamically destabilize the folded protein at body temperature. Wild-type function of p53 mutants can be recovered by binding of the p53 mutant to a compound that can shift the folding-unfolding equilibrium towards the folded state, thereby reducing the rate of unfolding and destabilization.


Non-limiting examples of amino acids include: alanine (A, Ala); arginine (R, Arg); asparagine (N, Asn); aspartic acid (D, Asp); cysteine (C, Cys); glutamic acid (E, Glu); glutamine (Q, Gln); glycine (G, Gly); histidine (H, His); isoleucine (I, Ile); leucine (L, Leu); lysine (K, Lys); methionine (M, Met); phenylalanine (F, Phe); proline (P, Pro); serine (S, Ser); threonine (T, Thr); tryptophan (W, Trp); tyrosine (Y, Tyr); and valine (V, Val).


Mechanism of Compounds of the Invention.

The compounds of the present invention can selectively bind to a p53 mutant and can recover wild-type activity of the p53 mutant including, for example, DNA binding function and activation of downstream targets involved in tumor suppression. In some embodiments, a compound of the invention selectively binds to the p53 Y220C mutant. The Y220C mutant is a temperature sensitive mutant, which binds to DNA at lower temperature and is denatured at body temperature. A compound of the invention can stabilize the Y220C mutant to reduce the likelihood of denaturation of the protein at body temperature.


Located in the periphery of the p53 β-sandwich connecting β-strands S7 and S8, the aromatic ring of Y220 is an integral part of the hydrophobic core of the β-sandwich. The Y220C mutation can be highly destabilizing, due to the formation of an internal surface cavity. A compound of the invention can bind to and occupy this surface crevice to stabilize the β-sandwich, thereby restoring wild-type p53 DNA-binding activity.


To determine the ability of a compound of the invention to bind and stabilize mutant p53, assays can be employed to detect, for example, a conformational change in the p53 mutant or activation of wild-type p53 targets. Conformational changes in p53 can be measured by, for example, differential scanning fluorimetry (DSF), isothermal titration calorimetry (ITC), nuclear magnetic resonance spectrometry (NMR), or X-ray crystallography. Additionally, antibodies specific for the wild type of mutant conformation of p53 can be used to detect a conformational change via, for example, immunoprecipitation (IP), immunofluorescence (IF), or immunoblotting.


Methods used to detect the ability of the p53 mutant to bind DNA can include, for example, DNA affinity immunoblotting, modified enzyme-linked immunosorbent assay (ELISA), electrophoretic mobility shift assay (EMSA), fluorescence resonance energy transfer (FRET), homogeneous time-resolved fluorescence (HTRF), and a chromatin immunoprecipitation (ChIP) assay.


To determine whether a compound described herein is able to reactivate the transcriptional activity of p53, the activation of downstream targets in the p53 signaling cascade can be measured. Activation of p53 effector proteins can be detected by, for example, immunohistochemistry (IHC-P), reverse transcription polymerase chain reaction (RT-PCR), and western blotting. The activation of p53 can also be measured by the induction of apoptosis via the caspase cascade and using methods including, for example, Annexin V staining, TUNEL assays, pro-caspase and caspase levels, and cytochrome c levels. Another consequence of p53 activation is senescence, which can be measured using methods such as β-galactosidase staining.


A p53 mutant that can be used to determine the effectiveness of a compound of the invention to increase the DNA binding ability of a p53 mutant is a p53 truncation mutant, which contains only amino acids 94-312, encompassing the DNA-binding domain of p53. For example, the sequence of the p53 Y220C mutant used for testing compound efficacy can be:









(SEQ ID NO. 1)


SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPV





QLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQH





LIRVEGNLRVEYLDDRNTFRHSVVVPCEPPEVGSDCTTIHYNYMCNSSCM





GGMNRRPILTIITLEDSSGNLLGRNSFEVHVCACPGRDRRTEEENLRKKG





EPHHELPPGSTKRALSNNT






A compound of the invention can increase the ability of a p53 mutant to bind DNA by at least or up to about 0.1%, at least or up to about 0.2%, at least or up to about 0.3%, at least or up to about 0.4%, at least or up to about 0.5%, at least or up to about 0.6%, at least or up to about 0.7%, at least or up to about 0.8%, at least or up to about 0.9%, at least or up to about 1%, at least or up to about 2%, at least or up to about 3%, at least or up to about 4%, at least or up to about 5%, at least or up to about 6%, at least or up to about 7%, at least or up to about 8%, at least or up to about 9%, at least or up to about 10%, at least or up to about 11%, at least or up to about 12%, at least or up to about 13%, at least or up to about 14%, at least or up to about 15%, at least or up to about 16%, at least or up to about 17%, at least or up to about 18%, at least or up to about 19%, at least or up to about 20%, at least or up to about 21%, at least or up to about 22%, at least or up to about 23%, at least or up to about 24%, at least or up to about 25%, at least or up to about 26%, at least or up to about 27%, at least or up to about 28%, at least or up to about 29%, at least or up to about 30%, at least or up to about 31%, at least or up to about 32%, at least or up to about 33%, at least or up to about 34%, at least or up to about 35%, at least or up to about 36%, at least or up to about 37%, at least or up to about 38%, at least or up to about 39%, at least or up to about 40%, at least or up to about 41%, at least or up to about 42%, at least or up to about 43%, at least or up to about 44%, at least or up to about 45%, at least or up to about 46%, at least or up to about 47%, at least or up to about 48%, at least or up to about 49%, at least or up to about 50%, at least or up to about 51%, at least or up to about 52%, at least or up to about 53%, at least or up to about 54%, at least or up to about 55%, at least or up to about 56%, at least or up to about 57%, at least or up to about 58%, at least or up to about 59%, at least or up to about 60%, at least or up to about 61%, at least or up to about 62%, at least or up to about 63%, at least or up to about 64%, at least or up to about 65%, at least or up to about 66%, at least or up to about 67%, at least or up to about 68%, at least or up to about 69%, at least or up to about 70%, at least or up to about 71%, at least or up to about 72%, at least or up to about 73%, at least or up to about 74%, at least or up to about 75%, at least or up to about 76%, at least or up to about 77%, at least or up to about 78%, at least or up to about 79%, at least or up to about 80%, at least or up to about 81%, at least or up to about 82%, at least or up to about 83%, at least or up to about 84%, at least or up to about 85%, at least or up to about 86%, at least or up to about 87%, at least or up to about 88%, at least or up to about 89%, at least or up to about 90%, at least or up to about 91%, at least or up to about 92%, at least or up to about 93%, at least or up to about 94%, at least or up to about 95%, at least or up to about 96%, at least or up to about 97%, at least or up to about 98%, at least or up to about 99%, at least or up to about 100%, at least or up to about 125%, at least or up to about 150%, at least or up to about 175%, at least or up to about 200%, at least or up to about 225%, or at least or up to about 250% as compared to the ability of the p53 mutant to bind DNA in the absence of a compound of the invention.


A compound described herein can increase the activity of the p53 mutant that is, for example, at least or up to about 2-fold, at least or up to about 3-fold, at least or up to about 4-fold, at least or up to about 5-fold, at least or up to about 6-fold, at least or up to about 7-fold, at least or up to about 8-fold, at least or up to about 9-fold, at least or up to about 10-fold, at least or up to about 11-fold, at least or up to about 12-fold, at least or up to about 13-fold, at least or up to about 14-fold, at least or up to about 15-fold, at least or up to about 16-fold, at least or up to about 17-fold, at least or up to about 18-fold, at least or up to about 19-fold, at least or up to about 20-fold, at least or up to about 25-fold, at least or up to about 30-fold, at least or up to about 35-fold, at least or up to about 40-fold, at least or up to about 45-fold, at least or up to about 50-fold, at least or up to about 55-fold, at least or up to about 60-fold, at least or up to about 65-fold, at least or up to about 70-fold, at least or up to about 75-fold, at least or up to about 80-fold, at least or up to about 85-fold, at least or up to about 90-fold, at least or up to about 95-fold, at least or up to about 100-fold, at least or up to about 110-fold, at least or up to about 120-fold, at least or up to about 130-fold, at least or up to about 140-fold, at least or up to about 150-fold, at least or up to about 160-fold, at least or up to about 170-fold, at least or up to about 180-fold, at least or up to about 190-fold, at least or up to about 200-fold, at least or up to about 250-fold, at least or up to about 300-fold, at least or up to about 350-fold, at least or up to about 400-fold, at least or up to about 450-fold, at least or up to about 500-fold, at least or up to about 550-fold, at least or up to about 600-fold, at least or up to about 650-fold, at least or up to about 700-fold, at least or up to about 750-fold, at least or up to about 800-fold, at least or up to about 850-fold, at least or up to about 900-fold, at least or up to about 950-fold, at least or up to about 1,000-fold, at least or up to about 1,500-fold, at least or up to about 2,000-fold, at least or up to about 3,000-fold, at least or up to about 4,000-fold, at least or up to about 5,000-fold, at least or up to about 6,000-fold, at least or up to about 7,000-fold, at least or up to about 8,000-fold, at least or up to about 9,000-fold, or at least or up to about 10,000-fold greater than the activity of the p53 mutant in the absence of the compound.


A compound of the invention can be used, for example, to induce apoptosis, cell cycle arrest, or senescence in a cell. In some embodiments, the cell is a cancer cell. In some embodiments, the cell carries a mutation in p53.


Compounds of the Invention.

In some embodiments, a compound of the disclosure comprises a heterocyclyl group comprising a halo substituent, wherein the compound binds a mutant p53 protein and increases wild-type p53 activity of the mutant protein. In some embodiments, the compound further comprises an indole group. In some embodiments, the indole group has a 1,1,1,-trifluoroethyl substituent at a 1-position of the indole group.


In some embodiments, the indole group has a propargyl substituent at a 2-position of the indole group. In some embodiments, the propargyl substituent is attached to the indole group via an sp carbon atom of the propargyl substituent. In some embodiments, the propargyl substituent is attached to a nitrogen atom of an aniline group via a methylene group of the propargyl substituent. In some embodiments, the indole group comprises an amino substituent at a 4-position of the indole group. In some embodiments, the amino substituent is attached to the heterocyclyl group. In some embodiments, the heterocyclyl group is a piperidine group. In some embodiments, the halo substituent is a fluoro group. In some embodiments, the halo substituent is a chloro group. In some embodiments, the compound has oral bioavailability that is at least about 50% greater than that of an analogous compound that lacks the halo substituent on the heterocyclyl group.


Non-limiting examples of compounds of the invention include compounds of any of the following formulae:




embedded image


embedded image


embedded image


embedded image


embedded image


embedded image


embedded image




embedded image


embedded image


embedded image


embedded image


embedded image


embedded image


In some embodiments, the disclosure provides a compound of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the Y atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof, wherein the compound is not a compound of Table 1.


In some embodiments, disclosed herein is a compound of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R9, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent, wherein at least one of R3 and R4 is alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


In some embodiments, the compound is of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • A is a linking group;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, heterocyclyl, or halo, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent; wherein at least one of R3 and R4 is alkyl, alkylene, alkenyl, alkenylene, alkynyl, alkynylene, aryl, heteroaryl, or heterocyclyl, each of which is substituted with at least halo;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is independently —C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


In some embodiments, the compound is of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • A is a linking group;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, heterocyclyl, or halo, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is independently —C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof, wherein the compound is not a compound of Table 1.


In some embodiments, A is alkylene, alkenylene, or alkynylene, each of which is substituted or unsubstituted. In some embodiments, A is alkylene. In some embodiments, A is alkenylene. In some embodiments, A is alkynylene.


In some embodiments, the compound of the formula is:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • A is a cyclic group substituted with at least halo;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • R3 is —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and A together with the nitrogen atom to which R3 and A are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent,
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


In some embodiments, the compound is of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • A is a cyclic group substituted with at least halo;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • R3 is —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and A together with the nitrogen atom to which R3 and A are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent,
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —OR23, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


In some embodiments, the pattern of dashed bonds is chosen to provide an aromatic system, for example, an indole, an indolene, a pyrrolopyridine, a pyrrolopyrimidine, or a pyrrolopyrazine.


In some embodiments, X1 is CR5, CR5R6, or a carbon atom connected to Q1. In some embodiments, X2 is CR7, CR7R8, or a carbon atom connected to Q1. In some embodiments, X3 is CR9, CR9R10, or a carbon atom connected to Q1. In some embodiments, X4 is CR11, CR11R12, or a carbon atom connected to Q1. In some embodiments, X5 is CR13, N, or NR13. In some embodiments, X1 is a carbon atom connected to Q1. In some embodiments, X2 is a carbon atom connected to Q1. In some embodiments, X3 is a carbon atom connected to Q1. In some embodiments, X4 is a carbon atom connected to Q1. In some embodiments, X5 is N.


In some embodiments, Q1 is a bond. In some embodiments, Q1 is C1-alkylene.


In some embodiments, m is 1. In some embodiments, m is 2. In some embodiments, m is 3. In some embodiments, m is 4.


In some embodiments, ring A is aryl, heteroaryl, or heterocyclyl, each of which is substituted or unsubstituted. In some embodiments, ring A is substituted aryl. In some embodiments, ring A is aryl substituted with fluoro-. In some embodiments, ring A is aryl substituted with chloro-. In some embodiments, ring A is substituted heteroaryl, In some embodiments, ring A is heteroaryl substituted with fluoro-. In some embodiments, ring A is heteroaryl substituted with chloro-. In some embodiments, ring A is substituted heterocyclyl. In some embodiments, ring A is heterocyclyl substituted with fluoro-. In some embodiments, ring A is heterocyclyl substituted with chloro-.


In some embodiments, R1 is alkyl, alkenyl, —C(O)R16, —C(O)OR16, or —C(O)NR16R17, each of which is unsubstituted or substituted. In some embodiments, R1 is substituted alkyl. In some embodiments, R1 is alkyl substituted with NR16R17.


In some embodiments, each R16 and R17 is independently alkyl, alkenyl, aryl, heteroaryl, heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen. In some embodiments, R16 is hydrogen or alkyl. In some embodiments, R17 is aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted. In some embodiments, R17 is substituted aryl. In some embodiments, R17 is substituted phenyl. In some embodiments, R17 is phenyl substituted with a sulfoxide group, carboxyl group, amide group, amino group, alkyl, alkoxy, hydroxy, halo, cyano, or heterocyclyl, each of which is independently substituted or unsubstituted. In some embodiments, R17 is phenyl substituted with methoxy. In some embodiments, R17 is phenyl substituted with a substituted sulfoxide group. In some embodiments, R17 is phenyl substituted with a carboxyl group. In some embodiments, R17 is phenyl substituted with a substituted amide group.


In some embodiments, the compound is of the formula:




embedded image


In some embodiments, Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond. In some embodiments, Q1 is alkylene, alkenylene, or alkynylene. In some embodiments, Q1 is C1-alkylene or a bond. In some embodiments, Q1 is C1-alkylene. In some embodiments, Q1 is a bond.


In some embodiments, Y is N. In some embodiments, Y is O. In some embodiments, Y is absent.


In some embodiments, R2 is hydrogen or alkyl. In some embodiments, R2 is alkyl. In some embodiments, R2 is substituted C1-C5-alkyl. In some embodiments, R2 is trifluoroethyl. In some embodiments, R2 is cycloalkyl. In some embodiments, R2 is cyclopropyl.


In some embodiments, R13 is alkyl, alkenyl, hydrogen, or halogen. In some embodiments, R13 is hydrogen.


In some embodiments, R2 is C1-C5-alkyl, and R13 is C1-C5-alkyl. In some embodiments, R2 is C1-C5-alkyl, and R13 is hydrogen. In some embodiments, R2 is substituted C1-C5-alkylene. In some embodiments, R2 is methyl, ethyl, propyl, iso-propyl, butyl, or tert-butyl, each of which is substituted or unsubstituted. In some embodiments, R13 is methyl, ethyl, propyl, iso-propyl, butyl or tert-butyl. In some embodiments, R2 is hydrogen, and R13 is hydrogen. In some embodiments, R2 is trifluoroethyl, and R13 is hydrogen.


In some embodiments, the compound is of the formula:




embedded image


In some embodiments, the compound is of the formula:




embedded image


In some embodiments, R3 is H, and R4 is —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted. In some embodiments, each R3 and R4 is independently substituted or unsubstituted C1-C6-alkylene. In some embodiments, R3 is H, and R4 is substituted or unsubstituted C1-C4 alkylene. In some embodiments, R3 is H, and R4 is substituted or unsubstituted heterocyclyl. In some embodiments, R3 is H, and R4 is substituted or unsubstituted piperidinyl. In some embodiments, R3 is H, and R4 is substituted or unsubstituted cycloalkyl. In some embodiments, R3 is H, and R4 is cycloalkyl substituted with an amino group. In some embodiments, R3 is H, and R4 is substituted or unsubstituted cyclobutyl. In some embodiments, R3 is H, and R4 is cyclobutyl substituted with an amino group. In some embodiments, R3 is H, and R4 is substituted or unsubstituted cyclohexyl. In some embodiments, R3 is H, and R4 is cyclohexyl substituted with an amino group.


In some embodiments, the compound is of the formula:




embedded image


In some embodiments, the compound is of the formula:




embedded image


R1 can be a group substituted with one or more substituents selected from a hydroxyl group, sulfhydryl group, halogens, amino group, nitro group, nitroso group, cyano group, azido group, sulfoxide group, sulfone group, sulfonamide group, carboxyl group, carboxaldehyde group, imine group, alkyl group, halo-alkyl group, cyclic alkyl group, alkenyl group, halo-alkenyl group, alkynyl group, halo-alkynyl group, alkoxy group, aryl group, aryloxy group, aralkyl group, arylalkoxy group, heterocyclyl group, acyl group, acyloxy group, carbamate group, amide group, urethane group, and ester group. In some embodiments, R1 is alkyl, alkenyl, —C(O)R16, —C(O)OR16, or —C(O)NR16R17. In some embodiments, R1 is substituted or unsubstituted C1-C3 alkyl. In some embodiments, R1 is C1-C3-alkyl substituted with an amine group. In some embodiments, R1 is C1-alkyl substituted with NR16R17. In some embodiments, each R16 and R17 is independently aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen. In some embodiments, R16 is H, and R17 is substituted aryl. In some embodiments, R16 is H, and R17 is substituted phenyl. In some embodiments, R16 is H, and R17 is phenyl substituted with alkyl, alkoxy, halo, sulfonamide, a sulfone, or a carboxy group. In some embodiments, R16 is H, and R17 is substituted heteroaryl. In some embodiments, R16 is H, and R17 is substituted heterocyclyl.


In some embodiments, R3 is —C(O)R19, —C(O)OR19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, and R4 is —C(O)R19, —C(O)OR19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen. In some embodiments, R3 is alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen. In some embodiments, R3 is substituted alkyl. In some embodiments, R3 is H.


In some embodiments, R3 is hydrogen and R4 is a ring A. In some embodiments, R4 or ring A is cycloalkyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted. In some embodiments, R4 or ring A is substituted or unsubstituted aryl. In some embodiments, R4 or ring A is substituted or unsubstituted phenyl. In some embodiments, R4 or ring A is substituted or unsubstituted cycloalkyl. In some embodiments, R4 or ring A is substituted or unsubstituted cyclopropyl. In some embodiments, R4 or ring A is substituted cyclopropyl. In some embodiments, R4 or ring A is substituted cyclohexyl. In some embodiments, R4 or ring A is cyclohexyl substituted with an amino group.


In some embodiments, R3 is H, and R4 or ring A is unsubstituted or substituted heterocyclyl. In some embodiments, R4 or ring A is heterocyclyl. In some embodiments, R4 or ring A is piperidinyl, piperazinyl, tetahydropyranyl, morpholinyl, or pyrrolidinyl, each of which is independently substituted or unsubstituted. In some embodiments, R3 is H, and R4 or ring A is substituted piperidinyl. In some embodiments, R3 is H, and R4 or ring A is piperidine substituted with alkyl, carboxy, heterocyclyl, or an amide group. In some embodiments, R3 is H, and R4 or ring A is unsubstituted or substituted methyl piperidinyl. In some embodiments, R3 is H, and R4 or ring A is 3-fluoro-1-methylpiperidinyl. In some embodiments, R3 is H, and R4 or ring A is piperidinyl substituted with methoxypropanol. In some embodiments, R3 is H, and R4 or ring A is 3-fluoro-1-(2-hydroxy-3-methoxypropyl)piperidinyl. In some embodiments, R3 is H, and R4 or ring A is unsubstituted or substituted tetrahydropyranyl. In some embodiments, R3 is H, and R4 or ring A is unsubstituted tetrahydropyranyl. In some embodiments, R3 is H, and R4 or ring A is tetrahydropyranyl substituted with alkyl. In some embodiments, R3 is H, and R4 or ring A is tetrahydrothiopyran-1,1-diooxide.


In some embodiments, R4 or ring A is cycloalkyl, aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-. In some embodiments, R4 or ring A is C4-C6-cycloalkyl substituted with at least halo-. In some embodiments, R4 or ring A is cyclohexyl substituted with at least halo-. In some embodiments, R4 or ring A is aryl substituted with at least halo-. In some embodiments, R4 or ring A is phenyl substituted with at least halo-. In some embodiments, R4 or ring A is aryl substituted with fluoro-. In some embodiments, R4 or ring A is phenyl substituted with fluoro-. In some embodiments, R4 or ring A is aryl substituted with chloro-. In some embodiments, R4 or ring A is phenyl substituted with chloro-. In some embodiments, R4 or ring A is heteroaryl substituted with at least halo-. In some embodiments, R4 or ring A is heteroaryl substituted with fluoro-. In some embodiments, R4 or ring A is heteroaryl substituted with chloro-. In some embodiments, R4 or ring A is C4-C6-heterocyclyl substituted with at least halo-. In some embodiments, R4 or ring A is heterocyclyl substituted with fluoro-. In some embodiments, R4 or ring A is heterocyclyl substituted with chloro-.


In some embodiments, R4 or ring A is piperidinyl, piperazinyl, tetahydropyranyl, morpholinyl, or pyrrolidinyl, each of which is independently substituted with at least halo-. In some embodiments, or ring A is piperidinyl substituted with halo-. In some embodiments, R4 or ring A is methylpiperidinyl substituted with halo-. In some embodiments, R4 or ring A is 3-fluoro-1-methylpiperidinyl. In some embodiments, R4 or ring A is 3-fluoro-1-(2-hydroxy-3-methoxypropyl)piperidinyl. In some embodiments, R4 or ring A is tetrahydropyranyl substituted with at least halo-.


In some embodiments, R4 or Ring A is a ring that is:




embedded image


wherein the ring is substituted or unsubstituted. In some embodiments, the ring is substituted with halo-. In some embodiments, the ring is substituted with fluoro. In some embodiments, R3 is H, and R4 is a ring that is




embedded image


wherein the ring is substituted or unsubstituted. In some embodiments, the ring is substituted with halo-. In some embodiments, the ring is substituted with fluoro. In some embodiments, R3 is H, and R4 is a ring that is




embedded image


wherein the ring is substituted or unsubstituted. In some embodiments, Ra is alkylene. In some embodiments, Ra is methyl. In some embodiments, the ring is substituted with halo. In some embodiments, the ring is substituted with fluoro. In some embodiments, R3 is H, and R4 is a ring that is




embedded image


wherein the ring is substituted or unsubstituted. In some embodiments, the ring is substituted with halo. In some embodiments, the ring is substituted with fluoro. In some embodiments, R3 is H, and R4 is a ring that is




embedded image


wherein the ring is substituted or unsubstituted.


In some embodiments, the R4 or ring A is substituted with one or more substituents selected from a hydroxyl group, sulfhydryl group, halogens, amino group, nitro group, nitroso group, cyano group, azido group, sulfoxide group, sulfone group, sulfonamide group, carboxyl group, carboxaldehyde group, imine group, alkyl group, halo-alkyl group, cyclic alkyl group, alkenyl group, halo-alkenyl group, alkynyl group, halo-alkynyl group, alkoxy group, aryl group, aryloxy group, aralkyl group, arylalkoxy group, heterocyclyl group, acyl group, acyloxy group, carbamate group, amide group, urethane group, and ester group.


In some embodiments, R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted. In some embodiments, R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a substituted heterocycle. In some embodiments, R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a heterocycle substituted with a hydroxyl group, halogen, amino group, or alkyl group. In some embodiments, R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a heterocycle, wherein the heterocycle is substituted by a substituted or unsubstituted heterocycle.


In some embodiments, the compound is of the formula:




embedded image


wherein:

    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each RQ is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • y is 0, 1, 2, 3, or 4;
    • each R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —OR23, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


In some embodiments, R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen. In some embodiments, R1 is alkyl, alkylene, alkoxy, —NR21R22, or aryl, each of which is independently substituted or unsubstituted; halo or hydrogen.


In some embodiments, R1 is substituted C1-C3-alkyl. In some embodiments, R1 is C1-C3-alkyl substituted with NR16R17. In some embodiments, R1 is methyl substituted with NR16R17, wherein each R16 and R17 is independently alkyl, cycloalkyl, aryl, heteroaryl, heterocyclyl, alkoxy, carboxyl group, amino group, acyl group, acyloxy group, or an amide group, any of which is unsubstituted or substituted, or hydrogen. In some embodiments, R1 is methyl substituted with NR16R17, wherein R16 is hydrogen, and R17 is a substituted carboxyl group. In some embodiments, R1 is methyl substituted with NR16R17, wherein R16 is hydrogen, and R17 is substituted aryl. In some embodiments, R1 is methyl substituted with NR16R17, wherein R16 is hydrogen, and R17 is substituted phenyl. In some embodiments, R1 is methyl substituted with NR16R17, wherein R16 is hydrogen, and R17 is phenyl. substituted with a sulfoxide group, carboxyl group, amide group, amino group, alkyl, alkoxy, hydroxy, halo, cyano, or heterocyclyl, each of which is independently substituted or unsubstituted. In some embodiments, R17 is phenyl substituted with methoxy. In some embodiments, R17 is phenyl substituted with a substituted sulfoxide group. In some embodiments, R17 is phenyl substituted with a carboxyl group. In some embodiments, R17 is a substituted amide group. In some embodiments, R17 is substituted with methoxy and sulfonamide.


In some embodiments, R2 is hydrogen or alkyl. In some embodiments, R2 is substituted C1-C5-alkylene. In some embodiments, R2 is trifluoroethyl.


In some embodiments, the compound is of the formula:




embedded image


or a pharmaceutically-acceptable salt thereof, wherein the variables are as defined above.


In some embodiments, each RQ is independently —C(O)R21, —C(O)R21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen. In some embodiments, each RQ is


In some embodiments, y is 1. In some embodiments, y is 2. In some embodiments, y is 3. In some embodiments, y is 4.


In some embodiments, R1 is —C(O)R16, C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen. In some embodiments, R1 is alkyl, alkylene, alkoxy, —NR21R22, or aryl, each of which is independently substituted or unsubstituted; halo or hydrogen.


In some embodiments, R1 is substituted alkyl. In some embodiments, R1 is substituted C1-C3-alkyl. In some embodiments, R1 is alkyl substituted with NR16R17. In some embodiments, R1 is C1-C3-alkyl substituted with NR16R17. In some embodiments, R1 is methyl substituted with NR16R17, wherein each R16 and R17 is independently alkyl, cycloalkyl, aryl, heteroaryl, heterocyclyl, alkoxy, carboxyl group, amino group, acyl group, acyloxy group, or an amide group, any of which is unsubstituted or substituted, or hydrogen. In some embodiments, R1 is methyl substituted with NR16R17, wherein R16 is hydrogen, and R17 is a substituted carboxyl group.


In some embodiments, R16 is alkyl, alkenyl, aryl, heteroaryl, heterocyclyl, or hydrogen, and R17 is aryl, heteroaryl, or heterocyclyl. In some embodiments, R16 is hydrogen, and R17 is phenyl, indolyl, piperidinyl, imidazolyl, thiazolyl, morpholinyl, pyrrolyl, or pyridinyl, each of which is substituted or unsubstituted.


In some embodiments, the compound is of the formula:




embedded image


In some embodiments, each R16 and R17 is independently alkyl, alkenyl, aryl, heteroaryl, heterocyclyl, or hydrogen. In some embodiments, R16 is aryl, and R17 is alkyl. In some embodiments, R16 is aryl, and R17 is hydrogen. In some embodiments, R16 is heteroaryl, and R17 is alkyl. In some embodiments, R16 is heteroaryl, and R17 is hydrogen. In some embodiments, R16 is substituted heteroaryl, and R17 is hydrogen. In some embodiments, R16 is substituted alkyl, and R17 is hydrogen. In some embodiments, R17 is aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted with halogen, alkyl, or hydroxyl. In some embodiments, R16 is hydrogen, and R17 is aryl or heteroaryl, substituted or unsubstituted with halogen or alkyl. In some embodiments, R16 is alkyl, and R17 is heteroaryl substituted with halogen or alkyl. In some embodiments, R16 is hydrogen. In some embodiments, R17 is aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted with alkyl. In some embodiments, R17 is aryl or heteroaryl, each of which is independently substituted with alkyl, wherein the alkyl is optionally substituted with fluorine, chlorine, bromine, iodine, or cyano. In some embodiments, R16 is alkyl, alkenyl, aryl, heteroaryl, heterocyclyl, or hydrogen, and R17 is aryl, heteroaryl, or heterocyclyl. In some embodiments, R16 is hydrogen, and R17 is phenyl, indolyl, piperidinyl, imidazolyl, thiazolyl, morpholinyl, pyrrolyl, or pyridinyl, each of which is substituted or unsubstituted. In some embodiments, R16 is hydrogen, and R17 is substituted phenyl. In some embodiments, R16 is hydrogen, and R17 is phenyl substituted with a sulfoxide group, carboxyl group, amide group, amino group, alkyl, alkoxy, hydroxy, halo, cyano, or heterocyclyl, each of which is independently substituted or unsubstituted. In some embodiments, R17 is phenyl substituted with methoxy. In some embodiments, R17 is phenyl substituted with a substituted sulfoxide group. In some embodiments, R17 is phenyl substituted with a carboxyl group. In some embodiments, R17 is a substituted amide group. In some embodiments, R17 is substituted with methoxy and sulfonamide.


In some embodiments, each R3 and R4 is independently unsubstituted or substituted alkyl. In some embodiments, R3 is hydrogen and R4 is —C(O)R19, —C(O)OR19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted. In some embodiments, R3 is hydrogen, and R4 is alkyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted. In some embodiments, R3 is H, and R4 is substituted heterocyclyl. In some embodiments, R3 is H, and R4 is substituted or unsubstituted C4-C6-heterocyclyl. In some embodiments, R3 is H, and R4 is substituted alkyl. In some embodiments, R3 is H, and R4 is substituted C1-C6-alkyl. In some embodiments, R3 is H, and R4 is substituted or unsubstituted cycloalkyl. In some embodiments, R3 is H, and R4 is substituted or unsubstituted C4-C6-cycloalkyl. In some embodiments, R3 is H, and R4 is C4-C6-cycloalkyl substituted with an amino group.


In some embodiments, the compound is of the formula:




embedded image


wherein:

    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent, wherein at least one of R3 and R4 is alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-;
    • each Z1 and Z2 is independently CR28, CR29, or N;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —OR23, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R25, R26, R27, R28, and R29 is independently hydrogen or a substituent selected from a hydroxyl group, sulfhydryl group, halogen, amino group, nitro group, nitroso group, cyano group, azido group, sulfoxide group, sulfone group, sulfonamide group, carboxyl group, carboxaldehyde group, imine group, alkyl group, halo-alkyl group, alkenyl group, halo-alkenyl group, alkynyl group, halo-alkynyl group, alkoxy group, aryl group, aryloxy group, aralkyl group, arylalkoxy group, heterocyclyl group, acyl group, acyloxy group, carbamate group, amide group, ureido group, epoxy group, and ester group.


      or a pharmaceutically-acceptable salt thereof.


In some embodiments, Z1 is N. In some embodiments, Z1 and Z2 are N. In some embodiments, each R25 and R26 is independently a halogen. In some embodiments, R25 is




embedded image


In some embodiments, R25 is a substituted sulfone group. In some embodiments, R25 is a sulfone group substituted with alkyl. In some embodiments, R25 is a methanesulfonyl group. In some embodiments, R25 is a sulfone group substituted with an amino group. In some embodiments, R25 is a sulfonamide. In some embodiments, R25 is a carboxy group. In some embodiments, R25 is a methoxycarbonyl group.


In some embodiments, the compound is of the formula:




embedded image


embedded image


wherein:

    • R2 is —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each RQ is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted;
    • y is 0, 1, 2, 3, or 4;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R25, R26, R27, R28, and R29 is independently hydrogen or a substituent selected from a hydroxyl group, sulfhydryl group, halogen, amino group, nitro group, nitroso group, cyano group, azido group, sulfoxide group, sulfone group, sulfonamide group, carboxyl group, carboxaldehyde group, imine group, alkyl group, halo-alkyl group, alkenyl group, halo-alkenyl group, alkynyl group, halo-alkynyl group, alkoxy group, aryl group, aryloxy group, aralkyl group, arylalkoxy group, heterocyclyl group, acyl group, acyloxy group, carbamate group, amide group, ureido group, epoxy group, and ester group.


      or a pharmaceutically-acceptable salt thereof.


In some embodiments, the compound is of the formula:




embedded image


embedded image


In some embodiments, R25 is a substituted sulfone group. In some embodiments, R25 is a sulfone group substituted with alkyl. In some embodiments, R25 is a methanesulfonyl group. In some embodiments, R25 is a sulfone group substituted with an amino group. In some embodiments, R25 is a sulfonamide. In some embodiments, R25 is a carboxy group. In some embodiments, R25 is a methoxycarbonyl group.


In some embodiments, the compound is of the formula:




embedded image


embedded image


wherein:

    • each RQ is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted;
    • y is 0, 1, 2, 3, or 4;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R26, R27, R28, and R29 is independently hydrogen or a substituent selected from a hydroxyl group, sulfhydryl group, halogen, amino group, nitro group, nitroso group, cyano group, azido group, sulfoxide group, sulfone group, sulfonamide group, carboxyl group, carboxaldehyde group, imine group, alkyl group, halo-alkyl group, alkenyl group, halo-alkenyl group, alkynyl group, halo-alkynyl group, alkoxy group, aryl group, aryloxy group, aralkyl group, arylalkoxy group, heterocyclyl group, acyl group, acyloxy group, carbamate group, amide group, ureido group, epoxy group, and ester group; and
    • R30 is alkyl or an amino group, each of which is substituted or unsubstituted,


      or a pharmaceutically-acceptable salt thereof.


In some embodiments, R30 is methyl. In some embodiments, R30 is NH2. In some embodiments, R30 is NHMe. In some embodiments, R30 is NMe2.


In some embodiments, the compound is of the formula:




embedded image


wherein R30 is alkyl or an amino group, each of which is unsubstituted or substituted. In some embodiments, R30 is methyl.


Non-limiting examples of compounds of the current disclosure include the following:




embedded image


or a pharmaceutically-acceptable salt thereof.


Non-limiting examples of compounds of the current disclosure include the following:




text missing or illegible when filed


text missing or illegible when filed


text missing or illegible when filed


or a pharmaceutically-acceptable salt thereof.


Non-limiting examples of compounds of the current disclosure include the following:




embedded image


or a pharmaceutically-acceptable salt thereof.


Non-limiting examples of compounds of the current disclosure include the following:




text missing or illegible when filed


text missing or illegible when filed


or a pharmaceutically-acceptable salt thereof.


Non-limiting examples of compounds of the current disclosure include the following:




embedded image


or a pharmaceutically-acceptable salt thereof.


Non-limiting examples of compounds of the current disclosure include the following:




text missing or illegible when filed


text missing or illegible when filed


or a pharmaceutically-acceptable salt thereof.


Non-limiting examples of compounds of the current disclosure include the following:




text missing or illegible when filed


or a pharmaceutically-acceptable salt thereof.


Compounds herein can include all stereoisomers, enantiomers, diastereomers, mixtures, racemates, atropisomers, and tautomers thereof.


Non-limiting examples of optional substituents include hydroxyl groups, sulfhydryl groups, halogens, amino groups, nitro groups, nitroso groups, cyano groups, azido groups, sulfoxide groups, sulfone groups, sulfonamide groups, carboxyl groups, carboxaldehyde groups, imine groups, alkyl groups, halo-alkyl groups, alkenyl groups, halo-alkenyl groups, alkynyl groups, halo-alkynyl groups, alkoxy groups, aryl groups, aryloxy groups, aralkyl groups, arylalkoxy groups, heterocyclyl groups, acyl groups, acyloxy groups, carbamate groups, amide groups, ureido groups, epoxy groups, and ester groups.


Non-limiting examples of alkyl and alkylene groups include straight, branched, and cyclic alkyl and alkylene groups. An alkyl or alkylene group can be, for example, a C1, C2, C3, C4, C5, C6, C7, C8, C9, C10, C11, C12, C13, C14, C15, C16, C17, C18, C19, C20, C21, C22, C23, C24, C25, C26, C27, C28, C29, C30, C31, C32, C33, C34, C35, C36, C37, C38, C39, C40, C41, C42, C43, C44, C45, C46, C47, C48, C49, or C50 group that is substituted or unsubstituted.


Non-limiting examples of straight alkyl groups include methyl, ethyl, propyl, butyl, pentyl, hexyl, heptyl, octyl, nonyl, and decyl.


Branched alkyl groups include any straight alkyl group substituted with any number of alkyl groups. Non-limiting examples of branched alkyl groups include isopropyl, isobutyl, sec-butyl, and t-butyl.


Non-limiting examples of substituted alkyl groups includes hydroxymethyl, chloromethyl, trifluoromethyl, aminomethyl, 1-chloroethyl, 2-hydroxyethyl, 1,2-difluoroethyl, and 3-carboxypropyl.


Non-limiting examples of cyclic alkyl groups include cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptlyl, and cyclooctyl groups. Cyclic alkyl groups also include fused-, bridged-, and spiro-bicycles and higher fused-, bridged-, and spiro-systems. A cyclic alkyl group can be substituted with any number of straight, branched, or cyclic alkyl groups. Non-limiting examples of cyclic alkyl groups include cyclopropyl, 2-methyl-cycloprop-1-yl, cycloprop-2-en-1-yl, cyclobutyl, 2,3-dihydroxycyclobut-1-yl, cyclobut-2-en-1-yl, cyclopentyl, cyclopent-2-en-1-yl, cyclopenta-2,4-dien-1-yl, cyclohexyl, cyclohex-2-en-1-yl, cycloheptyl, cyclooctanyl, 2,5-dimethylcyclopent-1-yl, 3,5-dichlorocyclohex-1-yl, 4-hydroxycyclohex-1-yl, 3,3,5-trimethylcyclohex-1-yl, octahydropentalenyl, octahydro-1H-indenyl, 3a,4,5,6,7,7a-hexahydro-3H-inden-4-yl, decahydroazulenyl, bicyclo[2.2.1]heptanyl, bicyclo[3.1.1]heptanyl, 1,3-dimethyl[2.2.1]heptan-2-yl, bicyclo[2.2.2]octanyl, and bicyclo[3.3.3]undecanyl.


Non-limiting examples of alkenyl and alkenylene groups include straight, branched, and cyclic alkenyl groups. The olefin or olefins of an alkenyl group can be, for example, E, Z, cis, trans, terminal, or exo-methylene. An alkenyl or alkenylene group can be, for example, a C2, C3, C4, C5, C6, C7, C8, C9, C10, C11, C12, C13, C14, C15, C16, C17, C18, C19, C20, C21, C22, C23, C24, C25, C26, C27, C28, C29, C30, C31, C32, C33, C34, C35, C36, C37, C38, C39, C40, C41, C42, C43, C44, C45, C46, C47, C48, C49, or C50 group that is substituted or unsubstituted. Non-limiting examples of alkenyl and alkenylene groups include ethenyl, prop-1-en-1-yl, isopropenyl, but-1-en-4-yl; 2-chloroethenyl, 4-hydroxybuten-1-yl, 7-hydroxy-7-methyloct-4-en-2-yl, and 7-hydroxy-7-methyloct-3,5-dien-2-yl.


Non-limiting examples of alkynyl or alkynylene groups include straight, branched, and cyclic alkynyl groups. The triple bond of an alkylnyl or alkynylene group can be internal or terminal. An alkylnyl or alkynylene group can be, for example, a C2, C3, C4, C5, C6, C7, C8, C9, C10, C11, C12, C13, C14, C15, C16, C17, C18, C19, C20, C21, C22, C23, C24, C25, C26, C27, C28, C29, C30, C31, C32, C33, C34, C35, C36, C37, C38, C39, C40, C41, C42, C43, C44, C45, C46, C47, C48, C49, or C50 group that is substituted or unsubstituted.


Non-limiting examples of alkynyl or alkynylene groups include ethynyl, prop-2-yn-1-yl, prop-1-yn-1-yl, and 2-methyl-hex-4-yn-1-yl; 5-hydroxy-5-methylhex-3-yn-1-yl, 6-hydroxy-6-methylhept-3-yn-2-yl, and 5-hydroxy-5-ethylhept-3-yn-1-yl.


A halo-alkyl group can be any alkyl group substituted with any number of halogen atoms, for example, fluorine, chlorine, bromine, and iodine atoms. A halo-alkenyl group can be any alkenyl group substituted with any number of halogen atoms. A halo-alkynyl group can be any alkynyl group substituted with any number of halogen atoms.


An alkoxy group can be, for example, an oxygen atom substituted with any alkyl, alkenyl, or alkynyl group. An ether or an ether group comprises an alkoxy group. Non-limiting examples of alkoxy groups include methoxy, ethoxy, propoxy, isopropoxy, and isobutoxy.


An aryl group can be heterocyclic or non-heterocyclic. An aryl group can be monocyclic or polycyclic. An aryl group can be substituted with any number of substituents described herein, for example, hydrocarbyl groups, alkyl groups, alkoxy groups, and halogen atoms. Non-limiting examples of aryl groups include phenyl, toluyl, naphthyl, pyrrolyl, pyridyl, imidazolyl, thiophenyl, and furyl. Non-limiting examples of substituted aryl groups include 3,4-dimethylphenyl, 4-tert-butylphenyl, 4-cyclopropylphenyl, 4-diethylaminophenyl, 4-(trifluoromethyl)phenyl, 4-(difluoromethoxy)-phenyl, 4-(trifluoromethoxy)phenyl, 3-chlorophenyl, 4-chlorophenyl, 3,4-dichlorophenyl, 2-fluorophenyl, 2-chlorophenyl, 2-iodophenyl, 3-iodophenyl, 4-iodophenyl, 2-methylphenyl, 3-fluorophenyl, 3-methylphenyl, 3-methoxyphenyl, 4-fluorophenyl, 4-methylphenyl, 4-methoxyphenyl, 2,3-difluorophenyl, 3,4-difluorophenyl, 3,5-difluorophenyl, 2,3-dichlorophenyl, 3,4-dichlorophenyl, 3,5-dichlorophenyl, 2-hydroxyphenyl, 3-hydroxyphenyl, 4-hydroxyphenyl, 2-methoxyphenyl, 3-methoxyphenyl, 4-methoxyphenyl, 2,3-dimethoxyphenyl, 3,4-dimethoxyphenyl, 3,5-dimethoxyphenyl, 2,4-difluorophenyl, 2,5-difluorophenyl, 2,6-difluorophenyl, 2,3,4-trifluorophenyl, 2,3,5-trifluorophenyl, 2,3,6-trifluorophenyl, 2,4,5-trifluorophenyl, 2,4,6-trifluorophenyl, 2,4-dichlorophenyl, 2,5-dichlorophenyl, 2,6-dichlorophenyl, 3,4-dichlorophenyl, 2,3,4-trichlorophenyl, 2,3,5-trichlorophenyl, 2,3,6-trichlorophenyl, 2,4,5-trichlorophenyl, 3,4,5-trichlorophenyl, 2,4,6-trichlorophenyl, 2,3-dimethylphenyl, 2,4-dimethylphenyl, 2,5-dimethylphenyl, 2,6-dimethylphenyl, 2,3,4-trimethylphenyl, 2,3,5-trimethylphenyl, 2,3,6-trimethylphenyl, 2,4,5-trimethylphenyl, 2,4,6-trimethylphenyl, 2-ethylphenyl, 3-ethylphenyl, 4-ethylphenyl, 2,3-diethylphenyl, 2,4-diethylphenyl, 2,5-diethylphenyl, 2,6-diethylphenyl, 3,4-diethylphenyl, 2,3,4-triethylphenyl, 2,3,5-triethylphenyl, 2,3,6-triethylphenyl, 2,4,5-triethylphenyl, 2,4,6-triethylphenyl, 2-isopropylphenyl, 3-isopropylphenyl, and 4-isopropylphenyl.


Non-limiting examples of substituted aryl groups include 2-aminophenyl, 2-(N-methylamino)phenyl, 2-(N,N-dimethylamino)phenyl, 2-(N-ethylamino)phenyl, 2-(N,N-diethylamino)phenyl, 3-aminophenyl, 3-(N-methylamino)phenyl, 3-(N,N-dimethylamino)phenyl, 3-(N-ethylamino)phenyl, 3-(N,N-diethylamino)phenyl, 4-aminophenyl, 4-(N-methylamino)phenyl, 4-(N,N-dimethylamino)phenyl, 4-(N-ethylamino)phenyl, and 4-(N,N-diethylamino)phenyl.


A heterocycle can be any ring containing a ring atom that is not carbon, for example, N, O, S, P, Si, B, or any other heteroatom. A heterocycle can be substituted with any number of substituents, for example, alkyl groups and halogen atoms. A heterocycle can be aromatic (heteroaryl) or non-aromatic. Non-limiting examples of heterocycles include pyrrole, pyrrolidine, pyridine, piperidine, succinamide, maleimide, morpholine, imidazole, thiophene, furan, tetrahydrofuran, pyran, and tetrahydropyran.


Non-limiting examples of heterocycles include: heterocyclic units having a single ring containing one or more heteroatoms, non-limiting examples of which include, diazirinyl, aziridinyl, azetidinyl, pyrazolidinyl, imidazolidinyl, oxazolidinyl, isoxazolinyl, thiazolidinyl, isothiazolinyl, oxathiazolidinonyl, oxazolidinonyl, hydantoinyl, tetrahydrofuranyl, pyrrolidinyl, morpholinyl, piperazinyl, piperidinyl, dihydropyranyl, tetrahydropyranyl, piperidin-2-onyl, 2,3,4,5-tetrahydro-1H-azepinyl, 2,3-dihydro-1H-indole, and 1,2,3,4-tetrahydroquinoline; and ii) heterocyclic units having 2 or more rings one of which is a heterocyclic ring, non-limiting examples of which include hexahydro-1H-pyrrolizinyl, 3a,4,5,6,7,7a-hexahydro-1H-benzo[d]imidazolyl, 3a,4,5,6,7,7a-hexahydro-1H-indolyl, 1,2,3,4-tetrahydroquinolinyl, and decahydro-1H-cycloocta[b]pyrrolyl.


Non-limiting examples of heteroaryl include: i) heteroaryl rings containing a single ring, non-limiting examples of which include, 1,2,3,4-tetrazolyl, [1,2,3]triazolyl, [1,2,4]triazolyl, triazinyl, thiazolyl, 1H-imidazolyl, oxazolyl, isoxazolyl, isothiazolyl, furanyl, thiophenyl, pyrimidinyl, 2-phenylpyrimidinyl, pyridinyl, 3-methylpyridinyl, and 4-dimethylaminopyridinyl; and ii) heteroaryl rings containing 2 or more fused rings one of which is a heteroaryl ring, non-limiting examples of which include: 7H-purinyl, 9H-purinyl, 6-amino-9H-purinyl, 5H-pyrrolo[3,2-d]pyrimidinyl, 7H-pyrrolo[2,3-d]pyrimidinyl, pyrido[2,3-d]pyrimidinyl, 4,5,6,7-tetrahydro-1-H-indolyl, quinoxalinyl, quinazolinyl, quinolinyl, 8-hydroxy-quinolinyl, and isoquinolinyl.


Any compound herein can be purified. A compound herein can be least 1% pure, at least 2% pure, at least 3% pure, at least 4% pure, at least 5% pure, at least 6% pure, at least 7% pure, at least 8% pure, at least 9% pure, at least 10% pure, at least 11% pure, at least 12% pure, at least 13% pure, at least 14% pure, at least 15% pure, at least 16% pure, at least 17% pure, at least 18% pure, at least 19% pure, at least 20% pure, at least 21% pure, at least 22% pure, at least 23% pure, at least 24% pure, at least 25% pure, at least 26% pure, at least 27% pure, at least 28% pure, at least 29% pure, at least 30% pure, at least 31% pure, at least 32% pure, at least 33% pure, at least 34% pure, at least 35% pure, at least 36% pure, at least 37% pure, at least 38% pure, at least 39% pure, at least 40% pure, at least 41% pure, at least 42% pure, at least 43% pure, at least 44% pure, at least 45% pure, at least 46% pure, at least 47% pure, at least 48% pure, at least 49% pure, at least 50% pure, at least 51% pure, at least 52% pure, at least 53% pure, at least 54% pure, at least 55% pure, at least 56% pure, at least 57% pure, at least 58% pure, at least 59% pure, at least 60% pure, at least 61% pure, at least 62% pure, at least 63% pure, at least 64% pure, at least 65% pure, at least 66% pure, at least 67% pure, at least 68% pure, at least 69% pure, at least 70% pure, at least 71% pure, at least 72% pure, at least 73% pure, at least 74% pure, at least 75% pure, at least 76% pure, at least 77% pure, at least 78% pure, at least 79% pure, at least 80% pure, at least 81% pure, at least 82% pure, at least 83% pure, at least 84% pure, at least 85% pure, at least 86% pure, at least 87% pure, at least 88% pure, at least 89% pure, at least 90% pure, at least 91% pure, at least 92% pure, at least 93% pure, at least 94% pure, at least 95% pure, at least 96% pure, at least 97% pure, at least 98% pure, at least 99% pure, at least 99.1% pure, at least 99.2% pure, at least 99.3% pure, at least 99.4% pure, at least 99.5% pure, at least 99.6% pure, at least 99.7% pure, at least 99.8% pure, or at least 99.9% pure.


In some embodiments, the compounds of the disclosure do not include compounds of Table 1, or a pharmaceutically-acceptable salt thereof.









TABLE 1







List of compounds








#
Structure IUPAC name





 1-P


embedded image





1-Anilino-3-{1-ethyl-5-[(1-methyl-4-



piperidylamino)methyl]-1H-indol-2-yl}-2-propyne





 2-P


embedded image





1-Anilino-3-{1-ethyl-5-



[(methylamino)methyl]-1H-indol-2-yl}-2-propyne





 3-P


embedded image





1-Anilino-3-{1-ethyl-5-[(tetrahydro-2H-



pyran-4-ylamino)methyl]-1H-indol-2-yl}-2-propyne





 4-P


embedded image





1-Anilino-3-[5-(benzylaminomethyl)-1-ethyl-



1H-indol-2-yl]-2-propyne





 5-P


embedded image





3-{1-Ethyl-5-[(methylamino)methyl]-1H-



indol-2-yl}-1-(p-fluorophenylamino)-2-propyne





 6-P


embedded image





3-{1-Ethyl-5-[(tetrahydro-2H-pyran-4-



ylamino)methyl]-1H-indol-2-yl}-1-(p-



fluorophenylamino)-2-propyne





 7-P


embedded image





1-(p-Chlorophenylamino)-3-{1-ethyl-5-{(1-



methyl-4-piperidylamino)methyl]-1H-indol-2-yl}-2-propyne





 8-P


embedded image





3-{1-Ethyl-5-[(tetrahydro-2H-pyran-4-



ylamino)methyl]-1H-indol-2-yl}-1-(6-



methyl-3-pyridylamino)-2-propyne





 9-P


embedded image





3-{1-Ethyl-5-[(methylamino)methyl]-1H-



indol-2-yl}-1-(6-methyl-3-pyridylamino)-2-propyne





 10-P


embedded image





3-{1-Ethyl-5-{(1-methyl-4-



piperidylamino)methyl]-1H-indol-2-yl}-1-(2-



methyl-4-pyridylamino)-2-propyne





 11-P


embedded image





3-[5-(Benzylaminomethyl)-1-ethyl-1H-indol-



2-yl]-1-(2-methyl-4-pyridylamino)-2-propyne





 12-P


embedded image





N-(3-{5-[(Diethylamino)methyl]-1-ethyl-1H-



indol-2-yl}prop-2-yn-1-yl)aniline





 13-P


embedded image





4-Chloro-N-(3-{5-[(diethylamino)methyl]-1-



ethyl-1H-indol-2-yl}prop-2-yn-1-yl)aniline





 14-P


embedded image





N-({1-Ethyl-2-[3-(phenylamino)pro-1-yn-1-



yl]-1H-indol-5-yl}methyl)oxetan-3-amine





 15-P

text missing or illegible when filed




N-[3-(1-Ethyl-5-{[(2-



methylpropyl)amino]methyl}-1H-indol-2-



yl)prop-2-yn-1-yl]aniline





 16-P

text missing or illegible when filed




N-[3-(1-Ethyl-5-{[(2-



methylpropyl)amino]methyl}-1H-indol-2-



yl)prop-2-yn-1-yl]aniline





 17-P


embedded image





N-({1-ethyl-2-[3-(phenylamino)prop-1-yn-1-



yl]-1H-indol-5-yl}methyl)-1-



methanesulfonylpiperidin-4-amine





 18-P


embedded image





N-(3-{1-Ethyl-5-[(ethylamino)methyl]-1H-



indol-2-yl}prop-2-yn-1-yl)aniline





 19-P


embedded image





N-{3-[5-({[2-



(Dimethylamino)ethyl]amino}methyl)-1-



ethyl-1H-indol-2-yl]prop-2-yn-1-yl}aniline





 20-P


embedded image





6-tert-Butyl-N-[3-(1-ethyl-5-{[(1-



methylpiperidin-4-yl)amino]methyl}-1H-



indol-2-yl)prop-2-yn-1-yl]pyridin-3-amine





 21-P


embedded image





N-[(2-{3-[(4-Chlorophenyl)amino]prop-1-



yn-1-yl}-1-ethyl-1H-indol-5-yl)methyl]oxan-4-amine





 22-P


embedded image





6-tert-Butyl-N-(3-{1-ethyl-5-



[(methylamino)methyl]-1H-indol-2-yl}prop-



2-yn-1-yl)pyridin-3-amine





 23-P


embedded image





4-[(3-{1-Ethyl-5-[(methylamino)methyl]-1H-



indol-2-yl}prop-2-yn-1-yl)amino]benzonitrile





 24-P


embedded image





4-tert-Butyl-N-(3-{1-ethyl-5-



[(methylamino)methyl]-1H-indol-2-yl}prop-



2-yn-1-yl)benzamide





 25-P


embedded image





4-Chloro-N-(3-{1-ethyl-5-



[(methylamino)methyl]-1H-indol-2-yl}prop-



2-yn-1-yl)-3-fluorobenzamide





 26-P


embedded image





4-Cyano-N-({1-ethyl-2-[3-



(phenylformamido)prop-1-yn-1-yl]-1H-



indol-5-yl}methyl)-N-methylbenzamide





 27-P


embedded image





3-(3-{1-Ethyl-5-[(methylamino)methyl]-1H-



indol-2-yl}prop-2-yn-1-yl)-1-[4-



(trifluoromethyl)phenyl]urea





 28-P


embedded image





N-{[1-(2-Chloroethyl)-2-{3-[(4-



chlorophenyl)amino]prop-1-yn-1-yl}-1H-



indol-5-yl]methyl}oxan-4-amine





 29-P


embedded image





2-(4-{[3-(1-Ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]amino}phenyl)-2-methylpropanenitrile





 30-P


embedded image





4-Cyano-N-(3-{1-ethyl-5-



[(methylamino)methyl}-1H-indol-2-yl}prop-



2-yn-1-yl)benzamide





 31-P


embedded image





N-(3-{1-Ethyl-5-[(methylamino)methyl]-1H-



indol-2-yl}prop-2-yn-1-yl)-6-



methylpyridine-3-carboxamide





 32-P


embedded image





3-[3-(1-Ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-1-yl]-1-phenylurea





 33-P


embedded image





N-[(2-{3-[(4-Chloro-3-



fluorophenyl)amino]prop-1-yn-1-yl}-1-ethyl-



1H-indol-5-yl)methyl]-1-methylpiperidin-4-amine





 34-P


embedded image





2-(5-{[3-(1-Ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





 35-P


embedded image





N-{[1-(2-Chloroethyl)-2-{3-[(4-



chlorophenyl)amino]prop-1-yn-1-yl}-1H-



indol-5-yl]methyl}-1-methylpiperidin-4-amine





 36-P


embedded image





6-tert-Butyl-N-[3-(1-ethyl-5-{[(1-



methanesulfonylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]pyridin-3-amine





 37-P


embedded image





2-(4-{[3-(1-Ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]amino}phenyl)-2-methylpropanoic acid





 38-P

text missing or illegible when filed




3-(1-Ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)-N-



methylprop-2-ynamide





 39-P


embedded image





Ethyl 2-(4-{[3-(1-ethyl-5-{[(1-



methylpiperidin-4-yl)amino]methyl}-1H-



indol-2-yl)prop-2-yn-1-yl]amino}phenyl)-2-methylpropanoate





 40-P


embedded image





2-(5-{[3-(1-Ethyl-5-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





 41-P


embedded image





N-[(1-Ethyl-2-{3-[(4-



methylphenyl)amino]prop-1-yn-1-yl}-1H-



indol-5-yl)methyl]-1-methylpiperidin-4-amine





 42-P


embedded image





4-{[3-(1-Ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]aminl}benzonitrile





 43-P


embedded image





3-(1-Ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)-N-phenylprop-2-ynamide





 44-P


embedded image





N-[(2-{3-[(4-Chlorophenyl)amino]prop-1-



yn-1-yl}-1-ethyl-1H-indol-5-yl)methyl]-1-



methanesulfonylpiperidin-4-amine


 45-P


embedded image





1-(4-{[(2-{3-[(4-Chlorophenyl)amino]prop-



1-yn-1-yl}-1-ethyl-1H-indol-5-



yl)methyl]amino}piperidin-1-yl)ethan-1-one





 46-P


embedded image





6-tert-Butyl-N-[3-(1-ethyl-5-{[(1-



methylpiperidin-4-yl)amino]methyl}-1H-



indol-2-yl)prop-2-yn-1-yl]pyridine-3-carboxamide





 47-P


embedded image





N-(3-{1-Ethyl-5-[(methylamino)methyl]-1H-



indol-2-yl}prop-2-yn-1-yl)-4-(trifluoromethyl)aniline





 48-P


embedded image





N-[(1-Ethyl-2-{3-[(4-



methylphenyl)amino]prop-1-yn-1-yl}-1H-



indol-5-yl)methyl]oxan-4-amine





 49-P


embedded image





N-(3-{1-ethyl-4-[(methylamino)methyl]-1H-



indol-2-yl}prop-2-yn-1-yl)aniline





 50-P


embedded image





N-[3-(1-ethyl-4-{[4-(pyrrolidin-1-



yl)piperidin-1-yl]methyl}-1H-indol-2-



yl)prop-2-yn-1-yl]aniline





 51-P


embedded image





N-({1-ethyl-2-[3-(phenylamino)prop-1-yn-1-



yl]-1H-indol-4-yl}methyl)-1-



methylpiperidin-4-amine





 52-P


embedded image





1-[(2-{3-[(4-Chlorophenyl)amino]prop-1-yn-



1-yl}-1-ethyl-1H-indol-4-



yl)methyl]piperidin-4-ol





 53-P


embedded image





4-Chloro-N-[3-(1-ethyl-4-{[4-(pyrrolidin-1-



yl)piperidin-1-yl]methyl}-1H-indol-2-yl)prop-2-yn-1-yl]aniline





 54-P


embedded image





1-[(2-{3-[(4-chlorophenyl)amino]prop-1-yn-



1-yl}-1-ethyl-1H-indol-4-yl)methyl]-N,N-



dimethylpiperidin-4-amine





 55-P


embedded image





4-Chloro-N-(3-{1-ethyl-4-[(4-



methylpiperazin-1-yl)methyl]-1H-indol-2-



yl}prop-2-yn-1-yl)aniline





 56-P


embedded image





1-{1-[(2-{3-[(4-chlorophenyl)amino]prop-1-



yn-1-yl}-1-ethyl-1H-indol-4-



yl)methyl]piperidin-4-yl}piperidin-4-ol





 57-P


embedded image





2-(5-{[3-(4-{[4-(4-Aminopiperidin-1-



yl)piperidin-1-yl]methyl}-1-ethyl-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





 58-P


embedded image





1-[(1-ethyl-2-{3-{(4-



fluorophenyl)amino]prop-1-yn-1-yl}-1H-



indol-5-yl)methyl]-N,N-dimethylpiperidin-4-amine





 59-P


embedded image





4-N-({1-ethyl-2-[3-(phenylamino)prop-1-yn-



1-yl]-1H-indol-5-yl}methyl)-1-N,1-N-



dimethylcyclohexane-1,4-diamine





 60-P


embedded image





4-chloro-N-(3-{1-ethyl-5-



[(methylamino)methyl]-1H-indol-2-yl}prop-



2-yn-1-yl)-3-fluoroaniline





 61-P


embedded image





6-tert-butyl-N-(3-{1-ethyl-5-



[(methylamino)methyl]-1H-indol-2-yl}prop-



2-yn-1-yl)pyridine-3-carboxamide





 62-P


embedded image





N-(3-{1-ethyl-5-[(methylamino)methyl]-1H-



indol-2-yl}prop-2-yn-1-yl)benzamide





 63-P


embedded image





3-(3-{1-ethyl-5-[(methylamino)methyl]-1H-



indol-2-yl}prop-2-yn-1-yl)-1-(4-methylphenyl)urea





 64-P


embedded image





4-chloro-N-(3-{1-ethyl-5-



[(methylamino)methyl]-1H-indol-2-yl}prop-



2-yn-1-yl)aniline





 65-P


embedded image





4-{[3-(1-ethyl-5-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]amino}benzonitrile





 66-P


embedded image





N-[(2-{3-[(4-chloro-3-



fluorophenyl)amino]prop-1-yn-1-yl}-1-ethyl-



1H-indol-5-yl)methyl]oxan-4-amine





 67-P


embedded image





3-[3-(1-ethyl-5-{[(oxan-4-yl)amino]methyl}-



1H-indol-2-yl)prop-2-yn-1-yl]-1-phenylurea





 68-P


embedded image





6-tert-butyl-N-[3-(1-ethyl-5-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]pyridin-3-amine





 69-P


embedded image





4-{[(2-{3-[(4-chlorophenyl)amino]prop-1-



yn-1-yl}-1-ethyl-1H-indol-5-



yl)methyl]amino}-1λ6-thiane-1,1-dione





 70-P


embedded image





N-[(2-{3-[(4-chlorophenyl)amino]prop-1-yn-



1-yl}-1-ethyl-1H-indol-5-yl)methyl]-1-(2-



methanesulfonylethyl)piperidin-4-amine





 71-P


embedded image





1-(4-{[(2-{3-[(4-chlorophenyl)amino]prop-1-



yn-1-yl}-1-ethyl-1H-indol-5-



yl)methyl]amino}piperidin-1-yl)-2-



(dimethylamino)ethan-1-one





 72-P

text missing or illegible when filed




2-(4-{[(2-{3-[(4-chlorophenyl)amino]prop-1-



yn-1-yl}-1-ethyl-1H-indol-5-



yl)methyl]amino}piperidin-1-yl)-N,N-dimethylacetamide





 73-P


embedded image





2-tert-butyl-N-[3-(1-ethyl-5-{[(1-



methylpiperidin-4-yl)amino]methyl}-1H-



indol-2-yl)prop-2-yn-1-yl]pyrimidin-5-amine





 74-P


embedded image





2-methyl-2-(5-{[3-(5-{[(oxan-4-



yl)amino]methyl]-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





 P-75


embedded image





2-[5-({3-[1-(2-fluoroethyl)-5-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl]prop-2-yn-



1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





 P-76


embedded image





3-(1-ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-1-ol





 77-P


embedded image





2-[5-({3-[1-(2-chloroethyl)-5-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl]prop-2-yn-



1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





 78-P


embedded image





2-[5-({3-[1-(2,2-difluoroethyl)-5-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl]prop-2-yn-



1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





 79-P


embedded image





6-chloro-N-[3-(1-ethyl-5-{[(1-



methylpiperidin-4-yl)amino]methyl}-1H-



indol-2-yl)prop-2-yn-1-yl]pyridin-3-amine





 80-P


embedded image





tert-butyl N-({3-ethyl-2-{3-



(phenylamino)prop-1-yn-1-yl]-1H-indol-6-



yl}methyl)-N-(oxan-4-yl)carbamate





 81-P


embedded image





6-Chloro-N-[3-(1-ethyl-4-{[4-(pyrrolidin-1-



yl)piperidin-1-yl]methyl}-1H-indol-2-



yl)prop-2-yn-1-yl]pyridin-3-amine





 82-P


embedded image





3-(1-ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-1-yl benzoate





 83-P


embedded image





2-[5-({3-[1-(2-chloroethyl)-5-{[(1-



methylpiperidin-4-yl)amino]methyl}-1H-



indol-2-yl]prop-2-yn-1-yl}amino)pyridin-2-



yl]-2-methylpropanenitrile





 84-P


embedded image





N-(6-chloropyridin-3-yl)-3-(1-ethyl-5-{[(1-



methylpiperidin-4-yl)amino]methyl}-1H-



indol-2-yl)prop-2-ynamide





 85-P


embedded image





N-[6-(1-cyano-1-methylethyl)pyridin-3-yl]-



3-(1-ethyl-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-ynamide





 86-P


embedded image





N-({3-ethyl-2-{3-(phenylamino)prop-1-yn-1-



yl]-1H-indol-6-yl}methyl)oxan-4-amine





 87-P


embedded image





2-[5-({3-[1-(2-chloroethyl)-4-{[4-(pyrrolidin-



1-yl)piperidin-1-yl]methyl}-1H-indol-2-



yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





 88-P


embedded image





2-(5-{[3-(5-{[(1-methanesulfonylpiperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





 89-P


embedded image





2-[5-({3-[5-({[1-(2-



methanesulfonylethyl)piperidin-4-



yl]amino}methyl)-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-methylpropanenitrile





 90-P


embedded image





2-(5-{[3-(5-{[3-(5-{[(1-acetylpiperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





 91-P


embedded image





2-{5-[(3-{5-[({1-[2-



(dimethylamino)acetyl]piperidin-4-



yl}amino)methyl]-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}-2-methylpropanenitrile





 92-P


embedded image





2-methyl-2-(5-{[3-(5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





 93-P


embedded image





2-methyl-2-{5-[(3-{5-[(methylamino)methyl]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile


 94-P


embedded image





6-Chloro-N-[3-(5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]pyridin-3-amine





 95-P


embedded image





6-chloro-N-[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]pyridin-3-amine





 96-P


embedded image





2-[5-({3-[1-(cyclopropylmethyl)-5-{[(oxan-



4-yl)amino]methyl}-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl}-2-methylpropanenitrile





 97-P

text missing or illegible when filed




2-(5-{[3-(4-{[4-(4-hydroxypiperidin-1-



yl]methyl}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





 98-P


embedded image





2-methyl-2-{5-[(3-{4-[(4-methylpiperazin-1-



yl)methyl]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}propanenitrile





 99-P


embedded image





2-(5-{[3-(1-ethyl-7-fluoro-4-{[4-(pyrrolidin-



1-yl)piperidin-1-yl]methyl}-1H-indol-2-



yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





100-P


embedded image





2-methyl-2-(5-{[3-(4-{[4-(pyrrolidin-1-



yl)piperidin-1-yl]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





101-P


embedded image





2-(5-{[3-(4-{[4-(4-hydroxypiperidin-1-



yl)piperidin-1-yl]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





102-P


embedded image





N-(6-cyanopyridin-3-yl)-3-(1-ethyl-5-{[(1-



methylpiperidin-4-yl)amino]methyl}-1H-



indol-2-yl)prop-2-ynamide





103-P


embedded image





N-[6-(1-cyano-1-methylethyl)pyridin-3-yl]-



3-(5-{[(oxan-4-yl)amino]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-ynamide





104-P

text missing or illegible when filed




N-[6-(1-cyano-1-methylethyl)pyridin-3-yl]-



3-(5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-ynamide





105-P


embedded image





2-methyl-2-(5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(oxiran-2-ylmethyl)-1H-



indol-2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)propanenitrile





106-P


embedded image





2-(5-{[3-(5-{[(2-



methoxyethyl)amino]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





107-P


embedded image





2-methyl-2-[5-({3-[5-({[2-(morpholin-4-



yl)ethyl]amino}methyl)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]propanenitrile





108-P


embedded image





2-methyl-2-(5-{[3-(4-{[(1-methylpiperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





109-P


embedded image





2-methyl-2-(5-{[3-(4-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





110-P


embedded image





2-(5-({3-[5-({[2-



(dimethylamino)ethyl]amino}methyl)-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





111-P


embedded image





2-(5-{[3-(7-fluoro-4-{[4-(pyrrolidin-1-



yl)piperidin-1-yl]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





112-P


embedded image





2-methyl-2-[5-({3-[1-(2,2,2-trifluoroethyl)-5-



{[(2,2,2-trifluoroethyl)amino]methyl}-1H-



indol-2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]propanenitrile





113-P


embedded image





2-[5-({3-[5-({[1-(2-hydroxyethyl)piperidin-



4-yl]amino}methyl)-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-methylpropanenitrile





114-P


embedded image





2-[5-({3-[5-({[1-(2-methoxyethyl)piperidin-



4-yl]amino}methyl)-1(2,2,2-trifluoroethyl)-



1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-methylpropanenitrile





115-P


embedded image





2-[5-({3-[5-({[4-(dimethylamino)cyclohexyl]amino}methyl)-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-



2-yn-1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





116-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-(morpholin-4-



yl)acetyl]piperidin-4-yl}amino)methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}propanenitrile





117-P


embedded image





2-(5-{[3-(4-{[(2-



methoxyethyl)amino]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





118-P


embedded image





2-methyl-2-{5-[(3-{4-[(methylamino)methyl]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile





119-P


embedded image





2-{5-[(3-{4-[(4-acetylpiperazin-1-yl)methyl]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





120-P


embedded image





2-methyl-2-[5-({3-[4-(morpholin-4-



ylmethyl)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]propanenitrile





121-P


embedded image





2-(5-{[3-(4-{[4-(dimethylamino)piperidin-1-



yl]methyl}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





122-P


embedded image





2-[5-({3-[4-(hydroxymethyl)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-methylpropanenitrile





123-P


embedded image





2-methyl-2-[5-({3-[4-({4-[2-(morpholin-4-



yl)-2-oxoethyl]piperazin-1-yl}methyl)-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl]propanenitrile





124-P


embedded image





2-(5-{[3-(3-ethyl-7-{[4-(pyrrolidin-1-



yl)piperidin-1-yl]methyl}-1H-indol-2-



yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





125-P


embedded image





methyl 5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxylate





126-P


embedded image





N-methyl-5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





127-P


embedded image





N-(2-hydroxyethyl)-5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





128-P


embedded image





N-(2-methoxyethyl)-5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





129-P


embedded image





2-[(5-{[3-(5-{[(oxan-4-yl)amino]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}pyridin-2-



yl)formamido]acetic acid





130-P


embedded image





5-{[3-(5-{[(oxan-4-yl)amino]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}pyridine-2-carboxylic acid





131-P


embedded image





N-(2-methanesulfonylethyl)-5-{[3-(5-



{[(oxan-4-yl)amino]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





132-P


embedded image





2-[5-({3-[1-(cyanomethyl)-5-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl]prop-2-yn-



1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





133-P


embedded image





2-methyl-2-[5-({3-[1-(2-methylpropyl)-5-



{[(oxan-4-yl)amino]methyl}-1H-indol-2-



yl]prop-2-yn-1-yl}amino)pyridin-2-yl]propanenitrile





134-P


embedded image





2-methyl-2-{5-[(3-{4-[(oxan-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}propanenitrile





135-P


embedded image








5-{[3-(5-{[(oxan-4-yl)amino]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}pyridine-2-carbonitrile





136-P


embedded image





N,N-dimethyl-5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





137-P


embedded image





N-(oxan-4-yl)-5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





138-P


embedded image





2-tert-butyl-N-[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]pyrimidin-5-amine





139-P


embedded image





N-(1-methylpiperidin-4-yl)-5-{[3-(5-{[(oxan-



4-yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





140-P


embedded image





N-[6-(1-cyano-1-methylethyl)pyridin-3-yl]-



3-[1-(2-fluoroethyl)-5-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl]prop-2-ynamide





141-P


embedded image





2-(5-{[3-(7-chloro-4-{[4-(pyrrolidin-1-



yl)piperidin-1-yl]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





142-P


embedded image





2-(5-{[3-(6-fluoro-4-{[4-(pyrrolidin-1-



yl)piperidin-1-yl]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





143-P


embedded image





2-(5-{[3-(1-ethyl-5-{[(oxan-4-



yl)amino]methyl}-1H-pyrrolo[2,3-c]pyridin-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





144-P


embedded image





2-methyl-2-(5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-pyrrolo[2,3-c]pyridin-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





145-P


embedded image





2-(5-{[3-(5-{[4-(dimethylamino)piperidin-1-



yl]methyl}-1-(2,2,2-trifluoroethyl)-1H-



pyrrolo[2,3-c]pyridin-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





146-P


embedded image





2-(5-{[3-(7-chloro-4-{[4-(pyrrolidin-1-



yl)piperidin-1-yl]methyl}-1-(2,2,2-



trifluoroethyl)-1H-pyrrolo[2,3-c]pyridin-2-



yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





147-P

text missing or illegible when filed




2-(5-{[3-(4-{[4-(diethylamino)piperidin-1-



yl]methyl}-6-fluoro-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





148-P


embedded image





2-(5-{[3-(4-{[4-(dimethylamino)-piperidin-1-



yl]methyl}-6-fluoro-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





149-P


embedded image





2-(5-{[3-(6-fluoro-4-{[4-(4-



hydroxypiperidin-1-yl)piperidin-1-



yl]methyl}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





150-P


embedded image





2-(5-{[3-(6-fluoro-5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





151-P


embedded image





2-(5-{[3-(5-{[(1-acetylpiperidin-4-



yl)amino]methyl}-6-fluoro-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





152-P


embedded image





2-(5-{[3-(6-chloro-4-{[4-



(dimethylamino)piperidin-1-yl]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





153-P


embedded image





2-(5-{[3-(6-chloro-4-{[4-



(diethylamino)piperidin-1-yl]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





154-P


embedded image





2-(5-{[3-(6-chloro-4-{[4-(4-



hydroxypiperidin-1-yl)piperidin-1-



yl]methyl}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





155-P


embedded image





2-(5-{[3-(4-{[4-(2-methanesulfonyl-



ethyl)piperazin-1-yl]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





156


embedded image





2-(4-{[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]methyl}piperazin-1-yl)-N,N-dimethylacetamide





157-P


embedded image





2-methyl-2-{5-[(3-{4-[(3-oxopiperazin-1-



yl)methyl]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}propanenitrile





158-P


embedded image





2-methyl-2-[5-({3-[4-({4-[2-(morpholin-4-



yl)-2-oxoethyl]piperidin-1-yl}methyl)-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]propanenitrile





159-P


embedded image





2-(4-{[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]methyl}piperazin-1-yl)acetamide





160-P


embedded image





N-[6-(1-cyano-1-methylethyl)pyridin-3-yl]-



3-(4-{[4-(pyrrolidin-1-yl)piperidin-1-



yl]methyl}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-ynamide





161-P


embedded image





2-(1-{[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]methyl}piperidin-4-yl)acetamide





162-P


embedded image





2-(5-{[3-(4-{[4-(2-aminoethyl)-piperazin-1-



yl]methyl}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





163-P


embedded image





2-(1-{[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]methyl}piperidin-4-yl)-N,N-dimethylacetamide





164-P

text missing or illegible when filed




2-methyl-2-(5-{[3-(4-{[4-(morpholin-4-



yl)piperidin-1-yl]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





165-P


embedded image





2-(5-{[3-(4-{[4-(4-aminopiperidin-1-



yl)piperidin-1-yl]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





166-P


embedded image





2-methyl-2-[5-({3-[1-(oxiran-2-ylmethyl)-4-



{[4-(pyrrolidin-1-yl)piperidin-1-yl]methyl}-



1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]propanenitrile





167-P


embedded image





2-(5-{[3-(3-ethyl-6-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





168-P


embedded image





2-methyl-2-(5-{[3-(6-{[(oxan-4-



yl)amino]methyl}-3-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





169-P


embedded image





2-(5-{[3-(1-acetyl-3-ethyl-6-{[(oxan-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





170-P


embedded image





2-(5-{[3-(3-ethyl-6-{[(1-methylpiperidin-4-



yl)amino]methyl}-1H-indol-2-yl)prop-2-yn-



1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





171-P


embedded image





2-methyl-2-(5-{[3-(6-{[(1-methylpiperidin-4-



yl)amino]methyl}-3-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





172-P


embedded image





2-{5-[(3-{6-chloro-4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





173-P


embedded image





2-(3-{[6-(1-cyano-1-methylethyl)pyridin-3-



yl]amino}prop-1-yn-1-yl)-6-fluoro-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indole-4-carboxamide





174-P


embedded image





2-[5-({3-[6-fluoro-4-(4-methylpiperazine-1-



carbonyl)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





175-P


embedded image





6-fluoro-2-{3-[(6-methanesulfonylpyridin-3-



yl)amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





176-P


embedded image





2-{5-[(3-{6-fluoro-4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-



methylpropanenitrile





177-P


embedded image





5-[(3-{6-fluoro-4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]-N-(pyridin-3-



yl)pyridine-2-carboxamide





178-P


embedded image





2-methyl-2-(5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-pyrrolo[2,3-b]pyridin-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





179-P


embedded image





2-methyl-2-{5-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-



pyrrolo[2,3-b]pyridin-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile





180-P


embedded image





2-(5-{[3-(7-chloro-1-ethyl-4-{[4-(pyrrolidin-



1-yl)piperidin-1-yl]methyl}-1H-indol-2-



yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





181-P


embedded image





2-(5-{[3-(7-chloro-5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





182-P


embedded image





2-(5-{[3-(7-chloro-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





183-P


embedded image





2-{5-[(3-{7-fluoro-4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





184-P


embedded image





2-(5-{[3-(7-fluoro-5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





185-P


embedded image





2-(5-{[3-(7-fluoro-5-{[(1-methylpiperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





186-P


embedded image





2-methyl-2-(5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-1,3-benzodiazol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





187-P


embedded image





N-{[2-(2-phenylethynyl)-1-(2,2,2-



trifluoroethyl)-1H-1,3-benzodiazol-5-



yl]methyl}oxan-4-amine





188-P


embedded image





2-methyl-2-(5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-pyrrolo[3,2-b]pyridin-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





189-P


embedded image





2-{3-[(4-methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-5-methyl-N-(1-methylpiperidin-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





190-P


embedded image





4-[(2-{3-[(4-methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-5-methyl-1-(2,2,2-trifluoroethyl)-1H-



indol-4-yl)amino]-1λ6-thiane-1,1-dione





191-P


embedded image





2-methyl-2-{5-[(3-{5-methyl-4-[(1-



methylpiperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile





192-P


embedded image





N-[1-(2-methanesulfonylethyl)piperidin-4-



yl]-2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-5-methyl-1-(2,2,2-trifluoroethyl)-1H-



indol-4-amine





193-P


embedded image





4-[(3-{5-methyl-4-[(piperidin-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]benzene-1-sulfonamide





194-P


embedded image





2-{3-[(4-methanesulfonylphenyl)amino]



prop-1-yn-1-yl}-5-methyl-N-[1-(oxan-4-yl)piperidin-4-



yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





195-P


embedded image





2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-5-methyl-1-(2,2,2-trifluoroethyl)-1H-



indol-4-yl)amino]piperidin-1-yl}ethan-1-ol





196-P


embedded image





2-[5-({3-[4-(methoxymethyl)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





197-P


embedded image





2-[5-({3-[4-(cyanomethyl)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-methylpropanenitrile





198-P


embedded image





2-methyl-2-[5-({3-[5-(morpholine-4-



carbonyl)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]propanenitrile





199-P


embedded image





2-methyl-2-[5-({3-[5-(4-methylpiperazine-1-



carbonyl)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]propanenitrile





200-P


embedded image





2-{5-[(3-{5-[4-(dimethylamino)piperidine-1-



carbonyl]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-



methylpropanenitrile





201-P


embedded image





2-(3-{[6-(1-cyano-1-methylethyl)pyridin-3-



yl]amino}prop-1-yn-1-yl)-N-{1-[2-



(dimethylamino)acetyl]piperidin-4-yl}-1-



(2,2,2-trifluoroethyl)-1H-indole-5-carboxamide





202-P


embedded image





2-(3-{[6-(1-cyano-1-methylethyl)pyridin-3-



yl]amino}prop-1-yn-1-yl)-N-(oxan-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indole-5-carboxamide





203-P


embedded image





2-methyl-2-(5-{[3-(5-{1-[(oxan-4-



yl)amino]ethyl}-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl)prop-2-yn-1-yl]amino}pyridin-2-



yl)propanenitrile





204-P


embedded image





2-methyl-2-{5-[3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-



pyrrolo[3,2-c]pyridin-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile





205-P


embedded image





2-methyl-2-[5-({3-[5-(morpholin-4-



ylmethyl)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridin-2-



yl]propanenitrile





206-P


embedded image





2-[5-({3-[5-({[1-(2-cyanoethyl)-piperidin-4-



yl]amino}methyl)-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





207-P


embedded image





2-methyl-2-(5-{[3-(5-{[(1-methylazetidin-3-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





208-P


embedded image





2-methyl-2-(5-{[3-(5-{[(oxetan-3-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





209-P


embedded image





2-(5-{[3-(5-{[4-(dimethylamino)-piperidin-1-



yl]methyl}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





210-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-(4-



methylpiperazin-1-yl)acetyl]piperidin-4-



yl}amino)methyl]-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile





211-P


embedded image





2-(5-{[3-(5-{[(1-methoxypropan-2-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





212-P


embedded image





2-methyl-2-(5-{[3-(5-{[(pyridin-4-



ylmethyl)amino]methyl]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





213-P


embedded image





2-methyl-2-(5-{[3-(5-{[(pyridin-3-



ylmethyl)amino]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





214-P


embedded image





2-[5-({3-[5-({[1-(dimethylamino)-propan-2-



yl]amino}methyl)-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-methylpropanenitrile





215-P


embedded image





2-[4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)piperidin-1-yl]-N-(oxan-4-yl)acetamide





216-P


embedded image





2-[5-({3-[5-({[1-(2-methoxyacetyl)-



piperidin-4-yl]amino}methyl)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





217-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-(oxan-4-



yl)acetyl]piperidin-4-yl}amino)-methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]-pyridin-2-yl}propanenitrile





218-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-(pyridin-3-



yl)acetyl]piperidin-4-yl}amino)-methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]-pyridin-2-yl}propanenitrile





219-P


embedded image





2-methyl-2-(5-{[3-(5-{[(1-{2-[(oxan-4-



yl)amino]acetyl}piperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-propanenitrile





220-P


embedded image





2-[4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)piperidin-1-yl]-N-methyl-



N-(propan-2-yl)acetamide





221-P


embedded image





2-[4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)piperidin-1-yl]-N-(2-



methoxyethyl)-N-methylacetamide





222-P


embedded image





6-methanesulfonyl-N-[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]pyridin-3-amine





223-P


embedded image





2-[4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)piperidin-1-yl]-N,N-



dimethylacetamide





224-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-oxo-2-



(pyrrolidin-1-yl)ethyl]piperidin-4-



yl}amino)methyl]-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile





225-P


embedded image





4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)-N,N-dimethylpiperidine-1-carboxamide





226-P


embedded image





2-{5-[(3-{5-[({1-[2-(azetidin-1-yl)-2-



oxoethyl]piperidin-4-yl}amino)-methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]-pyridin-2-yl}-2-



methylpropanenitrile





227-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-(pyrrolidin-1-



yl)acetyl]piperidin-4-yl}amino)methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}-propanenitrile





228-P


embedded image





2-(5-{[3-(5-{[(1-{2-[4-



(dimethylamino)piperidin-1-



yl]acetyl}piperidin-4-yl)amino]-methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}pyridin-2-yl)-2-methylpropanenitrile





229-P


embedded image





2-{5-[(3-{5-[({1-[2-



(diethylamino)acetyl]piperidin-4-



yl}amino)methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}-2-methylpropanenitrile





230-P


embedded image





2-methyl-2-(5-{[3-(5-{[(1-{2-



[methyl(propan-2-yl)amino]acetyl}piperidin-



4-yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





231-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-(pyridin-4-



yl)acetyl]piperidin-4-yl]amino)methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}propanenitrile





232-P


embedded image





2-[4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)piperidin-1-yl]-N-(pyridin-



4-yl)acetamide





233-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-(morpholin-4-



yl)-2-oxoethyl]piperidin-4-



yl}amino)methyl]-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile





234-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-(4-



methylpiperazin-1-yl)-2-oxoethyl]piperidin-



4-yl}amino)methyl]-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile





235-P


embedded image





2-[4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)piperidin-1-yl]-N-(pyridin-



3-yl)acetamide





236-P


embedded image





2-[4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)piperidin-1-yl]-N-(1-



methylpiperidin-4-yl)acetamide





237-P


embedded image





2-methyl-2-{5-({3-[5-({[4-(morpholin-4-



yl)cyclohexyl]amino}methyl)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]propanenitrile





238-P


embedded image





2-{5-[(3-{5-[({1-[2-(4-hydroxypiperidin-1-



yl)acetyl]piperidin-4-yl}amino)methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}-2-



methylpropanenitrile





239-P


embedded image





2-{5-[(3-{5-[({1-[2-(4-acetylpiperazin-1-



yl)acetyl]piperidin-4-yl}amino)methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





240-P


embedded image





2-(5-{[3-(5-{[(1,1-dioxo-1λ6-thian-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





241-P


embedded image





2-{5-[(3-{5-[({1-[2-(1,1-dioxo-1λ6,4-



thiomorpholin-4-yl)acetyl]piperidin-4-



yl}amino)methyl]-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}-2-methylpropanenitrile





242-P


embedded image





2-[5-({3-[5-({[1-(4-acetylpiperazine-1-



carbonyl)piperidin-4-yl]amino}methyl)-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





243-P


embedded image





2-(5-{[3-(5-{[(1-{2-[bis(2-



hydroxyethyl)amino]acetyl}piperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





244-P


embedded image





2-methyl-2-{5-[(3-{5-[({1-[2-(3-



oxopiperazin-1-yl)acetyl]piperidin-4-



yl}amino)methyl]-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}propanenitrile





245-P


embedded image





2-methyl-2-[5-({3-[5-({[1-(morpholine-4-



carbonyl)piperidin-4-yl]amino}-methyl)-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl]propanenitrile





246-P


embedded image





2-methyl-2-(5-{[3-(5-{[(1-methylpiperidin-3-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





247-P


embedded image





N-[4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)-cyclohexyl]acetamide





248-P


embedded image





2-{5-[(3-{5-[({1-[2-(1H-imidazol-1-



yl)acetyl]piperidin-4-yl}amino)-methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





249-P


embedded image





2-(5-{[3-(5-{[(1-{2-[(2-



methoxyethyl)(methyl)amino]acetyl}



piperidin-4-yl)amino]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





250-P


embedded image





N-[4-({[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl]methyl}amino)-



cyclohexyl]methanesulfonamide


251-P


embedded image





2-methyl-2-(5-{[3-(5-{[(1-methyl-6-



oxopiperidin-3-yl)amino]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





252-P


embedded image





2-[5-({3-[5-({[3-(dimethylamino)



cyclohexyl]amino}methyl)-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-



2-yn-1-yl}amino)pyridin-2-yl]-2-methylpropanenitrile





253-P


embedded image





2-methyl-2-[5-({3-[5-({[1-(4-



methylpiperazine-1-carbonyl)piperidin-4-



yl]amino}methyl)-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]propanenitrile





254-P


embedded image





2-{5-[(3-{5-[({1-[4-



(dimethylamino)piperidine-1-



carbonyl]piperidin-4-yl}amino)-methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





255-P


embedded image





2-{5-[(3-{5-[({1-[2-(3-hydroxypyrrolidin-1-



yl)acetyl]-piperidin-4-yl}amino)methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





256-P


embedded image





2-{5-[(3-{5-[({1-[2-(3-methoxypyrrolidin-1-



yl)acetyl]-piperidin-4-yl}amino)methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





257-P


embedded image





2-methyl-2-[5-({3-[5-({[1-(2-{2-oxa-8-



azaspiro[4.5]decan-8-yl}acetyl)-piperidin-4-



yl]amino}methyl)-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]propanenitrile





258-P


embedded image





2-{5-[(3-{5-[({1-[2-(4-hydroxy-4-



methylpiperidin-1-yl)acetyl]piperidin-4-



yl}amino)methyl]-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}-2-methylpropanenitrile





259-P


embedded image





2-(5-{[3-(5-{[(1-{2-[bis(2-



methoxyethyl)amino]acetyl}piperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





260-P


embedded image





2-(5-{[3-(5-{[(1-{2-



[methoxy(methyl)amino]acetyl}piperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]amino}



pyridin-2-yl)-2-methylpropanenitrile





261-P


embedded image





2-(5-{[3-(5-{[(1-{2-[(2,3-



dihydroxypropyl)(methyl)amino]acetyl}



piperidin-4-yl)amino]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





262-P


embedded image





2-methyl-2-(5-{[3-(5-{[(1-methyl-2-



oxopiperidin-4-yl)amino]methyl}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





263-P


embedded image





2-methyl-2-(5-{[3-(5-{[(1-{2-[methyl(1-



methylpiperidin-4-yl)amino]acetyl}piperidin-



4-yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-yl)propanenitrile





264-P


embedded image





2-methyl-2-[5-({3-[5-({[1-(2-{9-methyl-3,9-



diazaspiro[5.5]undecan-3-



yl}acetyl)piperidin-4-yl]amino}methyl)-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl]propanenitrile





265-P


embedded image





2-(5-{[3-(5-{[(1-{2-[3-(dimethyl-



amino)pyrrolidin-1-yl]acetyl}piperidin-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]amino}



pyridin-2-yl)-2-methylpropanenitrile





266-P


embedded image





N-[3-(5-{[(oxan-4-yl)amino]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]-6-(pyrrolidine-1-carbonyl)pyridin-3-amine





267-P


embedded image





6-(morpholine-4-carbonyl)-N-[3-(5-{[(oxan-



4-yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]pyridin-3-amine





268-P


embedded image





2-chloro-N-[3-(5-{[(oxan-4-yl)amino]-



methyl}-1-(2,2,2-trifluoroethyl)-1H-indol-2-



yl)prop-2-yn-1-yl]pyrimidin-5-amine





269-P


embedded image





5-{[3-(5-{[(oxan-4-yl)amino]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}-N-phenylpyridine-2-carboxamide





270-P


embedded image





N-methyl-5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-



(propan-2-yl)pyridine-2-carboxamide





271-P


embedded image





5-{[3-(5-{[(oxan-4-yl)amino]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}-N-(pyridin-4-yl)



pyridine-2-carboxamide





272-P


embedded image





5-{[3-(5-{[(oxan-4-yl)amino]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}-N-(pyridin-3-yl)



pyridine-2-carboxamide





273-P


embedded image





N-(1-methylazetidin-3-yl)-5-{[3-(5-{[(oxan-



4-yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





274-P


embedded image





N,N-diethyl-5-{[3-(5-{[(oxan-4-



yl)amino]methyl}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





275-P


embedded image





5-{[3-(5-{[(oxan-4-yl)amino]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}-N-(oxetan-3-yl)pyridine-2-carboxamide





276-P


embedded image





1-(4-{[(2-{3-[(2-tert-butylpyrimidin-5-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-5-



yl)methyl]amino}piperidin-1-yl)-2-



(dimethylamino)ethan-1-one





277-P


embedded image





1-(4-{[(2-{3-[(6-chloropyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-5-



yl)methyl]amino}piperidin-1-yl)-2-



(dimethylamino)ethan-1-one





278-P


embedded image





5-[(3-{5-[({1-[2-(dimethylamino)-



acetyl]piperidin-4-yl}amino)methyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]-N-(1-methylpiperidin-4-



yl)pyridine-2-carboxamide





279-P


embedded image





1-(4-{[(2-{3-[(4-chloro-3-



fluorophenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-5-



yl)methyl]amino}piperidin-1-yl)-2-



(dimethylamino)ethan-1-one





280-P


embedded image





2-(dimethylamino)-1-(4-{[(2-{3-[(6-



methylpyridin-3-yl)amino]prop-1-yn-1-yl}-



1-(2,2,2-trifluoroethyl)-1H-indol-5-



yl)methyl]amino}piperidin-1-yl)ethan-1-one





281-P


embedded image





1-(4-{[(2-{3-[(6-tert-butylpyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-5-



yl)methyl]amino}piperidin-1-yl)-2-



(dimethylamino)ethan-1-one





282-P


embedded image





N-[6-(1-cyano-1-methylethyl)pyridin-3-yl]-



3-[1-(2-fluoroethyl)-5-{[(1-methylpiperidin-



4-yl)amino]methyl}-1H-indol-2-yl]prop-2-ynamide





283-P


embedded image





2-{5-[(3-{5-[({1-[2-



(dimethylamino)acetyl]piperidin-4-



yl}amino)methyl]-1-ethyl-1H-indol-2-



yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-



methylpropanenitrile





284-P


embedded image





2-[5-({3-[1-(2,2-difluoroethyl)-5-[({1-[2-



(dimethylamino)acetyl]piperidin-4-



yl}amino)methyl]-1H-indol-2-yl]prop-2-yn-



1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





285-P


embedded image





2-{5-[(3-{5-[({1-[2-



(dimethylamino)acetyl]piperidin-4-



yl}amino)methyl]-1-(2-fluoroethyl)-1H-



indol-2-yl}prop-2-yn-1-yl)amino]pyridin-2-



yl}-2-methylpropanenitrile





286-P


embedded image





N-(6-chloropyridin-3-yl)-3-(5-{[(1-



methylpiperidin-4-yl)amino]methyl}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-ynamide





287-P


embedded image





2-(5-{[3-(5-{[(1-acetylpiperidin-4-



yl)amino]methyl}-1-(oxiran-2-ylmethyl)-1H-



indol-2-yl)prop-2-yn-1-yl]amino}pyridin-2-



yl)-2-methylpropanenitrile





288-P


embedded image





2-methyl-2-{5-[(3-{5-[(oxan-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}propanenitrile





289-P


embedded image





2-{5-[(3-{4-[(1-acetylpiperidin-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]pyridin-2-yl}-2-



methylpropanenitrile





290-P


embedded image





2-methyl-2-{5-[(3-{4-[(propan-2-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]pyridin-2-yl}propanenitrile





291-P


embedded image





2-methyl-2-{5-[(3-{4-[(piperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-



yl}propanenitrile





292-P


embedded image





2-(5-{[3-(4-{[1-(2-methoxyethyl)-piperidin-



4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl)prop-2-yn-1-yl]amino}pyridin-2-



yl)-2-methylpropanenitrile





293-P


embedded image





2-{5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-



methylpropanenitrile





294-P


embedded image





3-[2-(3-{[6-(1-cyano-1-methylethyl)-pyridin-



3-yl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl]-1-(oxan-4-yl)urea





295-P


embedded image





3-[2-(3-{[6-(1-cyano-1-methylethyl)-pyridin-



3-yl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl]-1-(1-



methylpiperidin-4-yl)urea





296-P


embedded image





2-(4-{[2-(3-{[6-(1-cyano-1-methylethyl)-



pyridin-3-yl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)-N,N-dimethylacetamide





297-P


embedded image





2-methyl-2-(5-{[3-(4-{[1-(propan-2-



yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





298-P


embedded image





2-methyl-2-(5-{[3-(4-{[1-(1-methylpiperidin-



4-yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





299-P


embedded image





4-{[2-(3-{[6-(1-cyano-1-methylethyl)-



pyridin-3-yl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl]amino}-N,N-



dimethylpiperidine-1-carboxamide





300-P


embedded image





N-[2-(3-{[6-(1-cyano-1-methylethyl)-



pyridin-3-yl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl]-4-



methylpiperazine-1-carboxamide





301-P


embedded image





1-[2-(3-{[6-(1-cyano-1-methylethyl)pyridin-



3-yl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl]-3,3-dimethylurea





302-P


embedded image





N-[2-(3-{[6-(1-cyano-1-methylethyl)-



pyridin-3-yl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl]morpholine-4-carboxamide





303-P


embedded image





2-{5-[(3-{4-[(4-hydroxycyclohexyl)-amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]pyridin-2-yl}-2-



methylpropanenitrile





304-P


embedded image





2-methyl-2-[5-({3-[4-({1-[2-(4-



methylpiperazin-1-yl)-2-oxoethyl]-piperidin-



4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl]prop-2-yn-1-yl}amino)pyridin-2-



yl]propanenitrile





305-P


embedded image





2-methyl-2-{5-[(3-{4-[(oxan-4-



ylmethyl)amino]-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl}prop-2-yn-1-yl)amino]pyridin-2-



yl}propanenitrile





306-P


embedded image





2-{5-[(3-{4-[(1-ethylpiperidin-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





307-P


embedded image





2-(5-{[3-(4-{[1-(2-hydroxyethyl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





308-P


embedded image





2-{5-(3-{4-[(1-methanesulfonylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-



methylpropanenitrile





309-P


embedded image





2-(5-{[3-(4-{[1-(2-methanesulfonyl-



ethyl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





310-P


embedded image





2-methyl-2-(5-{[3-(4-{[(1R,4R)-4-



hydroxycyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





311-P


embedded image





2-methyl-2-(5-{[3-(4-{[(1S,4S)-4-



hydroxycyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





312-P


embedded image





2-methyl-2-[5-({3-[4-({1-[2-(morpholin-4-



yl)-2-oxoethyl]piperidin-4-yl}amino)-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl]propanenitrile





313-P


embedded image





2-(4-{[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)-N,N-bis(2-



methoxyethyl)acetamide





314-P


embedded image





2-methyl-2-{5-[(3-{4-[(pyrrolidin-3-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}propanenitrile





315-P


embedded image





2-methyl-2-{5-[(3-{4-[(1-methylpyrrolidin-3-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}propanenitrile





316-P


embedded image





2-(4-{[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)acetamide





317-P


embedded image





methyl 2-(4-{[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)acetate





318-P


embedded image





2-[5-({3-[4-({1-[2-(4-hydroxypiperidin-1-yl)-



2-oxoethyl]piperidin-4-yl}amino)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-methylpropanenitrile





319-P


embedded image





2-methyl-2-{5-[(3-{4-[(2-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}propanenitrile





320-P


embedded image





2-{5-[(3-{4-[(1,1-dioxo-1λ6-thiolan-3-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile





321-P


embedded image





2-methyl-2-[5-({3-[4-({1-[2-oxo-2-



(pyrrolidin-1-yl)ethyl]piperidin-4-yl}amino)-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-



2-yn-1-yl}amino)pyridin-2-yl]propanenitrile





322-P


embedded image





2-{5-[(3-{4-[(1-{2-[4-



(dimethylamino)piperidin-1-yl]-2-



oxoethyl}piperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}-2-methylpropanenitrile





323-P


embedded image





2-[5-({3-[4-({1-[2-



(dimethylamino)acetyl]piperidin-4-



yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





324-P


embedded image





2-(5-{[3-(4-{[1-(1,1-dioxo-1λ6-thian-4-



yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





325-P


embedded image





2-(5-{[3-(4-{[1-(cyanomethyl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridin-2-yl)-2-



methylpropanenitrile





326-P


embedded image





2-methyl-2-[5-({3-[1-(2,2,2-trifluoroethyl)-4-



{[1-(2,2,2-trifluoroethyl)piperidin-4-



yl]amino}-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]propanenitrile





327-P


embedded image





2-{5-[(3-{4-[(1-{2-[4-(2-



methanesulfonylethyl)piperazin-1-yl]-2-



oxoethyl}piperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}-2-methylpropanenitrile





328-P


embedded image





2-[5-({3-[4-({1-[2-(1,1-dioxo-1λ6,4-



thiomorpholin-4-yl)-2-oxoethyl]piperidin-4-



yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





329-P


embedded image





2-(5-{[3-(4-{[1-(1-methanesulfonylpiperazin-



4-yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





330-P


embedded image





2-(4-{[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)-N-(2,3-



dihydroxypropyl)-N-methylacetamide





331-P


embedded image





2-(4-{[2-(3-{[6-(1-cyano-1-



methylethyl)pyridin-3-yl]amino}prop-1-yn-



1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)-N-(2,3-



dihydroxypropyl)acetamide





332-P


embedded image





2-[5-({3-[4-({1-[2-(4-



methanesulfonylpiperidin-1-yl)-2-



oxoethyl]piperidin-4-yl}amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





333-P


embedded image





2-{5-[(3-{4-[(1-{2-[4-(2-



hydroxyethyl)piperazin-1-yl]-2-



oxoethyl}piperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridin-2-yl}-2-methylpropanenitrile





334-P


embedded image





2-methyl-2-(5-{[3-(4-{[1-(oxan-4-



yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





335-P


embedded image





2-[5-({3-[4-({1-[1-(2-



methanesulfonylethyl)piperidine-4-



yl]piperidin-4-yl}amino)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)pyridin-2-yl]-2-methylpropanenitrile





336-P


embedded image





2-[5-({3-[4-({1-[1-(2-



methoxyethyl)piperidin-4-yl]piperidin-4-



yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





337-P


embedded image





2-[5-({3-[4-({1-[1-(2-



hydroxyethyl)piperidin-4-yl]piperidin-4-



yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





338-P


embedded image





2-[5-({3-[4-({1-[2-



(dimethylamino)ethyl]piperidin-4-yl}amino)-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-



2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





339-P


embedded image





2-(5-{[3-(4-{[1-(1-acetylpiperidin-4-



yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)-2-methylpropanenitrile





340-P


embedded image





2-methyl-2-[5-({3-[4-({1-[(1R,4R)-4-



hydroxycyclohexyl]piperidin-4-yl}amino)-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl]propanenitrile





341-P


embedded image





2-methyl-2-[5-({3-[4-({1-[(1S,4S)-4-



hydroxycyclohexyl]piperidin-4-yl}amino)-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl]propanenitrile





342-P


embedded image





N-(1-methylpiperidin-4-yl)-2-{3-[(6-



methylpyridin-3-yl)amino]prop-1-yn-1-yl}-



1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





343-P


embedded image





2-methyl-2-{5-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}propanenitrile





344-P


embedded image





5-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]-N-(pyridin-3-yl)pyridine-2-carboxamide





345-P


embedded image





5-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]pyridine-2-carbonitrile





346-P


embedded image





N-[6-(1-cyano-1-methylethyl)pyridin-3-yl]-



3-{4-[(1-methylpiperidin-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-ynamide





347-P


embedded image





2-{3-[(2-fluorophenyl)amino]prop-1-yn-1-



yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





348-P


embedded image





2-{3-[(3-fluorophenyl)amino]prop-1-yn-1-



yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





349-P


embedded image





4-amino-N-(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)benzene-1-sulfonamide





350-P


embedded image





2-{3-[(6-tert-butylpyridin-3-yl)amino]prop-



1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





351-P


embedded image





2-{3-[(4-fluorophenyl)amino]prop-1-yn-1-



yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





352-P


embedded image





N,N-dimethyl-5-[(3-{4-[(1-methylpiperidin-



4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl}prop-2-yn-1-yl)amino]pyridine-2-carboxamide





353-P


embedded image





5-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]-N-(propan-2-yl)pyridine-2-carboxamide





354-P


embedded image





N-(pyridin-3-yl)-5-{[3-(4-{[(1R,4R)-4-



(dimethylamino)cyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





355-P


embedded image





N-(pyridin-3-yl)-5-{[3-(4-{[(1S,4S)-4-



(dimethylamino)cyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





356-P


embedded image





2-{3-[(6-methanesulfonylpyridin-3-



yl)amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





357-P


embedded image





6-tert-butyl-N-(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)pyridine-3-carboxamide





358-P


embedded image





2-{3-{(6-chloropyridin-3-yl)amino]prop-1-



yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





359-P


embedded image





2-{4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]phenyl}propan-2-ol





360-P


embedded image





6-methyl-N-(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)pyridine-3-carboxamide





361-P


embedded image





N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-2-(3-{[6-



(trifluoromethyl)pyridin-3-yl]amino}prop-1-



yn-1-yl)-1H-indol-4-amine





362-P


embedded image





3-(3-{4-[(1-methylpiperidin-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)-1-phenylurea





363-P


embedded image





2-{3-[(4-tert-butyl-2-fluorophenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





364-P


embedded image





2-{3-fluoro-4-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]phenyl}-2-



methylpropanenitrile





365-P


embedded image





4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]benzene-1-sulfonamide





366-P


embedded image





2-{3-[(2,6-difluoro-4-methane-



sulfonylphenyl)amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





367-P


embedded image





N-methyl-4-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide





368-P


embedded image





2-{3-[(4-methanesulfonyl-3-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





369-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





370-P


embedded image





2-{3-[(5-methanesulfonylpyridin-2-



yl)amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





371-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methylphenyl)amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





372-P


embedded image





methyl 3-methoxy-4-[(3-{4-[(1-



methylpiperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]benzoate





373-P


embedded image





N-{3-methoxy-4-[(3-{4-[(1-methylpiperidin-



4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl}prop-2-yn-1-



yl)amino]phenyl}methanesulfonamide





374-P


embedded image





3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]benzonitrile





375-P


embedded image





3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]benzoic acid





376-P


embedded image





2-{3-[(2,4-dimethoxyphenyl)amino]prop-1-



yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





377-P


embedded image





2-{3-[(2-methoxypyridin-3-yl)amino]prop-1-



yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





378-P


embedded image





2-{3-[(5-fluoro-2-methoxyphenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





379-P


embedded image





2-{3-[(2-ethoxy-4-methane-



sulfonylphenyl)amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





380-P


embedded image





2-{3-[(3-fluoro-2-methoxyphenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





381-P


embedded image





3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide





382-P


embedded image





2-{3-[(4-fluoro-2-methoxyphenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





383-P


embedded image





3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]-benzamide





384-P


embedded image





2-{3-[(2-fluoro-6-methoxyphenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





385-P


embedded image





2-{3-[(4-tert-butyl-2-methoxyphenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





386-P


embedded image





4-methoxy-3-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]-benzonitrile





387-P


embedded image





2-{3-[(5-tert-butyl-2-methoxyphenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





388-P


embedded image





N-(1-methylpiperidin-4-yl)-2-[3-



(phenylamino)prop-1-yn-1-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





389-P


embedded image





5-methanesulfonyl-2-[(3-{4-[(1-



methylpiperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]benzonitrile





390-P


embedded image





2-(3-{[2-(2-fluoroethoxy)-4-



methanesulfonylphenyl]amino}prop-1-yn-1-



yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





391-P


embedded image





2-{3-[(3-methoxypyridin-4-yl)amino]prop-1-



yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





392-P


embedded image





2-{3-[(2-chloro-4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





393-P


embedded image





2-{3-[(4-methoxyphenyl)amino]prop-1-yn-1-



yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





394-P


embedded image





2-(3-{[4-methanesulfonyl-2-(2-



methoxyethoxy)phenyl]amino}prop-1-yn-1-



yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





395-P


embedded image





5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]pyridine-2-carbonitrile


396-P


embedded image





4-{[2-(3-{[6-(morpholine-4-



carbonyl)pyridin-3-yl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}-1λ6-thiane-1,1-dione


397-P


embedded image





4-{[2-(3-{[6-(4-methylpiperazine-1-



carbonyl)pyridin-3-yl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}-1λ6-thiane-1,1-dione





398-P


embedded image





4-[(2-{3-[(quinolin-3-yl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]-1λ6-thiane-1,1-dione





399-P


embedded image





4-[(2-{3-[(quinoxalin-6-yl)amino]prop-1-yn-



1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]-1λ6-thiane-1,1-dione





400-P


embedded image





4-[(2-{3-[(4-methanesulfonylphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-



1H-indol-4-yl)amino]-1λ6-thiane-1,1-dione





401-P


embedded image





5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]pyridine-2-carboxamide





402-P


embedded image





4-[(2-{3-[(6-methoxypyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





403-P


embedded image





4-{[2-(3-{[6-(4-hydroxypiperidine-1-



carbonyl)pyridin-3-yl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}-1λ6-thiane-1,1-dione





404-P


embedded image





4-[(2-{3-[(1-methyl-2-oxo-1,2-



dihydropyridin-4-yl)amino]prop-1-yn-1-yl}-



1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]-1λ6-thiane-1,1-dione





405-P


embedded image





4-[(2-{3-[(2-methoxypyridin-4-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





406-P


embedded image





2-{4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]-3-fluorophenyl}-



2-methylpropanenitrile





407-P


embedded image





5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-N-(1-methylpiperidin-4-



yl)pyridine-2-carboxamide





408-P


embedded image





4-[(2-{3-[(2-fluoro-4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





409-P


embedded image





4-{[(2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl]amino}-1λ6-



thiane-1,1-dione





410-P


embedded image





4-[(2-{3-[(2-tert-butylpyrimidin-5-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





411-P


embedded image





3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}-N-(4-



methanesulfonyl-phenyl)-prop-2-ynamide





412-P


embedded image





5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-N-(oxan-4-yl)pyridine-2-carboamide





413-P


embedded image





5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-N-(pyridin-3-yl)pyridine-2-carboxamide





414-P


embedded image





5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-N-methylpyridine-2-carboxamide





415-P


embedded image





4-[(2-{3-[(3-chloro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]-1λ6-thiane-1,1-dione





416-P


embedded image





N-(2,3-dihydroxypropyl)-5-[(3-{4-[(1,1-



dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridine-2-carboxamide





417-P


embedded image





5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-N-hydroxypyridine-2-carboxamide





418-P


embedded image





5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-N-(2-



hydroxyethyl)pyridine-2-carboxamide





419-P


embedded image





5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-N-hydroxy-N-



methylpyridine-2-carboxamide





420-P


embedded image





4-amino-N-(3-{4-[(1,1-dioxo-1λ6-thian-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)benzene-1-sulfonamide





421-P


embedded image





4-({2-[3-({pyrido[2,3-b]pyrazin-7-



yl}amino)prop-1-yn-1-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl}amino)-1λ6-



thiane-1,1-dione





422-P


embedded image





4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-benzamide





423-P


embedded image





4-{[2-(3-{[2-(methylsulfanyl)pyrimidin-5-



yl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl]amino}-1λ6-



thiane-1,1-dione





424-P


embedded image





4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]benzene-1-sulfonamide





425-P


embedded image





4-{[2-(3-{[4-(2-methylpropane-2-



sulfonyl)phenyl]amino}prop-1-yn-1-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}-



1λ6-thiane-1,1-dione





426-P


embedded image





4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-N,N-dimethylbenzene-1-sulfonamide





427-P


embedded image





4-{[1-(2,2,2-trifluoroethyl)-2-[2-



(trimethylsilyl)ethynyl]-1H-indol-4-



yl]amino}-1λ6-thiane-1,1-dione





428-P


embedded image





4-[(2-{3-[(5-methanesulfonylpyridin-2-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





429-P


embedded image





4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-



1λ6-thiane-1,1-dione





430-P


embedded image





4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-N-methylbenzene-1-sulfonamide





431-P


embedded image





4-{[2-ethynyl-1-(2,2,2-trifluoroethyl)-1H-



indol-4-yl]amino}-1λ6-thiane-1,1-dione





432-P


embedded image





N-{4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]-3-



methoxyphenyl}methanesulfonamide





433-P


embedded image





4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-3-methoxybenzoic acid





434-P


embedded image





4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-3-methoxybenzonitrile





435-P


embedded image





4-[(2-{3-[(5-fluoro-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-



1λ6-thiane-1,1-dione





436-P


embedded image





4-[(2-{3-[(2-methoxy-6-methylpyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





437-P


embedded image





4-[(2-{3-[(2-hydroxy-6-methylpyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





438-P


embedded image





4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-3-methoxybenzamide





439-P


embedded image





4-[(2-{3-[(2-methoxypyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





440-P


embedded image





4-[(2-{3-[(4-fluoro-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-



1λ6-thiane-1,1-dione





441-P


embedded image





4-[(2-{3-[(5-tert-butyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-



1λ6-thiane-1,1-dione





442-P


embedded image








4-[(2-{3-[(2-ethoxy-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]-1λ6-thiane-1,1-dione





443-P


embedded image





4-[(2-{3-[(3-fluoro-2-methoxyphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





444-P


embedded image





4-({2-[3-(methylamino)prop-1-yn-1-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl}amino)-



1λ6-thiane-1,1-dione





445-P


embedded image





4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide





446-P


embedded image





4-[(2-{3-[(2-fluoro-6-methoxyphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-



1H-indol-4-yl)amino]-1λ6-thiane-1,1-dione





447-P


embedded image





3-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-4-methoxybenzonitrile





448-P


embedded image





4-[(2-{3-[(4-tert-butyl-2-methoxy-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





449-P


embedded image





4-({2-[3-(phenylamino)prop-1-yn-1-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl}amino)-



1λ6-thiane-1,1-dione





450-P


embedded image





4-{[2-(3-{[2-(2-fluoroethoxy)-4-



methanesulfonylphenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino]-1λ6-thiane-1,1-dione





451-P


embedded image





2-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-5-



methanesulfonylbenzonitrile





452-P


embedded image





4-[(2-{3-[(2-chloro-4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





453-P


embedded image





4-[(2-{3-[(4-methoxyphenyl)amino]prop-1-



yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]-1λ6-thiane-1,1-dione





454-P


embedded image





4-{[2-(3-{[4-methanesulfonyl-2-(2-



methoxyethoxy)phenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}-1λ6-thiane-1,1-dione





455-P


embedded image





2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-N,N-dimethylacetamide





456-P


embedded image





2-methyl-2-(5-{[3-(4-{[(1R,4R)-4-



(dimethylamino)cyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridin-2-yl)propanenitrile





457-P


embedded image





2-(5-((3-(4-(((1S,4S)-4-(dimethylamino)-



cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-yl)amino)pyridin-



2-yl)-2-methylpropanenitrile





458-P


embedded image








N-[1-(2-methanesulfonylethyl)piperidin-4-



yl]-2-{3-[(4-methanesulfonylphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





459-P


embedded image





5-({3-[4-({1-



[(dimethylcarbamoyl)methyl]piperidin-4-



yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl]prop-2-yn-1-yl}amino)pyridine-2-carboxamide





460-P


embedded image





5-{[3-(4-{[1-(2-



methanesulfonylethyl)piperidin-4-yl]amino}-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-



2-yn-1-yl]amino}pyridine-2-carboxamide





461-P


embedded image





5-[(3-{4-[(piperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]pyridine-2-carboxamide





462-P


embedded image





5-{[3-(4-{[1-(carbamoylmethyl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridine-2-carboxamide





463-P


embedded image





5-{[3-(4-{[1-(2-hydroxyethyl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridine-2-carboxamide





464-P


embedded image





5-{[3-(4-{[1-(oxan-4-yl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}pyridine-2-carboxamide





465-P


embedded image





5-{[3-(4-{[(1R,4R)-4-(dimethylamino)-



cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





466-P


embedded image





4-{[3-(4-{[1-(2-methanesulfonyl-



ethyl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide





467-P


embedded image





4-{[3-(4-{[1-(2-methoxyethyl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]aminl}benzene-1-sulfonamide





468-P


embedded image





5-{[3-(4-{[(1S,4S)-4-(dimethylamino)-



cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-



1H-indol-2-yl)prop-2-yn-1-



yl]amino}pyridine-2-carboxamide





469-P


embedded image





N,N-dimethyl-4-{[3-(4-{[1-(oxan-4-



yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide





470-P


embedded image





4-{[3-(4-{[1-(oxan-4-yl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide





471-P


embedded image





2-{4-[(2-{3-[(4-sulfamoylphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-



piperidin-1-yl}acetamide





472-P


embedded image





4-{[(3-(4-{[1-(2-methoxyethyl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}-N,N-



dimethylbenzene-1-sulfonamide





473-P


embedded image





4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]benzene-1-sulfonamide





474-P


embedded image





4-{[3-(4-{[1-(2-hydroxyethyl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide





475-P


embedded image





4-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-



4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide





476-P


embedded image





4-({3-[4-({1-[2-(morpholin-4-yl)-2-



oxoethyl]piperidin-4-yl}amino)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)benzene-1-sulfonamide





477-P


embedded image





methyl 2-{4-[(2-{3-[(4-sulfamoylphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoro-



ethyl)-1H-indol-4-yl)amino]piperidin-1-yl}acetate





478-P


embedded image





4-{[3-(4-{[1-(2-hydroxyethyl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide





479-P


embedded image





4-({3-[4-({1-[2-(2-



hydroxyethoxy)ethyl]piperidin-4-yl}amino)-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-



2-yn-1-yl}amino)benzene-1-sulfonamide





480-P


embedded image





N,N-dimethyl-2-{4-[(2-{3-[(4-



sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamide





481-P


embedded image





4-({3-[4-({1-[2-(4-hydroxypiperidin-1-yl)-2-



oxoethyl]piperidin-4-yl}amino)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)benzene-1-sulfonamide





482-P


embedded image





2-{4-[(2-{3-[(4-



sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetic acid





483-P


embedded image





4-({3-[4-({1-[2-(4-methylpiperazin-1-yl)-2-



oxoethyl]piperidin-4-yl}amino)-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-



yl}amino)benzene-1-sulfonamide





484-P


embedded image





N-methyl-2-{4-[(2-{3-[(4-



sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamide





485-P


embedded image





N-methyl-4-[(3-{4-[(oxan-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]benzene-1-sulfonamide





486-P


embedded image





4-{[3-(4-{[1-(2-methoxyethyl)piperidin-4-



yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl)prop-2-yn-1-yl]amino}-N-



methylbenzene-1-sulfonamide





487-P


embedded image





N-methyl-4-{[3-(4-{[1-(oxan-4-yl)piperidin-



4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide





488-P


embedded image





2-(dimethylamino)ethyl 2-{4-[(2-{3-[(4-



methanesulfonylphenyl)-amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetate





489-P


embedded image





2-methoxy-4-[(3-{4-{[(oxan-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]benzene-1-sulfonamide





490-P


embedded image





2-chloro-4-[(3-{4-[(oxan-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]benzene-1-sulfonamide





491-P


embedded image





3-methoxy-4-{[3-(4-{[1-(oxan-4-



yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide





492-P


embedded image





4-{[3-(4-{[1-(2,3-dihydroxypropyl)-



piperidin-4-yl]amino}-1-(2,2,2-trifluoro-



ethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-



3-methoxybenzene-1-sulfonamide





493-P


embedded image





3-methoxy-4-[(3-{4-[(piperidin-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]benzene-1-sulfonamide





494-P


embedded image





3-methoxy-4-[(3-{4-[(oxan-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]benzene-1-sulfonamide





495-P


embedded image





3-methoxy-4-[(3-{4-[(oxan-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]benzamide





496-P


embedded image





3-methoxy-4-{[3-(4-{[1-(oxan-4-



yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzamide





497-P


embedded image





4-{[3-(4-{[1-(2,3-dihydroxypropyl)-



piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}-3-methoxybenzamide





498-P


embedded image





2-[5-({3-[1-(cyanomethyl)-4-[(1-



methylpiperidin-4-yl)amino]-1H-indol-2-



yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





499-P


embedded image





2-[5-({3-[1-(3-methoxypropyl)-4-[(1-



methylpiperidin-4-yl)amino]-1H-indol-2-



yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





500-P


embedded image





2-[5-({3-[1-(2-chloroethyl)-4-[(1-



methylpiperidin-4-yl)amino]-1H-indol-2-



yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





501-P


embedded image





2-methyl-2-{5-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(propan-2-yl)-1H-indol-2-



yl}prop-2-yn-1-yl)amino]pyridin-2-yl}propanenitrile





502-P


embedded image





2-{5-[(3-{1-cyclopentyl-4-[(1-



methylpiperidin-4-yl)amino]-1H-indol-2-



yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-



methylpropanenitrile





503-P


embedded image





2-methyl-2-{5-[(3-{4-[(1-methylpiperidin-4-



yl)amino]-1-(3,3,3-trifluoropropyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}propanenitrile





504-P


embedded image





1-(2-chloroethyl)-N-(1-methylpiperidin-4-



yl)-2-{3-[(6-methylpyridin-3-yl)amino]-



prop-1-yn-1-yl}-1H-indol-4-amine





505-P


embedded image





1-(2-chloroethyl)-N-(1-methylpiperidin-4-



yl)-2-{3-[(6-methylpyridin-3-yl)amino]-



prop-1-yn-1-yl}-1H-indol-4-amine





506-P


embedded image





1-(2-chloroethyl)-2-{3-[(4-chlorophenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1H-indol-4-amine





507-P


embedded image





2-[5-({3-[1-(1-cyanoethyl)-4-[(1-



methylpiperidin-4-yl)amino]-1H-indol-2-



yl]prop-2-yn-1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





508-P


embedded image





2-[5-({3-[1-(cyanomethyl)-4-[(1,1-dioxo-1λ6-



thian-4-yl)amino]-1H-indol-2-yl]prop-2-yn-



1-yl}amino)pyridin-2-yl]-2-



methylpropanenitrile





509-P


embedded image





4-[(2-{3-{(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(oxiran-2-ylmethyl)-1H-indol-4-



yl)amino]-1λ6-thiane-1,1-dione





510-P


embedded image





2-{3-[(4-methanesulfonylphenyl)-



amino]prop-1-yn-1-yl}-N-[1-(oxan-4-



yl)piperidin-4-yl]-1-(oxiran-2-ylmethyl)-1H-indol-4-amine





511-P


embedded image





4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(oxiran-2-ylmethyl)-1H-indol-4-yl)amino]-



1λ6-thiane-1,1-dione





512-P


embedded image





2-{3-[(4-methanesulfonyl-2-methoxy-



phenyl)amino]prop-1-yn-1-yl}-N-[1-(oxan-4-



yl)piperidin-4-yl]-1-(oxiran-2-ylmethyl)-1H-



indol-4-amine





513-P


embedded image





1-[6-(1-cyano-1-methylethyl)pyridin-3-yl]-3-



(3-{4-[(1-methylpiperidin-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)urea





514-P


embedded image





1-(6-methanesulfonylpyridin-3-yl)-3-(3-{4-



[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)urea





515-P


embedded image





1-[6-(1-cyano-1-methylethyl)pyridin-3-yl]-3-



(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)urea





516-P


embedded image





3-(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)-1-(6-methanesulfonylpyridin-3-yl)urea





517-P


embedded image





1-(6-cyanopyridin-3-yl)-3-(3-{4-[(1-



methylpiperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)urea





518-P


embedded image





1-(6-cyanopyridin-3-yl)-3-(3-{4-[(1,1-dioxo-



1λ6-thian-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)urea





519-P


embedded image





3-(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)-1-(quinoxalin-6-yl)urea





520-P


embedded image





N-(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)-4-methylpiperazine-1-carboxamide





521-P


embedded image





N-(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)morpholine-4-carboxamide





522-P


embedded image





4-[(2-{3-{(6-methanesulfonylpyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





523-P


embedded image





2-{4-[(2-{3-[(6-methanesulfonylpyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-N,N-dimethylacetamide





524-P


embedded image





N-(1-ethylpiperidin-4-yl)-2-{3-[(6-



methanesulfonylpyridin-3-yl)amino]prop-1-



yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





525-P


embedded image





N-[1-(2-methanesulfonylethyl)piperidin-4-



yl]-2-{3-[(6-methanesulfonylpyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





526-P


embedded image





2-{3-[(6-methanesulfonylpyridin-3-



yl)amino]prop-1-yn-1-yl}-N-[1-(1-



methylpiperidin-4-yl)piperidin-4-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





527-P


embedded image





2-{4-[(2-{3-[(6-methanesulfonylpyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl]ethan-1-ol





528-P


embedded image





4-{4-[(2-{3-{(6-methanesulfonylpyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]



piperidin-1-yl}-1λ6-thiane-1,1-dione





529-P


embedded image





2-{4-[(2-{3-[(6-methanesulfonylpyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-



yl}-1-(4-methylpiperazin-1-yl)ethan-1-one





530-P


embedded image





2-{3-[(4-methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-N-(oxan-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





531-P


embedded image





2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethan-1-ol





532-P


embedded image





2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-1-(4-



methylpiperazin-1-yl)ethan-1-one





533-P


embedded image





2-{3-[(4-methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-N-[1-(1-methylpiperidin-4-yl)piperidin-



4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





534-P


embedded image





N-(2,3-dihydroxypropyl)-2-{4-[(2-{3-[(4-



methanesulfonylphenyl)-amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-N-methylacetamide





535-P


embedded image





4-N-(2-{3-[(4-methanesulfonylphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)-1-N,1-N-



dimethylcyclohexane-1,4-diamine





536-P


embedded image





(1S,4S)-4-N-(2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)-1-N,1-N-



dimethylcyclohexane-1,4-diamine





537-P


embedded image





2-{3-[(4-methanesulfonylphenyl)-



amino]prop-1-yn-1-yl}-N-[1-(oxan-4-



yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





538-P


embedded image





2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-1-(morpholin-4-yl)ethan-1-one





539-P


embedded image





1-(4-hydroxypiperidin-1-yl)-2-{4-[(2-{3-[(4-



methanesulfonylphenyl)-amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethan-1-one





540-P


embedded image





2-{3-[(4-methanesulfonylphenyl)-



amino]prop-1-yn-1-yl}-N-(piperidin-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





541-P


embedded image





N-{1-[1-(2-methanesulfonylethyl)piperidin-



4-yl]piperidin-4-yl}-2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





542-P


embedded image





2-{3-[(4-methanesulfonylphenyl)-



amino]prop-1-yn-1-yl}-N-[1-(2-



methoxyethyl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





543-P


embedded image





3-{4-[(2-{3-[(4-methane-sulfonylphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}propanenitrile





544-P


embedded image





2-{3-[(4-methanesulfonylphenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





545-P


embedded image





2-{4-[(2-{3-[(4-methane-sulfonylphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamide





546-P


embedded image





4-{4-[(2-{3-[(4-methane-sulfonylphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-1λ6-thiane-1,1-dione





547-P


embedded image





2-{4-[(2-{3-[(4-methane-



sulfonylphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-N-methylacetamide





548-P


embedded image





2-(3-{[4-(ethanesulfonyl)phenyl]



amino}prop-1-yn-1-



yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





549-P


embedded image





2-{4-[(2-{3-[(2-fluoro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethan-1-ol





550-P


embedded image





2-{3-[(2-fluoro-4-methane-sulfonylphenyl)-



amino]prop-1-yn-1-yl}-N-[1-(2-



methanesulfonylethyl)-piperidin-4-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





551-P


embedded image





2-{4-[(2-{3-[(2-fluoro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamide





552-P


embedded image





2-{3-[(2-fluoro-4-methane-sulfonylphenyl)-



amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





553-P


embedded image





1-{4-[(2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)



amino]piperidin-1-yl}-2-methoxyethan-1-one





554-P


embedded image





2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-(1-



methylpyrrolidin-3-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





555-P


embedded image





N-hydroxy-2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamide





556-P


embedded image





3-{4-[(2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}propane-1,2-diol





557-P


embedded image





2-{3-[(2-fluoro-4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-[1-(1-



methylpiperidin-4-yl)piperidin-4-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





558-P


embedded image





2-(3-{[4-(ethanesulfonyl)phenyl]amino}prop-1-yn-1-



yl)-N-[1-(1-methylpiperidin-4-yl)piperidin-4-



yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





559-P


embedded image





2-{3-[(2-fluoro-4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-(oxan-4-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





560-P


embedded image





2-(4-{[2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)ethan-1-ol





561-P


embedded image





1-{4-[(2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}propan-2-ol





562-P


embedded image





2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-N-[1-(2-



methanesulfonylethyl)piperidin-4-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





563-P


embedded image





4-{[1-(2,2,2-trifluoroethyl)-2-{3-[(4-



trifluoromethanesulfonylphenyl)amino]prop-



1-yn-1-yl}-1H-indol-4-yl]amino}-1λ6-thiane-1,1-dione





564-P


embedded image





2-(4-{[1-(2,2,2-trifluoroethyl)-2-{3-[(4-



trifluoromethanesulfonylphenyl)amino]prop-



1-yn-1-yl}-1H-indol-4-yl]amino}piperidin-1-yl)ethan-1-ol





565-P


embedded image





N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-2-{3-[(4-



trifluoromethanesulfonylphenyl)amino]prop-



1-yn-1-yl}-1H-indol-4-amine





566-P


embedded image





2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-[1-(1-



methylpyrrolidin-3-yl)piperidin-4-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





567-P


embedded image





2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-[1-(3-



methanesulfonylpropyl)piperidin-4-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





568-P


embedded image





2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-N-[1-(2-



methoxyethyl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





569-P


embedded image





4-(4-{[2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)-1λ6-thiane-1,1-dione





570-P


embedded image





2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-N-[1-(oxan-4-



yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





571-P


embedded image





N-[1-(2-methanesulfonylethyl)-piperidin-4-



yl]-1-(2,2,2-trifluoroethyl)-2-{3-[(4-trifluoromethane-



sulfonylphenyl)amino]prop-1-yn-1-yl}-1H-indol-4-amine





572-P


embedded image





N-[1-(oxan-4-yl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-2-{3-[(4-



trifluoromethanesulfonylphenyl)amino]prop-



1-yn-1-yl}-1H-indol-4-amine





573-P


embedded image





N-[1-(1-methylpiperidin-4-yl)piperidin-4-yl]-



1-(2,2,2-trifluoroethyl)-2-{3-[(4-



trifluoromethanesulfonylphenyl)amino]prop-



1-yn-1-yl}-1H-indol-4-amine





574-P


embedded image





2-{3-[(2-fluoro-4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-[1-(oxan-4-



yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





575-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetonitrile





576-P


embedded image





2-{3-[(2-fluoro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-N-[1-(2-methoxyethyl)piperidin-4-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





577-P


embedded image





2-{3-[(3-chloro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-N-[1-(oxan-4-yl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





578-P


embedded image





2-{3-[(2,6-difluoro-4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-[1-(oxan-4-



yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-



1H-indol-4-amine





579-P


embedded image





2-{3-[(3-chloro-4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-[1-(2-



methoxyethyl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





580-P


embedded image





2-{4-[(2-{3-[(3-chloro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethan-1-ol





581-P


embedded image





(2S)-3-{4-[(2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}propane-1,2-diol





582-P


embedded image





N-(5-aminopentyl)-2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamide





583-P


embedded image





2-{3-[(2,6-difluoro-4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-N-[1-(2-



methoxyethyl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





584-P


embedded image





2-(3-{[4-(ethanesulfonyl)phenyl]-



amino}prop-1-yn-1-yl)-N-(oxan-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





585-P


embedded image





2-(4-{[2-(3-{[4-



(ethanesulfonyl)phenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)acetonitrile





586-P


embedded image





2-(3-{[4-(2-methylpropane-2-



sulfonyl)phenyl]amino}prop-1-yn-1-yl)-N-



[1-(oxan-4-yl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





587-P


embedded image





2-(2-{4-[(2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethoxy)ethan-1-ol





588-P


embedded image





1-{4-[(2-{3-[(2-fluoro-4-methane-



sulfonylphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}propan-2-ol





589-P


embedded image





3-{4-[(2-{3-[(2-fluoro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}propane-1,2-diol





590-P


embedded image





(1S,4S)-4-N-(2-{3-[(2-fluoro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-



N,1-N-dimethylcyclohexane-1,4-diamine





591-P


embedded image





3-(4-{[2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)propane-1,2-diol





592-P


embedded image





2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-N-[1-(3-



methanesulfonylpropyl)-piperidin-4-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





593-P


embedded image





1-(4-{[2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)propan-2-ol





594-P


embedded image





2-[2-(4-{[2-(3-{[4-(ethanesulfonyl)-



phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)ethoxy]ethan-1-ol





595-P


embedded image





(1R,4R)-4-N-(2-{3-[(2-fluoro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-



N,1-N-dimethyl-cyclohexane-1,4-diamine





596-P


embedded image





2-{3-[(2,6-difluoro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-N-[1-(2-methanesulfonylethyl)piperidin-



4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





597-P


embedded image





4-{4-[(2-{3-[(2,6-difluoro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-1λ6-thiane-1,1-dione





598-P


embedded image





2-{3-[(4-methanesulfonyl-3-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[1-(oxan-4-yl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





599-P


embedded image





2-{3-[(4-methanesulfonyl-3-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[1-(2-methoxyethyl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





600-P


embedded image





4-N-(2-{3-[(2-fluoro-4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-



N,1-N-dimethylcyclohexane-1,4-diamine





601-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetic acid





602-P


embedded image





2-hydroxyethyl 2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetate





603-P


embedded image





2-{3-[(4-methanesulfonylphenyl)-



amino]prop-1-yn-1-yl}-N-(2-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





604-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-3-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethan-1-ol





605-P


embedded image





(2S)-2-(2-{4-[(2-{3-[(4-methane-



sulfonylphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-



yl}acetamido)pentanedioic acid





606-P


embedded image





1,5-dimethyl (2S)-2-(2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamido)pentanedioate





607-P


embedded image





N-(4-carbamimidamidobutyl)-2-{4-[(2-{3-



[(4-methanesulfonylphenyl)-amino]prop-1-



yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamide





608-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



(oxan-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





609-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethan-1-ol





610-P


embedded image





2-{3-[(5-methanesulfonylpyridin-2-



yl)amino]prop-1-yn-1-yl}-N-(oxan-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





611-P


embedded image





3-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}propane-1,2-diol





612-P


embedded image





4-[(2-{3-[(2,4-dimethoxyphenyl)-



amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-thiane-1,1-dione





613-P


embedded image





methyl 4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzoate





614-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[1-(2-methanesulfonylethyl)-piperidin-4-yl]-



1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





615-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[1-(2-methoxyethyl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





616-P


embedded image





(1S,4S)-4-N-(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-N,1-



N-dimethylcyclohexane-1,4-diamine





617-P


embedded image





(1R,4R)-4-N-(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-N,1-



N-dimethylcyclohexane-1,4-diamine





618-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[1-(oxan-4-yl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





619-P


embedded image





1-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}propan-2-o





620-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[1-(1-methylpyrrolidin-3-yl)piperidin-4-yl]-



1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





621-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



(2-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





622-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-



indol-4-amine





623-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-1-(4-



methylpiperazin-1-yl)ethan-1-one





624-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamide





625-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[1-(1-methylpiperidin-4-yl)piperidin-4-yl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





626-P


embedded image





1-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]cyclohexyl}piperidin-4-ol





627-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-1-



(morpholin-4-yl)ethan-1-one





628-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-N,N-



dimethylacetamide





629-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetonitrile





630-P


embedded image





methyl 2-{4-[(2-{3-[(4-methane-sulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetate





631-P


embedded image





1-(4-hydroxypiperidin-1-yl)-2-{4-[(2-{3-[(4-



methanesulfonyl-2-methoxy-



phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethan-1-one





632-P


embedded image





2-(2-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethoxy)ethan-1-ol





633-P


embedded image





-[(1R,4R)-4-[(2-{3-[(4-methane-sulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]cyclohexyl]piperidin-4-ol





634-P


embedded image





2-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetic acid





635-P


embedded image





(1R,4R)-4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]cyclohexan-1-ol





636-P


embedded image





(1S,4S)-4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]cyclohexan-1-ol





637-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





638-P


embedded image





1-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]cyclohexyl}-3-methylpyrrolidin-3-ol





639-P


embedded image





(3R,4R)-1-{4-[(2-{3-[(4-methane-sulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]cyclohexyl}-pyrrolidine-3,4-diol





640-P


embedded image





4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidine-1-carboximidamide





641-P


embedded image





1-[(1S,4S)-4-[(2-{3-[(4-methane-sulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]cyclohexyl]piperidin-4-ol





642-P


embedded image





4-[(2-{3-[(3-methoxypyridin-4-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-



thiane-1,1-dione





643-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[(1S,4S)-4-(morpholin-4-yl)cyclohexyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





644-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





645-P


embedded image





2-(3-{[2-(2-fluoroethoxy)-4-



methanesulfonylphenyl]amino}prop-1-yn-1-



yl)-N-[1-(oxan-4-yl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





646-P


embedded image





4-{[2-(3-{[4-methanesulfonyl-2-



(trifluoromethyl)phenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}-1λ6-thiane-1,1-dione





647-P


embedded image





2-(3-{[4-methanesulfonyl-2-



(trifluoromethyl)phenyl]amino}prop-1-yn-1-



yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





648-P


embedded image





1-{4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}ethan-1-one





649-P


embedded image





3-methoxy-4-{[3-(4-{[1-(1-methylpiperidin-



4-yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide





650-P


embedded image





3-methoxy-4-[(3-{4-[(piperidin-4-yl)amino]-



1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-



2-yn-1-yl)amino]-benzamide





651-P


embedded image





3-methoxy-4-{[3-(4-{[1-(1-methylpiperidin-



4-yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzamide





652-P


embedded image





3-(4-{[2-(3-{[2-(2-fluoroethoxy)-4-



methanesulfonylphenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)propane-1,2-diol





653-P


embedded image





3-(4-{[2-(3-{[4-methanesulfonyl-2-(2-



methoxyethoxy)phenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)propane-1,2-diol





654-P


embedded image





2-(4-{[2-(3-{[4-methanesulfonyl-2-(2-



methoxyethoxy)phenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)acetamide





655-P


embedded image





2-(4-{[2-(3-{[2-(2-fluoroethoxy)-4-



methanesulfonylphenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)-1-(4-



methylpiperazin-1-yl)ethan-1-one





656-P


embedded image





2-(3-{[2-(2-fluoroethoxy)-4-



methanesulfonylphenyl]amino}prop-1-yn-1-



yl)-N-(oxan-4-yl)-1-(2,2,2-trifluoroethyl)-



1H-indol-4-amine





657-P


embedded image





2-(3-{[2-(2-fluoroethoxy)-4-



methanesulfonylphenyl]amino}prop-1-yn-1-



yl)-N-[1-(1-methylpiperidin-4-yl)piperidin-4-



yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine





658-P


embedded image





4-[(2-{3-[(4-methoxypyridin-3-



yl)amino]prop-1-yn-1-yl}-1-(2,2,2-



trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-thiane-1,1-dione





659-P


embedded image





S-{4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]-3-



methoxyphenyl}-2-hydroxyethane-1-sulfonamido





660-P


embedded image





2-hydroxy-S-{3-methoxy-4-[(3-{4-[(1-



methylpiperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]phenyl}ethane-1-sulfonamido





661-P


embedded image





2-methyl-2-[5-({3-[4-(morpholin-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-



yn-1-yl}amino)pyridin-2-yl]propanenitrile





662-P


embedded image





-{4-[(2-{3-[(4-methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}-N-[5-(2-{4-[(2-{3-



[(4-methanesulfonylphenyl)amino]prop-1-



yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetamido)pentyl]acetamide





663-P


embedded image





6-[(2-{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetyl)oxy]hexyl 2-



{4-[(2-{3-[(4-



methanesulfonylphenyl)amino]prop-1-yn-1-



yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidin-1-yl}acetate





664-P


embedded image





3-methoxy-4-({3-[4-({1-[2-(4-



methylpiperazin-1-yl)-2-oxoethyl]piperidin-



4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl]prop-2-yn-1-yl}amino)benzene-1-sulfonamide





665-P


embedded image





2-{5-methanesulfonyl-2-[(3-{4-[(1-



methylpiperidin-4-yl)amino]-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-



yl)amino]phenoxy}acetamide





666-P


embedded image





2-(3-{[4-methanesulfonyl-2-(2-



methoxyethoxy)phenyl]amino}prop-1-yn-1-



yl)-N-[1-(oxan-4-yl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





667-P


embedded image





2-(4-{[2-(3-{[4-methanesulfonyl-2-(2-



methoxyethoxy)phenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-ypethan-1-ol





668-P


embedded image





3-methoxy-4-[(3-{4-[(oxan-4-yl)amino]-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-



yn-1-yl)amino]benzoic acid





669-P


embedded image





2-{2-[(3-{4-[(1,1-dioxo-1λ6-thian-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]-5-



methanesulfonylphenoxy}acetamide





670-P


embedded image





4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidine-1-carboxamide





671-P


embedded image





2-{3-[(4-methoxypyridin-3-yl)amino]prop-1-



yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-amine





672-P


embedded image





4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]piperidine-1-carbothioamide





673-P


embedded image





4-[(2-{3-[(6-methanesulfonyl-4-



methoxypyridin-3-yl)amino]prop-1-yn-1-yl}-



1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]-1λ6-thiane-1,1-dione





674-P


embedded image





3-methoxy-4-{[3-(4-{[1-(2-



methoxyethyl)piperidin-4-yl]amino}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}benzene-1-sulfonamide





675-P


embedded image





4-{[2-(3-{[4-(ethanesulfonyl)-2-



methoxyphenyl]amino}prop-1-yn-1-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}-



1λ6-thiane-1,1-dione





676-P


embedded image





2-(3-{[4-(ethanesulfonyl)-2-



methoxyphenyl]amino}prop-1-yn-1-yl)-N-



[1-(oxan-4-yl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





677-P


embedded image





4-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-



4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl)prop-2-yn-1-yl]amino}-3-



methoxybenzoic acid





678-P


embedded image





methyl 4-{[3-(4-{[1-(2,3-



dihydroxypropyl)piperidin-4-yl]amino}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}-3-methoxybenzoate





679-P


embedded image





methyl 3-methoxy-4-[(3-{4-[(oxan-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]benzoate





680-P


embedded image





3-methoxy-4-({3-[4-({1-[2-(4-



methylpiperazin-1-yl)-2-oxoethyl]piperidin-



4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl]prop-2-yn-1-yl}amino)benzamide





681-P


embedded image





4-[(2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-



N-methylpiperidine-1-carboximidamide





682-P


embedded image





2-{3-[(6-methanesulfonyl-4-methoxypyridin-



3-yl)amino]prop-1-yn-1-yl}-N-(1-



methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





683-P


embedded image





2-{3-[(4-methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-N-



[1-(pyridin-4-yl)piperidin-4-yl]-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





684-P


embedded image





3-(4-{[2-(3-{[4-(ethanesulfonyl)-2-



methoxyphenyl]amino}prop-1-yn-1-yl)-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}piperidin-1-yl)propane-1,2-diol





685-P


embedded image





2-(3-{[4-(ethanesulfonyl)-2-



methoxyphenyl]amino}prop-1-yn-1-yl)-N-



(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





686-P


embedded image





2-hydroxy-S-{3-methoxy-4-[(3-{4-[(oxan-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]phenyl}ethane-1-sulfonamido





687-P


embedded image





2-(3-{[4-methanesulfonyl-2-(2,2,2-



trifluoroethoxy)phenyl]amino}prop-1-yn-1-



yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-



trifluoroethyl)-1H-indol-4-amine





688-P


embedded image





4-{[2-(3-{[4-methanesulfonyl-2-(2,2,2-



trifluoroethoxy)phenyl]amino}prop-1-yn-1-



yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-



yl]amino}-1λ6-thiane-1,1-dione





689-P


embedded image





2-hydroxy-S-(3-methoxy-4-{[3-(4-{[1-(oxan-



4-yl)piperidin-4-yl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}phenyl)ethane-1-sulfonamido





690-P


embedded image





S-(4-{[3-(4-{[1-(2,3-



dihydroxypropyl)piperidin-4-yl]amino}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}-3-methoxyphenyl)-2-



hydroxyethane-1-sulfonamido





691-P


embedded image





2-{3-methoxy-4-[(3-{4-[(1-methylpiperidin-



4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-



indol-2-yl}prop-2-yn-1-yl)amino]phenyl}-2-



methylpropanenitrile





692-P


embedded image





3-methoxy-4-{[3-(4-{[(1S,4S)-4-[(3R,4R)-



3,4-dihydroxypyrrolidin-1-



yl]cyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide





693-P


embedded image





3-methoxy-4-{[3-(4-{[(1R,4R)-4-[(3R,4R)-



3,4-dihydroxypyrrolidin-1-



yl]cyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide





694-P


embedded image





3-methoxy-4-{[3-(4-{[(1S,4S)-4-(4-



hydroxypiperidin-1-yl)cyclohexyl]amino}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}benzene-1-sulfonamide





695-P


embedded image





3-methoxy-4-{[3-(4-{[(1R,4R)-4-(4-



hydroxypiperidin-1-yl)cyclohexyl]amino}-1-



(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-



yn-1-yl]amino}benzene-1-sulfonamide





696-P


embedded image





2-{4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-



yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-



2-yl}prop-2-yn-1-yl)amino]-3-



methoxyphenyl}-2-methylpropanenitrile





697-P


embedded image





3-methoxy-4-{[3-(4-{[(1S,4S)-4-(morpholin-



4-yl)cyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide





698-P


embedded image





3-methoxy-4-{[3-(4-{[(1R,4R)-4-



(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide





699-P


embedded image





(3S,4S)-1-[(1S,4S)-4-[(2-{3-[(4-



methanesulfonyl-2-



methoxyphenyl)amino]prop-1-yn-1-yl}-1-



(2,2,2-trifluoroethyl)-1H-indol-4-



yl)amino]cyclohexyl]pyrrolidine-3,4-diol





700-P


embedded image





3-methoxy-4-{[3-(4-{[(1R,4R)-4-



(dimethylamino)cyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide





701-P


embedded image





3-methoxy-4-{[3-(4-{[(1S,4S)-4-



(dimethylamino)cyclohexyl]amino}-1-(2,2,2-



trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-



yl]amino}benzene-1-sulfonamide






text missing or illegible when filed indicates data missing or illegible when filed







In some embodiments, disclosed herein is a method of treating a cancer, the method comprising administering to a subject in need thereof a therapeutically-effective amount of a compound of the disclosure. A compound of the invention can, for example, slow the proliferation of cancer cell lines, or kill cancer cells. Non-limiting examples of cancer that can be treated by a compound of the invention include: acute lymphoblastic leukemia, acute myeloid leukemia, adrenocortical carcinoma, AIDS-related cancers, AIDS-related lymphoma, anal cancer, appendix cancer, astrocytomas, basal cell carcinoma, bile duct cancer, bladder cancer, bone cancers, brain tumors, such as cerebellar astrocytoma, cerebral astrocytoma/malignant glioma, ependymoma, medulloblastoma, supratentorial primitive neuroectodermal tumors, visual pathway and hypothalamic glioma, breast cancer, bronchial adenomas, Burkitt lymphoma, carcinoma of unknown primary origin, central nervous system lymphoma, cerebellar astrocytoma, cervical cancer, childhood cancers, chronic lymphocytic leukemia, chronic myelogenous leukemia, chronic myeloproliferative disorders, colon cancer, cutaneous T-cell lymphoma, desmoplastic small round cell tumor, endometrial cancer, ependymoma, esophageal cancer, Ewing's sarcoma, germ cell tumors, gallbladder cancer, gastric cancer, gastrointestinal carcinoid tumor, gastrointestinal stromal tumor, gliomas, hairy cell leukemia, head and neck cancer, heart cancer, hepatocellular (liver) cancer, Hodgkin lymphoma, Hypopharyngeal cancer, intraocular melanoma, islet cell carcinoma, Kaposi sarcoma, kidney cancer, laryngeal cancer, lip and oral cavity cancer, liposarcoma, liver cancer, lung cancers, such as non-small cell and small cell lung cancer, lymphomas, leukemias, macroglobulinemia, malignant fibrous histiocytoma of bone/osteosarcoma, medulloblastoma, melanomas, mesothelioma, metastatic squamous neck cancer with occult primary, mouth cancer, multiple endocrine neoplasia syndrome, myelodysplastic syndromes, myeloid leukemia, nasal cavity and paranasal sinus cancer, nasopharyngeal carcinoma, neuroblastoma, non-Hodgkin lymphoma, non-small cell lung cancer, oral cancer, oropharyngeal cancer, osteosarcoma/malignant fibrous histiocytoma of bone, ovarian cancer, ovarian epithelial cancer, ovarian germ cell tumor, pancreatic cancer, pancreatic cancer islet cell, paranasal sinus and nasal cavity cancer, parathyroid cancer, penile cancer, pharyngeal cancer, pheochromocytoma, pineal astrocytoma, pineal germinoma, pituitary adenoma, pleuropulmonary blastoma, plasma cell neoplasia, primary central nervous system lymphoma, prostate cancer, rectal cancer, renal cell carcinoma, renal pelvis and ureter transitional cell cancer, retinoblastoma, rhabdomyosarcoma, salivary gland cancer, sarcomas, skin cancers, skin carcinoma merkel cell, small intestine cancer, soft tissue sarcoma, squamous cell carcinoma, stomach cancer, T-cell lymphoma, throat cancer, thymoma, thymic carcinoma, thyroid cancer, trophoblastic tumor (gestational), cancers of unknown primary site, urethral cancer, uterine sarcoma, vaginal cancer, vulvar cancer, Waldenström macroglobulinemia, and Wilms tumor.


In some embodiments, the compounds of the invention show non-lethal toxicity.


In some embodiments, disclosed herein is a method of treating cancer comprising administering to a subject in need thereof a compound of Formula (I):




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the Y atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically acceptable salt thereof;


wherein the compound has an SC150 value for p53 Y220C of less than 1 μM as measured by a homogeneous time-resolved fluorescence (HTRF) assay


In some embodiments, disclosed herein is a method of inducing apoptosis in a cell, the method comprising contacting the cell with a therapeutically-effective amount of a compound that binds a p53 mutant, wherein the compound is a compound disclosed herein. In some embodiments, the compound increases the ability of the p53 mutant to bind DNA. In some embodiments, the cell expresses the p53. In some embodiments, the p53 mutant has a mutation at amino acid 220. In some embodiments, the p53 mutant is p53 Y220C. In some embodiments, the compound induces a conformational change in the p53 mutant. In some embodiments, the compound selectively binds the p53 mutant as compared to a wild type p53. In some embodiments, the therapeutically effective amount is from about 50 mg to about 3000 mg. In some embodiments, the compound increases a stability of a biologically active conformation of the p53 mutant relative to a stability of the biologically active conformation of the p53 mutant in an absence of the compound.


Pharmaceutically-Acceptable Salts.

The invention provides the use of pharmaceutically-acceptable salts of any therapeutic compound described herein. Pharmaceutically-acceptable salts include, for example, acid-addition salts and base-addition salts. The acid that is added to the compound to form an acid-addition salt can be an organic acid or an inorganic acid. A base that is added to the compound to form a base-addition salt can be an organic base or an inorganic base. In some embodiments, a pharmaceutically-acceptable salt is a metal salt. In some embodiments, a pharmaceutically-acceptable salt is an ammonium salt.


Metal salts can arise from the addition of an inorganic base to a compound of the invention. The inorganic base consists of a metal cation paired with a basic counterion, such as, for example, hydroxide, carbonate, bicarbonate, or phosphate. The metal can be an alkali metal, alkaline earth metal, transition metal, or main group metal. In some embodiments, the metal is lithium, sodium, potassium, cesium, cerium, magnesium, manganese, iron, calcium, strontium, cobalt, titanium, aluminum, copper, cadmium, or zinc.


In some embodiments, a metal salt is a lithium salt, a sodium salt, a potassium salt, a cesium salt, a cerium salt, a magnesium salt, a manganese salt, an iron salt, a calcium salt, a strontium salt, a cobalt salt, a titanium salt, an aluminum salt, a copper salt, a cadmium salt, or a zinc salt.


Ammonium salts can arise from the addition of ammonia or an organic amine to a compound of the invention. In some embodiments, the organic amine is triethyl amine, diisopropyl amine, ethanol amine, diethanol amine, triethanol amine, morpholine, N-methylmorpholine, piperidine, N-methylpiperidine, N-ethylpiperidine, dibenzylamine, piperazine, pyridine, pyrrazole, pipyrrazole, imidazole, pyrazine, or pipyrazine.


In some embodiments, an ammonium salt is a triethyl amine salt, a diisopropyl amine salt, an ethanol amine salt, a diethanol amine salt, a triethanol amine salt, a morpholine salt, an N-methylmorpholine salt, a piperidine salt, an N-methylpiperidine salt, an N-ethylpiperidine salt, a dibenzylamine salt, a piperazine salt, a pyridine salt, a pyrrazole salt, a pipyrrazole salt, an imidazole salt, a pyrazine salt, or a pipyrazine salt.


Acid addition salts can arise from the addition of an acid to a compound of the invention. In some embodiments, the acid is organic. In some embodiments, the acid is inorganic. In some embodiments, the acid is hydrochloric acid, hydrobromic acid, hydroiodic acid, nitric acid, nitrous acid, sulfuric acid, sulfurous acid, a phosphoric acid, isonicotinic acid, lactic acid, salicylic acid, tartaric acid, ascorbic acid, gentisinic acid, gluconic acid, glucaronic acid, saccaric acid, formic acid, benzoic acid, glutamic acid, pantothenic acid, acetic acid, propionic acid, butyric acid, fumaric acid, succinic acid, methanesulfonic acid, ethanesulfonic acid, benzenesulfonic acid, p-toluenesulfonic acid, citric acid, oxalic acid, or maleic acid.


In some embodiments, the salt is a hydrochloride salt, a hydrobromide salt, a hydroiodide salt, a nitrate salt, a nitrite salt, a sulfate salt, a sulfite salt, a phosphate salt, isonicotinate salt, a lactate salt, a salicylate salt, a tartrate salt, an ascorbate salt, a gentisinate salt, a gluconate salt, a glucaronate salt, a saccarate salt, a formate salt, a benzoate salt, a glutamate salt, a pantothenate salt, an acetate salt, a propionate salt, a butyrate salt, a fumarate salt, a succinate salt, a methanesulfonate (mesylate) salt, an ethanesulfonate salt, a benzenesulfonate salt, a p-toluenesulfonate salt, a citrate salt, an oxalate salt, or a maleate salt.


Pharmaceutical Compositions of the Invention.

A pharmaceutical composition of the invention can be used, for example, before, during, or after treatment of a subject with, for example, another pharmaceutical agent.


Subjects can be, for example, elderly adults, adults, adolescents, pre-adolescents, children, toddlers, infants, neonates, and non-human animals. In some embodiments, a subject is a patient.


A pharmaceutical composition of the invention can be a combination of any pharmaceutical compounds described herein with other chemical components, such as carriers, stabilizers, diluents, dispersing agents, suspending agents, thickening agents, and/or excipients. The pharmaceutical composition facilitates administration of the compound to an organism. Pharmaceutical compositions can be administered in therapeutically-effective amounts as pharmaceutical compositions by various forms and routes including, for example, intravenous, subcutaneous, intramuscular, oral, parenteral, ophthalmic, subcutaneous, transdermal, nasal, vaginal, and topical administration.


A pharmaceutical composition can be administered in a local manner, for example, via injection of the compound directly into an organ, optionally in a depot or sustained release formulation or implant. Pharmaceutical compositions can be provided in the form of a rapid release formulation, in the form of an extended release formulation, or in the form of an intermediate release formulation. A rapid release form can provide an immediate release. An extended release formulation can provide a controlled release or a sustained delayed release.


For oral administration, pharmaceutical compositions can be formulated by combining the active compounds with pharmaceutically-acceptable carriers or excipients. Such carriers can be used to formulate liquids, gels, syrups, elixirs, slurries, or suspensions, for oral ingestion by a subject. Non-limiting examples of solvents used in an oral dissolvable formulation can include water, ethanol, isopropanol, saline, physiological saline, DMSO, dimethylformamide, potassium phosphate buffer, phosphate buffer saline (PBS), sodium phosphate buffer, 4-2-hydroxyethyl-1-piperazineethanesulfonic acid buffer (HEPES), 3-(N-morpholino)propanesulfonic acid buffer (MOPS), piperazine-N,N′-bis(2-ethanesulfonic acid) buffer (PIPES), and saline sodium citrate buffer (SSC). Non-limiting examples of co-solvents used in an oral dissolvable formulation can include sucrose, urea, cremaphor, DMSO, and potassium phosphate buffer.


Pharmaceutical preparations can be formulated for intravenous administration. The pharmaceutical compositions can be in a form suitable for parenteral injection as a sterile suspension, solution or emulsion in oily or aqueous vehicles, and can contain formulatory agents such as suspending, stabilizing and/or dispersing agents. Pharmaceutical formulations for parenteral administration include aqueous solutions of the active compounds in water-soluble form. Suspensions of the active compounds can be prepared as oily injection suspensions. Suitable lipophilic solvents or vehicles include fatty oils such as sesame oil, or synthetic fatty acid esters, such as ethyl oleate or triglycerides, or liposomes. The suspension can also contain suitable stabilizers or agents which increase the solubility of the compounds to allow for the preparation of highly concentrated solutions. Alternatively, the active ingredient can be in powder form for constitution with a suitable vehicle, e.g., sterile pyrogen-free water, before use.


The active compounds can be administered topically and can be formulated into a variety of topically administrable compositions, such as solutions, suspensions, lotions, gels, pastes, medicated sticks, balms, creams, and ointments. Such pharmaceutical compositions can contain solubilizers, stabilizers, tonicity enhancing agents, buffers and preservatives.


The compounds of the invention can be applied topically to the skin, or a body cavity, for example, oral, vaginal, bladder, cranial, spinal, thoracic, or pelvic cavity of a subject. The compounds of the invention can be applied to an accessible body cavity.


The compounds can also be formulated in rectal compositions such as enemas, rectal gels, rectal foams, rectal aerosols, suppositories, jelly suppositories, or retention enemas, containing conventional suppository bases such as cocoa butter or other glycerides, as well as synthetic polymers such as polyvinylpyrrolidone, and PEG. In suppository forms of the compositions, a low-melting wax such as a mixture of fatty acid glycerides, optionally in combination with cocoa butter, can be melted.


In practicing the methods of treatment or use provided herein, therapeutically-effective amounts of the compounds described herein are administered in pharmaceutical compositions to a subject having a disease or condition to be treated. In some embodiments, the subject is a mammal such as a human. A therapeutically-effective amount can vary widely depending on the severity of the disease, the age and relative health of the subject, the potency of the compounds used, and other factors. The compounds can be used singly or in combination with one or more therapeutic agents as components of mixtures.


Pharmaceutical compositions can be formulated using one or more physiologically-acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active compounds into preparations that can be used pharmaceutically. Formulations can be modified depending upon the route of administration chosen. Pharmaceutical compositions comprising a compound described herein can be manufactured, for example, by mixing, dissolving, emulsifying, encapsulating, entrapping, or compression processes.


The pharmaceutical compositions can include at least one pharmaceutically-acceptable carrier, diluent, or excipient and compounds described herein as free-base or pharmaceutically-acceptable salt form. Pharmaceutical compositions can contain solubilizers, stabilizers, tonicity enhancing agents, buffers and preservatives.


Methods for the preparation of compositions comprising the compounds described herein include formulating the compounds with one or more inert, pharmaceutically-acceptable excipients or carriers to form a solid, semi-solid, or liquid composition. Solid compositions include, for example, powders, tablets, dispersible granules, capsules, and cachets. Liquid compositions include, for example, solutions in which a compound is dissolved, emulsions comprising a compound, or a solution containing liposomes, micelles, or nanoparticles comprising a compound as disclosed herein. Semi-solid compositions include, for example, gels, suspensions and creams. The compositions can be in liquid solutions or suspensions, solid forms suitable for solution or suspension in a liquid prior to use, or as emulsions. These compositions can also contain minor amounts of nontoxic, auxiliary substances, such as wetting or emulsifying agents, pH buffering agents, and other pharmaceutically-acceptable additives.


Non-limiting examples of dosage forms suitable for use in the invention include liquid, powder, gel, nanosuspension, nanoparticle, microgel, aqueous or oily suspensions, emulsion, and any combination thereof.


Non-limiting examples of pharmaceutically-acceptable excipients suitable for use in the invention include binding agents, disintegrating agents, anti-adherents, anti-static agents, surfactants, anti-oxidants, coating agents, coloring agents, plasticizers, preservatives, suspending agents, emulsifying agents, anti-microbial agents, spheronization agents, and any combination thereof.


A composition of the invention can be, for example, an immediate release form or a controlled release formulation. An immediate release formulation can be formulated to allow the compounds to act rapidly. Non-limiting examples of immediate release formulations include readily dissolvable formulations. A controlled release formulation can be a pharmaceutical formulation that has been adapted such that release rates and release profiles of the active agent can be matched to physiological and chronotherapeutic requirements or, alternatively, has been formulated to effect release of an active agent at a programmed rate. Non-limiting examples of controlled release formulations include granules, delayed release granules, hydrogels (e.g., of synthetic or natural origin), other gelling agents (e.g., gel-forming dietary fibers), matrix-based formulations (e.g., formulations comprising a polymeric material having at least one active ingredient dispersed through), granules within a matrix, polymeric mixtures, and granular masses.


In some, a controlled release formulation is a delayed release form. A delayed release form can be formulated to delay a compound's action for an extended period of time. A delayed release form can be formulated to delay the release of an effective dose of one or more compounds, for example, for about 4, about 8, about 12, about 16, or about 24 h.


A controlled release formulation can be a sustained release form. A sustained release form can be formulated to sustain, for example, the compound's action over an extended period of time. A sustained release form can be formulated to provide an effective dose of any compound described herein (e.g., provide a physiologically-effective blood profile) over about 4, about 8, about 12, about 16 or about 24 h.


Non-limiting examples of pharmaceutically-acceptable excipients can be found, for example, in Remington: The Science and Practice of Pharmacy, Nineteenth Ed (Easton, Pa.: Mack Publishing Company, 1995); Hoover, John E., Remington's Pharmaceutical Sciences, Mack Publishing Co., Easton, Pa. 1975; Liberman, H. A. and Lachman, L., Eds., Pharmaceutical Dosage Forms, Marcel Decker, New York, N.Y., 1980; and Pharmaceutical Dosage Forms and Drug Delivery Systems, Seventh Ed. (Lippincott Williams & Wilkins1999), each of which is incorporated by reference in its entirety.


Multiple therapeutic agents can be administered in any order or simultaneously. In some embodiments, a compound of the invention is administered in combination with, before, or after treatment with another therapeutic agent. If simultaneously, the multiple therapeutic agents can be provided in a single, unified form, or in multiple forms, for example, as multiple separate pills. The agents can be packed together or separately, in a single package or in a plurality of packages. One or all of the therapeutic agents can be given in multiple doses. If not simultaneous, the timing between the multiple doses can vary to as much as about a month.


Therapeutic agents described herein can be administered before, during, or after the occurrence of a disease or condition, and the timing of administering the composition containing a therapeutic agent can vary. For example, the compositions can be used as a prophylactic and can be administered continuously to subjects with a propensity to conditions or diseases in order to lessen a likelihood of the occurrence of the disease or condition. The compositions can be administered to a subject during or as soon as possible after the onset of the symptoms. The administration of the therapeutic agents can be initiated within the first 48 h of the onset of the symptoms, within the first 24 h of the onset of the symptoms, within the first 6 h of the onset of the symptoms, or within 3 h of the onset of the symptoms. The initial administration can be via any route practical, such as by any route described herein using any formulation described herein.


A compound can be administered as soon as is practical after the onset of a disease or condition is detected or suspected, and for a length of time necessary for the treatment of the disease, such as, for example, from about 1 month to about 3 months. In some embodiments, the length of time a compound can be administered can be about 1 day, about 2 days, about 3 days, about 4 days, about 5 days, about 6 days, about 1 week, about 2 weeks, about 3 weeks, about 4 weeks, about 1 month, about 5 weeks, about 6 weeks, about 7 weeks, about 8 weeks, about 2 months, about 9 weeks, about 10 weeks, about 11 weeks, about 12 weeks, about 3 months, about 13 weeks, about 14 weeks, about 15 weeks, about 16 weeks, about 4 months, about 17 weeks, about 18 weeks, about 19 weeks, about 20 weeks, about 5 months, about 21 weeks, about 22 weeks, about 23 weeks, about 24 weeks, about 6 months, about 7 months, about 8 months, about 9 months, about 10 months, about 11 months, about 1 year, about 13 months, about 14 months, about 15 months, about 16 months, about 17 months, about 18 months, about 19 months, about 20 months, about 21 months, about 22 months about 23 months, about 2 years, about 2.5 years, about 3 years, about 3.5 years, about 4 years, about 4.5 years, about 5 years, about 6 years, about 7 years, about 8 years, about 9 years, or about 10 years. The length of treatment can vary for each subject.


Pharmaceutical compositions described herein can be in unit dosage forms suitable for single administration of precise dosages. In unit dosage form, the formulation is divided into unit doses containing appropriate quantities of one or more compounds. The unit dosage can be in the form of a package containing discrete quantities of the formulation. Non-limiting examples are packaged injectables, vials, or ampoules. Aqueous suspension compositions can be packaged in single-dose non-reclosable containers. Multiple-dose reclosable containers can be used, for example, in combination with or without a preservative. Formulations for injection can be presented in unit dosage form, for example, in ampoules, or in multi-dose containers with a preservative.


Pharmaceutical compositions provided herein, can be administered in conjunction with other therapies, for example, chemotherapy, radiation, surgery, anti-inflammatory agents, and selected vitamins. The other agents can be administered prior to, after, or concomitantly with the pharmaceutical compositions.


Depending on the intended mode of administration, the pharmaceutical compositions can be in the form of solid, semi-solid or liquid dosage forms, such as, for example, tablets, suppositories, pills, capsules, powders, liquids, suspensions, lotions, creams, or gels, for example, in unit dosage form suitable for single administration of a precise dosage.


For solid compositions, nontoxic solid carriers include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talc, cellulose, glucose, sucrose, and magnesium carbonate.


Non-limiting examples of pharmaceutically active agents suitable for combination with compositions of the disclosure include anti-infectives, i.e., aminoglycosides, antiviral agents, antimicrobials, anticholinergics/antispasmotics, antidiabetic agents, antihypertensive agents, antineoplastics, cardiovascular agents, central nervous system agents, coagulation modifiers, hormones, immunologic agents, immunosuppressive agents, and ophthalmic preparations.


Compounds can be delivered via liposomal technology. The use of liposomes as drug carriers can increase the therapeutic index of the compounds. Liposomes are composed of natural phospholipids, and can contain mixed lipid chains with surfactant properties (e.g., egg phosphatidylethanolamine). A liposome design can employ surface ligands for attaching to unhealthy tissue. Non-limiting examples of liposomes include the multilamellar vesicle (MLV), the small unilamellar vesicle (SUV), and the large unilamellar vesicle (LUV). Liposomal physicochemical properties can be modulated to optimize penetration through biological barriers and retention at the site of administration, and to reduce a likelihood of developing premature degradation and toxicity to non-target tissues. Optimal liposomal properties depend on the administration route: large-sized liposomes show good retention upon local injection, small-sized liposomes are better suited to achieve passive targeting. PEGylation reduces the uptake of the liposomes by the liver and spleen, and increases the circulation time, resulting in increased localization at the inflamed site due to the enhanced permeability and retention (EPR) effect. Additionally, liposomal surfaces can be modified to achieve selective delivery of the encapsulated drug to specific target cells. Non-limiting examples of targeting ligands include monoclonal antibodies, vitamins, peptides, and polysaccharides specific for receptors concentrated on the surface of cells associated with the disease.


Non-limiting examples of dosage forms suitable for use in the disclosure include liquid, elixir, nanosuspension, aqueous or oily suspensions, drops, syrups, and any combination thereof. Non-limiting examples of pharmaceutically-acceptable excipients suitable for use in the disclosure include granulating agents, binding agents, lubricating agents, disintegrating agents, sweetening agents, glidants, anti-adherents, anti-static agents, surfactants, anti-oxidants, gums, coating agents, coloring agents, flavoring agents, coating agents, plasticizers, preservatives, suspending agents, emulsifying agents, plant cellulosic material and spheronization agents, and any combination thereof.


Compositions of the invention can be packaged as a kit. In some embodiments, a kit includes written instructions on the administration/use of the composition. The written material can be, for example, a label. The written material can suggest conditions methods of administration. The instructions provide the subject and the supervising physician with the best guidance for achieving the optimal clinical outcome from the administration of the therapy. The written material can be a label. In some embodiments, the label can be approved by a regulatory agency, for example the U.S. Food and Drug Administration (FDA), the European Medicines Agency (EMA), or other regulatory agencies.


Dosing.

Pharmaceutical compositions described herein can be in unit dosage forms suitable for single administration of precise dosages. In unit dosage form, the formulation is divided into unit doses containing appropriate quantities of one or more compounds. The unit dosage can be in the form of a package containing discrete quantities of the formulation. Non-limiting examples are liquids in vials or ampoules. Aqueous suspension compositions can be packaged in single-dose non-reclosable containers. Multiple-dose reclosable containers can be used, for example, in combination with a preservative. Formulations for parenteral injection can be presented in unit dosage form, for example, in ampoules, or in multi-dose containers with a preservative.


A dose can be expressed in terms of an amount of the drug divided by the mass of the subject, for example, milligrams of drug per kilograms of subject body mass. A compound described herein can be present in a composition in a range of from about 1 mg to about 2000 mg; from about 100 mg to about 2000 mg; from about 10 mg to about 2000 mg; from about 5 mg to about 1000 mg, from about 10 mg to about 500 mg, from about 50 mg to about 250 mg, from about 100 mg to about 200 mg, from about 1 mg to about 50 mg, from about 50 mg to about 100 mg, from about 100 mg to about 150 mg, from about 150 mg to about 200 mg, from about 200 mg to about 250 mg, from about 250 mg to about 300 mg, from about 300 mg to about 350 mg, from about 350 mg to about 400 mg, from about 400 mg to about 450 mg, from about 450 mg to about 500 mg, from about 500 mg to about 550 mg, from about 550 mg to about 600 mg, from about 600 mg to about 650 mg, from about 650 mg to about 700 mg, from about 700 mg to about 750 mg, from about 750 mg to about 800 mg, from about 800 mg to about 850 mg, from about 850 mg to about 900 mg, from about 900 mg to about 950 mg, or from about 950 mg to about 1000 mg.


In some embodiments, a compound is administered in an amount ranging from about 5 mg/kg to about 50 mg/kg, 250 mg/kg to about 2000 mg/kg, about 10 mg/kg to about 800 mg/kg, about 50 mg/kg to about 400 mg/kg, about 100 mg/kg to about 300 mg/kg, or about 150 mg/kg to about 200 mg/kg. In some embodiments, a compound described herein can be present in a composition in a range of from about 20 mg/kg to about 400 mg/kg. In some embodiments, a compound described herein can be present in a composition in a range of from about 20 mg/kg to about 240 mg/kg. In some embodiments, a compound described herein can be present in a composition in a range of from about 75 mg/kg to about 150 mg/kg. In some embodiments, a compound described herein can be present in a composition in a range of from about 75 mg/kg to about 150 mg/kg. In some embodiments, a compound described herein can be present in a composition in a range of from about 100 mg/kg to about 150 mg/kg.


In some embodiments, a compound described herein can be present in a composition in an amount of about 75 mg/kg. In some embodiments, a compound described herein can be present in a composition in an amount of about 100 mg/kg. In some embodiments, a compound described herein can be present in a composition in an amount of about 150 mg/kg. In some embodiments, a compound described herein can be present in a composition in an amount of about 200 mg/kg. In some embodiments, a compound described herein can be present in a composition in an amount of about 250 mg/kg. In some embodiments, a compound described herein can be present in a composition in an amount of about 400 mg/kg.


A compound described herein can be present in a composition in an amount of about 1 mg, about 2 mg, about 3 mg, about 4 mg, about 5 mg, about 10 mg, about 15 mg, about 20 mg, about 25 mg, about 30 mg, about 35 mg, about 40 mg, about 45 mg, about 50 mg, about 55 mg, about 60 mg, about 65 mg, about 70 mg, about 75 mg, about 80 mg, about 85 mg, about 90 mg, about 95 mg, about 100 mg, about 125 mg, about 150 mg, about 175 mg, about 200 mg, about 250 mg, about 300 mg, about 350 mg, about 400 mg, about 450 mg, about 500 mg, about 550 mg, about 600 mg, about 650 mg, about 700 mg, about 750 mg, about 800 mg, about 850 mg, about 900 mg, about 950 mg, about 1000 mg, about 1050 mg, about 1100 mg, about 1150 mg, about 1200 mg, about 1250 mg, about 1300 mg, about 1350 mg, about 1400 mg, about 1450 mg, about 1500 mg, about 1550 mg, about 1600 mg, about 1650 mg, about 1700 mg, about 1750 mg, about 1800 mg, about 1850 mg, about 1900 mg, about 1950 mg, or about 2000 mg.


In some embodiments, a compound described herein can be present in a composition in an amount of about 100 mg, about 120 mg, about 140 mg, about 160 mg, about 180 mg, about 200 mg, about 220 mg, about 240 mg, about 260 mg, about 280 mg, or about 300 mg. In some embodiments, a compound described herein can be present in a composition in an amount of about 150 mg. In some embodiments, a compound described herein can be present in a composition in an amount of about 170 mg. In some embodiments, a compound described herein can be present in a composition in an amount of about 280 mg. In some embodiments, a compound described herein can be present in a composition in an amount of about 300 mg.


EXAMPLES
A. Synthesis of Alkynyl Reagents
Example A1
Synthesis of 3-(fluoromethoxy)-N-methyl-4-(prop-2-yn-1-ylamino)benzamide



embedded image


Step 1. To a solution of 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (947.37 mg, 4.12 mmol, 1 eq.) in DCM (50 mL) was added dropwise BBr3 (3.62 g, 14.43 mmol, 1.39 mL, 3.5 eq.) at −10° C. The mixture was stirred at 0° C. for 2 h. TLC analysis (DCM:MeOH=20:1, Rf=0.4) indicated that 10% of the starting material remained, and one new spot with polarity lower than that of the starting material was detected. Saturated solution of NaOH was added until the pH of the mixture was greater than 11. The mixture was extracted with DCM (50 mL×3), and the organic layer was discarded. 12M HCl was added into the aqueous phase until the pH was 8. The aqueous phase was extracted with EtOAc (150 mL×3), and the combined organic layers were washed with brine (150 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was stirred in PE (50 mL) at 25° C. for 12 h. The mixture then was filtered to afford 3-hydroxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (0.7 g, 3.08 mmol, 74.81% yield) as a yellow solid.


Step 2. To a solution of 3-hydroxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (0.3 g, 1.32 mmol, 1 eq.) and bromofluoromethane (298.60 mg, 2.64 mmol, 251.45 μL, 2 eq.) in DMF (10 mL) was added K2CO3 (365.45 mg, 2.64 mmol, 2 eq.). The mixture was stirred at 50° C. for 1 h, after which time TLC analysis (DCM:MeOH=20:1, Rf=0.5) indicated that the starting phenol was completely consumed, and one new spot was observed. The mixture was poured into water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated. The resulting residue was purified by prep-TLC (DCM:MeOH=20:1, Rf=0.5) to afford 3-(fluoromethoxy)-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (0.3 g, 1.08 mmol, 81.64% yield) as a yellow solid.


Example A2
Synthesis of 3-(2-cyanoethoxy)-N-methyl-4-(prop-2-yn-1-ylamino)benzamide



embedded image


A mixture of 3-hydroxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (200 mg, 685.52 μmol, 1 eq.) and benzyl(trimethyl)ammonium hydroxide (3.82 mg, 6.86 μmol, 4.15 μL, 30% purity, 0.01 eq.) was stirred in acrylonitrile (1.09 g, 20.57 mmol, 1.36 mL, 30 eq.) at 85° C. for 16 h under N2. TLC analysis indicated that ˜50% of the starting phenol remained, and one new spot with polarity lower than that of the starting material was observed. The mixture was concentrated under reduced pressure to provide a residue, which was purified by prep-TLC (DCM:MeOH=20:1, Rf=0.5) to afford 3-(2-cyanoethoxy)-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (100 mg, 349.80 μmol, 39.69% yield) as a yellow solid.


Example A3
Synthesis of 3-(cyanomethoxy)-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


Step 1. To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.4 g, 1.42 mmol, 1 eq.) in DCM (10 mL) was added dropwise BBr3 (1.24 g, 4.95 mmol, 477.20 μL, 3.5 eq.) at −10° C. The mixture was stirred at 0° C. for 2 h, after which time TLC analysis (DCM:MeOH=10:1, Rf=0.4) indicated that ˜10% of the starting methyl ether remained, and two new spots with polarity greater than that of the starting material were observed. 1N NaOH was added until the pH of the mixture was greater than 11. The mixture was extracted with DCM (50 mL×3), and the organic layer was discarded. 12M HCl was added into the aqueous phase until the pH was equal to 8, and the aqueous phase was extracted with EtOAc (150 mL×3). The combined organic layers were washed with brine (150 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (DCM:MeOH=10:1, Rf=0.4) to afford 3-hydroxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.25 g, 983.42 μmol, 69.50% yield) as a yellow solid.


Step 2. To a solution of 3-hydroxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.25 g, 983.42 μmol, 1 eq.) and bromoacrylonitrile (235.92 mg, 1.97 mmol, 131.07 μL, 2 eq.) in DMF (10 mL) was added K2CO3 (271.84 mg, 1.97 mmol, 2 eq.). The mixture was stirred at 50° C. for 2 h. TLC analysis (DCM:MeOH=10:1, Rf=0.5) indicated that the starting phenol was completely consumed, and one new spot was observed. The mixture was poured into water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (DCM:MeOH=10:1, Rf=0.5) to afford 3-(cyanomethoxy)-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.2 g, 716.20 μmol, 72.83% yield) as a yellow solid.


Example A4
General Procedure for Preparation of 2-(fluoromethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline, and 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetonitrile



embedded image


Synthesis of 5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenol: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (5 g, 19.85 mmol, 1 eq.) in DCM (50 mL) was added dropwise BBr3 (12.43 g, 49.63 mmol, 4.78 mL, 2.5 eq.) at −10° C. The mixture was stirred at 0° C. for 2 h. TLC analysis (PE:EtOAc=1:1, Rf=0.4) indicated that ˜10% of the starting methyl ether remained, and one major new spot with polarity greater than that of the starting material was observed. 1N NaOH was added until the pH of the mixture was greater than 11. The mixture was extracted with DCM (50 mL×3), and the organic layer was discarded. 12M HCl was added into the aqueous phase until the pH was equal to 8, and the aqueous phase was extracted with EtOAc (150 mL×3). The combined organic layers were washed with brine (150 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was stirred in PE (50 mL) at 25° C. for 12 h. The mixture was then filtered and dried to afford 5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenol (8 g, 30.19 mmol, 76.04% yield) as a yellow solid.


Synthesis of 2-(fluoromethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline, and 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetonitrile: To a solution of 5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenol (0.5 g, 2.22 mmol, 1 eq.) and 2-bromoacetonitrile (450 mg, 3.77 mmol, 2 eq.) or bromofluoromethane: 422 mg, 3.77 mmol, 2 eq.) in DMF (10 mL) was added K2CO3 (521.5 mg, 3.77 mmol, 2 eq.). The mixture was stirred at 50° C. for 2 h, and the mixture was poured into water (50 mL). The mixture was extracted with EtOAc (30 mL×3), and the combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure. The resulting residue was purified by column chromatography to afford 2-(fluoromethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (700 mg, crude) or 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetonitrile as a yellow gum.


Example A5
General Procedure for Preparation of N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)acetamide and N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)propionamide



embedded image


To a mixture of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (1 eq.), DMAP (0.1 eq.), and TEA (1 eq.) in THF (4 mL) was added (R1)2O (2 eq.) under N2 at 25° C. The mixture was stirred at 25° C. for 2 h, and TLC analysis indicated that the reaction was complete. The reaction mixture was diluted with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC to provide the desired product as a yellow oil.


Example A6
Preparation of N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)-N-methylpropionamide



embedded image


To a solution of 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.06 g, 235.94 μmol, 1 eq.) in THF (2 mL) were added DMAP (2.88 mg, 23.59 μmol, 0.1 eq.), TEA (23.87 mg, 235.94 μmol, 32.84 μL, 1 eq.), and propionic anhydride (61.41 mg, 471.87 μmol, 60.80 μL, 2 eq.). The reaction mixture was stirred at 25° C. for 10 h. LC-MS analysis detected the desired mass. The reaction mixture was concentrated under reduced pressure, and the resulting residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1, Rf=0.43) to provide N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)-N-methylpropionamide (0.04 g, 90.22 μmol, 38.24% yield) as a yellow solid.


Example A7
Preparation of N-methyl-5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline, N,N-dimethyl-5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline, and N-(5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)phenyl)acetamide



embedded image


Synthesis of 4-(methylsulfonyl)-2-nitro-1-(prop-2-yn-1-yloxy)benzene: To a mixture of propargyl bromide (2.74 g, 23 mmol, 1.98 mL, 5 eq.) and 4-(methylsulfonyl)-2-nitrophenol (1 g, 4.60 mmol, 1 eq.) in DMF (10 mL) was added K2CO3 (1.91 g, 13.80 mmol, 3 eq.). The mixture was stirred at 50° C. for 2 h, after which time TLC (EtOAc, Rf=0.43) indicated that the reaction was complete. The reaction mixture was quenched with water (150 mL) and extracted with EtOAc (50 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide crude 4-(methylsulfonyl)-2-nitro-1-(prop-2-yn-1-yloxy)benzene as a light yellow solid.


Synthesis of 5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline: To a solution of 4-(methylsulfonyl)-2-nitro-1-(prop-2-yn-1-yloxy)benzene (1.2 g, 4.70 mmol, 1 eq.) in AcOH (10 mL) was added Fe (1.31 g, 23.51 mmol, 5 eq.). The mixture was stirred at 70° C. for 2 h, after which time TLC analysis (PE:EtOAc=1:1, Rf=0.43) indicated that the reaction was complete. The reaction mixture was concentrated under reduced pressure to remove solvent and diluted with EtOAc (50 mL). The reaction mixture was quenched by adding a saturated solution of NaHCO3 (200 mL) at 25° C. and extracted with EtOAc (50 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:1) to provide 5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline (0.86 g, 3.44 mmol, 73.09% yield) as a light yellow solid.


Synthesis of N-(5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)phenyl)acetamide: A mixture of 5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline (100 mg, 399.53 μmol, 1 eq.), acetic anhydride (203.94 mg, 2 mmol, 187.10 μL, 5 eq.), and TEA (80.86 mg, 799.06 μmol, 111.22 μL, 2 eq.) in DCM (3 mL) was stirred at 50° C. for 2 h. TLC analysis (EtOAc, Rf=0.24) indicated that the reaction was complete. The reaction mixture was concentrated under reduced pressure to remove solvent. The residue was purified by prep-TLC to provide N-(5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)phenyl)acetamide (100 mg, 374.11 μmol, 93.64% yield) as a light yellow solid.


Synthesis of N-methyl-5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline: To a solution of 5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline (0.5 g, 2.2 mmol, 1 eq.) in MeOH (5 mL) were added AcOH (53.3 mg, 887.8 μmol, 50.8 μL, 0.4 eq.) and NaBH3CN (418.5 mg, 6.66 mmol, 3 eq.). The mixture was stirred at 25° C. for 0.5 h, then formaldehyde (234.2 mg, 2.9 mmol, 214.8 μL, 1.3 eq.) was added. The mixture was stirred further at 25° C. for 9.5 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was partitioned by adding a saturated solution of NaHCO3 (30 mL) and EtOAc (10 mL), and extracted with EtOAc (5 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was first purified by prep-TLC (PE:EtOAc=2:1, Rf=0.6) and further purified by prep-HPLC to provide N-methyl-5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline (100 mg, 376.11 μmol, 16.94% yield) as a colorless oil.


Synthesis of N,N-dimethyl-5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline: To a solution of 5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline (0.2 g, 887.8 μmol, 1 eq.) in MeOH (5 mL) were added AcOH (21.3 mg, 355.1 μmol, 20.3 μL, 0.4 eq.) and NaBH3CN (167.4 mg, 2.66 mmol, 3 eq.). The mixture was stirred at 25° C. for 0.5 h, then formaldehyde (216.2 mg, 2.7 mmol, 198.3 μL, 3 eq.) was added. The mixture was stirred further at 25° C. for 9.5 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was partitioned by adding a saturated solution of NaHCO3 (30 mL) and EtOAc (10 mL), and extracted with EtOAc (5 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The residue was first purified by prep-TLC (PE:EtOAc=2:1, Rf=0.6) to provide N,N-dimethyl-5-(methylsulfonyl)-2-(prop-2-yn-1-yloxy)aniline (0.1 g, 355.29 μmol, 40% yield) as a colorless oil.


Example A8
Preparation of 4-(methylsulfonyl)-N-(prop-2-yn-1-yl)-2-(trifluoromethyl)aniline



embedded image


Synthesis of methyl(4-nitro-3-(trifluoromethyl)phenyl)sulfane: To a solution of 4-fluoro-1-nitro-2-(trifluoromethyl)benzene (10 g, 47.82 mmol, 1 eq.) in DMF (100 mL) was added NaSMe (33.52 g, 95.65 mmol, 30.47 mL, 20% purity, 2 eq.) in one portion at 0° C. under N2. The mixture was stirred at 25° C. for 60 min, after which time TLC analysis indicated that the reaction was complete. The reaction was diluted with water (100 mL) and extracted with EtOAc (100 mL×3). The organic layer was then washed with half-saturated brine (100 mL×5), dried over anhydrous sodium sulfate, filtered, and concentrated to give 4-methylsulfanyl-1-nitro-2-(trifluoromethyl)benzene (11.4 g, crude) as a brown liquid, which was used in the next step without purification.


Synthesis of 4-(methylsulfonyl)-1-nitro-2-(trifluoromethyl)benzene: To a solution of 4-methylsulfanyl-1-nitro-2-(trifluoromethyl)benzene (10 g, 42.16 mmol, 1 eq.) in acetone (100 mL), water (100 mL), and MeOH (10 mL) was added potassium peroxymonosulfate (51.84 g, 84.32 mmol, 2 eq.) in one portion at 0° C. under N2. The mixture was stirred at 25° C. for 60 min, after which time TLC and LC-MS analysis indicated that the reaction was complete. The reaction was quenched by adding a saturated solution of Na2S2O3. The reaction mixture was slowly added to saturated NaHCO3 (15 mL), then added saturated Na2S2O3 (20 mL) was added. Completion of the reaction was monitored by KI starch test paper. Then the mixture was extracted with EtOAc (50 mL×3), and the organic phase was washed with brine (40 mL×3). The organic phase was dried over anhydrous sodium sulfate, filtered and concentrated in vacuo to afford crude 4-methylsulfonyl-1-nitro-2-(trifluoromethyl)benzene (9.8 g, 36.40 mmol, 86.35% yield) as a white solid.


Synthesis of 4-(methylsulfonyl)-2-(trifluoromethyl)aniline: A solution of 4-methylsulfonyl-1-nitro-2-(trifluoromethyl)benzene (9.5 g, 35.29 mmol, 1 eq.) in EtOH (200 mL) and NH4Cl (aq) (50 mL) was heated to 90° C., and Fe (9.85 g, 176.45 mmol, 5 eq.) was then added in one portion at 90° C. The reaction mixture was stirred at 90° C. for 1 h, after which time TLC analysis indicated that the reaction was complete. The reaction was filtered while the reaction mixture was still hot. The filtrate was diluted with water (100 mL) and extracted with EtOAc (200 mL×4). The combined organic layers were washed with brine (200 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated to provide crude 4-methylsulfonyl-2-(trifluoromethyl)aniline (7.2 g) as a yellow solid. The crude product was purified by column chromatography (SiO2, PE:EtOAc=2:1 to 1:1) to provide 4-methylsulfonyl-2-(trifluoromethyl)aniline (6.8 g, 28.43 mmol, 97.14% yield) as a yellow solid.


Synthesis of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethyl)phenyl)carbamate and tert-butyl (tert-butoxycarbonyl)(4-(methylsulfonyl)-2-(trifluoromethyl)phenyl)carbamate: To a solution of 4-methylsulfonyl-2-(trifluoromethyl)aniline (4 g, 16.72 mmol, 1 eq.) in THF (25 mL) were added Boc2O (4.38 g, 20.07 mmol, 4.61 mL, 1.2 eq.) and DMAP (2.45 g, 20.07 mmol, 1.2 eq.). The reaction mixture was stirred at 70° C. for 1 h, after which time TLC analysis indicated that the reaction was complete. The reaction was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with water (30 mL×3) and brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=6:1 to 4:1) to provide a mixture of tert-butyl N-[4-methylsulfonyl-2-(trifluoromethyl)phenyl]carbamate and tert-butyl N-tert-butoxycarbonyl-N-[4-methylsulfonyl-2-(trifluoromethyl)phenyl]carbamate as a yellow gum.


Synthesis of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethyl)phenyl)carbamate: To the mixture of the previous step (2.5 g, 5.69 mmol, 1 eq.) dissolved in MeOH (40 mL) was added K2CO3 (2.36 g, 17.07 mmol, 3 eq.) in one portion. The mixture was stirred at 25° C. for 6 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction was filtered and concentrated to afford tert-butyl N-[4-methylsulfonyl-2-(trifluoromethyl)phenyl]carbamate (2.0 g, crude) as a red solid.


Synthesis of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethyl)phenyl)(prop-2-yn-1-yl)carbamate: To a solution of tert-butyl N-[4-methylsulfonyl-2-(trifluoromethyl)phenyl]carbamate (2 g, 5.89 mmol, 1 eq.) in DMF (12 mL) were added Cs2CO3 (5.76 g, 17.68 mmol, 3 eq.) and propargyl bromide (2.10 g, 17.68 mmol, 1.52 mL, 3 eq.). The reaction mixture was stirred for 1.5 h at 25° C., after which time TLC analysis (PE:EtOAc=1:1, Rf(starting material)=0.68, product Rf(product)=0.50) indicated that the reaction was complete. The reaction was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with water (30 mL×3) and brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=4:1 to 2:1) to provide tert-butyl N-[4-methylsulfonyl-2-(trifluoromethyl)phenyl]-N-prop-2-ynyl-carbamate (1.7 g, 4.50 mmol, 76.43% yield) as a colorless gum.


Synthesis of 4-(methylsulfonyl)-N-(prop-2-yn-1-yl)-2-(trifluoromethyl)aniline: A solution of tert-butyl N-[4-methylsulfonyl-2-(trifluoromethyl)phenyl]-N-prop-2-ynyl-carbamate (1.7 g, 4.50 mmol, 1 eq.) in HCl/EtOAc (4 M, 34 mL, 30.19 eq.) was stirred at 25° C. for 1 h, after which time TLC analysis (PE:EtOAc=1:1, Rf(starting material)=0.49, Rf(product)=0.27) indicated that the reaction was complete. The reaction was concentrated directly to provide 4-methylsulfonyl-N-prop-2-ynyl-2-(trifluoromethyl)aniline (1.1 g, 3.97 mmol, 88.07% yield) as a white solid.


Example A9
Preparation of 2-chloro-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline



embedded image


Synthesis of (3-chloro-4-nitrophenyl)(methyl)sulfane: To a mixture of 2-chloro-4-fluoro-1-nitro-benzene (10 g, 56.97 mmol, 1 eq.) in DMF (120 mL) was added NaSMe (39.93 g, 113.93 mmol, 36.30 mL, 20% purity, 2 eq.) in one portion at 0° C. under N2. The mixture was stirred at 25° C. for 60 min, after which time TLC analysis (PE:EtOAc=10:1, Rf1=0.66, Rf2=0.55) indicated that the reaction was complete. The reaction was diluted with water (100 mL) and extracted with EtOAc (100 mL×3). The combined organic layers were washed with half-saturated brine (100 mL×5), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=5:1) to provide 2-chloro-4-methylsulfanyl-1-nitro-benzene (4.3 g, 21.12 mmol, 37.07% yield) as a yellow solid.


Synthesis of 2-chloro-4-(methylsulfonyl)-1-nitrobenzene: To a mixture of 2-chloro-4-methylsulfanyl-1-nitro-benzene (4.3 g, 21.12 mmol, 1 eq.) in toluene (25 mL), MeOH (2.5 mL), and water (25 mL) was added potassium peroxymonosulfate (25.96 g, 42.23 mmol, 2 eq.) in one portion at 0° C. under N2. The mixture was stirred at 25° C. for 60 min, after which time TLC (PE:EtOAc=1:1, Rf(sm)=0.63, Rf(pdt)=0.51) indicated that the reaction was complete. The reaction was quenched with saturated Na2S2O3 (200 mL) and extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated to provide crude 2-chloro-4-methylsulfonyl-1-nitro-benzene (5.0 g, crude) as a yellow solid.


Synthesis of 2-chloro-4-(methylsulfonyl)aniline: A mixture of 2-chloro-4-methylsulfonyl-1-nitro-benzene (4.5 g, 19.10 mmol, 1 eq.) in EtOH (40 mL) and a saturated NH4Cl solution (10 mL) was heated to 90° C., and then Fe (3.20 g, 57.29 mmol, 3 eq.) was added in one portion. The reaction mixture was stirred at 90° C. for 1 h, after which time TLC analysis (PE:EtOAc=1:1, Rf(starting material)=0.7, Rf(product)=0.31) indicated that the reaction was complete. The reaction was diluted with water (50 mL) and extracted with EtOAc (100 mL×3). The combined organic layers were washed with water (50 mL×3) and brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=4:1 to 2:1) to provide 2-chloro-4-methylsulfonyl-aniline (3.7 g, 17.99 mmol, 94.21% yield) as an off-white solid.


Synthesis of tert-butyl (2-chloro-4-(methylsulfonyl)phenyl)carbamate: To a mixture of 2-chloro-4-methylsulfonyl-aniline (3.7 g, 17.99 mmol, 1 eq.) and (Boc)2O (4.71 g, 21.59 mmol, 4.96 mL, 1.2 eq.) in THF (50 mL) was added DMAP (2.20 g, 17.99 mmol, 1 eq.) in one portion. The mixture was stirred at 70° C. for 12 h, after which time TLC (PE:EtOAc=1:1, Rf(sm)=0.45, Rf(pdt)=0.66) indicated that some starting primary amine remained in the mixture. The reaction was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with water (30 mL×3) and brine (30 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=4:1 to 2:1) to provide tert-butyl N-(2-chloro-4-methylsulfonyl-phenyl)carbamate (2.7 g, 8.83 mmol, 49.08% yield) as a white solid.


Synthesis of tert-butyl (2-chloro-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate: To a mixture of tert-butyl N-(2-chloro-4-methylsulfonyl-phenyl)carbamate (2.4 g, 7.85 mmol, 1 eq.) in DMF (24 mL) were added Cs2CO3 (7.67 g, 23.55 mmol, 3 eq.) and propargyl bromide (2.80 g, 23.55 mmol, 2.03 mL, 3 eq.). The reaction mixture was stirred for 1.5 h at 25° C., after which time TLC analysis (PE:EtOAc=1:1, Rf(starting material)=0.68, Rf(product)=0.60) indicated that the reaction was complete. The reaction was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with water (30 mL×3) and brine (30 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=4:1 to 3:1) to provide tert-butyl N-(2-chloro-4-methylsulfonyl-phenyl)-N-prop-2-ynyl-carbamate (1.7 g, 4.94 mmol, 62.99% yield) as a colorless gum.


Synthesis of 2-chloro-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline: A solution of tert-butyl N-(2-chloro-4-methylsulfonyl-phenyl)-N-prop-2-ynyl-carbamate (300 mg, 872.54 mmol, 1 eq.) in HCl/EtOAc (4 M, 6.59 L, 30.19 eq.) was stirred at 25° C. for 1 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was directly concentrated to provide crude 2-chloro-4-methylsulfonyl-N-prop-2-ynyl-aniline (180 mg, crude) as a brown solid.


Example A10
Preparation of 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide



embedded image


A mixture of 3-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid (50 mg, 207.11 μmol, 1 eq.), HATU (94.50 mg, 248.53 μmol, 1.2 eq.), and DIPEA (53.53 mg, 414.21 μmol, 72.15 μL, 2 eq.) in DMF (3 mL) was stirred at 25° C. for 15 min, and NH2Me (20.97 mg, 310.66 μmol, 1.5 eq.) was added. The mixture was stirred for 3.75 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched by adding water (40 mL), and the resulting mixture was extracted with EtOAc (10 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, EtOAc:PE=2:1, Rf=0.25) to provide 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (45 mg, 185.57 μmol, 89.60% yield) as a light yellow oil.


Example A11
Preparation of N,N-bis(2-hydroxyethyl)-3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


Synthesis of N,N-bis(2-hydroxyethyl)-3-methoxy-4-nitrobenzenesulfonamide: To a mixture of diethanolamine (835.59 mg, 7.95 mmol, 766.59 μL, 2 eq.) and TEA (804.23 mg, 7.95 mmol, 1.11 mL, 2 eq.) in DCM (10 mL) was added a solution of 3-methoxy-4-nitrobenzenesulfonyl chloride (1 g, 3.97 mmol, 1 eq.) in DCM (5 mL) at 0° C. The reaction was warmed to 25° C. over 1 h with stirring, after which time TLC analysis (PE:EtOAc=1:2, Rf=0.3) indicated that the reaction was complete. The reaction mixture was diluted with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by column chromatography (SiO2, PE:EtOAc=1:2, Rf=0.3) to afford N,N-bis(2-hydroxyethyl)-3-methoxy-4-nitrobenzenesulfonamide (1.2 g, 3.0 mmol, 75.42% yield) as a yellow solid.


Synthesis of 4-amino-N,N-bis(2-hydroxyethyl)-3-methoxybenzenesulfonamide: To a mixture of N,N-bis(2-hydroxyethyl)-3-methoxy-4-nitrobenzenesulfonamide (1.2 g, 3 mmol, 1 eq.) and NH4Cl (801.55 mg, 15 mmol, 523.89 μL, 5 eq.) in EtOH (20 mL) and water (4 mL) at 70° C. was added Fe (836.92 mg, 15 mmol, 5 eq.). The mixture was stirred at 70° C. for 1 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was diluted with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by column chromatography (SiO2, EtOAc, Rf=0.28) to provide 4-amino-N,N-bis(2-hydroxyethyl)-3-methoxybenzenesulfonamide (0.8 g, 2.20 mmol, 73.55% yield) as a yellow oil.


Synthesis of N,N-bis(2-hydroxyethyl)-3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide: A mixture of 4-amino-N,N-bis(2-hydroxyethyl)-3-methoxybenzenesulfonamide (0.1 g, 275.54 μmol, 1 eq.), propargyl bromide (49.17 mg, 413.32 μmol, 35.63 4, 1.5 eq.), and K2CO3 (38.08 mg, 275.54 μmol, 1 eq.) in DMF (2 mL) was stirred at 50° C. for 12 h, after which time LC-MS analysis indicated that the desired product was present in the mixture. The reaction mixture was diluted with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, EtOAc:PE=1:1, Rf=0.31) to afford N,N-bis(2-hydroxyethyl)-3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.05 g, 121.81 μmol, 44.21% yield) as a yellow oil.


Example A12
Preparation of 2-methoxy-4-((4-methylpiperazin-1-yl)sulfonyl)-N-(prop-2-yn-1-yl)aniline



embedded image


Synthesis of 1-((4-fluoro-3-methoxyphenyl)sulfonyl)-4-methylpiperazine: To a solution of N-methylpiperazine (312.12 mg, 3.12 mmol, 345.65 μL, 2 eq.) in DCM (2 mL) was added TEA (315.32 mg, 3.12 mmol, 433.73 4, 2 eq.). The resulting solution was then added into a solution of 4-fluoro-3-methoxybenzenesulfonyl chloride (350 mg, 1.56 mmol, 1 eq.) in DCM (4 mL) dropwise. The reaction mixture was warmed to 25° C. over 2 h with stirring, after which time TLC analysis (PE:EtOAc=1:1, Rf=0.40) indicated that the reaction was complete. The reaction mixture was quenched by adding water (60 mL) at 25° C. and extracted with EtOAc (20 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by column chromatography (SiO2, PE:EtOAc=1:0 to 1:1) to provide 1-((4-fluoro-3-methoxyphenyl)sulfonyl)-4-methylpiperazine (410 mg, 1.35 mmol, 86.70% yield) as a light yellow solid. MS (ES+, m/z): 288.9.


Synthesis of 2-methoxy-4-((4-methylpiperazin-1-yl)sulfonyl)-N-(prop-2-yn-1-yl)aniline: A mixture of 1-((4-fluoro-3-methoxyphenyl)sulfonyl)-4-methylpiperazine (100 mg, 329.47 μmol, 1 eq.), propargylamine (1.72 g, 31.23 mmol, 2 mL, 94.78 eq.), K2CO3 (91.07 mg, 658.95 μmol, 2 eq.), and KF (38.28 mg, 658.95 μmol, 15.44 μL, 2 eq.) was stirred at 100° C. for 12 h in a sealed tube, after which time TLC analysis (PE:EtOAc=1:1, Rf=0.23) detected a new compound. The reaction mixture was quenched by adding water (40 mL) and extracted with EtOAc (10 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) over two runs to provide 2-methoxy-4-((4-methylpiperazin-1-yl)sulfonyl)-N-(prop-2-yn-1-yl)aniline (25 mg, 69.57 μmol, 21.12% yield) as a light yellow solid.


Example A13
Preparation of 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetamide



embedded image


Synthesis of 5-(methylthio)-2-nitrophenol: To a solution of 5-fluoro-2-nitrophenol (5 g, 31.83 mmol, 1 eq.) in DMF (50 mL) was added NaSMe (66.93 g, 190.98 mmol, 60.85 mL, 6 eq.) at 0° C. The mixture was heated to 50° C. for 5 h, after which time HPLC and LC-MS analysis indicated that the reaction was complete. The residue was poured into a saturated aqueous solution of NH4Cl (300 mL), and the aqueous phase was extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (200 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford 5-(methylthio)-2-nitrophenol (5.20 g, crude) as a yellow solid.


Synthesis of 5-(methylsulfonyl)-2-nitrophenol: To a solution of 5-(methylthio)-2-nitrophenol (1 g, 5.40 mmol, 1 eq.) in acetone (10 mL), water (10 mL), and MeOH (1 mL) was added potassium peroxymonosulfate (8.30 g, 13.50 mmol, 2.50 eq.) at 0° C. The mixture warmed to 20° C. and stirred for 5 r h, after which time LC-MS analysis indicated that the reaction was complete. The residue was poured into a saturated aqueous solution of Na2SO3 (50 mL), and 12N HCl (20 mL) was added to adjust the pH of the solution to <7. The aqueous phase was extracted with EtOAc (50 mL×3). The organic phase was dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford 5-(methylsulfonyl)-2-nitrophenol (1.10 g, crude) as a yellow solid.


Synthesis of 2-(5-(methylsulfonyl)-2-nitrophenoxy)acetamide: To a mixture of 5-(methylsulfonyl)-2-nitrophenol (500 mg, 2.30 mmol, 1 eq.) in DMF (10 mL) were added K2CO3 (953.65 mg, 6.90 mmol, 3 eq.), 2-chloroacetamide (537.68 mg, 5.75 mmol, 2.50 eq.), and KI (382.14 mg, 2.30 mmol, 1 eq.). The mixture was stirred at 50° C. for 2 h, after which time HPLC analysis indicated a reactant to product ratio of 1:1. Second portions of 2-chloroacetamide (215.07 mg, 2.30 mmol, 1 eq.), K2CO3 (476.82 mg, 3.45 mmol, 1.50 eq.), and KI (190.90 mg, 1.15 mmol, 0.50 eq.) was added to the reaction, and the resulting mixture was stirred further at 50° C. for 2 h. HPLC analysis indicated a reactant to product ratio of 1:5. The residue was poured into water (30 mL), and the aqueous phase was extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford 2-(5-(methylsulfonyl)-2-nitrophenoxy)acetamide (380 mg, crude) as a yellow solid.


Synthesis of 2-(2-amino-5-(methylsulfonyl)phenoxy)acetamide: To a solution of 2-(5-(methylsulfonyl)-2-nitrophenoxy)acetamide (380 mg, 1.39 mmol, 1 eq.) in EtOH (3 mL) was added NH4Cl (74.12 mg, 1.39 mmol, 48.44 μL, 1 eq.). The mixture was heated to 70° C., and Fe (773.86 mg, 13.86 mmol, 10 eq.) was added. The reaction mixture was stirred at 70° C. for 1 h, after which time HPLC analysis indicated that the reaction was complete. The mixture was poured into water (50 mL), filtered with diatomite, and extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford 2-(2-amino-5-(methylsulfonyl)phenoxy)acetamide (270 mg, crude) as a black brown solid.


Synthesis of 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetamide: To a solution of 2-(2-amino-5-(methylsulfonyl)phenoxy)acetamide (240 mg, 982.52 μmol, 1 eq.) in DMF (8 mL) were added K2CO3 (407.38 mg, 2.95 mmol, 3 eq.) and 3-bromoprop-1-yne (584.40 mg, 4.91 mmol, 423.48 μL, 5 eq.). The mixture was stirred at 70° C. for 3 h, after which time HPLC analysis indicated that 29.5% of the starting primary amine remained and 25.5% of desired compound was detected, with the percent values referring to the peak area. The reaction mixture was poured into water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (DCM:MeOH=10:1, Rf=0.40) to provide 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetamide (80 mg, 276.68 μmol, 28.16% yield) as a light red solid. MS (ES+, m/z): 283.0.


Example A14
Preparation of N-(isoxazol-3-yl)-3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


Synthesis of N-(isoxazol-3-yl)-3-methoxy-4-nitrobenzenesulfonamide: To a solution of 3-methoxy-4-nitrobenzenesulfonyl chloride (2 g, 7.95 mmol, 1 eq.) in pyridine (10 mL) was added isoxazol-3-amine (801.86 mg, 9.54 mmol, 703.39 μL, 1.2 eq.). The mixture was stirred at 20° C. for 2 h, after which time TLC analysis (EtOAc:DCM:PE:TEA=1:1:3:0.5, Rf(starting material)=0.40, Rf(product)=0.04) indicated that the starting material was consumed. The mixture was poured into water (20 mL) and extracted with EtOAc (20 mL×2, 10 mL×1). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography to provide N-(isoxazol-3-yl)-3-methoxy-4-nitrobenzenesulfonamide (6.5 g, 21.72 mmol, 91.10% yield) as a black brown oil. MS (ES+, m/z): 300.0.


Synthesis of N-(isoxazol-3-yl)-3-methoxy-4-nitro-N-42-(trimethylsilyl)ethoxy)methyl)benzene sulfonamide: To a solution of N-(isoxazol-3-yl)-3-methoxy-4-nitrobenzenesulfonamide (2 g, 6.68 mmol, 1 eq.) in THF (20 mL) was added NaH (534.60 mg, 13.37 mmol, 60% in mineral oil, 2 eq.) at 0° C. under N2. The mixture was stirred at 0° C. for 30 mins, and (2-(chloromethoxy)ethyl)trimethylsilane (SEMCl) (1.67 g, 10.02 mmol, 1.77 mL, 1.5 eq.) was added. The resulting mixture was stirred at 0° C. for 1 h, after which time TLC analysis (PE:EtOAc=3:1, Rf(starting material)=0.60, Rf(product)=0.35) indicated that the reaction was complete. The residue was poured into water (100 mL), and the aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EtOAc=1:0 to 10:1 to afford N-(isoxazol-3-yl)-3-methoxy-4-nitro-N-((2-(trimethylsilyl)ethoxy)methyl)benzenesulfonamide (1.8 g, 3.98 mmol, 59.57% yield) as a black brown oil.


Synthesis of 4-amino-N-(isoxazol-3-yl)-3-methoxy-N-42-(trimethylsilyl)ethoxy)methyl) benzenesulfonamide: To a solution of N-(isoxazol-3-yl)-3-methoxy-4-nitro-N-((2-(trimethylsilyl) ethoxy)methyl)benzenesulfonamide (1.8 g, 3.98 mmol, 1 eq.) in EtOH (10 mL) was added saturated solution of NH4Cl (0.5 mL). The mixture was heated to 70° C., Fe (2.22 g, 39.81 mmol, 10 eq.) was added, and the mixture was stirred further at 70° C. for 2 h. TLC analysis (PE:EtOAc=3:1, Rf=0.35) indicated that the reaction was complete. The mixture was poured into a saturated aqueous solution of NaHCO3 (100 mL), filtered with diatomite, and extracted with EtOAc (60 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EtOAc=1:0 to 3:1) to afford 4-amino-N-(isoxazol-3-yl)-3-methoxy-N-((2-(trimethylsilyl)ethoxy)methyl)benzenesulfonamide (1 g, 2.25 mmol, 56.58% yield) as a black brown oil.


Synthesis of N-(isoxazol-3-yl)-3-methoxy-4-(prop-2-yn-1-ylamino)-N-((2-(trimethylsilyl) ethoxy)methyl)benzenesulfonamide: To a mixture of 4-amino-N-(isoxazol-3-yl)-3-methoxy-N-((2-(trimethylsilyl)ethoxy)methyl)benzenesulfonamide (450 mg, 1.01 mmol, 1 eq.) in CHCl3 (10 mL) was added DIEA (655.04 mg, 5.07 mmol, 882.80 4, 5 eq.). The mixture was heated to 70° C., propargyl bromide (241.17 mg, 2.03 mmol, 174.76 4, 2 eq.) was added, and the mixture was stirred further for 12 h. LC-MS and HPLC analysis indicated that 58% of the starting primary amine remained and 11% of the product was detected, with the percent values referring to the peak area. An additional portion of propargyl bromide (602.93 mg, 5.07 mmol, 436.91 μL, 5 eq.) was added, and the mixture was stirred further at 70° C. for 6 h. LC-MS and HPLC analysis indicated that 15% of the starting primary amine remained and 45% of the desired product was detected, with the percent values referring to the peak area. The mixture was poured into water (30 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EtOAc=1:0 to 10:1 to afford N-(isoxazol-3-yl)-3-methoxy-4-(prop-2-yn-1-ylamino)-N-((2-(trimethylsilyl)ethoxy)methyl)benzenesulfonamide (340 mg, 568.29 μmol, 56% yield) as a yellow oil.


Synthesis of N-(isoxazol-3-yl)-3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide: To a solution of N-(isoxazol-3-yl)-3-methoxy-4-(prop-2-yn-1-ylamino)-N-((2-(trimethylsilyl)ethoxy)methyl)benzenesulfonamide (280 mg, 468.01 μmol, 1 eq.) in DCM (4 mL) was added TFA (1 mL). The mixture was stirred at 20° C. for 12 h, after which time LC-MS and HPLC analysis indicated that the reaction was complete. The mixture was poured into a saturated aqueous solution of NaHCO3 (40 mL) and extracted with EtOAc (25 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EtOAc=1:0 to 3:1) to afford N-(isoxazol-3-yl)-3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (150 mg, 379.50 μmol, 81% yield) as a yellow solid.


Example A15
Preparation of N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


Synthesis of N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-nitrobenzenesulfonamide. To a mixture of 3-methoxy-4-nitrobenzenesulfonyl chloride (2.5 g, 9.93 mmol, 1 eq.) and 2-(methylamino)ethan-1-ol (969.59 mg, 12.91 mmol, 1.04 mL, 1.3 eq.) in DCM (25 mL) was added TEA (5.03 g, 49.65 mmol, 6.91 mL, 5 eq.) at 25° C. The mixture was stirred at 25° C. for 12 h, after which time LC-MS analysis indicated that the reaction was complete. The mixture was poured into water (100 mL) and extracted with DCM (80 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-nitrobenzenesulfonamide (2.1 g, crude) as a black brown oil. MS (ES+, m/z): 291.1.


Synthesis of 4-amino-N-(2-hydroxyethyl)-3-methoxy-N-methylbenzenesulfonamide: N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-nitrobenzenesulfonamide (2.1 g, 7.23 mmol, 1 eq.) dissolved in AcOH (20 mL), and the mixture was heated to 70° C. Fe (4.04 g, 72.34 mmol, 10 eq.) was then added, and the mixture was stirred further at 70° C. for 2 h, after which time LC-MS analysis indicated that the reaction was complete. The residue was poured into a saturated aqueous solution of NaHCO3 (500 mL), filtered with diatomite, and extracted with EtOAc (300 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography to afford 4-amino-N-(2-hydroxyethyl)-3-methoxy-N-methylbenzenesulfonamide (1.8 g, 6.22 mmol, 86% yield) as a black brown solid. MS (ES+, m/z): 261.2.


Synthesis of N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino) benzenesulfonamide. To a mixture of 4-amino-N-(2-hydroxyethyl)-3-methoxy-N-methylbenzenesulfonamide (500 mg, 1.73 mmol, 1 eq.) in CHCl3 (5 mL) was added DIPEA (1.12 g, 8.64 mmol, 1.51 mL, 5 eq.). The mixture was heated to 70° C., and propargyl bromide (1.03 g, 8.64 mmol, 745.10 μL, 5 eq.) was added. The mixture was stirred at 70° C. for 12 h, after which time HPLC and LC-MS analysis indicated that 12.6% of the starting material remained, 68.1% of the product was detected, and 7.7% of a byproduct were detected (percent values refer to peak areas). The mixture was poured into water (60 mL) and extracted with EtOAc (60 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography, (column height: 250 mm, diameter: 100 mm, 100-200 mesh silica gel) concentrated, dissolved in PE:EtOAc=1:1 (20 mL), and heated to 70° C. Additional EtOAc (5 mL) was added to dissolve any remaining solids, and the mixture was stirred further for 1 h. The mixture was cooled to 25° C., and the resulting solid precipitate was filtered. The mother liquor was subjected to two rounds of prep-HPLC, then combine two parts to afford N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.28 g, 50.0% yield) as a yellow solid. MS (ES+, m/z): 299.1.


Example A16
Preparation of 3-methoxy-N-(5-methylisoxazol-3-yl)-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


3-methoxy-N-(5-methylisoxazol-3-yl)-4-(prop-2-yn-1-ylamino)benzenesulfonamide was prepared via a procedure analogous to the synthesis of N-(isoxazol-3-yl)-3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide according to EXAMPLE A14, using 5-methylisoxazol-3-amine in place of isoxazol-3-amine.


Example A17
Preparation of 2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline hydrochloride



embedded image


Synthesis of N,N-dimethyl-2-(5-(methylsulfonyl)-2-nitrophenoxy)ethan-1-amine: To a mixture of 5-(methylsulfonyl)-2-nitrophenol (prepared according to the first two steps of EXAMPLE A13) (200 mg, 920.81 μmol, 1 eq.) in THF (10 mL) were added KI (29.96 mg, 180.48 μmol, 0.196 eq.), 2-chloro-N,N-dimethyl-ethanamine (213.54 mg, 1.48 mmol, 1.61 eq., HCl), and Cs2CO3 (738.05 mg, 2.27 mmol, 2.46 eq.). The mixture was stirred at 70° C. for 16 h, after which time HPLC analysis indicated a reactant:product ratio of 4:1. The mixture was poured into water (40 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide N,N-dimethyl-2-(5-(methylsulfonyl)-2-nitrophenoxy)ethan-1-amine (300 mg, crude) as a yellow oil. MS (ES+, m/z): 288.9.


Synthesis of 2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)aniline: To a solution of N,N-dimethyl-2-(5-(methylsulfonyl)-2-nitrophenoxy)ethan-1-amine (0.5 g, 1.73 mmol, 1 eq.) in MeOH (50 mL) was added Pd/C (50 mg, 227.18 mmol, 15% purity, 131 eq.). The mixture was degassed and purged with H2 (349.59 ug, 173.42 μmol, 2.33e-2 μL) and stirred under H2 (50 psi) at 20° C. for 12 h, after which time LC-MS analysis indicated that the reaction was complete. The mixture was poured into MeOH (100 mL), filtered with diatomite, and concentrated to provide 2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)aniline (450 mg, crude) as a black brown oil. MS (ES+, m/z): 259.1.


Synthesis of tert-butyl (tert-butoxycarbonyl)(2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)phenyl)carbamate: To a solution of 2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)aniline (200 mg, 774.18 μmol, 1 eq.) in dioxane (7 mL) were added Boc2O (1.01 g, 4.65 mmol, 1.07 mL, 6 eq.) and DMAP (94.58 mg, 774.18 μmol, 1 eq.). The reaction was then stirred at 110° C. for 16 h, after which time LC-MS analysis indicated that the reaction was complete. The mixture was poured into water (50 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide tert-butyl (tert-butoxycarbonyl)(2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)phenyl)carbamate (550 mg, crude) as a black brown oil. MS (ES+, m/z): 459.1.


Synthesis of tert-butyl (2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)phenyl)carbamate: To a solution of tert-butyl (tert-butoxycarbonyl)(2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)phenyl)carbamate (550 mg, 1.20 mmol, 1 eq.) in MeOH (10 mL) was added K2CO3 (497.29 mg, 3.60 mmol, 3 eq.). The resulting mixture was stirred at 40° C. for 4 h, after which time LC-MS analysis indicated that the reaction was complete. The mixture was concentrated in vacuo, diluted with EtOAc (30 mL) and water (30 mL), and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, DCM to DCM:MeOH=10:1) to provide tert-butyl (2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)phenyl)carbamate (210 mg, 535.18 μmol, 44.6% yield) as a yellow oil. MS (ES+, m/z): 359.1.


Synthesis of tert-butyl (2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate: To a mixture of tert-butyl (2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)phenyl)carbamate (50 mg, 127.42 μmol, 1 eq.) in DMF (1.5 mL) was added NaH (10.19 mg, 254.85 μmol, 60% in mineral oil, 2 eq.) at 0° C. The mixture was stirred at 0° C. for 0.5 h, and a solution of propargyl bromide (22.74 mg, 191.13 μmol, 16.48 μL, 1.5 eq.) in DMF (0.5 mL) was then added dropwise. The mixture was stirred for a further 1 h at 0° C., after which time a new spot was observed upon TLC analysis (DCM:MeOH=20:1, Rf(starting material)=0.23, Rf(product)=0.17). The mixture was poured into a saturated aqueous solution of NH4Cl (10 mL), EtOAc (10 mL) was added, and the resulting mixture was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC to provide tert-butyl (2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate (35 mg, 80.26 μmol, 31.5% yield) as a yellow oil. MS (ES+, m/z): 397.4.


Synthesis of 2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline hydrochloride: A solution of tert-butyl (2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate (35 mg, 80.26 μmol, 1 eq.) in HCl/EtOAc (4 M, 20.06 μL) was stirred at 15° C. for 1 h, after which time HPLC and LC-MS analysis indicated that the reaction was complete. The mixture was concentrated in vacuo to provide 2-(2-(dimethylamino)ethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline hydrochloride (30 mg, crude) as a yellow oil. MS (ES+, m/z): 296.9.


Example A18
Preparation of 2-methoxy-4-(morpholinosulfonyl)-N-(prop-2-yn-1-yl)aniline



embedded image


2-Methoxy-4-(morpholinosulfonyl)-N-(prop-2-yn-1-yl)aniline was prepared via a procedure analogous to the synthesis of N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide according to EXAMPLE A15, using morpholine in place of 2-(methylamino)ethan-1-ol. MS (ES+, m/z): 311.1.


Example A19
Preparation of 1-(4-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl) sulfonyl)piperazin-1-yl)ethan-1-one



embedded image


1-(4-((3-methoxy-4-(prop -2-yn-1-ylamino)phenyl)sulfonyl)piperazin-1-yl)ethan-1-one was prepared via a procedure analogous to the synthesis of N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide according to EXAMPLE A15, using N-acetylpiperazine in place of 2-(methylamino)ethan-1-ol.


Example A20
Preparation of N-(2,3-dihydroxypropyl)-3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


N-(2,3-dihydroxypropyl)-3-methoxy-4-(prop -2-yn -1-ylamino)benzene sulfonamide was prepared via a procedure analogous to the synthesis of N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide according to EXAMPLE A15, using (rac)-3-aminopropane-1,2-diol in place of 2-(methylamino)e than-1-ol.


Example A21
Preparation of 2-(fluoromethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline



embedded image


To a solution of 5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenol (400 mg, 1.60 mmol, 1 eq.) in DMF (8 mL) were added K2CO3 (662.61 mg, 4.79 mmol, 3 eq.) and bromo(fluoro)methane (360.95 mg, 3.20 mmol, 2 eq.) in one portion under N2. The mixture was stirred at 40° C. for 60 min. TLC and LC-MS analysis showed that the reaction was complete. The reaction was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with water (30 mL×3) and brine (30 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=1.5:1 to 1:1) to afford the desired product (320 mg, 1.24 mmol, 77.83% yield) as a pink solid. MS (ES+, m/z): 258.0.


Example A22
Preparation of methyl 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetate



embedded image


To a solution of 5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino) phenol (0.3 g, 1.3 mmol, 1 eq.) in acetonitrile (5 mL) were added K2CO3 (552.18 mg, 4 mmol, 3 eq.) and methyl 2-bromoacetate (1.5 eq.). Then the mixture was stirred for 0.5 h at 40° C. under N2. TLC analysis showed that the reaction was complete. The reaction was quenched with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with saturate brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (SiO2, DCM:MeOH=1:0) to afford the desired product as a yellow solid. 75.8% yield, MS (ES+, m/z): 298.1.


Example A23
Preparation of 6-(methylsulfonyl)-3-(prop-2-yn-1-yl)benzo[d]oxazol-2(3H)-one



embedded image


To a solution of 5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenol (0.9 g, 4 mmol, 1 eq.) in DMF (9 mL) was added CDI (777.40 mg, 4.79 mmol, 1.2 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h and then at 80° C. for 1 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the mass of the desired product was detected. The mixture was poured into water (50 mL), and the resulting mixture was extracted with DCM (20 mL×3). The combined organic layers were washed with water (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude residue was lyophilized to afford the desired product (1 g, crude) as a yellow solid. MS (ES+, m/z): 252.0.


Example A24
Synthesis of (3R,4R)-3-methoxy-N-(prop-2-yn-1-yl)tetrahydro-2H-pyran-4-amine



embedded image


To a solution of (3R)-3-methoxytetrahydropyran-4-amine (0.1 g, 596.54 μmol, 1 eq., HCl) in CH3CN (2 mL) were added K2CO3 (0.5 g, 3.62 mmol, 6 eq.) and 3-bromoprop-1-yne (56.77 mg, 477.23 μmol, 41.14 μL, 0.8 eq.). The mixture was stirred at 25° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction was concentrated under reduced pressure and purified by prep-TLC (SiO2, DCM:MeOH=20:1) to afford the desired product (0.029 g, 145.67 μmol, 24.4% yield) as a yellow oil. MS (ES+, m/z): 170.2.


Example A25
Synthesis of 2-fluoro-5-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid



embedded image


Preparation of 2-fluoro-5-methoxy-4-nitrobenzoic acid: To a solution of 2,5-difluoro-4-nitro-benzoic acid (5 g, 24.62 mmol, 1 eq.) in MeOH (60 mL) was added a solution of KOH (4.14 g, 73.86 mmol, 3 eq.) in MeOH (20 mL) dropwise. The mixture was heated at reflux for 2 h (oil bath temperature: 80° C.). The resulting mixture was stirred at 80° C. for 2 h. LC-MS analysis showed that the reaction was complete. 2 N HCl was added to the reaction mixture at 20° C. to adjust the pH of the mixture to 2. The mixture was then concentrated to remove MeOH. The residue was extracted with water (100 mL) and EtOAc (100 mL×3). The organic layer was washed with brine (100 mL), dried over anhydrous sodium sulfate, filtered, and concentrated to afford the crude product (5.2 g, crude) as a yellow solid.


Preparation of methyl 2-fluoro-5-methoxy-4-nitrobenzoate: A solution of 2-fluoro-5-methoxy-4-nitrobenzoic acid (0.3 g, 1.39 mmol, 1 eq.) in HCl/MeOH (10 mL) was stirred at 25° C. for 3 h until a yellow solid formed. LC-MS analysis showed that the reaction was complete. The reaction was concentrated under reduced pressure to afford the desired product (0.3 g, 1.24 mmol, 89.2% yield) as a yellow solid.


Preparation of methyl 4-amino-2-fluoro-5-methoxybenzoate: To a mixture of methyl 2-fluoro-5-methoxy-4-nitro-benzoate (0.3 g, 1.24 mmol, 1 eq.) in EtOH (3 mL) and saturated aqueous NH4Cl (1 mL) at 90° C. was added Fe (347.26 mg, 6.22 mmol, 5 eq.). The mixture was stirred at 90° C. for 1 h. TLC analysis showed that the reaction was complete. The mixture was extracted with EtOAc (20 mL×3). The organic layer was washed with brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=3:1) to afford the desired product (0.22 g, 994.08 μmol, 79.93% yield) as an orange solid.


Preparation of methyl 4-((tert-butoxycarbonyl)amino)-2-fluoro-5-methoxybenzoate: To a solution of methyl 4-amino-2-fluoro-5-methoxy-benzoate (200 mg, 903.71 μmol, 1 eq.) in di-tert-butyl-dicarbonate (4.75 g, 21.76 mmol, 5 mL, 24.08 eq.) was stirred at 110° C. for 6 h. LC-MS analysis showed that some starting material remained. The reaction mixture was concentrated under reduced pressure and purified by prep-TLC (SiO2, PE:EtOAc=4:1) to afford the desired product (0.23 g, 691.63 μmol, 76.53% yield) as a white solid. MS (ES+, m/z): 300.2.


Preparation of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoate: To a solution of methyl 4-((tert-butoxycarbonyl)amino)-2-fluoro-5-methoxybenzoate (0.2 g, 601.42 μmol, 1 eq.) in DMF (4 mL) were added Cs2CO3 (587.86 mg, 1.80 mmol, 3 eq.) and 3-bromoprop-1-yne (143.09 mg, 1.20 mmol, 103.69 μL, 2 eq.). The reaction mixture was stirred at 40° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was poured into EtOAc (15 mL) and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (15mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=5:1) to afford the desired product (0.18 g, 480.22 μmol, 79.85% yield) as a white oil.


Preparation of 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoic acid: To a solution of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoate (0.16 g, 426.87 μmol, 1 eq.) in THF (1 mL), MeOH (1 mL), and water (1 mL) was added lithium hydroxide hydrate (53.74 mg, 1.28 mmol, 3 eq.). The mixture was stirred at 25° C. for 1 h. TLC analysis showed that the reaction was complete. 1M HCl was added to adjust the pH of the reaction mixture to 2. The mixture was extracted with EtOAc (20 mL×3). The organic layer was washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to obtain the crude product (0.14 g, crude) as a white solid. The crude product was used without purification.


Preparation of 2-fluoro-5-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid: A solution of 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoic acid (0.15 g, 463.94 μmol, 1 eq.) in 4N HCl/EtOAc (6 mL, 51.73 eq.) was stirred at 25° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction was concentrated under reduced pressure to obtain the crude product (0.1 g, crude, HCl) as a yellow solid. The crude product was used without purification. MS (ES+, m/z): 222.0.


Example A26
Preparation of (3S)-3-methoxy-N-(prop-2-yn-1-yl)tetrahydro-2H-pyran-4-amine



embedded image


To a solution of (3S)-3-methoxytetrahydro-2H-pyran-4-amine (0.5 g, 3.81 mmol, 1 eq.) in CH3CN (8 mL) was added K2CO3 (1.58 g, 11.44 mmol, 3 eq.). The mixture was stirred at 25° C., and 3-bromoprop-1-yne (362.76 mg, 3.05 mmol, 262.87 μL, 0.8 eq.) was added to the solution. The resulting reaction mixture was stirred at 25° C. for 3 h. TLC analysis showed that the reaction was complete, and some starting material remained. The reaction was filtered and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 5:1) to afford the desired product (0.33 g, 1.76 mmol, 46.04% yield) as a yellow oil. MS (ES+, m/z): 170.1.


Example A27
Synthesis of 2-(COOR)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline



embedded image


To a solution of 5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenol (1 eq.) in DCM (5 mL) were added pyridine (1 eq.) and R-anhydride (1 eq.). The mixture was stirred at 25° C. for 2 h. LC-MS analysis showed the desired product. The reaction mixture was quenched by adding water (100 mL) at 0° C. and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=PE:EtOAc=1:1, Rf=0.5) to afford the desired product.


Example A28
Synthesis of 4-(methylsulfonyl)-N-(prop-2-yn-1-yl)-2-(trifluoromethoxy)aniline



embedded image


Preparation of 4-(methylsulfonyl)-2-(trifluoromethoxy)aniline: To a mixture of 4-bromo-2-(trifluoromethoxy)aniline (5 g, 19.53 mmol, 2.96 mL, 1 eq.) and sodium methylsulfate (5.98 g, 58.59 mmol, 3 eq.) in DMSO (50 mL) were added L-proline (1.12 g, 9.76 mmol, 0.5 eq.) and CuI (1.49 g, 7.81 mmol, 0.4 eq.). The reaction mixture was stirred at 100° C. for 16 h under N2. TLC analysis showed that some of the starting material remained. The mixture was stirred at 20° C. for 1 h and was extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:1) to afford the desired product (2.6 g, 10.19 mmol, 52.16% yield) as a white solid.


Preparation of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl) carbamate: To a solution of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl) carbamate (500 mg, 1.76 mmol, 1 eq.) in THF (10 mL) were added Boc2O (461.78 mg, 2.12 mmol, 486.09 μL, 1.2 eq.) and DMAP (258.49 mg, 2.12 mmol, 1.2 eq.). The reaction mixture was stirred at 70° C. for 1 h. TLC and LC-MS analysis showed that the reaction was complete. The reaction was diluted with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:1) to afford tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)carbamate (900 mg, 1.98 mmol, 112.07%yield) and N,N-di(tert-butoxycarbonyl)-4-(methylsulfonyl)-2-(trifluoromethoxy)aniline (900 mg, 2.53 mmol, 143.65% yield) as a white solid.


A mixture of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)carbamate (700 mg, 1.54 mmol, 1 eq.), N,N-di(tert-butoxycarbonyl)-4-(methylsulfonyl)-2-(trifluoromethoxy)aniline (700 mg, 1.97 mmol, 1.28 eq.), and K2CO3 (637.25 mg, 4.61 mmol, 3 eq.) in MeOH (18 mL) was stirred at 40° C. for 2 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was filtered and concentrated under reduced pressure to give the crude product (1 g) as a light yellow solid.


Preparation of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)(prop-2-yn-1-yl)carbamate: To the solution of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl) carbamate (0.8 g, 2.25 mmol, 1 eq.) in DMF (20 mL) were added Cs2CO3 (2.20 g, 6.75 mmol, 3 eq.) and 3-bromoprop-1-yne (803.49 mg, 6.75 mmol, 582.24 μL, 3 eq.) at 25° C. The mixture was stirred for 1 h. TLC and LC-MS showed that the reaction was complete. The reaction was diluted with water (20 mL) and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by column chromatography (SiO2, DCM:MeOH=10:1) to afford the desired product (0.65 g, 1.49 mmol, 66.05% yield) as a yellow solid.


Preparation of 4-(methylsulfonyl)-N-(prop-2-yn-1-yl)-2-(trifluoromethoxy)aniline: A solution of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)(prop-2-yn-1-yl)carbamate (650 mg, 1.49 mmol, 1 eq.) in HCl/EtOAc (4 M, 13.50 mL, 36.31 eq.) was stirred at 25° C. for 0.5 h. LC-MS analysis showed that the reaction was complete. The reaction was diluted with EtOAc (10 mL) and concentrated in vacuo. The desired product (340 mg, crude, HCl) was obtained as a yellow solid. MS (ES+, m/z): 291.9.


Example A29
Synthesis of 2-methyl-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline



embedded image


To a solution of 2-methyl-4-(methylsulfonyl)aniline (1 g, 5.40 mmol, 1 eq.) in DMF (10 mL) were added K2CO3 (2.24 g, 16.19 mmol, 3 eq.) and 3-bromoprop-1-yne (642.18 mg, 5.40 mmol, 465.35 μL, 1 eq.) at 70° C. The mixture was stirred at 70° C. for 12 h. TLC analysis showed that some of the starting material remained. The reaction was poured into water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:1) to afford the desired product (0.5 g, 2.02 mmol, 37.33% yield) as a yellow solid. MS (ES+, m/z): 224.1.


Example A30
Synthesis of 2-fluoro-5-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide



embedded image


Preparation of 2-fluoro-5-methoxy-4-nitrobenzoic acid: To a solution of 2,5-difluoro-4-nitro-benzoic acid (4 g, 19.69 mmol, 1 eq.) in MeOH (64 mL) was added a solution of KOH (3.31 g, 59.08 mmol, 3 eq.; dropwise addition) in MeOH (16 mL) at 80° C. The resulting mixture was stirred at 80° C. for 2 h. HPLC analysis showed that the reaction was complete. To the solution was added 2 N HCl at 20° C. to adjust the pH of the mixture to 2. The mixture was concentrated to remove MeOH, and the residue was extracted with water (30 mL) and EtOAc (40 mL×3). The organic layer was washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated. The crude product (4 g, 18.59 mmol, 94.41% yield) was obtained as a yellow solid and used without purification.


Preparation of 4-amino-2-fluoro-5-methoxybenzoic acid: A mixture of 2-fluoro-5-methoxy-4-nitrobenzoic acid (4 g, 18.59 mmol, 1 eq.) and Pd/C (2 g, 1.88 mmol, 10% purity, 1.01e-1 eq.) in MeOH (50 mL) was degassed and purged with N2 three times and stirred at 20° C. for 5 h under H2 (15 Psi). LC-MS and HPLC analysis showed that the reaction was complete. The mixture was filtered through silica gel, and the filtrate was concentrated. The crude residue (3.5 g, 17.01 mmol, 91.50% yield) was obtained as a yellow solid and used without purification. MS (ES+, m/z): 184.2.


Preparation of 4-amino-2-fluoro-5-methoxy-N-methylbenzamide: A mixture of 4-amino-2-fluoro-5-methoxybenzoic acid (2 g, 10.80 mmol, 1 eq.), methanamine hydrochloride (1.46 g, 21.60 mmol, 2 eq.), HOBt (2.19 g, 16.20 mmol, 1.5 eq.), EDCI (3.11 g, 16.20 mmol, 1.5 eq.), and TEA (4.37 g, 43.21 mmol, 6 mL, 4 eq.) in DCM (30 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 2 h under N2. LC-MS analysis showed that the reaction was complete. The mixture was extracted with water (30 mL) and DCM (50 mL×5). The organic layer was washed with brine (40 mL), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1) to obtain the desired product (1.1 g, 5 mmol, 46.24% yield) as a white solid. MS (ES+, m/z): 199.1.


Preparation of 2-fluoro-5-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide: A mixture of 4-amino-2-fluoro-5-methoxy-N-methylbenzamide (0.7 g, 3.18 mmol, 1 eq.), 3-bromoprop-1-yne (2.27 g, 19.07 mmol, 1.64 mL, 6 eq.), and K2CO3 (1.32 g, 9.54 mmol, 3 eq.) in DMF (10 mL) was degassed and purged with N2 three times, and the mixture was stirred at 105° C. for 12 h under N2. TLC analysis showed that the starting material was consumed. The reaction mixture was extracted with water (60 mL) and EtOAc (40 mL×3). The organic layer was washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=5:1 to 3:1) to obtain the desired product (0.6 g, 1.78 mmol, 55.93% yield) as a yellow solid.


Example A31
Synthesis of 2-amino-N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl) acetamide



embedded image


Preparation of tert-butyl (2-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonamido)-2-oxoethyl)carbamate: To a solution of (tert-butoxycarbonyl)glycine (437.45 mg, 2.50 mmol, 70.16 μL, 2 eq.) in DCM (6 mL) were added HATU (949.47 mg, 2.50 mmol, 2 eq.) and TEA (252.68 mg, 2.50 mmol, 347.57 μL, 2 eq.). The mixture was stirred at 25° C. for 0.5 h. 3-Methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (300 mg, 1.25 mmol, 1 eq.) was then added to the reaction, and the mixture was stirred at 25° C. for 2 h. TLC analysis showed that 40% of the starting material remained. Second portions of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (437.45 mg, 2.50 mmol, 2 eq.), HATU (949.47 mg, 2.50 mmol, 2 eq.), and TEA (252.68 mg, 2.50 mmol, 347.57 μL, 2 eq.) were added to the reaction, and the mixture was stirred further at 25° C. for 10 h. TLC analysis showed that the starting material was consumed. The mixture was poured into water (10 mL), and the aqueous phase was extracted with DCM (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography (PE:EtOAc=1:1 to 1:2) to afford the desired product (560 mg, 845.40 μmol, 67.71% yield) as a colorless oil.


Preparation of 2-amino-N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)acetamide: tert-Butyl (2-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonamido)-2-oxoethyl)carbamate (490 mg, 739.72 μmol, 1 eq.) was dissolved in 4N HCl in EtOAc (5 mL) and the solution was stirred at 25° C. for 1 h. LC-MS analysis showed that the reaction was complete. The residue was concentrated in vacuo to afford the crude product (350 mg, crude) as a white solid. MS (ES+, m/z): 298.1.


Example A32
Synthesis of 4-methoxy-N-prop-2-ynyl-pyridin-3-amine



embedded image


Preparation of tert-butyl N-tert-butoxycarbonyl-N-(4-methoxy-3-pyridyl)carbamate: To a solution of 4-methoxypyridin-3-amine (810 mg, 6.52 mmol, 1 eq.) in THF (25 mL) was added LiHMDS (1 M, 399.55 μL, 2.48 eq.). The solution was purged with N2 three times, and the mixture was stirred at 0° C. for 30 mins under N2. Then, Boc2O (2.85 g, 13.04 mmol, 3 mL, 2 eq.) was added to the reaction, and the mixture was stirred at 0° C. for 2 h under N2. TLC analysis showed that the starting material was partially consumed, and one spot for the desired product was detected. The reaction mixture was poured into a saturated NH4Cl solution (100 mL) and was extracted with EtOAc (50 mL×1, then 25 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford tert-butyl N-tert-butoxycarbonyl-N-(4-methoxy-3-pyridyl)carbamate (1.5 g, crude) as a yellow oil.


Preparation of tert-butyl N-(4-methoxy-3-pyridyl)carbamate: A mixture of tert-butyl N-tert-butoxycarbonyl-N-(4-methoxy-3-pyridyl)carbamate (1.50 g, 4.62 mmol, 1 eq.) and K2CO3 (639.13 mg, 4.62 mmol, 1 eq.) in MeOH (2 mL) was degassed and purged with N2 three times. The mixture was stirred at 50° C. for 16 h under N2. TLC analysis showed that the starting material was consumed, and one spot for the desired product was observed. The mixture was poured into water (100 mL) and extracted with EtOAc (50 mL×1, then 25 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was purified by column chromatography to afford tert-butyl N-(4-methoxy-3-pyridyl)carbamate (1 g, 4.01 mmol, 86.87% yield) as a yellow oil.


Preparation of tert-butyl N-(4-methoxy-3-pyridyl)-N-prop-2-ynyl-carbamate: A mixture of tert-butyl N-(4-methoxy-3-pyridyl)carbamate (500 mg, 2.23 mmol, 1 eq.) and NaH (160.56 mg, 6.69 mmol, 3 eq., 60% in mineral oil) in THF (25 mL) was stirred at 0° C. for 1 h under N2. Then, 3-bromoprop-1-yne (530.46 mg, 4.46 mmol, 384.39 μL, 2 eq.) was added, and the resulting mixture was stirred at 0° C. for 1 h under N2. TLC analysis showed that the starting material was consumed, and one new spot for the desired product was observed. The mixture was poured into water (100 mL) and extracted with EtOAc (50 mL×1, then 25 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was purified by column chromatography (PE:EtOAc=2:1) to afford tert-butyl N-(4-methoxy-3-pyridyl)-N-prop-2-ynyl-carbamate (200 mg, 762.49 μmol, 34.19% yield) as a yellow oil.


Preparation of 4-methoxy-N-prop-2-ynyl-pyridin-3-amine: To a solution of tert-butyl N-(4-methoxy-3-pyridyl)-N-prop-2-ynyl-carbamate (200 mg, 762.49 μmol, 1 eq.) in EtOH (10 mL) was added HCl/EtOAc (4 M, 190.62 μL, 1 eq.). The solution was purged with N2 three times and stirred at 25° C. for 2 h under N2. TLC analysis showed that the starting material was consumed, and one spot for the desired product was observed. The mixture was concentrated under reduced pressure to afford 4-methoxy-N-prop-2-ynyl-pyridin-3-amine (150 mg, 755.10 μmol, 99.03% yield, HCl) as a yellow solid. The desired product was used without further purification.


Example A33
Synthesis of 2-methoxy-N-prop-2-ynyl-4-(trifluoromethyl)aniline



embedded image


Synthesis of 2-methoxy-1-nitro-4-(trifluoromethyl)benzene: To a solution of 2-fluoro-1-nitro-4-(trifluoromethyl) benzene (23 g, 110 mmol, 1 eq.) in MeOH (350 mL) was added a solution of KOH (18.51 g, 329.99 mmol, 3 eq.) in MeOH (100 mL) at 80° C. The resulting mixture was stirred at 80° C. for 2 h. TLC analysis (Rf(product)=0.6, PE:EtOAc=5:1) showed that the starting material was consumed, and that a new spot had formed. 2 N HCl was added to the reaction mixture to adjust the pH of the mixture to 2. The solution was then concentrated. The crude residue was washed with water (150 mL) and extracted with EtOAc (300 mL×2). The organic layer was washed with brine (15 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford 2-methoxy-1-nitro-4-(trifluoromethyl)benzene (22.5 g, 91.57 mmol, 83.25% yield) as a yellow solid. The crude residue was used directly without any purification.


Synthesis of 2-methoxy-4-(trifluoromethyl)aniline: To a solution of 2-methoxy-1-nitro-4-(trifluoromethyl)benzene (23.8 g, 96.86 mmol, 1 eq.) in EtOH (300 mL) and saturated NH4Cl (100 mL) was added Fe (27.05 g, 484.32 mmol, 5 eq.) in several portions at 70° C. over 10 min. The resulting mixture was stirred at 70° C. for 0.5 h. TLC analysis (Rf(product)=0.50, PE:EtOAc=5:1) showed that the reaction was complete. The reaction mixture was poured into EtOAc (1500 mL), and the resulting mixture was washed with water (500 mL) and extracted with EtOAc (300 mL×2). The organic layer was washed with brine (200 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford 2-methoxy-4-(trifluoromethyl)aniline (19 g, 89.46 mmol, 92.35% yield) as a yellow oil. The residue was used directly without any purification.


Synthesis of 2-methoxy-N-prop-2-ynyl-4-(trifluoromethyl)aniline: A mixture of 2-methoxy-4-(trifluoromethyl)aniline (1 g, 5.23 mmol, 1 eq.), 3-bromoprop-1-yne (3.11 g, 26.16 mmol, 2.25 mL, 5 eq.), K2CO3 (2.17 g, 15.69 mmol, 3 eq.) was prepared in DMF (10 mL). The mixture was degassed and purged with N2 three times, and the mixture was stirred at 105° C. for 8 h under a N2 atmosphere. TLC analysis showed that the starting material was consumed (PE:EtOAc=5:1). The mixture was washed with water (60 mL) and extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=25:1 to 15:1) to afford 2-methoxy-N-prop-2-ynyl-4-(trifluoromethyl)aniline (0.8 g, 2.44 mmol, 46.70% yield) as a yellow oil.


Example A34
Synthesis of ((4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate



embedded image


Preparation of (3-methoxy-4-nitrophenyl)(methyl)sulfane: To a solution of 4-fluoro-2-methoxy-1-nitrobenzene (2 g, 11.69 mmol, 1 eq.) in DMF (20 mL) was added sodium methanethiolate (5.32 g, 15.19 mmol, 4.84 mL, 20% purity, 1.3 eq.). The mixture was stirred at 20° C. for 2 h. TLC analysis showed that the reaction was complete. The reaction mixture was diluted by adding a saturated NH4Cl solution (100 mL). The mixture was filtered and concentrated under reduced pressure to give (3-methoxy-4-nitrophenyl)(methyl)sulfane (2.4 g, crude) as a yellow solid.


Preparation of ((3-methoxy-4-nitrophenyl)thio)methyl acetate: To a solution of (3-methoxy-4-nitrophenyl)(methyl)sulfane (1.4 g, 7.03 mmol, 1 eq.) in DCE (15 mL) were added phenyl-λ3-iodanediyl diacetate (3.40 g, 10.54 mmol, 1.5 eq.) and Pd(OAc)2 (473.30 mg, 2.11 mmol, 0.3 eq.). The mixture was stirred at 100° C. for 6 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was quenched with water (300 mL) and extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=8:1 to 3:1) to afford ((3-methoxy-4-nitrophenyl)thio)methyl acetate (1 g, 3.89 mmol, 55.31% yield) as a yellow solid.


Preparation of ((3-methoxy-4-nitrophenyl)sulfonyl)methyl acetate: To a solution of ((3-methoxy-4-nitrophenyl)thio)methyl acetate (0.9 g, 3.50 mmol, 1 eq.) in a mixture of acetone (4 mL), water (0.4 mL), and MeOH (4 mL) was added oxone (6.45 g, 10.50 mmol, 3 eq.). The mixture was stirred at 25° C. for 5 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was diluted with saturated Na2S2O3 solution (200 mL) and extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford ((3-methoxy-4-nitrophenyl)sulfonyl)methyl acetate (1 g, crude) as a yellow solid. The crude product was used in the next step without purification. MS (ES+, m/z): 311.9.


Preparation of ((4-amino-3-methoxyphenyl)sulfonyl)methyl acetate: To a solution of ((3-methoxy-4-nitrophenyl)sulfonyl)methyl acetate (0.9 g, 3.11 mmol, 1 eq.) in EtOH (8 mL) were added saturated NH4Cl solution (166.43 mg, 3.11 mmol, 2 mL, 1 eq.) and Fe (521.26 mg, 9.33 mmol, 3 eq.). The mixture was stirred at 60° C. for 2 h. TLC analysis showed that the reaction was complete. The reaction mixture was filtered, diluted with water (100 mL), extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 4:1) to afford ((4-amino-3-methoxyphenyl)sulfonyl)methyl acetate (580 mg, 2.24 mmol, 71.90% yield) as a yellow solid.


Preparation of ((4-((tert-butoxycarbonyl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate: To a solution of ((4-amino-3-methoxyphenyl)sulfonyl)methyl acetate (0.49 g, 1.89 mmol, 1 eq.) in tert-butoxycarbonyl tert-butyl carbonate (20.62 g, 94.49 mmol, 21.71 mL, 50 eq.) was stirred at 130° C. for 4 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was filtered, diluted with water (100 mL) and extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 4:1) to afford ((4-((tert-butoxycarbonyl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate (0.45 g, 1.25 mmol, 66.25% yield) as a white oil.


Preparation of ((4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate: To a solution of ((4-((tert-butoxycarbonyl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate (0.35 g, 973.86 μmol, 1 eq.) in DMF (4 mL) were added 3-bromoprop-1-yne (217.22 mg, 1.46 mmol, 157.41 μL, 1.5 eq.) and Cs2CO3 (634.61 mg, 1.95 mmol, 2 eq.). The mixture was stirred at 25° C. for 1 h under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was diluted with water (100 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (50 mL×2) and brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) to afford ((4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate (0.3 g, 754.83 μmol, 77.51% yield) as a yellow oil. MS (ES+, m/z): 342.0.


Example A35
Synthesis of tert-butyl (5-fluoro-2-methoxy-4-(methylcarbamoyl)phenyl)(prop-2-yn-1-yl)carbamate



embedded image


Preparation of 2-fluoro-5-methoxy-4-nitro-benzoic acid: A mixture of 2,5-difluoro-4-nitro-benzoic acid (20 g, 98.47 mmol, 1 eq.) in MeOH (200 mL) was added dropwise KOH (16.57 g, 295.42 mmol, 3 eq.) in MeOH (50 mL) at 80° C. The mixture was stirred at 80° C. for 1 h. TLC analysis (SiO2, DCM:MeOH:AcOH=400:20:1, Rf=0.6) indicated that the starting material was consumed completely. 6M HCl was added dropwise into the mixture to adjust the pH of the solution to pH<2. The mixture was then concentrated under reduced pressure to remove MeOH. The mixture was diluted with water (200 mL) and EtOAc (200 mL) and extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (200 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a crude product. The crude product was used directly in the next step without purification. 1H NMR (400 MHz, DMSO-d6) δ 8.02-7.99 (d, J=9.6 Hz, 1H), 7.67-7.66 (d, J=5.6 Hz, 1H), 3.956 (s, 3H).


Preparation of methyl 2-fluoro-5-methoxy-4-nitro-benzoate: A mixture of 2-fluoro-5-methoxy-4-nitro-benzoic acid (19.5 g, 90.64 mmol, 1 eq.) in HCl/MeOH (4 M, 195 mL, 8.61 eq.) was stirred at 25° C. for 8 h. TLC (SiO2, PE:EtOAc=2:1, Rf=0.5) indicated the starting material was consumed completely. The reaction mixture was concentrated under reduced pressure to remove solvent to give a residue. The crude product (19g) was obtained as a yellow solid and used in the next step without purification. 1H NMR (400 MHz, DMSO-d6) δ 8.21-8.20 (d, J=4.0 Hz, 1H), 7.50-7.48 (d, J=8.0 Hz, 1H), 4.01 (s, 3H), 3.71 (s, 3H).


Preparation of methyl 4-amino-2-fluoro-5-methoxy-benzoate: To a solution of methyl 2-fluoro-5-methoxy-4-nitro-benzoate (19 g, 82.91 mmol, 1 eq.) and NH4Cl (26.61 g, 497.46 mmol, 6 eq.) in EtOH (200 mL) and water (40 mL) was added Fe (13.89 g, 248.73 mmol, 3 eq.) at 90° C., and the resulting mixture was stirred for 1 h. LC-MS analysis showed that 23% of the nitro starting material remained, several new peaks were observed, and 22% of desired compound was detected. Fe (9.26 g, 165.82 mmol, 2 eq.) was added into the mixture, and the mixture was stirred further at 90° C. for 2 h. TLC analysis indicated that the starting material was consumed completely. The mixture was diluted with EtOH (200 mL) and filtered through a pad of diatomaceous earth. The filtrate was concentrated under reduced pressure to give the crude product, which was purified by column chromatography (SiO2, PE:EtOAc=30:1 to PE:EtOAc:DCM=30:2:3, Rf=0.5). Methyl 4-amino-2-fluoro-5-methoxy-benzoate (17 g, 80.23 mmol, 53.27% yield) was obtained as light yellow solid. 1H NMR (400 MHz, DMSO-d6) δ 7.16-7.15 (d, J=2.0 Hz, 1H), 6.02-6.01 (d, J=6.4 Hz, 1H), 3.74 (s, 3H), 3.41 (s, 3H). MS (ES+, m/z): 199.1.


Preparation of Methyl 4-(tert-butoxycarbonylamino)-2-fluoro-5-methoxy-benzoate: A mixture of methyl 4-amino-2-fluoro-5-methoxy-benzoate (16 g, 80.33 mmol, 1 eq.) and Boc2O (152 g, 696.46 mmol, 160 mL, 8.67 eq.) was stirred at 110° C. for 6 h. TLC analysis (SiO2, PE:EtOAc=4:1, Rf=0.6) indicated that 10% of the starting material was remained, and one major new spot with polarity lower than that of the starting material was detected. The reaction mixture was concentrated under reduced pressure to remove solvent to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=60:1 to 50:1, Rf=0.6). Methyl 4-(tert-butoxycarbonylamino)-2-fluoro-5-methoxy-benzoate (17 g, 51.12 mmol, 63.64% yield) was obtained as a light yellow solid. 1H NMR (400 MHz, DMSO-d6) δ 8.45 (s, 1H), 7.62 (d, J=6.0 Hz, 1H), 7.45 (d, J=5.6 Hz, 1H), 3.90 (s, 3H), 3.80 (s, 3H), 1.48 (s, 6H).


Preparation of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoate: A mixture of methyl 4-(tert-butoxycarbonylamino)-2-fluoro-5-methoxy-benzoate (15 g, 45.11 mmol, 1 eq.) and Cs2CO3 (29.39 g, 90.21 mmol, 2 eq.) in DMF (110 mL) was added propargyl bromide (10.73 g, 90.21 mmol, 7.78 mL, 2 eq.). The mixture was stirred at 25° C. for 1 h. TLC (SiO2, PE:EtOAc=8:1, Rf=0.5) indicated the starting material was consumed completely. The mixture was diluted with water (500 mL). The mixture was extracted with EtOAc (200 mL×3). The combined organic layers were washed with saturated brine (200 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a crude product. The residue was purified by column chromatography (SiO2, PE:EtOAc=0:1) to give methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoate. 1H NMR (400 MHz, DMSO-d6) δ 7.45 (d, J=2.4 Hz, 1H), 7.30 (d, J=5.6 Hz, 1H), 7.35 (s, 2H), 3.90 (s, 3H), 3.80 (s, 3H), 3.20 (s, 1H), 1.35 (s, 6H).


Preparation of 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoic acid: To a solution of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoate (2 g, 5.93 mmol, 1 eq.) in THF (5 mL), MeOH (5 mL), and water (5 mL) was added NaOH (474.26 mg, 11.86 mmol, 2 eq.). The mixture was stirred for 0.5 h at 40° C. TLC analysis showed that the reaction was complete. The reaction was quenched with water (50 mL), and the pH of the mixture was adjusted to 3 using 1N HCl. The resulting mixture was filtered and concentrated to afford 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoic acid as a light-yellow solid.


Preparation of tert-butyl (5-fluoro-2-methoxy-4-(methylcarbamoyl)phenyl)(prop-2-yn-1-yl)carbamate: To a solution of 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoic acid (1.7 g, 5.26 mmol, 1 eq.) in DMF (15 mL) were added HOBt (1.42 g, 10.52 mmol, 2 eq.), EDIC (2.02 g, 10.52 mmol, 2 eq.), DIPEA (2.04 g, 15.77 mmol, 2.75 mL, 3 eq.) and methanamine (1.07 g, 15.77 mmol, 3 eq., HCl salt). The mixture was stirred for 1 h at 25° C. under N2. TLC analysis showed that the reaction was complete. The reaction was quenched with water (50 mL) and extracted with EtOAc (30 mL). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=4:1 to 2:1) to afford tert-butyl (5-fluoro-2-methoxy-4-(methylcarbamoyl)phenyl)(prop-2-yn-1-yl)carbamate (1.6 g, 4.76 mmol, 90.47% yield) as a yellow oil.


Example A36
Synthesis of 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


Preparation of 3-methoxy-N,N-dimethyl-4-nitrobenzenesulfonamide: A solution of dimethylamine (145.82 mg, 1.79 mmol, 1.5 eq.) in DCM (1 mL) was added into TEA (241.27 mg, 2.38 mmol, 331.87 μL, 2 eq.). The resulting mixture was then added dropwise to a solution of 3-methoxy-4-nitrobenzenesulfonyl chloride (300 mg, 1.19 mmol, 1 eq.) in DCM and stirred at 25° C. for 2 h. TLC analysis (PE:EtOAc=3:1, Rf=0.40) indicated that the reaction was complete. The mixture was quenched with water (40 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, PE:EtOAc=3:1) to afford 3-methoxy-N,N-dimethyl-4-nitrobenzenesulfonamide (270 mg, 933.66 μmol, 78.32% yield) as a light-yellow solid.


Preparation of 4-amino-3-methoxy-N,N-dimethylbenzenesulfonamide: To a solution of 3-methoxy-N,N-dimethyl-4-nitrobenzenesulfonamide (250 mg, 864.50 μmol, 1 eq.) and solid NH4Cl (231.22 mg, 4.32 mmol, 5 eq.) in EtOH (5 mL) and water (1 mL) was added Fe (482.78 mg, 8.64 mmol, 10 eq.) at 70° C. The mixture was stirred for 2 h. TLC analysis (PE:EtOAc=1:1, Rf=0.24) indicated that the reaction was complete. The mixture was quenched with water (60 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 4-amino-3-methoxy-N,N-dimethylbenzenesulfonamide (210 mg, crude) as a light-yellow solid.


Preparation of 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide: A solution of 4-amino-3-methoxy-N,N-dimethylbenzenesulfonamide (330 mg, 1.43 μmol, 1 eq.) in CHCl3 (10 mL) was added into a mixture of 3-bromoprop-1-yne (340.94 mg, 2.87 μmol, 247.06 μL, 2 eq.) and DIPEA (926.02 mg, 7.17 mmol, 1.25 mL, 5 eq.) in CHCl3 (3 mL). The mixture was stirred at 70° C. for 16 h. TLC analysis (PE:EtOAc=1:1, Rf=0.43) indicated that the reaction was complete. The mixture was quenched with water (40 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) to afford 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (210 mg, 47.5% yield)as a light-yellow solid. MS (ES+, m/z): 269.2.


Example A37
Synthesis of tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate



embedded image


Preparation of 2-fluoro-6-methoxy-4-(methylsulfonyl)aniline: To a solution of 4-bromo-2-fluoro-6-methoxyaniline (626.34 mg, 6.14 mmol, 3 eq.) in DMSO (15 mL) were added DL-proline (117.73 mg, 1.02 mmol, 0.5 eq.), CuI (389.49 mg, 2.05 mmol, 1 eq.), and NaOH (81.80 mg, 2.05 mmol, 1 eq.). The reaction mixture was stirred at 90° C. for 16 h under N2. TLC analysis (PE:EtOAc=2:1, Rf=0.5) indicated that the starting material was consumed completely, and one major new spot with lower polarity than that of the starting material was detected. The mixture was diluted with a saturated EDTA solution (100 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 2:1) to afford the desired product (1.2 g, 5.47 mmol, 89.22% yield) as a white solid.


Preparation of 2-fluoro-6-methoxy-N,N-di(tert-butyloxycarbonyl)-4-(methylsulfonyl)aniline: To a mixture of 2-fluoro-6-methoxy-4-(methylsulfonyl)aniline (1.2 g, 4.93 mmol, 1 eq.) and Boc2O (4.30 g, 19.71 mmol, 4.53 mL, 4 eq.) in 1,4-dioxane (12 mL) were added DMAP (60.18 mg, 492.63 μmol, 0.1 eq.) and TEA (1.99 g, 19.71 mmol, 2.74 mL, 4 eq.). The reaction mixture was stirred at 110° C. for 6 h. TLC analysis (PE:EtOAc=2:1, Rf=0.5) indicated that the starting material was consumed completely, and one major new spot with lower polarity than that of the starting material was detected. The mixture was diluted with water (100 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=20:1 to 2:1) to afford the desired product (1.9 g, 4.08 mmol, 82.75% yield) as a yellow oil.


Preparation of tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)carbamate: A mixture of 2-fluoro-6-methoxy-N,N-di(tert-butyloxycarbonyl)-4-(methylsulfonyl)aniline (900 mg, 1.93 mmol, 1 eq.) and K2CO3 (1.33 g, 9.66 mmol, 5 eq.) in MeOH (10 mL) was stirred at 25° C. for 2 h. The mixture was then heated to 40° C. and stirred further for 2 h. TLC analysis (PE:EtOAc=2:1, Rf=0.4) indicated that the starting material was consumed completely, and one major new spot with polarity greater than that of the starting material was detected. The reaction mixture was concentrated under reduced pressure. The crude residue was diluted with water (200 mL) and extracted with EtOAc (70 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue (1.6 g, crude) was obtained as a light-yellow solid and used directly in the next step.


Preparation of tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate: A mixture of tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)carbamate (1.5 g, 4.23 mmol, 1 eq.) and Cs2CO3 (2.75 g, 8.45 mmol, 2 eq.) in DMF (16 mL) was stirred at 25° C. for 1 h. TLC analysis (PE:EtOAc=2:1, Rf=0.4) indicated that the starting material was consumed completely, and one major new spot with polarity lower than that of the starting material was detected. The mixture was diluted with water (100 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=20:1 to 4:1) to afford tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate (1.9 g, 3.99 mmol, 94.32% yield) as a light-yellow oil.


Example A38
Synthesis of 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


Preparation of 3-methoxy-N,N-dimethyl-4-nitrobenzenesulfonamide: A solution of N-methylmethanamine (194.43 mg, 2.38 mmol, 218.46 μL, 1.2 eq., HCl) in DCM (15 mL) and Et3N (1.01 g, 9.93 mmol, 1.38 mL, 5 eq.) was prepared under N2 at 0° C. A solution of 3-methoxy-4-nitrobenzenesulfonyl chloride (500 mg, 1.99 mmol, 1 eq.) in DCM (5 mL) was added dropwise to the mixture, and the mixture was stirred at 20° C. for 2 h. TLC analysis (PE:EtOAc=1:1, Rf=0.42) showed that the reaction was complete. The mixture was concentrated in vacuo and purified by column chromatography (SiO2, PE:EtOAc=20:1 to 0:1, Rf=0.42) to afford the desired product (500 mg, 1.86 mmol, 93.69% yield) as a yellow solid. MS (ES+, m/z): 261.1.


Preparation of 4-amino-3-methoxy-N,N-dimethylbenzenesulfonamide: To a solution of 3-methoxy-N,N-dimethyl-4-nitrobenzenesulfonamide (450 mg, 1.68 mmol, 1 eq.) in EtOH (15 mL) and water (5 mL) was added NH4Cl (448.09 mg, 8.38 mmol, 292.87 μL, 5 eq.) under N2. Fe (467.85 mg, 8.38 mmol, 5 eq.) was added to the mixture at 90° C., and the resulting mixture was stirred at 90° C. for 0.5 h. TLC analysis (PE:EtOAc=1:1, Rf=0.39) showed that the reaction was complete. The reaction mixture was subjected to heat filtration, filtered and concentrated in vacuo. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 0:1, Rf=0.39) to afford the desired product (380 mg, 1.54 mmol, 91.99% yield) as a light yellow solid. MS (ES+, m/z): 231.0.


Preparation of 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide: To a mixture of 4-amino-3-methoxy-N,N-dimethylbenzenesulfonamide in CHCl3 (10 mL) were added DIPEA (865.91 mg, 6.70 mmol, 1.17 mL, 5 eq.) and 3-bromoprop-1-yne (797.03 mg, 6.70 mmol, 577.56 μL, 5 eq.). The mixture was degassed and purged with N2 three times at 20° C., and the mixture was stirred at 70° C. for 10 h. Then, DIPEA (346.37 mg, 2.68 mmol, 466.81 μL, 2 eq.) and 3-bromoprop-1-yne (318.81 mg, 2.68 mmol, 231.02 μL, 2 eq.) were added to the mixture, and the resulting mixture was stirred further at 70° C. for 10 h. LC-MS and TLC analysis (PE:EtOAc=1:1, Rf=0.50) indicated that 20% of the starting material remained, and one major new spot was detected. The mixture was concentrated in vacuo and purified by column chromatography (SiO2, PE:EtOAc=10:1 to 0:1, Rf=0.5) to afford the desired product (120 mg, 290.69 μmol, 21.69% yield) as a light-yellow solid. MS (ES+, m/z): 268.9.


Example A41
Synthesis of 4-methoxy-6-(methylsulfonyl)-N-(prop-2-yn-1-yl)pyridin-3-amine



embedded image


Preparation of 4-methoxy-2-(methylthio)-5-nitropyridine: To a solution of 2-chloro-4-methoxy-5-nitro-pyridine (1.50 g, 7.95 mmol, 1 eq.) in DMF (20 mL) was added NaSMe (3.34 g, 47.70 mmol, 3.04 mL, 6 eq.). The mixture was stirred at 15° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the mass of the desired product was detected. The reaction mixture was partitioned by adding water (50 mL) and EtOAc (50 mL). The organic phase was separated, washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford the desired product (1.30 g, 6.49 mmol, 81.68% yield) as a brown solid. MS (ES+, m/z): 200.8.


Preparation of 4-methoxy-2-(methylsulfonyl)-5-nitropyridine: To a solution of 4-methoxy-2-(methylthio)-5-nitropyridine (1.30 g, 6.49 mmol, 1 eq.) in acetone (20 mL), MeOH (2 mL) and water (20 mL) was added oxone (11.98 g, 19.48 mmol, 3 eq.). The mixture was stirred at 0-15° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the desired mass was detected. The reaction mixture was partitioned using a saturated Na2S2O4 solution (100 mL) and EtOAc (100 mL). The organic phase was separated, washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford the desired product (1.45 g, 5.68 mmol, 87.56% yield) as a yellow solid. MS (ES+, m/z): 233.1.


Preparation of 4-methoxy-6-(methylsulfonyl)pyridin-3-amine: To a solution of 4-methoxy-2-methylsulfonyl-5-nitro-pyridine (1 g, 4.31 mmol, 1 eq.) in AcOH (20 mL) was added Fe (2.41 g, 43.10 mmol, 10 eq.). The mixture was stirred at 50° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the desired mass was detected. The reaction mixture was partitioned by adding water (100 mL) and EtOAc (100 mL). The organic phase was separated, washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:1) to afford the desired product (510 mg, 2.52 mmol, 58.51% yield) as a brown solid. MS (ES+, m/z): 202.8.


Preparation of tert-butyl (4-methoxy-6-(methylsulfonyl)pyridin-3-yl)carbamate: To a solution of 4-methoxy-6-(methylsulfonyl)pyridin-3-amine (650 mg, 3.21 mmol, 1 eq.) in dioxane (10 mL) was added Boc2O (4.20 g, 19.26 mmol, 4.42 mL, 6 eq.). The mixture was stirred at 110° C. for 14 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the desired mass was detected. The reaction mixture was concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:1) to afford the desired product (0.65 g, 2.15 mmol, 66.97% yield) as a yellow oil. MS (ES+, m/z): 302.9.


Preparation of tert-butyl (4-methoxy-6-(methylsulfonyl)pyridin-3-yl)(prop-2-yn-1-yl)carbamate: To a mixture of NaH (529.20 mg, 13.23 mmol, 60% in mineral oil, 10 eq.) in DMF (4 mL) was added tert-butyl (4-methoxy-6-(methylsulfonyl)pyridin-3-yl)carbamate (400 mg, 1.32 mmol, 1 eq.). The mixture was stirred at 0° C. for 30 min, and 3-bromoprop-1-yne (236.07 mg, 1.98 mmol, 171.07 μL, 1.50 eq.) was added to the mixture. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the desired mas was detected. The reaction mixture was partitioned by adding water (40 mL) and EtOAc (40 mL). The organic phase was separated, washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:1) to afford the desired product (250 mg, 734.44 μmol, 55.51% yield) as a yellow oil. MS (ES+, m/z): 341.2.


Preparation of 4-methoxy-6-(methylsulfonyl)-N-(prop-2-yn-1-yl)pyridin-3-amine: To a solution of tert-butyl (4-methoxy-6-(methylsulfonyl)pyridin-3-yl)(prop-2-yn-1-yl)carbamate (170 mg, 499.42 μmol, 1 eq.) was added HCl/EtOAc (4 M, 2.02 mL, 16.17 eq.). The mixture was stirred at 15° C. for 1 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the desired mass was detected. The reaction mixture was concentrated under reduced pressure to afford the desired product (100 mg, 361.35 72.35% yield, HCl) was obtained as a brown solid. MS (ES+, m/z): 241.1.


Example A42
Synthesis of 2-(4-methoxy-5-(prop-2-yn-1-ylamino)pyridin-2-yl)-2-methylpropanenitrile
Route 1:



embedded image


Preparation of 2-(4-methoxy-5-nitropyridin-2-yl)-2-methylpropanenitrile: To a solution of 2-chloro-4-methoxy-5-nitropyridine (2 g, 10.61 mmol, 1 eq.) in THF (5 mL) was added KHMDS (1 M, 53.03 mL, 5 eq.) drop-wise at 0° C. under N2. Then, isobutyronitrile (2.20 g, 31.82 mmol, 3 eq.) was added, and the resulting mixture was stirred at 0° C. for 2 h. TLC analysis (PE:EtOAc=1:1) showed that the starting material was consumed completely. The reaction was quenched by adding ice slowly, and the mixture was extracted with EtOAc (10 mL×2). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:1) to afford 2-(4-methoxy-5-nitropyridin-2-yl)-2-methylpropanenitrile (0.66 g, 2.98 mmol, 28.13% yield) as a yellow solid.


Preparation of 2-(5-amino-4-methoxypyridin-2-yl)-2-methylpropanenitrile: To a solution of 2-(4-methoxy-5-nitropyridin-2-yl)-2-methylpropanenitrile (0.35 g, 1.58 mmol, 1 eq.) in EtOH (5 mL) and water (1 mL) were added NH4Cl (423.16 mg, 7.91 mmol, 276.57 μL, 5 eq.), and Fe (441.83 mg, 7.91 mmol, 5 eq.) in order at 90° C. under N2. The mixture was heated to 90° C. and stirred for 1 h. TLC analysis showed that the reaction was complete. The mixture was filtered and concentrated under reduced pressure. The residue was poured into a mixture of DCM and water (w/w=1:1) (20 mL) and stirred for 30 min. The aqueous phase was extracted with DCM (5 mL×2). The combined organic layers were washed with brine (5 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) to afford the desired product (0.22 g, 1.15 mmol, 72.71% yield) as a yellow solid.


Preparation of 2-(4-methoxy-5-(prop-2-yn-1-ylamino)pyridin-2-yl)-2-methylpropanenitrile: To a mixture of 2-(5-amino-4-methoxypyridin-2-yl)-2-methylpropanenitrile (0.24 g, 1.26 mmol, 1 eq.) and 3-bromoprop-1-yne (746.50 mg, 6.28 mmol, 540.94 μL, 5 eq.) in DMF (5 mL) was added K2CO3 (520.36 mg, 3.77 mmol, 3 eq.) in one portion at 25° C. under N2. The mixture was stirred at 70° C. for 12 h. LC-MS and TLC analysis (PE:EtOAc=1:1, Rf=0.45) showed that the reaction was complete. The mixture was poured into water (50 mL) and stirred for 2 min. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by silica gel chromatography (PE:EtOAc=10:1 to 0:1) to afford the desired product (0.255 g, 889.75 μmol, 70.89% yield) as a yellow solid. MS (ES+, m/z): 230.0.


Route 2:



embedded image


Preparation of tert-butyl (6-(2-cyanopropan-2-yl)-4-methoxypyridin-3-yl)carbamate: To a solution of 2-(5-amino-4-methoxypyridin-2-yl)-2-methylpropanenitrile (0.15 g, 784.40 μmol, 1 eq.) in dioxane (5 mL) were added (Boc)2O (855.96 mg, 3.92 mmol, 901.01 μL, 5 eq.) and DMAP (191.66 mg, 1.57 mmol, 2 eq.) in one portion at 25° C. under N2. The mixture was stirred at 110° C. for 12 h. LC-MS analysis showed that the reaction was complete, and a di-Boc byproduct was detected. The mixture was cooled to 25° C. and concentrated under reduced pressure at 50° C. The residue was added to solution of 500 mg solid Na2CO3 in MeOH (10 mL) to convert the di-Boc byproduct to the desired mono-Boc-protected product. The mixture was stirred at 40° C. for 2 h. The mixture was cooled to 25° C. and concentrated under reduced pressure at 40° C. The crude residue was purified by silica gel chromatography (PE:EtOAc=30:1 to 3:1) to afford the desired product (0.18 g, 586.93 μmol, 74.83% yield) as a colorless oil. MS (ES+, m/z): 291.9.=


Preparation of tert-butyl (6-(2-cyanopropan-2-yl)-4-methoxypyridin-3-yl)(prop-2-yn-1-yl)carbamate: To a mixture of tert-butyl (6-(2-cyanopropan-2-yl)-4-methoxypyridin-3-yl)carbamate (0.18 g, 617.82 1 eq.) in DMF (2 mL) was added NaH (37.07 mg, 926.74 60% in mineral oil, 1.5 eq.) in one portion at 0° C. under N2. The mixture was stirred at 0° C. for 30 min, then 3-bromoprop-1-yne (88.20 mg, 741.39 μmol, 63.91 μL, 1.2 eq.) was added in one portion at 0° C. under N2. The mixture was stirred at 0° C. for 1.5 h. LC-MS analysis showed that the reaction was complete. The mixture was poured into water (20 mL) and stirred for 2 min. The aqueous phase was extracted with EtOAc (10 mL×2). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by silica gel chromatography (PE:EtOAc=30:1 to 3:1) to afford the desired product (0.15 g, 432.61 μmol, 70.02% yield) as a colorless oil. MS (ES+, m/z): 329.9.


Preparation of 2-(4-methoxy-5-(prop-2-yn-1-ylamino)pyridin-2-yl)-2-methylpropanenitrile: A solution of tert-butyl (6-(2-cyanopropan-2-yl)-4-methoxypyridin-3-yl)(prop-2-yn-1-yl)carbamate (120 mg, 364.31 μmol, 1 eq.) in HCl/EtOAc (5 mL) was prepared at 0° C. under N2 and stirred at 0° C. for 2 h. TLC analysis (PE:EtOAc=3:1, Rf=0) showed that the reaction was complete. The mixture was poured into a saturated Na2CO3 solution (50 mL) and stirred for 2 min. The aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered and concentrated in vacuo. The crude residue was purified by prep-TLC (PE:EtOAc=3:1, Rf=0.4) to afford the desired product (100 mg, 417.88 μmol) as a white solid. MS (ES+, m/z): 230.3.


Example A43
Synthesis of 3-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid



embedded image


A solution of 4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-methoxy-benzoic acid (1.1 g, 3.60 mmol, 1 eq.) in 4 N HCl/EtOAc (50 mL) was stirred at 20° C. for 2 h. TLC analysis (PE:EtOAc=1:1, Rf=0.5) showed that the starting material was consumed. The mixture was concentrated to afford the crude product (0.8 g, 3.51 mmol, 97.39% yield) as a yellow solid. The crude product was used without purification.


Example A44
Synthesis of methyl 3-methoxy-4-(prop-2-yn-1-ylamino)benzoate



embedded image


Preparation of methyl 3-methoxy-4-(prop-2-yn-1-ylamino)benzoate: A solution of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxybenzoate in 4N HCl in EtOAc (20 mL) was degassed and purged with N2 three times. The mixture was then stirred at 20° C. for 1 h under N2. TLC analysis (PE:EtOAc=3:1, Rf=0.55) indicated that the starting material was consumed, and one new spot had formed. The reaction mixture was quenched by adding a saturated NaHCO3 solution (30 mL) and was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (25 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (0.58 g, 2.12 mmol, 67.59% yield) was obtained as a yellow solid and used without purification.


Preparation of 3-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid: A solution of methyl 3-methoxy-4-(prop-2-yn-1-ylamino)benzoate in MeOH and water (10 mL, MeOH:water=1:3) was degassed and purged with N2 three times. The solution was stirred at 20° C. for 1 h under N2. TLC analysis (PE:EtOAc=3:1, Rf=0) indicated that the starting material remained, and one major new spot was detected. The reaction mixture was extracted with EtOAc (50 mL×2), and the pH of the mixture was adjusted to 3-4 by adding 2M HCl. The organic layer was washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford the desired product (0.6 g, 2.34 mmol, 42.73% yield) as a yellow solid.


Example A45
Synthesis of 3-methoxy-4-(prop-2-yn-1-ylamino)benzamide



embedded image


Preparation of 4-amino-3-methoxybenzoic acid: To a solution of methyl 4-amino-3-methoxybenzoate (4.5 g, 23.59 mmol, 1 eq.) in MeOH (45 mL), water (15 mL), and THF (15 mL) was added LiOH (4.95 g, 117.97 mmol, 5 eq.) in one portion at 25° C. under N2. The mixture was stirred at 25° C. for 12 h. TLC analysis (PE:EtOAc=3:1, Rf=0) showed that the reaction was complete. The mixture was concentrated under reduced pressure at 40° C. The residue was poured into water (50 mL) and stirred for 1 min. The aqueous phase was extracted with EtOAc (30 mL×3). 2 N HCl was added to the aqueous phase to adjust the pH of the solution to 2. The aqueous phase was filtered and concentrated in vacuo to afford the desired product (4 g, 22.73 mmol, 96.35% yield) as a light yellow solid.


Preparation of 4-amino-3-methoxybenzamide: To a solution of 4-amino-3-methoxybenzoic acid (4 g, 22.73 mmol, 1 eq., 95% purity) in DMF (50 mL) were added NH4OAc (8.76 g, 113.66 mmol, 5 eq.), DIPEA (29.38 g, 227.32 mmol, 39.60 mL, 10 eq.), and HATU (17.29 g, 45.46 mmol, 2 eq.) in one portion at 25° C. under N2. The mixture was stirred at 25° C. for 2 h. TLC analysis (PE:EtOAc=0:1, Rf=0.30) showed that the reaction was complete. The mixture was poured into water (800 mL) and stirred for 2 min. The aqueous phase was extracted with EtOAc (300 mL×3). The combined organic layers were washed with brine (300 mL×1), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography (SiO2, PE:EtOAc=100:1 to 0:1) to afford the desired product (5 g, 18.05 mmol, 79.42% yield) as a yellow oil.


Preparation of 3-methoxy-4-(prop-2-yn-1-ylamino)benzamide: To a mixture of 4-amino-3-methoxybenzamide (5 g, 18.05 mmol, 1 eq., 60% purity) and 3-bromoprop-1yne (4.52 g, 36.11 mmol, 3.28 mL, 2 eq., 95% purity) in DMF (50 mL) was added K2CO3 (7.49 g, 54.16 mmol, 3 eq.) in one portion at 25° C. under N2. The mixture was stirred at 70° C. for 4 h. TLC analysis (PE:EtOAc=0:1, Rf=0.40) showed that the reaction was complete. The mixture was cooled to 25° C., and the residue was poured into water (500 mL) and stirred for 2 min. The aqueous phase was extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (300 mL×1), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography (SiO2, PE:EtOAc=100:1 to 0:1) to afford the desired product (3.32 g, 12.19 mmol, 67.54% yield) as a yellow solid.


Example A46
Synthesis of 2-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)ethan-1-ol



embedded image


Preparation of 2-((3-methoxy-4-nitrophenyl)thio)ethan-1-ol: A solution of 4-fluoro-2-methoxy-1-nitrobenzene (1.24 g, 11.69 mmol, 1 eq.) and 2-mercaptoethan-1-ol (1.83 g, 23.37 mmol, 1.63 mL, 2 eq.) was degassed and purged with N2 three times. The mixture was stirred at 25° C. for 19 h under N2. TLC analysis (PE:EtOAc=5:1, Rf=0.05; DCM:MeOH=10:1, Rf=0.45) showed that the reaction was complete. The residue was poured into water (200 mL) and was stirred for 30 min. The mixture was filtered and concentrated in vacuo. The residue was poured into water (200 mL) and extracting the mixture with EtOAc (100 mL×3). The combined organic layers were washed with brine (80 mL×3), filtered and concentrated in vacuo. The crude product (2.8 g, crude) was obtained as a yellow solid and used without purification.


Preparation of 2-((3-methoxy-4-nitrophenyl)sulfonyl)ethan-1-ol: To a solution of 2-((3-methoxy-4-nitrophenyl)thio)ethan-1-ol (2.8 g, 12.21 mmol, 1 eq.) in acetone (40 mL), water (40 mL), and MeOH (4 mL) was added oxone (15.02 g, 24.43 mmol, 2 eq.). The mixture was stirred at 25° C. for 2 h. TLC analysis (DCM:MeOH=10:1, Rf=0.4) indicated that the starting material was consumed completely, and one new spot was detected. The residue was poured into a saturated solution of Na2SO3 (300 mL) and stirred for 30 min. The mixture was filtered and concentrated in vacuo. The residue was poured into a saturated Na2SO3 solution (300 mL) and stirred for 30 min and extracting the mixture with EtOAc (100 mL×3). The combined organic layers were washed with brine (80 mL×3), filtered and concentrated in vacuo. The crude product (3 g, crude) was obtained as a white solid and used without purification.


Preparation of 2-((4-amino-3-methoxyphenyl)sulfonyl)ethan-1-ol: A solution of 2-((3-methoxy-4-nitrophenyl)sulfonyl)ethan-1-ol (3 g, 11.48 mmol, 1 eq.) in EtOH (20 mL) and water (4 mL) were added NH4Cl (3.69 g, 68.90 mmol, 6 eq.) and Fe (1.92 g, 34.45 mmol, 3 eq.) at 90° C. The mixture was stirred at 90° C. for 0.5 h. TLC analysis (DCM:MeOH=10:1, Rf=0.5) indicated that 50% of the starting material remained, and two major new spots with polarity greater than that of the starting material were detected. An additional portion of Fe (1.28 g, 22.97 mmol, 2 eq.) was added into the mixture, and the mixture was stirred at 90° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.5) indicated that the starting material was consumed completely, and one major new spot with polarity greater than that of the starting material was detected. The residue was diluted with EtOAc (400 mL). The mixture was diluted with water (400 mL) and extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (200 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (2.8 g, crude) was obtained as a white oil. MS (ES+, m/z): 232.0. 1H NMR (400 MHz, DMSO-d6) δ ppm 3.27-3.35 (m, 2H) 3.60-3.68 (m, 2H) 3.80-3.88 (m, 3H) 4.78-4.87 (m, 1H) 5.67-5.81 (m, 2H) 6.69-6.77 (m, 1H) 7.13-7.18 (m, 1H) 7.18-7.24 (m, 1H).


Preparation of 2-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)ethan-1-ol: To a solution of 2-((4-amino-3-methoxyphenyl)sulfonyl)ethan-1-ol (0.15 g, 648.6 μmol, 1 eq.) in DMF (1 mL) were added K2CO3 (179.3 mg, 1.30 mmol, 2 eq.) and 3-bromoprop-1-yne (67.51 mg, 454.02 μmol, 48.92 μL, 0.7 eq.). The mixture was degassed and purged with N2 three times, and the mixture was stirred at 50° C. for 19 h under N2. TLC analysis (PE:EtOAc=1:2, Rf=0.5) indicated that 10% of the starting material remained, and one major new spot with polarity lower than that of the starting material was detected. The residue was diluted with water (50 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=0:1) to afford the desired product (0.053 g, 177.12 μmol, 27.31% yield) as a yellow oil. 1H NMR (400 MHz, DMSO-d6) δ ppm 3.09 (s, 1H) 3.33-3.37 (m, 2H) 3.63 (q, J=6.44 Hz, 2H) 3.87 (s, 3H) 4.00 (br d, J=4.16 Hz, 2H) 4.84 (t, J=5.56 Hz, 1H) 6.26-6.38 (m, 1H) 6.69-6.80 (m, 1H) 7.11-7.24 (m, 1H) 7.35 (br d, J=8.19 Hz, 1H).


Example A47
Synthesis of 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide and 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (1 g, 4.16 mmol, 1 eq.) in acetone (10 mL) were added K2CO3 (1.15 g, 8.32 mmol, 2 eq.) and CH3I (708.87 mg, 4.99 mmol, 310.91 μL, 1.2 eq.). The mixture was stirred at 50° C. for 6 h. LC-MS analysis showed that 27% of the starting material remained, and the desired compound was detected. The reaction mixture was diluted with water (300 mL) and extracted with EtOAc (100 mL×2). The combined organic layers were washed with water (200 mL×2) and brine (200 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) to afford the desired products as yellow oils. 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.7 g, 2.75 mmol), 66.08% yield, MS (ES+, m/z): 255.1; 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.2 g, 745.35 μmop, 17.91% yield, MS (ES+, m/z): 269.1.


Example A48
Synthesis of 5-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)thiophene-2-carboxylic acid



embedded image


Preparation of methyl 5-((tert-butoxycarbonyl)amino)thiophene-2-carboxylate: A mixture of methyl 5-aminothiophene-2-carboxylate (1 g, 6.36 mmol, 1 eq.) and Boc2O (4.17 g, 19.09 mmol, 4.38 mL, 3 eq.) was degassed and purged with N2 three times, and the mixture was stirred at 110° C. for 1.5 h under N2. TLC analysis (PE:EtOAc=3:1, Rf=0.50) indicated that the starting material remained, and one major new spot was detected. The reaction mixture was quenched by adding PE (200 mL) and stirring the mixture for 1 h. The mixture was filtered and concentrated under reduced pressure to give a residue. The crude product (1.6 g, 5.60 mmol, 87.97% yield) was obtained as a yellow solid and used without further purification. MS (ES+, m/z): 258.1.


Preparation of methyl 5-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)thiophene-2-carboxylate: A mixture of methyl 5-(tert-butoxycarbonylamino)thiophene-2-carboxylate (1.5 g, 5.25 mmol, 1 eq.), 3-bromoprop-1-yne (686.56 mg, 5.77 mmol, 497.51 μL, 1.1 eq.), and Cs2CO3 (5.13 g, 15.74 mmol, 3 eq.) in DMF (20 mL) was degassed and purged with N2 three times, The mixture was then stirred at 25° C. for 4 h under N2. TLC analysis (PE:EtOAc=3:1, Rf=0.60) indicated that the starting material remained, and one major new spot was detected. The reaction mixture was quenched by adding water (200 mL) and extracting the mixture with EtOAc (100 mL×3). The combined organic layers were washed with brine (30 mL×4), filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:0 to 40:1) to afford the desired product (1.1 g, 3.35 mmol, 63.89% yield) as a yellow solid.


Preparation of 5-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)thiophene-2-carboxylic acid: A mixture of methyl 5-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)thiophene-2-carboxylate (0.5 g, 1.69 mmol, 1 eq.) and Cs2CO3 (5.52 g, 16.93 mmol, 10 eq.) in MeOH (5 mL), water (5 mL), and THF (5 mL) was degassed and purged with N2 three times. The mixture was then stirred at 25° C. for 4 h under N2 atmosphere. TLC analysis (EtOAc=1, Rf=0.3) indicated that the starting material remained, and one major new spot was detected. The reaction mixture was concentrated under reduced pressure to remove THF and MeOH. The residue was diluted with water (10 mL), and 2N HCl was added to adjust the pH of the mixture to 5. The mixture was then extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (0.43 g, 1.36 mmol, 80.36% yield) was obtained as a yellow solid and used without purification. MS (ES+, m/z): 282.0.


Example A49
Synthesis of ethyl 3-methoxy-4-(prop-2-yn-1-ylamino)benzoate



embedded image


Preparation of ethyl 3-methoxy-4-(prop-2-yn-1-ylamino)benzoate: To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid (500 mg, 2.44 mmol, 1 eq.) in DMF (6 mL) were added iodoethane (570.02 mg, 3.65 mmol, 292.32 μL, 1.5 eq.) and K2CO3 (1.01 g, 7.31 mmol, 3 eq.). The mixture was stirred at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (80 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The desired product (540 mg, crude) was obtained as a yellow solid and used without purification.


Example A50
Synthesis of 3-hydroxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide



embedded image


To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (0.2 g, 707.51 μmol, 1 eq.) in DCM (2 mL) at 0° C. was added boron tribromide (886.24 mg, 3.54 mmol, 340.86 μL, 5 eq.) under N2. The mixture was stirred at 0-25° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (100 mL) at 0° C. and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, PE:EtOAc=1:3) to afford the desired product (0.12 g, 424.31 μmol, 59.97% yield) as a yellow oil.


B. Compounds with 2-ethynyl-N-(alkyl)-1H-indole-4-amine Core
Example B1
Synthesis of Compounds 6A, 7A, 8A, and 9A



embedded image


Preparation of 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(1-methylpiperidin-4-yl)urea and N-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-4-methylpiperazine-1-carboxamide: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.) and DIPEA (12 eq.) in DCM (6 mL) was added triphosgene (441.07 μmol, 1 eq.). The mixture was stirred at 0° C. for 0.5 h. 1-Methylpiperazine or 1-methylpiperidin-4-amine (1.2 eq.) was then added into the mixture, and the resulting mixture was stirred further at 0° C. for 0.5 h. The reaction mixture was poured into a saturated aqueous solution of Na2CO3 (20 mL) and extracted with DCM (20 mL×3). The combined organic layers were concentrated under reduced pressure to give a residue. The crude residue was dissolved in toluene and concentrated (10 mL×2) to obtain the desired product.


Preparation of N-[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]-4-methyl-piperazine-1-carboxamide: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (150 mg, 441.07 μmol, 1 eq.) and DIPEA (684 mg, 5.29 mmol, 921.92 μL, 12 eq.) in DCM (2 mL) was added triphosgene (131 mg, 441.07 μmol, 1 eq.). The mixture was stirred at 0° C. for 0.5 h. 1-Methylpiperazine (53 mg, 529.28 μmol, 59 μL, 1.2 eq.) was added into the mixture, and the mixture was stirred at 0° C. for 0.5 h. TLC analysis (DCM:MeOH=20:1, Rf=0.2) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was poured into a saturated aqueous Na2CO3 solution (20 mL) and extracted with DCM (20 mL×3). The combined organic layers were concentrated under reduced pressure to give a residue. The residue was diluted with toluene (10 mL), and the mixture was concentrated under reduced pressure to give a residue. After repeating the toluene dilution step twice, the residue was diluted with toluene (10 mL) and filtered to obtain the desired product. N-[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]-4-methyl-piperazine-1-carboxamide (150 mg, 294.06 μmol, 66.67% yield). LC-MS (ES+, m/z): 467.0 [(M+H)+].


Preparation of final products: To a mixture of 3-methoxy-4-(prop-2-yn-1-ylamino)benzamide or 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1-2 eq.) in DMSO (2 mL) were added i-Pr2NH (10˜30 eq.), CuI (1˜2 eq.), 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(1-methylpiperidin-4-yl)urea or N-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-4-methylpiperazine-1-carboxamide (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.). The mixture was stirred at 20˜40° C. for 1-3 h under N2. LC-MS or TLC analysis detected that the reaction was complete. The mixture was poured into saturated EDTA solution (20 mL) and stirred for 1 h, and the aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with saturated brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by TLC, prep-TLC or prep-HPLC to afford the desired product.


3-Methoxy-4-{[3-(4-{[(1-methylpiperidin-4-yl)carbamoyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 557.1; 3-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-(1-methylpiperidin-4-yl)urea, MS (ES+, m/z): 592.1; N-(2-{3-[(4-carbamoyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-4-methylpiperazine-1-carboxamide, MS (ES+, m/z): 543.1; and N-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-4-methylpiperazine-1-carboxamide, MS (ES+, m/z): 578.3.


Example B2
Synthesis of Compounds 13A, 15A, 16A, and 17A



embedded image


embedded image


Preparation of tert-butyl 4-(3-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)ureido)piperidine-1-carboxylate 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(piperidin-4-yl)urea: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (800 mg, 2.35 mmol) and DIPEA (3.65 g, 28.23 mmol, 4.92 mL, 12 eq.) in DCM (10 mL) was added triphosgene (698.07 mg, 2.35 mmol, 1 eq.). The mixture was stirred at 0° C. for 0.5 h. tert-Butyl 4-aminopiperidine-1-carboxylate (565.35 mg, 2.82 mmol, 1.2 eq.) was then added into the mixture, and the resulting mixture was stirred at 0° C. for 0.5 h. TLC analysis (PE:EtOAc=1:1, Rf=0.16) showed that the starting material was consumed completely. Saturated solution of NaHCO3 (30 mL) was added to the reaction mixture, and the aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were concentrated in vacuo to obtain the crude product. MS (ES+, m/z): 566.8.


Preparation of 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(piperidin-4-yl)urea: To a solution of tert-butyl 4-(3-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)ureido)piperidine-1-carboxylate-1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(piperidin-4-yl)urea (0.8 g, 1.34 mmol, 1 eq.) in DCM (3 mL) was added TFA (4.59 g, 40.26 mmol, 2.98 mL, 30 eq.). The reaction mixture was stirred at 25° C. for 0.5 h. LC-MS analysis showed that the starting material was consumed completely. The reaction mixture was washed with a saturated solution of NaHCO3 (30 mL) and extracted with EtOAc (5 mL×3). The combined organic layers were washed with brine (80 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give the crude product as a brown solid (350 mg, 55.9% yield). MS (ES+, m/z): 467.0.


Preparation of 2-iodo-N—C(O)R-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(piperidin-4-yl) urea (100 mg, 214.48 μmol, 1 eq.) and R—Br (428.96 μmol, 2 eq.) in DMF (3 mL) was added K2CO3 (59.29 mg, 428.96 μmol, 2 eq.). The mixture was stirred at 25° C. for 4 h. LC-MS or TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (40 mL) and extracting the mixture with EtOAc (50 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC to afford the desired products as brown oils.


2-(4-(3-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)ureido)piperidin-1-yl)acetamide, 36% yield, MS (ES+, m/z): 524.0; 1-(1-(2-hydroxyethyl)piperidin-4-yl)-3-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)urea, 34% yield, MS (ES+, m/z): 511.0; 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(1-(2-methoxyethyl)piperidin-4-yl)urea, MS (ES+, m/z): 525.0; 1-(1-(2,3-dihydroxypropyl)piperidin-4-yl)-3-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)urea, 37% yield, MS (ES+, m/z): 541.0.


Preparation of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N—C(O)R-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (26.90 mg, 112.44 μmol, 1.5 eq.) in DMSO (3 mL) were added 2-iodo-N—C(O)R-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (45 mg, 74.96 μmol, 1 eq.), CuI (1 eq.), N-isopropylpropan-2-amine (1 eq.), and Pd(PPh3)4 (0.02 eq.). The mixture was stirred at 45° C. for 1 h. LC-MS or TLC analysis indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (40 mL) at 25° C. and extracting the mixture with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.24) and prep-HPLC to afford the desired products as light yellow solids.


2-(4-{[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)carbamoyl]amino}piperidin-1-yl)acetamide, MS (ES+, m/z): 635.5; 1-[1-(2-hydroxyethyl)piperidin-4-yl]-3-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)urea, MS (ES+, m/z): 622.3; 3-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-[1-(2-methoxyethyl)piperidin-4-yl]urea, MS (ES+, m/z): 636.1; and 1-[1-(2,3-dihydroxypropyl)piperidin-4-yl]-3-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)urea, MS (ES+, m/z): 652.2.


Example B3
Synthesis of 3-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-[1-(oxan-4-yl)piperidin-4-yl]urea (Compound 14A)



embedded image


Preparation of 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(1-(tetrahydro-2H-pyran-4-yl)piperidin-4-yl)urea: A mixture of 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(piperidin-4-yl)urea (107.37 mg, 1.07 mmol, 98.50 μL, 5 eq.), tetrahydro-4H-pyran-4-one (100 mg, 214.48 μmol, 1 eq.), AcOH (12.88 μg, 2.14e-1 μmol, 1.23e-2 μL, 0.001 eq.), and NaBH3CN (26.96 mg, 428.96 μmol, 2 eq.) in MeOH (2 mL) was stirred at 25° C. for 2 h. LC-MS analysis confirmed that the reaction was complete. The reaction mixture was quenched by adding a saturated solution of NH4HCO3(40 mL) and extracting the mixture with EtOAc (50 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.24) to afford the desired product as a brown solid. 29% yield, MS (ES+, m/z): 551.0.


Preparation of 3-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-[1-(oxan-4-yl)piperidin-4-yl]urea: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (22.17 mg, 92.67 μmol, 1.5 eq.) in DMSO (3 mL) were added 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(1-(tetrahydro-2H-pyran-4-yl)piperidin-4-yl)urea (40 mg, 61.78 μmol, 1 eq.), CuI (11.77 mg, 61.78 μmol, 1 eq.), N-isopropylpropan-2-amine (6.25 mg, 61.78 μmol, 8.73 μL, 1 eq.), and Pd(PPh3)4 (1.43 mg, 1.24 μmol, 0.02 eq.). The mixture was stirred at 45° C. for 1 h. LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (40 mL) at 25° C., and the mixture was extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to obtain the desired product (17.2 mg, 25.89 μmol, 41.91% yield) as a light yellow solid. 3-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-[1-(oxan-4-yl)piperidin-4-yl]urea, MS (ES+, m/z): 662.3.


Example B4
Synthesis of Compounds 10A, 11A, and 12A



embedded image


General procedure for the preparation of 1-(4-(dimethylamino)cyclohexyl)-3-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)urea and 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(pyridin-4-yl)urea: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.) and DIPEA (12 eq.) in DCM was added triphosgene (1 eq.). The mixture was stirred at 0° C. for 0.5 h, and N1,N1-dimethylcyclohexane-1,4-diamine or pyridine-4-amine (1.2 eq.) was added to the reaction. The resulting reaction mixture was stirred further at 0° C. for 0.5 h. TLC analysis showed that the staring material was consumed completely. The reaction mixture was quenched by adding a saturated solution of Na2CO3. The reaction mixture was partitioned by adding EtOAc, and the aqueous phase was extracted with EtOAc (×3). The organic phase was washed with brine (×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give the crude product. The residue was purified by prep-TLC to give the desired products as brown solids.


Preparation of 1-(4-(dimethylamino)cyclohexyl)-3-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)urea and 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(pyridin-4-yl)urea: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1.2 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (1 eq.), 1-(4-(dimethylamino)cyclohexyl)-3-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)urea or 1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(pyridin-4-yl)urea (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 25° C. The mixture was stirred at 25° C. for 1-2 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution and stirring the mixture at 25° C. for 2 h. The reaction mixture was partitioned by adding EtOAc, and the aqueous phase was extracted with EtOAc. The organic phase was washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC prep-HPLC to give solutions of the desired products. The solutions were lyophilized to give the desired products as yellow solids.


3-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-[(1R,4R)-4-(dimethylamino)cyclohexyl]urea, MS (ES+, m/z): 620.3; 3-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-1-[(1S,4S)-4-(dimethylamino)cyclohexyl]urea, MS (ES+, m/z): 620.3; and 1-(2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-3-(pyridin-4-yl)urea, MS (ES+, m/z): 572.3.


Example B5
Preparation of Compound 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N,N-dimethyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 1A)



embedded image


Preparation of tert-butyl (3-(4-(dimethylamino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate: To a mixture of tert-butyl (3-(4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (150 mg, 238.8 μmol, 1 eq.) and dimethylamine hydrochloride (31 mg, 262.73 μmol, 1.1 eq.) in DMF (2 mL) were added Brettphos Pd (G4) (15 mg, 16.72 μmol, 0.07 eq.), Cs2CO3 (233 mg, 716.54 μmol, 3 eq.) and RuPhos (15 mg, 33.44 μmol, 0.14 eq.). The reaction mixture was degassed and purged with N2. The mixture was heated to 90° C. and stirred for 2 h, after which time TLC (PE:EtOAc=1:1, Rf=0.45) and LC-MS analysis indicated that the reaction was complete. The mixture was poured into saturated EDTA solution (10 mL) and stirred for 1 h. The mixture was extracted with EtOAc (20 mL×3), and the combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, and concentrated. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=8:1 to 3:1) to provide tert-butyl (3-(4-(dimethylamino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (100 mg, 141.47 μmol, 72% yield).


Preparation of final product: To a solution of tert-butyl (3-(4-(dimethylamino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (0.1 g, 172.52 μmol, 1 eq.) in EtOAc (2 mL) was added HCl/EtOAc (4 M, 10 mL, 231.85 eq.). The mixture was stirred at 25° C. for 1 h, after which time TLC analysis (PE:EtOAc=1:1, Rf=0.3) indicated that the reaction was complete. The reaction mixture was filtered and concentrated in vacuo. The residue was purified by prep-HPLC to provide 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N,N-dimethyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (27.6 mg, 57.56μmol, 33.36% yield) as a light yellow solid.


Example B6
Preparation of Compound 4-[(3-{4-[(1,5-dihydroxypentan-3-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide (Compound 4A)



embedded image


Synthesis of 3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)pentane-1,5-diol: To a mixture of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 294.05 μmol, 1 eq.) in MeOH (5 mL) were added 1,5-dihydroxypentan-3-one (69.47 mg, 588.09 μmol, 40.50 μL, 2 eq.) and SnCl2-2H2O (13.27 mg, 58.81 μmol, 4.90 μL, 0.20 eq.), followed by PMHS (70.57 mg, 1.18 mmol, 4 eq.). The resulting mixture was stirred for 3 h at 70° C., after which time LC-MS analysis indicated that a species with the desired mass had formed. The mixture was concentrated under reduced pressure to provide a crude residue that was purified by prep-TLC (SiO2, EtOAc:PE=2:1, Rf=0.16. 3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)pentane-1,5-diol (0.05 g, 96.11 μmol, 32.68% yield) was obtained as a yellow oil. MS (ES+, m/z): 443.1.


Synthesis of final product: To a mixture of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (40.75 mg, 144.16 μmol, 1.5 eq.) and 3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)pentane-1,5-diol (0.05 g, 96.11 μmol, 1 eq.) in DMSO (2 mL) were added CuI (18.30 mg, 96.11 μmol, 1 eq.), followed by Pd(PPh3)4(11.11 mg, 9.61 μmol, 0.10 eq.) and N-isopropylpropan-2-amine (9.73 mg, 96.11 μmol, 13.58 μL, 1 eq.). The reaction mixture was stirred at 30° C. for 1 h under N2, after which time TLC analysis (PE:EtOAc=1:2, Rf=0.30) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (30 mL). EtOAc (10 mL) was added, the resulting mixture was stirred at 25° C. for 1 h, and the mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (SiO2, PE:EtOAc=1:2, Rf=0.30) and further purified by prep-HPLC to afford 4-[(3-{4-[(1,5-dihydroxypentan-3-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide (0.007 g, 12.47 μmol, 12.98% yield) as white solid. MS (ES+, m/z): 555.2.


Example B7
Synthesis of 2-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]acetamide (Compound 3A)



embedded image


Synthesis of ethyl (2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)glycinate: To a mixture of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.5 g, 1.47 mmol, 1 eq.) and ethyl 2-bromoacetate (2.46 g, 14.70 mmol, 1.63 mL, 10 eq.) in THF (5 mL) was added DIPEA (1.28 mL, 4.41 mmol, 3 eq.) in one portion at 25° C. under N2. The mixture was stirred at 25° C. for 96 h, after which time TLC analysis (PE:EtOAc=5:1, Rf=0.4) indicated that the reaction was complete. The mixture was concentrated in vacuo at 45° C., and the residue was purified by silica gel chromatography (SiO2, PE:EtOAc=100:1 to 5:1) to afford ethyl (2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)glycinate (400 mg, 844.73 μmol, 57.46% yield) as a yellow solid.


Synthesis of (2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)glycine: To a mixture of ethyl (2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)glycinate (400 mg, 938.59 μmol, 1 eq.) in MeOH (3 mL), THF (9 mL), and water (3 mL) was added LiOH.H2O (196.93 mg, 4.69 mmol, 5 eq.) in one portion at 25° C. under N2. The mixture was stirred at 25° C. for 12 h, after which time LC-MS analysis indicated that the reaction was complete. The mixture was concentrated under reduced pressure at 40° C., and the residue was poured into water (10 mL) and stirred for 1 min. The aqueous phase was extracted with EtOAc (10 mL×2), adjusted to pH 2 by adding 2N HCl, and extracting the mixture again with EtOAc (10 mL×2). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford (2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)glycine (280 mg, 668.14 μmol, 71.19% yield) as a yellow solid.


Synthesis of 2-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)acetamide: To a mixture of (2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)glycine (120 mg, 301.42 μmol, 1 eq.) in DMF (5 mL) were added 1-(3-Dimethylaminopropyl)-3-ethylcarbodiimide (EDCI) (115.56 mg, 602.84 μmol, 2 eq.), HOBt (81.46 mg, 602.84 μmol, 2 eq.), DIPEA (155.82 mg, 1.21 mmol, 210.01 μL, 4 eq.) and NH4Cl (32.25 mg, 602.84 μmol, 21.08 μL, 2 eq.) under N2. The mixture was stirred at 25° C. for 12 h, after which time LC-MS analysis indicated that the reaction was complete. The mixture was poured into water (30 mL) and stirred for 2 min, and the aqueous phase was extracted with EtOAc (20 mL×5). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was washed with DCM (10 mL×3), filtered, and concentrated in vacuo to afford 2-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)acetamide (70 mg, 96.66 μmol, 32.07% yield) as light yellow solid.


Preparation of final product: To a mixture of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (36.30 mg, 151.08 μmol, 1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (127.40 mg, 1.26 mmol, 177.93 μL, 10 eq.), CuI (23.98 mg, 125.90 μmol, 1 eq.), 2-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)acetamide (50 mg, 125.90 μmol, 1 eq.), and Pd(PPh3)4 (29.10 mg, 25.18 μmol, 0.2 eq.) under N2. The mixture was stirred at 45° C. for 1 h, after which time LC-MS and TLC analysis (PE:EtOAc=0:1, Rf=0.32) indicated that the reaction was complete. EtOAc (10 mL) was added, and the mixture was poured into a saturated EDTA solution (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (40 mL×2), and the organic layer was poured again into a saturated EDTA solution (40 mL) and stirred for 1 h. The aqueous phase was extracted again with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, treated with activated carbon, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (PE:EtOAc=0:1, Rf=0.32) and further purified by prep-HPLC to afford 2-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]acetamide (5.1 mg, 9.04 μmol, 7.18% yield) as light yellow solid. MS (ES+, m/z): 510.1.


TABLE 2 shows compounds with a 2-ethynyl-N-(alkyl)-1H-indole-4-amine core.












TABLE 2





Compound


LC-MS


No.
Structure
IUPAC
(ES+, m/z)







1A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop- 1-yn-1-yl}-N,N- dimethyl-1-(2,2,2- trifluoroethyl)-1H- indol-4-amine
480.0





2A


embedded image


3-methoxy-4-[(3-{4-[(2- methoxyethyl)amino]-1- (2,2,2-trifluoroethyl)-1H- indol-2-yl}prop-2-yn- 1-yl)amino]benzene-1- sulfonamide
511.1





3A


embedded image


2-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino] prop-1-yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)amino] acetamide
510.1





4A


embedded image


4-[(3-{4-[(1,5-dihydroxy- pentan-3-yl)amino]-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn- 1-yl)aminol-3-methoxy- benzene-1-sulfonamide
555.2





5A


embedded image


N-(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)acetamide
494.2





6A


embedded image


3-(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)-1-(1- methylpiperidin-4- yl)urea
592.1





7A


embedded image


3-methoxy-4-{[3-(4- {[(1-methylpiperidin- 4-yl)carbamoyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino} benzamide
557.1





8A


embedded image


N-(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)-4-methyl- piperazine-1- carboxamide
578.3





9A


embedded image


N-(2-{3-[(4-carbamoyl- 2-methoxyphenyl)amino] prop-1-yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H-indol- 4-yl)-4-methylpiperazine- 1-carboxamide
543.1





10A


embedded image


3-(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)-1-[(1S,4S)- 4-(dimethylamino)cyclo- hexyl]urea
620.3





11A


embedded image


1-(2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl)-3- (pyridin-4-yl)urea
572.3





12A


embedded image


3-(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)-1-[(1R,4R)- 4-(dimethyl- amino)cyclohexyl]urea
620.3





13A


embedded image


3-(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)-1-[1-(2- methoxyethyl)piperidin- 4-yl]urea
636.1





14A


embedded image


3-(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)-1-[1-(oxan-4- yl)piperidin-4-yl]urea
662.3





15A


embedded image


1-[1-(2,3-dihydroxy- propyl)piperidin-4-yl]-3- (2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoro- ethyl)-1H-indol-4- yl)urea
652.2





16A


embedded image


2-(4-{[(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)carbamoyl] amino}piperidin-1- yl)acetamide
635.2





17A


embedded image


1-[1-(2-hydroxy- ethyl)piperidin-4- yl]-3-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)-1H- indol-4-yl)urea
622.3









C. Compounds with 2-ethynyl-N-(cycloalkyl)-1H-indole-4-amine Core
Example C1
Synthesis of Compounds 31A, 32A, 33A, 34A, and 35A



embedded image


General procedure for the preparation of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-1-methylcyclohexan-1-ol and 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexane-1-carbonitrile: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.) in EtOH were added 4-hydroxy-4-methylcyclohexan-1-one or 4-oxocyclohexane-1-carbonitrile (5 eq.) and Ti(OEt)4 (5 eq.). The reaction mixture was stirred at 50° C. for 3-5 h. Then, NaBH3CN (5 eq.) was added to the reaction under N2 at 0° C., and the mixture was stirred for 5 min. The reaction mixture was warmed to 50° C. and stirred further for 1 h. TLC analysis showed that the starting material was consumed completely. The solution was dried in vacuo to give the crude residue, which was purified by column chromatography or prep-TLC to afford 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-1-methylcyclohexan-1-ol and 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexane-1-carbonitrile as a yellow or brown oil.


Preparation of final products: To a mixture of 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (1.2 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (1 eq.), 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-1-methylcyclohexan-1-ol or 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexane-1-carbonitrile (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 25° C. The mixture was stirred for 1-2 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution at 25° C. and stirring the mixture for 2 h. The reaction mixture was partitioned by adding EtOAc, and the aqueous phase was extracted with EtOAc. The organic phase was washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by column chromatography or prep-TLC, then purified further by prep-HPLC to give a solution of the desired product. The solution was lyophilized to afford the desired product as a yellow solid.


3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-hydroxy-4-methylcyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 543.2; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-hydroxy-4-methylcyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 543.2; 4-[(3-{4-[(4-cyanocyclohexyl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxy-N-methylbenzamide, MS (ES+, m/z): 538.2; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-cyanocyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 538.2; and 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-cyanocyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 538.2.


Example C2
Synthesis of Compounds 279A and 280A



embedded image


To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid (52.68 mg, 231.06 μmol, 1.5 eq.) in DMSO (3 mL) were added N-(4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 154.04 μmol, 1 eq.), CuI (29.34 mg, 154.04 μmol, 1 eq.), N-isopropylpropan-2-amine (15.59 mg, 154.04 μmol, 21.77 μL, 1 eq.), and Pd(PPh3)4 (3.56 mg, 3.08 μmol, 0.02 eq.). The resulting mixture was stirred at 45° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.24) indicated that the reaction was complete. The reaction mixture was quenched with saturated EDTA solution (40 mL) at 25° C. and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and by prep-HPLC to afford the desired products as yellow solids.


4-((3-(4-(((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (26.6 mg, 44.27 μmol, 28.74% yield), MS (ES+, m/z): 597.2; and 4-((3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (26.3 mg, 40.51 μmol, 26.30% yield), MS (ES+, m/z): 597.2.


Example C3
Synthesis of 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-aminocyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide (Compound 25A)



embedded image


Preparation of tert-butyl (4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)carbamate: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (300 mg, 882.14 μmol, 1 eq.) in EtOH (3 mL) were added tert-butyl (4-oxocyclohexyl)carbamate (940.68 mg, 4.41 mmol, 940.68 μL, 5 eq.) and Ti(OEt)4 (1.01 g, 4.41 mmol, 914.66 μL, 5 eq.). The reaction mixture was stirred at 50° C. for 3 h. Then, NaBH3CN (184.78 mg, 2.94 mmol, 5 eq.) was added to the reaction under N2 at 0° C., and the reaction mixture was stirred further for 5 min. The reaction mixture was warmed to 50° C. and stirred further for 1 h. TLC analysis showed that the starting material was consumed completely. The solution was dried in vacuo, and the crude residue was purified by column chromatography or prep-TLC to give the desired product (300 mg, crude) as a yellow oil or solid. MS (ES+, m/z): 552.1.


Preparation of tert-butyl (4-((2-(3-((2-methoxy-4-(methylcarbamoyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)carbamate: To a mixture of 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (73.11 mg, 334.97 μmol, 2 eq.) and tert-butyl (4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)carbamate (100 mg, 167.49 μmol, 1 eq.) in DMSO (3 mL) were added i-Pr2NH (16.95 mg, 167.49 μmol, 23.67 μL, 1 eq.), Pd(PPh3)4 (3.87 mg, 3.35 μmol, 0.02 eq.), and CuI (31.90 mg, 167.49 μmol, 1 eq.) under N2. The reaction mixture was stirred for 1 h at 45° C. TLC analysis indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (40 mL) at 25° C., and extracting the mixture was extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by prep-TLC to afford tert-butyl (4-((2-(3-((2-methoxy-4-(methylcarbamoyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)carbamate (70% yield) as a light-yellow solid.


Preparation of 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-aminocyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide: A solution of tert-butyl (4-((2-(3-((2-methoxy-4-(methylcarbamoyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)carbamate (80 mg, 114.71 μmol, 1 eq.) in a 1:1 mixture of DCM (0.5 mL) and TFA (0.5 mL) was stirred at 25° C. for 1 h. TLC analysis indicated that reaction was complete. The reaction mixture was concentrated under reduced pressure and purified by prep-TLC and prep-HPLC to afford the desired product (13.4 mg, 24.51 μmol, 21.37% yield) as a light-yellow solid. MS (ES+, m/z): 528.2.


Example C4
Synthesis of Compounds 269A, 270A, 396A, and 397A



embedded image


General Procedure: To a mixture of 4-(ethylsulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline (1.3 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (0.5 eq.), N-(4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or N-(4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.20 eq.) at 25° C. The mixture was stirred for 1 h. LC-MS analysis showed that the reaction was complete. EtOAc was poured into the reaction, and the resulting mixture was then poured into a saturated EDTA solution and stirred for 1 h. The aqueous phase was extracted with EtOAc (3×). The combined organic layers were washed with brine (3×), dried over anhydrous sodium sulfate, mixed with activated carbon to remove color, and concentrated in vacuo. The crude residue was purified by prep-TLC and prep-HPLC to obtain the desired product as a light-yellow solid.


N-((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-(3-((4-(ethylsulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 645.2; N-((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-(3-((4-(ethylsulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 645.2; N-((1R,4R)-4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)-2-(3-(ethylsulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 673.2; and N-((1S,4S)-4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)-2-(3-(ethylsulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 673.2.


Example C5
Synthesis of 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(pyrrolidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide (Compound 422A)



embedded image


General procedure for the preparation of 2-iodo-N-(4-(pyrrolidin-1-yl)cyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (1 eq.) in EtOH were added pyrrolidine (5 eq.) and Ti(OEt)4 (5 eq.). The reaction mixture was stirred at 50° C. for 3 h. Then, NaBH3CN (5 eq.) was added to the reaction under N2 at 0° C., and the resulting mixture was stirred for 5 min. The reaction mixture was warmed to 50° C. and stirred for 1 h. TLC and LC-MS analysis showed that the starting material was consumed completely. The solution was dried in vacuo, and the crude residue was purified by column chromatography (SiO2) to afford 2-iodo-N-(4-(pyrrolidin-1-yl)cyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine.


General procedure for the preparation of 3-methoxy-4-((3-(4-(((1R,4R)-4-(pyrrolidin-1-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-benzenesulfonamide: To a mixture of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (1.2 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (1 eq.), 2-iodo-N-(4-(pyrrolidin-1-yl)cyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 25˜45° C. The mixture was stirred for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated solution of EDTA and stirring the resulting mixture at 25° C. for 2 h. EtOAc was added to the reaction mixture, and the aqueous phase was extracted with EtOAc. The organic phase was washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give the crude product. The crude residue was purified by prep-TLC and prep-HPLC to give the solution of the desired product. The solution was lyophilized to afford 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(pyrrolidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide. MS (ES+, m/z): 604.2.


Example C6
Synthesis of Compounds 331A, 332A, 333A, and 334A



embedded image


To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzamide (35.88 mg, 147.97 μmol, 1.5 eq.) in DMSO (3 mL) were added i-Pr2NH (9.98 mg, 98.65 μmol, 13.94 μL, 1 eq.), CuI (626.26 mg, 3.29 mmol, 2 eq.), N-(4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or N-(4-(6-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (60 mg, 98.65 μmol, 1 eq.), and Pd(PPh3)4 (2.28 mg, 1.97 μmol, 0.02 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h under N2. The mixture was poured into a saturated EDTA solution (20 mL), stirred at 25° C. for 1 h, and extracted with EtOAc (20 mL×3). The combined organic layers were concentrated under reduced pressure to give a residue, which was purified by prep-TLC and prep-HPLC to afford the desired product.


3-methoxy-4-{[3-(4-{[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 624.3; 4-((3-(4-(((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzamide, MS (ES+, m/z): 624.3; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{6-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 624.3; 4-((3-(4-(((1S,4S)-4-(6-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzamide. MS (ES+, m/z): 624.3.


Example C7
Synthesis of 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(1,1-dioxo-1λ6-thiomorpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide (Compound 372A)



embedded image


Preparation of 2-iodo-N-(4-thiomorpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (1 eq.) in thiomorpholine (10.90 g, 105.63 mmol, 10 mL, 51.20 eq.) was added AcOH (1 eq.). The reaction mixture was stirred at 25° C. for 2 h. Then, NaBH3CN (5 eq.) was added to the reaction mixture under N2 at 0° C., and the mixture was stirred for 5 min. The reaction mixture was warmed to 50° C. and stirred further for 3 h. TLC and LC-MS analysis showed that the starting material was consumed completely. The reaction was partitioned by adding water (100 mL) and EtOAc (20 mL). The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 0:1) to afford 2-iodo-N-(4-thiomorpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine.


Preparation of 4-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl) thiomorpholine 1,1-dioxide: A mixture of 2-iodo-N-(4-thiomorpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.) in CHCl3 (20 mL) was added m-CPBA (5 eq.) at 0° C. The mixture was stirred at 0-25° C. for 5 h. TLC and LC-MS analysis showed that the reaction was complete. The reaction was partitioned by adding a saturated solution of Na2CO3 (200 mL) and EtOAc (50 mL). The residue was purified by column chromatography (SiO2) to afford 4-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)thiomorpholine 1,1-dioxide.


Preparation of 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(1,1-dioxo-1λ6-thiomorpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide: To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (1.2 eq.) in DMSO (1 mL) were added i-Pr2NH (10 eq.), CuI (1 eq.), 4-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)thiomorpholine 1,1-dioxide (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 25° C. The mixture was stirred for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (30 mL) at 25° C. and stirring the mixture for 2 h. The resulting mixture was partitioned by adding EtOAc (10 mL), and the aqueous phase was extracted with EtOAc (10 mL×3). The organic phase was washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give the crude product. The crude residue was purified by prep-TLC and prep-HPLC to give a solution of the desired product. The solution was lyophilized to afford 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(1,1-dioxo-1λ6-thiomorpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide. MS (ES+, m/z): 668.2.


Example C8
Synthesis of Compounds 77A and 78A



embedded image


Preparation of 2-iodo-1H-indol-4-amine: To a solution of 2-iodo-4-nitro-1H-indole (3 g, 10.4 mmol, 1 eq.) in EtOH (30 mL) was added saturated solution of NH4Cl (5 mL) at 25° C. The mixture was heated to 70° C., and Fe (2.9 g, 52.1 mmol, 5 eq.) was added. The resulting mixture was stirred at 70° C. for 1 h. TLC analysis (PE:EtOAc=3:1, Rf=0.5) showed that the reaction was complete. The reaction mixture was dried, and the residue was dissolved in EtOAc (15 mL) and washed with water (50 mL). The organic layer was then concentrated, and the crude product was purified by column chromatography (PE:EtOAc=2:1) to afford 2-iodo-1H-indol-4-amine (2.5 g, 9.7 mmol, 93% yield) as a black brown solid.


Preparation of (1R,4R)—N1-(2-iodo-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine: To a solution of 2-iodo-1H-indol-4-amine (0.5 g, 1.9 mmol, 1 eq.) in MeOH (5 mL) were added 4-(dimethylamino)cyclohexanone (1.37 g, 9.7 mmol, 5 eq.), polymethyldrosiloxane (PMHS) (581.26 mg, 9.69 mmol, 5 eq.), and SnCl2.2H2O (437.20 mg, 1.94 mmol, 1 eq.). The mixture was stirred at 70° C. for 3 h. LC-MS analysis showed that the reaction was complete. 2 g of sodium sulfate was added to the reaction, and the mixture was filtered. The filtered solution was concentrated in vacuo, and the crude product was purified by prep-TLC (MeOH, Rf=0.3) to afford (1R,4R)—N1-(2-iodo-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine (260 mg, 474.9 μmol, 24.5% yield) as a gray solid. MS (ES+, m/z): 382.0.


Preparation of (1R,4R)—N1-(2-iodo-1-(oxiran-2-ylmethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine and 2-((4-(((1R,4R)-4-(dimethylamino)cyclohexyl)amino)-2-iodo-1H-indol-1-yl)methyl)acrylonitrile: To a solution of (1R,4R)—N1-(2-iodo-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine (1 eq.) in DMF (10 mL) was added NaH (2 eq.). The reaction mixture was stirred at 0° C. for 20 min, and 2-(bromomethyl)oxirane or 2-(bromomethyl)acrylonitrile (1.2 eq.) was added. The reaction mixture was stirred further at 0-25° C. for 40 min. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched with water (10 mL) and extracted with EtOAc (10 mL). The combined organic layers were dried over sodium sulfate, filtered, and concentrated in vacuo. The crude product was purified by prep-TLC to afford the desired products as brown solids. (1R,4R)—N1-(2-iodo-1-(oxiran-2-ylmethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 440.2; and 2-((4-(((1R,4R)-4-(dimethylamino)cyclohexyl)amino)-2-iodo-1H-indol-1-yl)methyl)acrylonitrile, MS (ES+, m/z): 449.0.


General procedure for the preparation of (1R,4R)—N4-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-[(oxiran-2-yl)methyl]-1H-indol-4-yl)-N1,N1-dimethylcyclohexane-1,4-diamine and 2-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1H-indol-1-yl)methyl]prop-2-enenitrile: To a mixture of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1.3 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (1 eq.), (1R,4R)—N1-(2-iodo-1-(oxiran-2-ylmethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine or 2-((4-(((1R,4R)-4-(dimethylamino)cyclohexyl)amino)-2-iodo-1H-indol-1-yl)methyl)acrylonitrile (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 25° C. The mixture was stirred for 1 h under N2. LC-MS or TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution, and the resulting mixture was stirred at 25° C. for 2 h. The reaction mixture was partitioned by adding EtOAc. The layers were separated, and the aqueous phase was extracted with EtOAc. The organic phase was washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC and prep-HPLC to give a solution of the desired product. The solution was lyophilized to afford the desired product as a light-yellow solid. (1R,4R)—N4-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-[(oxiran-2-yl)methyl]-1H-indol-4-yl)-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 551.2; and 2-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1H-indol-1-yl)methyl]prop-2-enenitrile, MS (ES+, m/z): 560.3.


Example C9
Synthesis of Compounds 119A, 120A, 314A, and 315A



embedded image


General Procedure for the preparation of N-(4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine: To a solution of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (1 eq.) in EtOH were added 7-oxa-2-azaspiro[3.5]nonane or dimethylamine (5 eq.), Ti(OEt)4 (5 eq.), and i-Pr2NH (1 eq.). The reaction mixture was stirred at 50° C. for 3 h. Then, NaBH3CN (5 eq.) was added to the reaction mixture under N2 at 0° C., and the mixture was stirred further for 5 min, warmed to 50° C., and stirred for 1 h. TLC and LC-MS analysis showed that the starting material was consumed completely. The solution was concentrated under reduced pressure to give the crude product. The crude residue was purified by column chromatography (SiO2) to afford the desired products.


Preparation of final products: To a solution of 4-(ethylsulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline (1.2 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (1 eq.), N-(4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution at 25° C. and stirring the mixture for 2 h. EtOAc was added to the mixture, and the aqueous phase was extracted with EtOAc, The organic phase was washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give the crude product. The crude residue was purified by prep-TLC and prep-HPLC to give solutions of the desired products. The solutions were lyophilized to afford the desired products.


2-(3-{[4-(ethanesulfonyl)-2-methoxyphenyl]amino}prop-1-yn-1-yl)-N-[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 673.4; 2-(3-{[4-(ethane sulfonyl)-2-methoxyphenyl]amino}prop-1-yn-1-yl)-N-[(1S,4S)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 673.3; (1R,4R)—N4-[2-(3-{[4-(ethane sulfonyl)-2-methoxyphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 591.4; and (1S,4S)—N4-[2-(3-{[4-(ethane sulfonyl)-2-methoxyphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 591.3.


Example C10
Synthesis of Compounds 153A and 154A



embedded image


Preparation of (1R,4R)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine and (1S,4S)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine: To a solution of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (1 g, 2.20 mmol, 1 eq.) and 2-methoxy-N-methyl-ethanamine (980.84 mg, 11 mmol, 1.18 mL, 5 eq.) in EtOH (10 mL) was added Ti(OEt)4 (2.01 g, 8.80 mmol, 1.83 mL, 4 eq.). The mixture was stirred at 50° C. for 4 h, and NaBH3CN (276.59 mg, 4.40 mmol, 2 eq.) was added. The resulting mixture was stirred at 50° C. for 1 h. LC-MS and TLC analysis (PE:EtOAc=3:1, Rf1=0.05, Rf2=0.10) showed that the reaction was complete. The reaction mixture was poured into a saturated aqueous solution of NaHCO3 (60 mL) and filtered to give a filter liquor. The filter liquor was extracted with EtOAc (60 mL×3). The combined organic layers were washed with brine (40 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc:TEA=20:20:1, Rf1=0.3, Rf2=0.4) to afford the desired product as a yellow oil.


(1R,4R)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine (600 mg, 1.06 mmol, 48.17% yield); and (1S,4S)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine (500 mg, 883.49 μmol, 40.14% yield).


Preparation of N-ethyl-3-methoxy-4-((3-(4-((4-((2-methoxyethyl)(methyl)amino)cyclohexyl)-amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzamide: To a mixture of N-ethyl-3-methoxy-4-(prop-2-yn-1-ylamino)benzamide (1-2 eq., HCl or free) in DMSO (1-10 mL) were added i-Pr2NH (10˜30 eq.), CuI (1˜2 eq.), (1R,4R)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine or (1S,4S)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.) at 20˜45° C. The mixture was stirred at 20˜45° C. for 1˜4 h. EtOAc (10 mL) was poured into the reaction mixture, and the resulting mixture was then poured into 2N aqueous EDTA (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (30 mL×3). The organic layer was poured again into saturated EDTA solution (30 mL) (saturation) and stirred further for 1 h. The aqueous phase was extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, treated with activated carbon, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC or column chromatography, then purified once or twice prep-HPLC to afford N-ethyl-3-methoxy-4-((3-(4-((4-((2-methoxyethyl)(methyl)amino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzamide.


Example C11
Synthesis of Compounds 117A, 118A, 155A, 156A, and 661A



embedded image


General Procedure: To a mixture of the R- and R2-substituted alkyne compound above (1˜2 eq.) in DMSO were added i-Pr2NH (10˜30 eq.), CuI (1˜2 eq.), R1-substituted 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.). The mixture was stirred at 20˜45° C. for 1˜3 h under N2. The mixture was poured into a saturated aqueous solution of EDTA and stirred for 1 h, and the aqueous phase was extracted with EtOAc (3×) The combined organic layers were washed with brine (3×), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by TLC, prep-HPLC, or TLC and prep-HPLC to afford the desired product.


(1R,4R)—N1-(2-(3-((2-(fluoromethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 595.2; (1S,4S)—N1-(2-(3-((2-(fluoromethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 595.2; (1R,4R)—N1-(2-(3-((2-(fluoromethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine, MS (ES+, m/z): 639.3; (1S,4S)—N1-(2-(3-((2-(fluoromethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine, MS (ES+, m/z): 639.3; and 2-(2-{[3-(4-{[1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-5-methanesulfonylphenoxy)acetonitrile, MS (ES+, m/z): 618.2.


Example C12
Synthesis of Compounds 183A and 184A



embedded image


Preparation of 2-iodo-N-((1R,4R)-4-morpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and 2-iodo-N-((1S,4S)-4-morpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (1 g, 2.20 mmol, 1 eq.) and morpholine (9.59 g, 110.04 mmol, 9.68 mL, 50 eq.) was added AcOH (158.59 mg, 2.64 mmol, 151.04 μL, 1.2 eq.). The mixture was stirred at 25° C. for 4 h, and NaBH3CN (276.60 mg, 4.40 mmol, 2 eq.) was added. The resulting mixture was stirred at 25° C. for 1 h. LC-MS and TLC analysis (PE:EtOAc=3:1, Rf1=0.1, Rf2=0.15) showed that the reaction was complete. The reaction mixture was poured into a saturated aqueous solution of NaHCO3 (60 mL) and filtered to give a filter liquor. It was then extracted with EtOAc (60 mL×3). The combined organic layers were washed with brine (40 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=2:1 to 0:1, Rf1=0.2, Rf2=0.3) to afford the desired products as light-yellow solids. 2-iodo-N-((1R,4R)-4-morpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (550 mg, 975.70 μmol, 44.33% yield); and 2-iodo-N-((1S,4S)-4-morpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (500 mg, 887 μmol, 40.30% yield).


Preparation of N-ethyl-3-methoxy-4-{[3-(4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide and N-ethyl-3-methoxy-4-((3-(4-(((1S,4S)-4-morpholinocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzamide: To a solution of N-ethyl-3-methoxy-4-(prop-2-yn-1-ylamino)benzamide (1˜2 eq., HCl or free) in DMSO (1˜10 mL) were added i-Pr2NH (10˜30 eq.), CuI (1˜2 eq.), 2-iodo-N-((1R,4R)-4-morpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or 2-iodo-N-((1S,4S)-4-morpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.) at 20˜45° C. The mixture was stirred at 20˜45° C. for 1˜4 h. EtOAc (10 mL) was poured into the mixture, and the resulting mixture was then poured into 2N aqueous EDTA (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (3×). The combined organic layers were poured to 2N aqueous EDTA and stirred for 1 h. The aqueous phase was extracted again with EtOAc (3×). The combined organic layers were washed with brine (3×), dried over anhydrous sodium sulfate, treated with activated carbon, filtered, and concentrated in vacuo. The crude mixture was purified by prep-TLC or column chromatography, then purified once or twice using prep-HPLC to afford the desired products.


N-ethyl-3-methoxy-4-{[3-(4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 612.3; and N-ethyl-3-methoxy-4-((3-(4-(((1S,4S)-4-morpholinocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzamide, MS (ES+, m/z): 612.3.


Example C13
Synthesis of Compounds 324A and 325A



embedded image


Preparation of N-((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-(3-((2-(fluoromethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-(3-((2-(fluoromethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of N-(4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.) and 2-(fluoromethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1.2 eq.) in DMSO (3 mL) were added i-Pr2NH (10 eq.), CuI (1 eq.), and Pd(PPh3)4 (0.2 eq.) in one portion under N2. The mixture was stirred at 20° C. for 2 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was diluted with EtOAc (20 mL), and the resulting mixture was poured into saturated EDTA solution (10 mL) and stirred for 0.5 h. The organic layer was poured into saturated EDTA solution (20 mL) and stirred further for 1 h. The resulting aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with water (25 mL×3) and brine (15 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC and prep-HPLC to obtain the desired product as a white solid. N-((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-(3-((2-(fluoromethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 677.3; and N-((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-(3-((2-(fluoromethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 677.3.


Example C14
Synthesis of Compounds 83A, 84A, 85A, and 86A



embedded image


To a mixture of N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)acetamide or N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)propionamide (1.5 eq.) and N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine (1 eq.) in DMSO (2 mL) were added CuI (1 eq.), Pd(PPh3)4 (0.10 eq.), and N-isopropylpropan-2-amine (1 eq.) at 30° C. The mixture was stirred for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (30 mL) and EtOAc (10 mL) and stirring the mixture at 25° C. for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC and prep-HPLC to afford the desired products.


N-(3-methoxy-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzenesulfonyl)acetamide, C-MS (ES+, m/z): 620.1; N-(3-methoxy-4-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzenesulfonyl)acetamide, C-MS (ES+, m/z): 620.3; N-(3-methoxy-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzenesulfonyl)propanamide, C-MS (ES+, m/z): 634.3; and N-(3-methoxy-4-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzenesulfonyl)propenamide, MS (ES+, m/z): 634.2.


Example C15
Synthesis of Compounds 95A, 234A, 329A, 330A, 346A, 347A, 393A, 394A, 518A



embedded image


To a solution of 2-ethoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1.5 eq.) in DMSO (25 mg/mL) were added 2-iodo-N—(R1)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), CuI (1 eq.), i-Pr2NH (1 eq.), and Pd(PPh3)4 (0.02 eq.). The mixture was stirred at 45° C. for 1 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.24) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (40 mL) at 25° C. and extracting the mixture with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC and prep-HPLC to afford the desired products as yellow solids.


N-((1R,4R)-4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)-2-(3-((2-ethoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 673.2; N-((1S,4S)-4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)-2-(3-((2-ethoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 673.2; N-((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-(3-((2-ethoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 673.3; N-((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-(3-((2-ethoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 673.3; 2-(3-((2-ethoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 563.2; 2-(3-((2-ethoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-((1R,4R)-4-morpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 633.2; 2-(3-((2-ethoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-((1S,4S)-4-morpholinocyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 633.2; 2-{3-[(2-ethoxy-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 645.2; and (1R,4R)—N4-(2-{3-[(2-ethoxy-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 591.2.


Example C16
Synthesis of Compounds 174A, 175A, 176A, 177A, 178A, 179A, and 180A



embedded image


embedded image


Preparation of 2-iodo-4-nitro-1-(phenylsulfonyl)-1H-indole: To a solution of 2-iodo-4-nitro-1H-indole (3 g, 10.4 mmol, 1 eq.) in THF (30 mL) was added NaH (1.3 g, 31.3 mmol, 60% in mineral oil, 3 eq.). The reaction mixture was stirred at 0° C. for 10 min, and benzenesulfonyl chloride (2.8 g, 15.7 mmol, 2 mL, 1.5 eq.) was then added to the solution. The reaction mixture was stirred at 25° C. for 50 min. TLC analysis (PE:EtOAc=5:1, Rf=0.5) showed that the reaction was complete. The reaction mixture was quenched by adding water (50 mL) and extracted with EtOAc (50 mL). The crude product was washed with PE (100 mL), and the resulting solution was filtered and concentrated to afford the desired product (4.15 g, 9.7 mmol, 93.1% yield) as a yellow solid.


Preparation of 2-iodo-1-(phenylsulfonyl)-1H-indol-4-amine: A solution of 2-iodo-4-nitro-1-(phenylsulfonyl)-1H-indole (1.3 g, 3 mmol, 1 eq.) in AcOH (15 mL) was heated to 70° C., and Fe (847.7 mg, 15.2 mmol, 5 eq.) was added. The resulting mixture was stirred further at 70° C. for 1 h. TLC analysis (PE:EtOAc=3:1, Rf=0.5) showed that the reaction was complete. The reaction mixture was concentrated, and the crude product was extracted with EtOAc (15 mL) and washed with water (50 mL). The crude residue was purified by silica gel chromatography (PE:EtOAc=2:1) and again by prep-HPLC to afford the desired product (1 g, 2.51 mmol, 82.71% yield) as a yellow oil. MS (ES+, m/z): 399.1.


Preparation of 2-iodo-N-((1R,4R)-4-morpholinocyclohexyl)-1-(phenylsulfonyl)-1H-indol-4-amine: To a mixture of 2-iodo-1-(phenylsulfonyl)-1H-indol-4-amine (1 g, 2.5 mmol, 1 eq.) and 4-morpholinocyclohexanone (920.3 mg, 5 mmol, 2 eq.) in DMF (10 mL) was added TMSCl (545.6 mg, 5 mmol, 637.4 μL, 2 eq.). The mixture was stirred at 0° C. for 1 h, and BH3.THF (1M, 7.5 mL, 3 eq.) was added to the reaction mixture under N2. The mixture was stirred further at 0° C. for 2 h. TLC analysis (PE:EtOAc=5:1, Rf=0.5) showed that the starting material was consumed completely. The reaction mixture was partitioned by adding water (100 mL) and EtOAc (100 mL). The organic phase was separated, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a filter liquor. The filter liquor was dried further by vacuum to give the crude product as a yellow oil. The yellow oil was purified by chromatography on silica gel column chromatography (PE:EtOAc=5:1) to give the desired product (0.55 g, crude) as a yellow oil.


Preparation of 2-iodo-N-((1R,4R)-4-morpholinocyclohexyl)-1H-indol-4-amine: To a solution of 2-iodo-N-((1R,4R)-4-morpholinocyclohexyl)-1-(phenylsulfonyl)-1H-indol-4-amine (0.3 g, 530.5 μmol, 1 eq.) in MeOH (10 mL) was added K2CO3 (586.6 mg, 4.2 mmol, 8 eq.) at 20° C. The mixture was heated to 80° C. and stirred for 2 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was concentrated and purified using silica gel column chromatography (PE:EtOAc=1:1, added Et3N, Rf=0.5) to afford the desired product (0.2 g, 470 μmol, 88.6% yield) as a yellow solid.


General Procedure for the preparation of R-substituted 2-iodo-1-R—N-((1R,4R)-4-morpholinocyclohexyl)-1H-indol-4-amine: To a solution of 2-iodo-N-((1R,4R)-4-morpholinocyclohexyl)-1H-indol-4-amine (1 eq.) in DMF (10 mL) was added NaH (2 eq.; 60% in mineral oil). The reaction mixture was stirred at 0° C. for 20 min, and R—Br was added (1˜1.2 eq.). The resulting reaction mixture was stirred at 0˜25° C. for 40 min. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (10 mL) and extracted with EtOAc (10 mL). The organic phase was concentrated in vacuo and purified by prep-TLC to give the desired product as a brown solid.


General Procedure for the preparation of final products: To a mixture of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline or 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (1.3 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (1 eq.), 2-iodo-1-(R-substituted)-N-((1R,4R)-4-morpholinocyclohexyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 25° C. The mixture was stirred for 1 h under N2. LC-MS or TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution at 25° C. and stirring the mixture for 2 h. The reaction mixture was partitioned between by adding EtOAc, and the aqueous phase was extracted with EtOAc. The organic phase was washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated in vacuo to give the crude product. The crude residue was purified by prep-TLC and prep-HPLC to give the solution of the desired product. The solution was lyophilized to afford the desired products as light yellow solids.


1-(2-fluoroethyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]-1H-indol-4-amine, MS (ES+, m/z): 583.3; 1-(2,2-difluoroethyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]-1H-indol-4-amine, MS (ES+, m/z): 601.3; 2-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1H-indol-1-yl)acetonitrile, MS (ES+, m/z): 576.3; 4-({3-[1-(2-fluoroethyl)-4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1H-indol-2-yl]prop-2-yn-1-yl}amino)-3-methoxy-N-methylbenzamide, MS (ES+, m/z): 562.3; 4-({3-[1-(cyanomethyl)-4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1H-indol-2-yl]prop-2-yn-1-yl}amino)-3-methoxy-N-methylbenzamide, MS (ES+, m/z): 555.3; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-propyl-N-[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]-1H-indol-4-amine, MS (ES+, m/z): 579.3; and 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2-methylpropyl)-N-[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]-1H-indol-4-amine, MS (ES+, m/z): 593.3.


Example C17
Synthesis of Compounds 309A, 310A, 311A, and 312A



embedded image


Preparation of methyl 2-(2-((3-(4-((4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxylacetate: To a solution of methyl 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetate (19.55 mg, 65.77 μmol, 1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (16.64 mg, 164.42 μmol, 23.24 μL, 3 eq.), CuI (10.44 mg, 54.81 μmol, 1 eq.), N-(4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.03 g, 54.81 μmol, 1 eq.), and Pd(PPh3)4 (6.33 mg, 5.48 μmol, 0.1 eq.). The mixture was stirred for 10 min at 40° C. under N2. LC-MS analysis showed that the reaction was complete. The reaction was diluted with EtOAc (20 mL) and saturated EDTA solution (20 mL) and stirred at 20° C. for 1 h. The mixture was then extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desired product (0.0103 g, 13.84 μmol, 25.25% yield) as a light yellow solid. MS (ES+, m/z): 717.2.


Preparation of 2-(2-((3-(4-(((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxylacetic acid: To a solution of methyl 2-(2-((3-(4-((4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxy)acetate (0.08 g, 111.61 μmol, 1 eq.) in THF (1 mL) were added MeOH (1 mL), water (0.4 mL), and LiOH.H2O (9.37 mg, 223.21 μmol, 2 eq.). The mixture was stirred for 0.5 h at 40° C. under N2. LC-MS analysis showed that the reaction was complete. The pH of the reaction mixture was adjusted to 6 using 2M aqueous formic acid, and the resulting white solid was filtered, and concentrated. The crude residue was purified by prep-HPLC to afford the desired product (0.0085 g, 12.09 μmol, 10.84% yield) as a white solid. MS (ES+, m/z): 703.2.




embedded image


Preparation of methyl 2-(2-((3-(4-(((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxy)acetate: To a solution of 2-iodo-N-[4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (0.15 g, 274.03 μmol, 1 eq.) in DMSO (5 mL) were added i-Pr2NH (83.19 mg, 822.08 μmol, 116.18 μL, 3 eq.), CuI (52.19 mg, 274.03 μmol, 1 eq.), methyl 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetate (122.21 mg, 411.04 μmol, 1.5 eq.), and Pd(PPh3)4 (31.67 mg, 27.40 μmol, 0.1 eq.). The mixture was stirred for 10 min at 40° C. under N2. TLC analysis showed that the reaction was complete. The reaction was diluted with EtOAc (20 mL) and saturated EDTA solution and stirred further at 20° C. for 1 h. The reaction mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=20:1) and prep-HPLC to afford the desired product (0.0169 g, 23.46 μmol, 8.56% yield) as a light yellow solid. MS (ES+, m/z): 717.2.


Preparation of 2-(2-((3-(4-(((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxy)acetic acid: To a solution of methyl 2-(2-((3-(4-(((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxy)acetate (0.06 g, 83.70 μmol, 1 eq.) in MeOH (0.5 mL) were added THF (0.5 mL), water (0.2 mL), and LiOH.H2O (7.02 mg, 167.41 μmol, 2 eq.). The mixture was stirred for 0.5 h at 40° C. under N2. LC-MS analysis showed that the reaction was complete. The mixture was purified by prep-HPLC to afford the desired product (0.0162 g, 23.05 μmol, 27.54% yield) as a white solid. MS (ES+, m/z): 703.2.


Example C18
Synthesis of Compounds 130A, 131A, 265A, 266A, 512A, and 716A



embedded image


Preparation of 4-chloro-2-methoxy-N-(prop-2-yn-1-yl)aniline: To a mixture of 4-chloro-2-methoxyaniline (2 g, 1 eq.) and 3-bromoprop-1-yne (1.27 g, 0.8 eq.) in CHCl3 (10 mL) and THF (10 mL) was added DIPEA (6.30 mL, 3 eq.). The mixture was stirred at 70° C. for 6 h. LC-MS or TLC analysis showed that the reaction was complete. The reaction mixture was concentrated in vacuo. The crude product was poured into water, and the aqueous phase was extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (80 mL), dried over anhydrous Na2SO4, filtered, and concentrated in vacuo. The crude residue was purified by column chromatography to afford the desired product (700 mg, 26.71% yield) as a yellow oil. MS (ES+, m/z): 196.0.


General procedure for the preparation of 2-(34(4-chloro-2-methoxyphenyl)amino)prop-1-yn-1-yl)-N—R1-substituted-1-(2,2,2-trifluoroethyl)-1H-indol-4-amines: To a solution of 4-chloro-2-methoxy-N-(prop-2-yn-1-yl)aniline (2 eq.) in DMSO (3 mL) were added i-Pr2NH (10 eq.), CuI (1 eq.), 2-iodo-N—R1-substituted-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.40 eq.). The mixture was stirred at 45° C. for 2˜5 h under N2. LC-MS or TLC analysis showed that the reaction was complete. The mixture was poured into a saturated EDTA solution and stirred for 1 h. The aqueous phase was extracted with EtOAc (3×). The combined organic layers were washed with brine (3×), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by TLC, prep-HPLC, or TLC and prep-HPLC to afford the desired products.


(1R,4R)—N4-(2-{3-[(4-chloro-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 533.2; (1S,4S)—N1-(2-(3-((4-chloro-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 533.2; N-((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-(3-((4-chloro-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 587.2; N-((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-(3-((4-chloro-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 587.2; 2-{3-[(4-chloro-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 505.1; and 1-{4-[(2-{3-[(4-chloro-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol, MS (ES+, m/z): 579.2.


Example C19
Synthesis of 4-(3-(4-(((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-7-(methylsulfonyl)-2H-benzo[b][1,4]oxazin-3(4H)-one (Compound 326A)



embedded image


Preparation of 2-(2-((3-(4-(((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxy)acetonitrile: To a solution of 6-(methylsulfonyl)-3-(prop-2-yn-1-yl)benzo[d]oxazol-2(3H)-one (706.14 mg, 2.14 mmol, 1.3 eq.) in DMSO (10 mL) were added i-Pr2NH (4.99 g, 49.32 mmol, 6.97 mL, 30 eq.), CuI (626.26 mg, 3.29 mmol, 2 eq.), N-((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 g, 1.64 mmol, 1 eq.), and Pd(PPh3)4 (474.98 mg, 411.04 μmol, 0.25 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h under N2. TLC analysis (DCM:TEA:MeOH=100:1:10, Rf=0.3) indicated that the starting material consumed completely. The mixture was poured into saturated EDTA solution (100 mL), stirred at 25° C. for 1 h, and extracted with EtOAc (50 mL×3). The combined organic layers were poured into a saturated EDTA solution (200 mL) and stirred at 25° C. for 1 h. The aqueous phase was extracted with EtOAc (100 mL×3). The combined organic layers were concentrated under reduced pressure to give a residue, which was purified by column chromatography (DCM:MeOH=50:1 to 5:1) to afford the desired product (1 g, 1.46 mmol, 88.95% yield). MS (ES+, m/z): 684.3.


Preparation of 4-(3-(4-(((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-7-(methylsulfonyl)-2H-benzo[b][1,4]oxazin-3(4H)-one: To a mixture of 2-(2-((3-(4-(((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxy)acetonitrile (0.5 g, 731.23 μmol, 1 eq.) in acetonitrile (10 mL) and water (10 mL) was added TFA (19.25 g, 168.83 mmol, 12.50 mL, 230.88 eq.) at 25° C. The mixture was stirred at 25° C. for 8 h. LC-MS analysis showed that the starting material was consumed completely. The mixture was poured into a saturated Na2CO3 solution (50 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (DCM:MeOH=10:1, Rf=0.3) and further purified by prep-HPLC. The resulting solution was concentrated under reduced pressure to remove acetonitrile. A saturated Na2CO3 solution was added drop-wise into the mixture to adjust the pH of the solution to 8. The mixture was then extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford the desired product (154.4 mg, 220.52 μmol, 30.16% yield) as a yellow solid. MS (ES+, m/z): 685.3.


Example C20
Synthesis of Compounds 125A, 126A, 291A, 292A, 493A, and 671A



embedded image


General Procedure: To a solution of 6-(methylsulfonyl)-3-(prop-2-yn-1-yl)benzo[d]oxazol-2(3H)-one (2 eq.) in DMSO (1 mL) were added i-Pr2NH (30 eq.), CuI (1˜2 eq.), 2-iodo-N—R1-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.150.50 eq.). The mixture was stirred at 25° C. for 1 h under N2. LC-MS or TLC analysis showed that the reaction was complete. The mixture was poured into a saturated EDTA solution and stirred for 1 h. The aqueous phase was extracted with EtOAc (3×). The combined organic layers were washed with brine (3×), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC, prep-HPLC, or prep-TLC and prep-HPLC to afford the desired products.


3-(3-(4-(((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-6-(methylsulfonyl)benzo[d]oxazol-2(3H)-one, MS (ES+, m/z): 643.2; 3-(3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-6-(methylsulfonyl)benzo[d]oxazol-2(3H)-one, MS (ES+, m/z): 643.2; 3-(3-(4-((1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-6-(methylsulfonyl)benzo[d]oxazol-2(3H)-one, MS (ES+, m/z): 635.3; 3-(3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-6-(methylsulfonyl)benzo[d]oxazol-2(3H)-one, MS (ES+, m/z): 561.2; 3-(3-(4-(((1R,4R)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-6-(methylsulfonyl)benzo[d]oxazol-2(3H)-one, MS (ES+, m/z): 589.2; 3-(3-(4-(((1S,4S)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-6-(methylsulfonyl)benzo[d]oxazol-2(3H)-one, MS (ES+, m/z): 589.2.


Example C21
Synthesis of Compounds 148A, 187A, and 395A



embedded image


To a solution of 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (2-2.2 eq.) in DMSO (2-4 mL) were added i-Pr2NH (10 eq.) and CuI (1 eq.). Then, 2-iodo-4-R-1-(2,2,2-trifluoroethyl)-1H-indole (1 eq.) and Pd(PPh3)4 (0.2-0.4 eq.) were added, and the resulting mixture was stirred at 25° C. for 60 min under N2. TLC and LC-MS analysis were used to monitor the reaction. The reaction mixture was diluted with EtOAc (15 mL), and poured into saturated EDTA solution (20 mL), and stirred for 1 h. The aqueous phase was then extracted with EtOAc (20 mL×3). The combined organic layers were washed with water (20 mL×2) and brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated to give a residue. The residue was purified by prep-TLC and prep-HPLC to afford the desired products.


3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 674.2; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 634.3; and 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(diethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 620.2.


Example C22
Synthesis of 3-methoxy-N,N-dimethyl-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide (Compound 127A)



embedded image


To a solution of 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (1.5-2 eq.) in DMSO (2 mL) were added i-Pr2NH (10 eq.) and CuI (1 eq.). Then, (1S,4S)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine (1 eq.) and Pd(PPh3)4 (0.4 eq.) were added, and the mixture was stirred at 25° C. for 60 min under N2. TLC and LC-MS analysis were used to monitor the reactions. The reaction mixture was diluted with EtOAc (15 mL) and poured into saturated EDTA solution (20 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with water (20 mL×2) and brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated to give a residue. The residue was purified by prep-TLC and prep-HPLC to obtain the desired product. MS (ES+, m/z): 606.2.


Example C23
Synthesis of 2-fluoro-5-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide (Compound 136A)



embedded image


A mixture of (1R,4R)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine (180 mg, 386.85 μmol), 2-fluoro-5-methoxy-N-methyl-4-(prop-2-ynylamino)benzamide (91.39 mg, 386.85 μmol, 1 eq.), CuI (73.68 mg, 386.85 μmol, 1 eq.), Pd(PPh3)4 (89.41 mg, 77.37 μmol, 0.2 eq.), and i-Pr2NH (391.46 mg, 3.87 mmol, 546.73 μL, 10 eq.) in DMSO (3 mL) was degassed and purged with N2 three times. The mixture was then stirred at 20° C. for 1 h under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.5) indicated that the starting material remained, and one major new spot was detected. The mixture was added to saturated EDTA solution and stirred at 20° C. for 1 h under N2. The reaction mixture was quenched by adding water (20 mL) and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1) and prep-HPLC to afford the desired product (0.058 g, 100.61 μmol, 26.01% yield) as a yellow solid. MS (ES+, m/z): 574.3.


Example C24
Synthesis of N-[(7S,8R)-7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 870A)



embedded image


Preparation of tert-butyl (3-(4-(((7S,8R)-7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate: To a mixture of tert-butyl (3-(4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (500 mg, 812.40 μmol, 1 eq.) and 7-fluoro-1,4-dioxaspiro[4.5]decan-8-amine (189.15 mg, 893.64 μmol, 1.1 eq., HCl) in dioxane (5 mL) were added Cs2CO3 (794.09 mg, 2.44 mmol, 3 eq.), RuPhos (49.28 mg, 105.61 μmol, 0.13 eq.), and BrettPhos (Pd, G4) (44.87 mg, 48.74 μmol, 0.06 eq.) under N2. The mixture was stirred at 20° C. and slowly warmed to 110° C. under N2. The mixture was then stirred at 110° C. for 17 h. TLC analysis (PE:EtOAc=1:1, Rf=0.5) indicated that 10% of the starting material remained, and one major new spot with polarity larger than that of the starting material was detected. The reaction mixture was quenched by adding a saturated EDTA solution (100 mL) and extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=5:1 to 1:1) and reversed-phase HPLC to afford the desired product (240 mg, 324.62 μmol, 38.40% yield) as a yellow solid. MS (ES+, m/z): 710.3.


Preparation of N-[(7S,8R)-7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of tert-butyl (3-(4-(((7S,8R)-7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (30 mg, 40.58 μmol, 1 eq.) in TFA (770 mg, 6.75 mmol, 0.5 mL, 166.42 eq.) and DCM (1 mL) was degassed and purged with N2 three times. The mixture was stirred at 25° C. for 30 min under N2. TLC analysis (PE:EtOAc=1:1, Rf=0.4) indicated that 10% of the starting material remained, and one major new spot with polarity greater than that of the starting material was detected. The reaction mixture was concentrated under reduced pressure to remove solvent. The residue was diluted with a saturated Na2CO3 solution (5 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (3 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was purified by reversed-phase HPLC to give the desired product (11.4 mg, 18.59 μmol, 45.81% yield) as a white solid. MS (ES+, m/z): 610.2.


Example C25
Synthesis of Compounds 273A, 274A, 281A, 282A, 521A, and 696A



embedded image


General Procedure: To a mixture of alkyne (1-2 eq.) in DMSO (2 mL) were added i-Pr2NH (3-10 eq.), CuI (0.20-1 eq.), 2-iodo-N—(R2-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.). The mixture was stirred at 20˜40° C. for 1-3 h under N2. LC-MS or TLC analysis detected the reaction was complete. The mixture was poured into saturated EDTA solution and stirred for 1 h. The aqueous phase was extracted with EtOAc (3×). The combined organic layers were washed with brine (3×), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC, then by prep-HPLC to afford the desired compound.


2-fluoro-5-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide), MS (ES+, m/z): 614.2; 4-((3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzamide, MS (ES+, m/z): 614.2; 2-fluoro-5-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzoic acid, MS (ES+, m/z): 615.2; 4-((3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzoic acid, MS (ES+, m/z): 615.2; 2-(3-(((3R,4R)-3-methoxytetrahydro-2H-pyran-4-yl)amino)prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 497.2; and 1-methoxy-3-(4-((2-(3-(((3R,4R)-3-methoxytetrahydro-2H-pyran-4-yl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol, MS (ES+, m/z): 553.2.


Example C26
Synthesis of Compounds 305A and 306A



embedded image


General Procedure: To a mixture of N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)acetamide (1.3 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (0.5 eq.), N-(4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.20 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h. LC-MS analysis showed that the reaction was complete. EtOAc (20 mL) was poured into the mixture, and the resulting mixture was poured into a saturated EDTA solution (30 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, treated with activated carbon, filtered, and concentrated in vacuo. The residue was purified by prep-TLC and prep-HPLC to afford the desired products as white solids.


N-((4-((3-(4-(((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)acetamide, MS (ES+, m/z): 702.3; and N-((4-((3-(4-(((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)acetamide, MS (ES+, m/z): 702.3.


Example C27
Synthesis of Compounds 307A and 308A



embedded image


General Procedure: To a mixture of 2-amino-N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)acetamide (1.2 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (0.5 eq.), N-(4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.20 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h. LC-MS and HPLC analysis showed that the reaction was complete. EtOAc (10 mL) was poured into the mixture, and the resulting mixture was poured into a saturated EDTA solution (30 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (30 mL×2). The organic layer was poured to a saturated EDTA solution (30 mL) and stirred further for 1 h. The aqueous phase was extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-HPLC to afford the desired products as light yellow solids.


N-((4-((3-(4-(((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)-2-aminoacetamide, MS (ES+, m/z): 717.3; and N-((4-((3-(4-(((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)-2-aminoacetamide, MS (ES+, m/z): 717.3.


Example C28
Synthesis of Compounds 514A, 513A, 683A, 684A, 132A, 133A, 128A, 129A, 271A, and 272A



embedded image


General Procedure: To a solution of (3S,4R)-3-methoxy-N-(prop-2-yn-1-yl)tetrahydro-2H-pyran-4-amine or 2-fluoro-5-methoxy-4-(prop-2-yn-1-ylamino)benzamide (1˜2 eq.) in DMSO (2 mL) were added i-Pr2NH (3˜10 eq.), CuI (0.20˜1 eq.), 2-iodo-N—(R2-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.). The mixture was stirred at 20˜40° C. for 1˜3 h under N2. LC-MS or TLC analysis showed that the reaction was complete. The mixture was poured into saturated EDTA solution and stirred for 1 h. The aqueous phase was extracted with EtOAc (3×). The combined organic layers were washed with brine (3×), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC and prep-HPLC to afford the desired products.


2-fluoro-5-methoxy-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide, MS (ES+, m/z): 532.2; 2-(3-(((3S,4R)-3-methoxytetrahydro-2H-pyran-4-yl)amino)prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 479.2; 2-fluoro-4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-5-methoxybenzamide, MS (ES+, m/z): 606.2; 1-methoxy-3-(4-((2-(3-(((3S,4R)-3-methoxytetrahydro-2H-pyran-4-yl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol, MS (ES+, m/z): 553.2; 4-((3-(4-(((1R,4R)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzamide, MS (ES+, m/z): 560.2; 4-((3-(4-(((1S,4S)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-2-fluoro-5-methoxybenzamide, MS (ES+, m/z): 560.2; (1R,4R)—N1-(2-(3-(((3S,4R)-3-methoxytetrahydro-2H-pyran-4-yl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 507.3; (1S,4S)—N1-(2-(3-(((3S,4R)-3-methoxytetrahydro-2H-pyran-4-yl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 507.3; N-((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-(3-(((3S,4R)-3-methoxytetrahydro-2H-pyran-4-yl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 561.3; and N-((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-(3-(((3S,4R)-3-methoxytetrahydro-2H-pyran-4-yl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 561.3.


Example C29
Synthesis of (3S,4R)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]cyclohexan-1-ol (Compound 43A)



embedded image


Preparation of tert-butyl (3-(4-(((7S,8R)-7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate: To a mixture of tert-butyl (3-(4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (0.5 g, 812.40 μmol, 1 eq.), Cs2CO3 (794.09 mg, 2.44 mmol, 3 eq.), RuPhos (49.28 mg, 105.61 μmol, 0.13 eq.), and (7R,8R)-7-fluoro-1,4-dioxaspiro[4.5]decan-8-amine (189.15 mg, 893.64 μmol, 1.1 eq., HCl) in dioxane (10 mL) was added BrettPhos (Pd, G4) (44.87 mg, 48.74 μmol, 0.06 eq.) at 25° C. under N2. The mixture was de-gassed and heated to 110° C. and stirred for 12 h under N2. TLC analysis (PE:EtOAc=1:1, Rf=0.2) indicated that 10% of the starting material remained, and one major new spot with polarity greater than that of the starting material was detected. The reaction mixture was concentrated under reduced pressure to remove dioxane. The residue was diluted with water (50 mL) and extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:2) to afford the desired product (0.6 g, 798.88 μmol, 56.70% yield) as a yellow solid.


Preparation of (3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one: To a solution of tert-butyl (3-(4-(((7S,8R)-7-fluoro-1,4-dioxaspiro[4.5]decan-8-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (100 mg, 140.90 μmol, 1 eq.) in water (0.3 mL) was added TFA (3 mL) at 0° C. The mixture was stirred for 45 min. TLC analysis (PE:EtOAc=1:1) showed that the starting material remained, and one new spot was detected. The mixture was poured into a saturated aqueous solution of Na2CO3 (50 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give the desired product (0.09 g, crude) as a yellow solid.


Preparation of (3S,4R)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]cyclohexan-1-ol: To a solution of (3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (50 mg, 88.41 μmol, 1 eq.) in DCE (1 mL) were added AcOH (0.2 mL) and NaBH(OAc)3 (37.47 mg, 176.81 μmol, 2 eq.). The mixture was stirred at 0° C. for 1 h. TLC analysis (PE:EtOAc=1:2, Rf=0.2) indicated that 30% of the starting material remained, and one major new spot with polarity greater than that of the starting material was detected. The mixture was poured into a saturated aqueous solution of Na2CO3 (40 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (PE:EtOAc:DCM:MeOH=50:50:30:3) and prep-HPLC to afford the desired product (15 mg, 25.58 μmol, 28.94% yield) as a white solid. MS (ES+, m/z): 568.2.


Example C30
Synthesis of Compounds 37A, 38A, 39A, 40A, 41A, and 42A



embedded image


Preparation of 2-(((4-((trimethylsilyl)oxy)cyclohex-3-en-1-yl)-λ2-azaneyl)carbonyl)benzoic acid: To a solution of 2-(((4-oxocyclohexyl)-λ2-azaneyl)carbonyl)benzoic acid (10 g, 41.11 mmol, 1 eq.) in THF (150 mL) was added LDA (2 M, 30.83 mL, 1.5 eq.) at −78° C. The mixture was stirred at −78° C. for 10 min, then warmed up to 20° C. and stirred further at 20° C. for 10 min. The mixture was then cooled to −78° C., and TMSCl (4.91 g, 45.22 mmol, 5.74 mL, 1.1 eq.) was added into the reaction. The mixture was then stirred at −78° C. for 0.5 h, then warmed up to 20° C. for 1 h. TLC analysis (PE:EtOAc=3:1, Rf=0.4) indicated that 30% of the starting material remained, and one major new spot with polarity lower than that of the starting material was detected. The mixture was poured into saturated solution of NH4Cl (100 mL) and extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine (100 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=50:1 to 1:1) to afford the desired product (4 g, 11.41 mmol, 27.76% yield) as a light yellow solid.


Preparation of 2-(((3-fluoro-4-oxocyclohexyl)-λ2-azaneyl)carbonyl)benzoic acid: To solution of 2-(((4-((trimethylsilyl)oxy)cyclohex-3-en-1-yl)-λ2-azaneyl)carbonyl)benzoic acid (1.5 g, 4.76 mmol, 1 eq.) in DMF (16 mL) was added a solution of Selectfluor™ (1.85 g, 5.23 mmol, 1.1 eq.) in DMF (12 mL) at 0° C. The mixture was slowly was warmed to 20° C. and stirred for 1 h under N2. TLC analysis (PE:EtOAc=3:1, Rf=0.1) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was diluted with saturated solution of NH4Cl (100 mL) and extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give the desired product (1 g, crude) as a light yellow solid.




embedded image


Preparation of tert-butyl (3-(4-((4-(1,3-dioxoisoindolin-2-yl)-2-fluorocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)-carbamate: To a mixture of tert-butyl (3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (500 mg, 906.49 μmol, 1 eq.) and 2-(((3-fluoro-4-oxocyclohexyl)-λ2-azaneyl)carbonyl)benzoic acid (473.64 mg, 1.81 mmol, 2 eq.) in DMF (10 mL) was added TMSCl (246.21 mg, 2.27 mmol, 287.63 μL, 2.5 eq.) at 0° C. The mixture was stirred at 0° C. for 1 h, BH3.THF (1 M, 2.72 mL, 3 eq.) was added into the mixture at 0° C., and the resulting mixture was stirred further at 0° C. for 1 h. HPLC analysis showed that 5% of the starting material remained, and 57.3% of the desired compound was detected. The mixture was poured into a saturated aqueous solution of Na2CO3 (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC.


The solution obtained from peak 2 (retention time 3.6 min) was adjusted to pH>9 by adding a saturated solution of Na2CO3. The mixture was then extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give tert-butyl N-[3-[4-[[4-(1,3-dioxoisoindolin-2-yl)-2-fluoro-cyclohexyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]-N-(2-methoxy-4-methylsulfonyl-phenyl)carbamate (0.2 g, 144.57 μmol, 15.95% yield) was obtained as a yellow solid.


Preparation of tert-butyl (3-(4-((4-amino-2-fluorocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate: To a solution of tert-butyl (3-(4-((4-(1,3-dioxoisoindolin-2-yl)-2-fluorocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (0.18 g, 221.83 μmol, 1 eq.) in MeOH (3 mL) was added NH2NH2.H2O (33.31 mg, 665.49 μmol, 32.34 μL, 3 eq.) at 65° C. The mixture was stirred for 2.5 h under N2. LC-MS and HPLC analysis showed that the starting material was consumed completely, and one main peak with the desired mass was detected. The mixture was poured into saturated solution of Na2CO3 (30 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give the desired product (0.16 g, crude) as a yellow solid. MS (ES+, m/z): 667.3.


Preparation of Boc-protected intermediates: To a solution of tert-butyl (3-(4-((4-amino-2-fluorocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (0.14 g, 209.98 μmol, 1 eq.) in MeOH (1 mL) were added AcOH (37.11 mg, 617.91 μmol, 35.34 μL, 2.94 eq.), paraformaldehyde (31.52 mg), and NaBH3CN (65.98 mg, 1.05 mmol, 5 eq.) at 50° C. The mixture was stirred for 1.5 h under N2. LC-MS analysis showed that the starting material remained, and several new peaks were observed. The reaction mixture was diluted with saturated solution of Na2CO3 (30 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (PE:EtOAc:DCM:MeOH:TEA=50:50:100:10:30) to afford the desired products as yellow solids.


tert-Butyl (3-(4-((4-(dimethylamino)-2-fluorocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (15 mg, 21.59 μmol, 30% yield), MS (ES+, m/z): 695.3; tert-butyl (3-(4-((2-fluoro-4-(methylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (15 mg, 22.03 μmol, 30.62% yield), MS (ES+, m/z): 681.2; tert-butyl (3-(4-((4-amino-2-fluorocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (30 mg, 43.29 μmol, 60.15% yield), MS (ES+, m/z): 667.2.


General procedure for the preparation of final products: To a solution of tert-butyl (3-(4-((4-(dimethylamino)-2-fluorocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate; tert-butyl (3-(4-((2-fluoro-4-(methylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate; or tert-butyl (3-(4-((4-amino-2-fluorocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (30 mg, 45 mol, 1 eq.) in EtOAc (1 mL) was added HCl/EtOAc (4 M, 2.08 mL, 185 eq.) at 25° C. The mixture was stirred for 1 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with desired mass was detected. The mixture was poured into a saturated solution of Na2CO3 (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue as purified by prep-HPLC to afford the desired products.


(1R,2R,4S)-2-fluoro-N1-(2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 595.3; (1R,2R,4S)-2-fluoro-N1-(2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-methylcyclohexane-1,4-diamine, MS (ES+, m/z): 581.3; and (1R,2R,4S)-2-fluoro-N1-(2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)cyclohexane-1,4-diamine, MS (ES+, m/z): 567.2; 2-fluoro-N1-(2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 595.3; 2-fluoro-N1-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-methylcyclohexane-1,4-diamine, MS (ES+, m/z): 581.3; 2-fluoro-N1-(2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)cyclohexane-1,4-diamine, MS (ES+, m/z): 567.2.


Example C31
Synthesis of Compounds 58A, 475A, 481A, 545A, 546A, 556A, 560A, 561A, 615A, 693A, 717A, 1004A, and 1005A



embedded image


To a solution of alkyne (1˜2 eq., HCl or free) in DMSO (1˜10 mL) were added i-Pr2NH (10˜30 eq.), CuI (1˜2 eq.), 1-(2,2-difluoroethyl)-2-iodo-N—(R1-substituted)-1H-indol-4-amine (1 eq.), Pd(PPh3)4 (0.20˜0.50 eq.) at 20˜45° C. The mixture was stirred at for 1˜4 h. TLC or LC-MS analysis detected that the reaction was complete. EtOAc (10 mL) was poured into the mixture, and the resulting mixture was poured into a saturated EDTA solution (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (40 mL×2). The combined organic layers were poured to a saturated EDTA solution (40 mL) and stirred further for 1 h. The aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, treated with activated carbon, filtered, and concentrated in vacuo. The mixture was purified by prep-TLC or column chromatography, then purified once or twice by prep-HPLC to afford the desired products.


3-methoxy-4-{[3-(4-{[(1S,4S)-4-[(3S,4S)-3,4-dihydroxypyrrolidin-1-yl]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 621.3; 3-methoxy-4-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzoic acid, MS (ES+, m/z): 515.1; 2-(2-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethoxy)ethan-1-ol, MS (ES+, m/z): 623.2; 3-methoxy-4-((3-(4-((tetrahydro-2H-pyran-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzoic acid, MS (ES+, m/z): 502.2; 2-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-ol, MS (ES+, m/z): 579.2; 4-((3-(4-((1-(2,3-dihydroxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid, MS (ES+, m/z): 575.2; methyl 3-methoxy-4-((3-(4-((tetrahydro-2H-pyran-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzoate, MS (ES+, m/z): 516.2; methyl 4-((3-(4-((1-(2,3-dihydroxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate, MS (ES+, m/z): 589.2; 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(1-(2-methoxyethyl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 593.2; 3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol, MS (ES+, m/z): 609.3; 3-methoxy-4-({3-[4-({1-[(2-oxo-1,3-dioxolan-4-yl)methyl]piperidin-4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-yl}amino)benzene-1-sulfonamide, MS (ES+, m/z): 636.2; 4-({4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}methyl)-1,3-dioxolan-2-one, MS (ES+, m/z): 635.2; and 6-fluoro-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 567.2.


Example C32
Synthesis of Compounds 202A, 203A, 204A, 205A, 398A, 399A, 400A, 401A, and 1047A



embedded image


General procedure for the preparation of 2-iodo-N—(R2-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A mixture of 6-oxa-3λ2-azabicyclo[3.1.1]heptane or 2-oxa-6λ2-azaspiro[3.3]heptane (1.5 eq.) 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (1 eq.) with NaOAc (2 eq.) and Ti(OEt)4 (2 eq.) in EtOH (10 mL) was stirred for 1˜11 h at 25° C., and NaBH3CN (2 eq.) was added. The reaction mixture was stirred at 25° C. for 1 h. TLC analysis showed that the starting material was consumed completely, and two new spots were detected. The reaction mixture was poured into a saturated aqueous solution of NaHCO3 and filtered. The filtrate was extracted with EtOAc (2×). The combined organic layers were concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=2:1 to 1:1) to afford the desired products.


Preparation of final products: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline or 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (1.2 eq.) in DMSO were added CuI (1 eq.) and N-isopropylpropan-2-amine (10 eq.). The mixture was degassed with N2 three times, and 2-iodo-N—(R2-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.) and Pd(PPh3)4 (0.2 eq.) were added. The mixture was stirred at 25° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.25) showed that the starting material was consumed completely, and one main peak with the desired mass was detected. The reaction mixture was diluted with EtOAc, and the resulting mixture was poured into saturated EDTA solution (30 mL), stirred for 2 h, and extracted with EtOAc (2×). The combined organic layers were washed with brine (10 mL), and the organic layer was then concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC to give a residue, and the residue was further purified by prep-HPLC to afford the final products.


2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 27% yield, MS (ES+, m/z): 631.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 18% yield, MS (ES+, m/z): 631.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, 14.2% yield, MS (ES+, m/z): 632.2; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, 13.7% yield, MS (ES+, m/z): 632.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 27.1% yield, MS (ES+, m/z): 631.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 21.5% yield, MS (ES+, m/z): 631.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, 23% yield, MS (ES+, m/z): 632.2; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, 13.1% yield, MS (ES+, m/z): 632.2; and 4-[(2-{3-[(2-methoxy-4-{2-oxa-6-azaspiro[3.3]heptane-6-sulfonyl}phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-thiane-1,1-dione, 12.5% yield, MS (ES+, m/z): 667.1.


Example C33
Synthesis of 200A and 201A



embedded image


Preparation of tert-butyl 6-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.5 g, 1.47 mmol, 1 eq.) in MeOH (5 mL) were added tert-butyl 6-oxo-2-azaspiro[3.3]heptane-2-carboxylate (776.49 mg, 3.68 mmol, 40.50 μL, 2.5 eq.) and SnCl2.2H2O (66.35 mg, 294.05 μmol, 24.48 μL, 0.20 eq.). tert-Butyl 6-oxo-2-azaspiro[3.3]heptane-2-carboxylate (352.86 mg, 5.88 mmol, 4 eq.) was then added to the mixture at 70° C., and the reaction mixture was stirred for 3 h. TLC analysis showed that the reaction was complete. The mixture was concentrated, and the crude residue was purified by column chromatography to afford the desired product as a white solid. MS (ES+, m/z): 535.9.


General procedure for the preparation of tert-butyl 6-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate and tert-butyl 6-((2-(3-((2-methoxy-4-sulfamoylphenyl)amino)-prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate: To a mixture 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline or 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (1.5 eq.) and tert-butyl 6-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate (1 eq.) in DMSO were added CuI (1 eq.),Pd(PPh3)4 (0.10 eq.), and N-isopropylpropan-2-amine (1 eq.). The mixture was stirred at 25° C. for 1 h under N2. LC-MS analysis showed that the reaction was complete. The reaction was poured into saturated EDTA solution (50 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with saturated EDTA solution (20 mL) by stirring the mixture for 1 h. The organic layer was washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was purified by prep-TLC to afford the desired products as yellow solids.


General procedure for the preparation of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(2-azaspiro[3.3]heptan-6-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and 4-((3-(4-((2-azaspiro[3.3]heptan-6-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide: To a solution of tert-butyl 6-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate or tert-butyl 6-((2-(3-((2-methoxy-4-sulfamoylphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate (1 eq.) in DCM was added 2,2,2-trifluoroacetic acid (175 eq.) at 20° C. The mixture was stirred for 16 h. LC-MS analysis indicated that the starting material was consumed, and one main peak with the desired mass was detected. The reaction mixture was concentrated under reduced pressure to remove solvent. The residue was purified by prep-HPLC to afford the desired products as yellow solids.


2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(2-azaspiro[3.3]heptan-6-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 547.2; and 4-((3-(4-((2-azaspiro[3.3]heptan-6-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 548.2.


Example C34
Synthesis of Compounds 79A, 80A, 487A, 621A, 731A, and 1009A



embedded image


General Procedure: To a mixture of 5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenol (1.2 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (1 eq.), 2-iodo-N—(R1-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.20 eq.) at 25° C. The mixture was stirred for 2 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution and stirring the resulting mixture at 25° C. for 2 h. The reaction mixture was partitioned by adding EtOAc, and the aqueous phase was extracted with EtOAc. The combined organic layers were washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC and prep-HPLC to give a solution of the desired product. The solution was lyophilized to afford the desired product as a light yellow solid.


5-methanesulfonyl-2-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]phenol, MS (ES+, m/z): 522.1; 2-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-5-methanesulfonylphenol, MS (ES+, m/z): 609.2; 5-methanesulfonyl-2-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenol, MS (ES+, m/z): 563.2; 5-methanesulfonyl-2-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenol, MS (ES+, m/z): 563.1; 2-hydroxy-1-{4-[(2-{3-[(2-hydroxy-4-methanesulfonyl-phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}ethan-1-one, MS (ES+, m/z): 579.2; and 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-6-methoxy-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 579.2.


Example C35
Synthesis of Compounds 52A, 53A, 90A, 91A, 216A, 217A, 218A, 219A, 224A, 636A, 640A, and 641A



embedded image


To a mixture of R2-substituted alkyne (1.2 eq.) and 2-iodo-N—(R1-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.) in DMSO (2 mL) were added CuI (1 eq.), Pd(PPh3)4 (0.10 eq.), and N-isopropylpropan-2-amine (1 eq.). The mixture was stirred at 25˜30° C. for 1 h under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (30 mL) and EtOAc (10 mL), and the resulting mixture was stirred at 25° C. for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC and prep-HPLC to afford the desired product.


N-(3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(methylsulfonyl)phenyl)propionamide, MS (ES+, m/z): 673.1; N-(3-(4-((1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(N-propionylsulfamoyl)phenyl)propionamide MS (ES+, m/z): 722.3; N-(3-(4-(((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(methylsulfonyl)phenyl)propionamide, MS (ES+, m/z): 673.1; and N-(3-(4-(((1S,4S)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(methylsulfonyl)phenyl)propionamide. MS (ES+, m/z): 619.1.


Compounds 90A, 91A, 640A, 218A, 224A, 618A, and 641A were synthesized using the method described above.


N-(3-(4-((1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(methylsulfonyl)phenyl)propionamide, MS (ES+, m/z): 665.3; N-(3-(4-((1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(methylsulfonyl)phenyl)isobutyramide, MS (ES+, m/z): 679.3; N-(2-hydroxy-4-methanesulfonylphenyl)-2-methyl -N-[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]propanamide, MS (ES+, m/z): 687.2; N-(3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(methylsulfonyl)phenyl)isobutyramide, MS (ES+, m/z): 687.2; 5-methanesulfonyl-2-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenyl 2-methylpropanoate, MS (ES+, m/z): 687.4; N-(3-(4-(((1R,4R)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(methylsulfonyl)phenyl)isobutyramide, MS (ES+, m/z): 633.3; and N-(3-(4-(((1S,4S)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(methylsulfonyl)phenyl)isobutyramide, MS (ES+, m/z): 633.3.


Example C36
Synthesis of Compounds 140A, 141A, 142A, 143A, 283A, 284A, 285A, 286A, 703A, and 710A



embedded image


General Procedure: To a solution of 2-(R-substituted)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1.5 eq.; EXAMPLE A28 and A29) in DMSO were added 2-iodo-N—(R1-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), CuI (1 eq.), i-Pr2NH (1 eq.), and Pd(PPh3)4 (0.02 eq.). The mixture was stirred at 45° C. for 1 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.24) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (40 mL) at 25° C. and extracting the resulting mixture with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC and prep-HPLC to obtain he desired product as a light yellow solid.


1-{4-[(2-{3-[(4-methanesulfonyl-2-methylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol, MS (ES+, m/z): 607.3; (1R,4R)—N4-[2-(3-{[4-methanesulfonyl-2-(trifluoromethoxy)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 631.1; (1S,4S)—N1,N1-dimethyl-N4-(2-(3-((4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)cyclohexane-1,4-diamine, MS (ES+, m/z): 631.1; (1R,4R)—N4-(2-{3-[(4-methanesulfonyl-2-methylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 561.3; (1S,4S)—N1,N1-dimethyl-N4-(2-(3-((2-methyl-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)cyclohexane-1,4-diamine, MS (ES+, m/z): 561.3; 2-{3-[(4-methanesulfonyl-2-methylphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 615.3; N-((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-(3-((2-methyl-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 615.3; 2-(3-{[4-methanesulfonyl-2-(trifluoromethoxy)phenyl]amino}prop-1-yn-1-yl)-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 685.2; N-((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-(3-((4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 685.2; and 1-(4-{[2-(3-{[4-methanesulfonyl-2-(trifluoromethoxy)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 677.1.


Example C37
Synthesis of Compounds 249A and 250A



embedded image


General procedure for the preparation of 3-methoxy-4-(prop-2-yn-1-ylamino)benzonitrile: To a solution of 4-amino-3-methoxybenzonitrile (1 eq.) in DMF were added K2CO3 (3 eq.) and 3-bromoprop-1-yne (3 eq.). The mixture was stirred at 70° C. for 1 h. TLC analysis (PE:EtOAc=3:1) indicated that 10% of the starting material remained, and one major new spot with polarity lower than that of the starting material was detected. The reaction mixture was diluted with water (10 mL) and extracted with EtOAc. The combined organic layers were washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC to afford the desired product as a brown solid.


General procedure for the preparation of final products: To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzonitrile (1.2 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (1 eq.), N-((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 45° C. The mixture was stirred at 45° C. for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution at 25° C. and stirring the resulting mixture for 2 h. The reaction mixture was partitioned by adding EtOAc, and the aqueous phase was extracted with EtOAc. The organic phase was washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give the crude product. The residue was purified by prep-TLC and prep-HPLC to give a solution of the desired product. The solution was lyophilized to give the desired final product as a light yellow solid.


3-methoxy-4-[(3-{4-[(4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzonitrile, MS (ES+, m/z): 578.2; and 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzonitrile, MS (ES+, m/z): 578.3.


Example C38
Synthesis of Compounds 121A, 122A, 251A, 252A, 301A, 302A, and 665A



embedded image


embedded image


General procedure for the preparation of 2-(3-methoxy-4-nitrophenyl)acetonitrile: To a mixture of 1-methoxy-2-nitrobenzene (10 g, 65.30 mmol, 8 mL, 1 eq.) and 2-(4-chlorophenoxy)acetonitrile (1.3 eq.) (14.23 g, 84.89 mmol, 1.3 eq.) in DMF (1 mL) was added a solution of t-BuOK (2.2 eq.) in DMF (2 mL) at −20° C. The mixture was stirred at −20° C. for 30 min, poured into ice-cold 2M HCl, and stirred further for 1 h. TLC analysis (PE:EtOAc=3:1) indicated that 40% of the starting material remained, and two major new spots with polarity greater than that of the starting material were detected. The mixture was poured into ice-cold 2M HCl and stirred further for 1 h. The reaction mixture was then diluted with water and extracted with EtOAc (100 mL). The combined organic layers were washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography to obtain the desired product as a brown solid.


General procedure for the preparation of 2-(3-methoxy-4-nitrophenyl)-2-methylpropanenitrile: To a mixture of 2-(3-methoxy-4-nitrophenyl)acetonitrile (1 eq.) and tetrabutylammonium bromide (TBAB; 1.8 eq.) in toluene were added NaOH (1.67 g, 41.63 mmol, 10 eq.) and CH3I (10 eq.). The mixture was stirred at 25° C. for 1 h. TLC analysis (PE:EtOAc=3:1) indicated that the starting material was consumed completely, and two new spots were detected. The reaction mixture was diluted with water (20 mL) and extracted with EtOAc (40 mL). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, PE:EtOAc=3:1) to obtain the desired product as a yellow solid.


Preparation of 2-(4-amino-3-methoxyphenyl)-2-methylpropanenitrile: To a solution of 2-(3-methoxy-4-nitrophenyl)-2-methylpropanenitrile (1 eq.) in EtOH (2 mL) and water (0.5 mL) were added NH4Cl (5 eq.) and Fe (5 eq.). The mixture was stirred at 70° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely, and the desired mass was detected. The reaction mixture was diluted with water (10 mL) and extracted with EtOAc (20 mL). The combined organic layers were washed with saturated brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, PE:EtOAc=3:1) to obtain the desired product as a yellow oil.


Preparation of tert-butyl (4-(2-cyanopropan-2-yl)-2-methoxyphenyl)carbamate: To a solution of 2-(4-amino-3-methoxyphenyl)-2-methylpropanenitrile (1 eq.) in dioxane (4 mL) was added (Boc)2O (2 eq.). The mixture was stirred at 110° C. for 2 h. TLC analysis (PE:EtOAc=3:1) showed that 10% of the starting material remained, and two new spots were detected. The reaction mixture was diluted with water (20 mL) and extracted with EtOAc (10 mL). The combined organic layers were washed with saturated brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, PE:EtOAc=3:1) to obtain the desired product as a light-yellow oil.


Preparation of tert-butyl (4-(2-cyanopropan-2-yl)-2-methoxyphenyl)(prop-2-yn-1-yl)carbamate: To a solution of tert-butyl (4-(2-cyanopropan-2-yl)-2-methoxyphenyl)carbamate (0.3 g, 1.03 mmol, 1 eq.) in DMF (2 mL) was added NaH (3 eq., 60% in mineral oil) at 0° C. The mixture was stirred at 0° C. for 10 min, and 3-bromoprop-1-yne (368.73 mg, 3.10 mmol, 267.20 μL, 3 eq.) was added to the mixture at 0° C. The mixture was stirred further for 20 min. LC-MS analysis showed that the starting material was consumed completely, and the desired mass was detected. The reaction mixture was diluted with saturated solution of NH4Cl (10 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was obtained as a light-yellow oil.


Preparation of 2-(3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)-2-methylpropanenitrile: To a solution of tert-butyl (4-(2-cyanopropan-2-yl)-2-methoxyphenyl)(prop-2-yn-1-yl)carbamate (1 eq.) in EtOAc (1 mL) was added HCl/EtOAc (5 mL; 4 N). The mixture was stirred at 25° C. for 1 h. LC-MS analysis showed that the starting material was consumed completely, and the desired mass was detected. The reaction mixture was diluted with saturated solution of NaHCO3 (10 mL) and extracted with EtOAc (10 mL). The combined organic layers were washed with saturated brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, PE:EtOAc=5:1) to afford the desired product as a yellow oil.


Preparation of final products: To a solution of 2-(3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)-2-methylpropanenitrile (1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (10 eq.), CuI (1 eq.), 2-iodo-N—(R-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), Pd(PPh3)4 (0.2 eq.). The mixture was stirred at room temperature for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (20 mL) at 45° C. and stirring the resulting mixture for 1 h. The reaction mixture was partitioned by adding EtOAc (10 mL), and the aqueous phase was extracted with EtOAc (10 mL×2). The organic phase was washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC and prep-HPLC to give a solution of the desired product. The solution was lyophilized to give the desired product as a light-yellow oil.


2-(3-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenyl)-2-methylpropanenitrile, MS (ES+, m/z): 620.3; 2-(4-((3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)-2-methylpropanenitrile, MS (ES+, m/z): 620.3; 2-(3-methoxy-4-{[3-(4-{[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenyl)-2-methylpropanenitrile, MS (ES+, m/z): 648.4; 2-(4-((3-(4-(((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)-2-methylpropanenitrile, MS (ES+, m/z): 648.4; 2-(3-methoxy-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenyl)-2-methylpropanenitrile, MS (ES+, m/z): 566.2; 2-(4-((3-(4-(((1S,4S)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)-2-methylpropanenitrile, MS (ES+, m/z): 566.2; and 2-(4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxyphenyl)-2-methylpropanenitrile, MS (ES+, m/z): 612.3.


Example C39
Synthesis of Compounds 160A, 161A, 181A, 182A, 204A, 205A, 375A, 377A, and 378A



embedded image


General Procedure: To a mixture of 2-methoxy-4-(R2-substituted)-N-(prop-2-yn-1-yl)aniline (100 mg, 164.42 μmol, 1 eq.) in DMSO (3 mL) were added i-Pr2NH (16.64 mg, 164.42 μmol, 23.24 μL, 1 eq.), CuI (31.31 mg, 164.42 μmol, 1 eq.), 2-iodo-N-(4-(R1-substituted) cyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 45° C. The mixture was stirred at 45° C. for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (40 mL) at 25° C. for 1 h. The reaction mixture was partitioned by adding EtOAc (20 mL), and the aqueous phase was extracted with EtOAc (20 mL×3). The organic phase was washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (SiO2, EtOAc:MeOH:TEA=10:1:1, Rf=0.43) and prep-HPLC to give a solution of the desired product. The solution was lyophilized to give the desired product as a light yellow solid.


3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.4; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.3; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 622.2; 3-methoxy-4-((3-(4-(((1S,4S)-4-((2-methoxyethyl)(methyl)amino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 622.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 660.2; 4-((3-(4-(((1S,4S)-4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 660.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 632.2; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 632.2; 3-methoxy-4-((3-(4-(((1R,4R)-4-morpholinocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 620.2; and 3-methoxy-4-((3-(4-(((1S,4S)-4-morpholinocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 620.2.


Example C40
Synthesis of Compounds 46A, 47A, 49A, 51A, 58A, 59A, 60A, 360A, 361A, 465A, 470A, 548A, 552A, 768A, 993A, and 1041A



embedded image


General Procedure: To a solution of R2-substituted alkyne (1-2 eq., HCl or free) in DMSO (1˜10 mL) were added i-Pr2NH (10˜30 eq.), CuI (1˜2 eq.), 2-iodo-N—(R1-substituted)methyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.) at 20˜45° C. The mixture was stirred for 1˜4 h. TLC or LC-MS analysis detected that the reaction was complete. EtOAc (10 mL) was poured into the mixture, and the resulting mixture was poured into a 2N aqueous EDTA (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (3×). The organic layer was poured to saturated EDTA solution and stirred for 1 h. The aqueous phase was extracted with EtOAc (3×). The combined organic layers were washed with brine (3×), dried over anhydrous sodium sulfate, mixed with activated carbon, filtered, and concentrated in vacuo. The mixture was purified by prep-TLC or column chromatography then purified further by prep-HPLC to afford the desired compounds.


3-Methoxy-4-{[3-(4-{[(1S,4S)-4-[(3S,4S)-3,4-dihydroxypyrrolidin-1-yl]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 636.2; 4-((3-(4-(((1R,4S)-4-((3S,4S)-3,4-dihydroxypyrrolidin-1-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 636.2; 3-methoxy-4-((3-(4-(((1R,4R)-4-morpholinocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 620.3; 3-methoxy-4-((3-(4-(((1S,4S)-4-morpholinocyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 636.2; 4-((3-(4-(((1R,4R)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 578.2; 4-((3-(4-(((1S,4S)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 578.3; 3-methoxy-4-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 550.2; 4-((3-(4-(((1R,4R)-4-((3R,4R)-3,4-dihydroxypyrrolidin-1-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 636.2; 4-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(oxan-4-yl)benzene-1-sulfonamide, MS (ES+, m/z): 694.3; 3-methoxy-N-(oxan-4-yl)-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 621.3; 4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxy-N-(oxan-4-yl)benzene-1-sulfonamide, MS (ES+, m/z): 669.1; 3-methoxy-4-((3-(4-((1-(tetrahydro-2H-pyran-4-yl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 620.2; 3-methoxy-N-(oxan-4-yl)-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 662.2; 3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-N-(oxan-4-yl)benzene-1-sulfonamide, MS (ES+, m/z): 634.2; and 3-methoxy-N-(oxan-4-yl)-4-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 662.3.


Example C41
Synthesis of Compounds 44A and 45A



embedded image


Preparation of 2,2′-((4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)azanediyl)bis(ethan-1-ol): To a solution of 4-42-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (80 mg, 179 μmol, 1 eq.) in EtOH (5 mL) were added 2,2′-azanediylbis(ethan-1-ol) (112.91 mg, 1.07 mmol, 103.59 μL, 6 eq.) and Ti(OEt)4 (204.15 mg, 894.98 μmol, 185.59 μL, 5 eq.). The mixture was stirred at 50° C. for 12 h. The mixture was then cooled to 20° C., and NaBH3CN (56.24 mg, 894.98 μmol, 5 eq.) was added to the reaction. The resulting reaction mixture was stirred at 20° C. for 4 h. LC-MS analysis showed that 33% of the starting material remained. The mixture was stirred at 50° C. for 12 h. HPLC analysis showed that 13% of the starting material remained. The reaction mixture was poured into a saturated aqueous solution of NaHCO3 (30 mL) and stirred for 30 min. The mixture was then filtered through diatomite and washed with EtOAc (30 mL). The aqueous layer was extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1, Rf=0.24) to afford the desired product (30 mg) as a yellow solid. MS (ES+, m/z): 526.2.


Preparation of final products: To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzene sulfonamide (29.48 mg, 104.27 μmol, 2 eq.) in DMSO (1 mL) were added i-Pr2NH (52.76 mg, 521.37 μmol, 73.68 μL, 10 eq.), CuI (9.93 mg, 52.14 μmol, 1 eq.), 2,2′-((4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)azanediyl)bis(ethan-1-ol) (30 mg, 52.14 μmol, 1 eq.), and Pd(PPh3)4 (12.05 mg, 10.43 μmol, 0.20 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. EtOAc (10 mL) was poured into the mixture, and the resulting mixture was poured into 2N aqueous EDTA (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (40 mL×2). The organic layer was poured to 2N aqueous EDTA (40 mL) and stirred for 1 h, and the aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, treated with activated carbon, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC and prep-HPLC to afford the desired products as light yellow solids.


3-methoxy-4-{[3-(4-{[(1R,4R)-4-[bis(2-hydroxyethyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 638.3; and 3-methoxy-4-{[3-(4-{[(1S,4S)-4-[bis(2-hydroxyethyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 638.3.


Example C42
Synthesis of Compounds 134A, 135A, 277A, 278A, and 515A



embedded image


A mixture of 2-iodo-N—(R-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), 2-methoxy-N-(prop-2-yn-1-yl)-4-(trifluoromethyl)aniline (1˜3 eq.), CuI (21.78 mg, 114.35 μmol, 1 eq.), i-Pr2NH (115.71 mg, 1.14 mmol, 161.61 μL, 10 eq.), and Pd(PPh3)4 (52.86 mg, 45.74 μmol, 0.4 eq.) in DMSO (1 mL) was degassed and purged with N2 three times and was then stirred at 50° C. for 1˜2 h under N2. A saturated EDTA solution (15 mL) was added to the reaction, and the mixture was stirred further for 1.5 h. The resulting mixture was extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated. The crude residue was purified by prep-HPLC to obtain the desired compound.


2-(3-{[2-methoxy-4-(trifluoromethyl)phenyl]amino}prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 539.2; 2-(3-{[2-methoxy-4-(trifluoromethyl)phenyl]amino}prop-1-yn-1-yl)-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 621.2; N-((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-(3-((2-methoxy-4-(trifluoromethyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 621.2; (1R,4R)—N4-[2-(3-{[2-methoxy-4-(trifluoromethyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 567.2; and (1S,4S)—N1-(2-(3-((2-methoxy-4-(trifluoromethyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 567.2.


Example C43
Synthesis of Compounds 136A, 137A, 275A, 276A, 335A, 516A, and 690A



embedded image


A mixture of 2-iodo-N-(R-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), 2-fluoro-5-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (51.98 mg, 220.02 μmol, 5 eq.), DIPEA (189.57 mg, 1.47 mmol, 255.49 μL, 10 eq.), CuI (27.94 mg, 146.68 μmol, 1 eq.), and Pd(PPh3)4 (33.90 mg, 29.34 μmol, 0.2 eq.) in DMSO (5 mL) was degassed and purged with N2 three times, and the mixture was stirred at 20° C. for 1 h under N2. To the mixture was added a saturated EDTA solution (25 mL), and the mixture was stirred further for 1.5 h. The mixture was then extracted with EtOAc (20 mL×3). The organic layer was washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=50:1, Rf=0.5) and prep-HPLC to obtain the desired products.


2-fluoro-4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-5-methoxy-N-methylbenzamide, MS (ES+, m/z): 620.3; 2-fluoro-5-methoxy-N-methyl-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide, MS (ES+, m/z): 546.2; 2-fluoro-5-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 628.2; 4-((3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-2-fluoro-5-methoxy-N-methylbenzamide, MS (ES+, m/z): 628.2; 2-fluoro-5-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 574.3; 4-((3-(4-(((1S,4S)-4-(dimethylamino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-2-fluoro-5-methoxy-N-methylbenzamide, MS (ES+, m/z): 574.2; and


2-fluoro-5-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 656.3.


Example C44
Preparation of Compounds 71A, 72A, 74A, 75A, 170A, 171A, 482A, 484A, 596A, 601A, 609A, 620A, 1003A, and 1008A



embedded image


General procedure: To a mixture of alkyne (1.2 eq.) in DMSO were added i-Pr2NH (10 eq.), CuI (1 eq.), 2-iodo-N—(R1-substituted)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated solution of EDTA and stirring the resulting mixture at 25° C. for 2 h. The reaction mixture was partitioned by adding EtOAc, and the aqueous phase was extracted with EtOAc. The organic phase was washed with brine, dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC and prep-HPLC to give a solution of the desired product. The solution was lyophilized to give the desired product as a yellow solid.


3-methoxy-N-methyl-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 551.2; 3-methoxy-N-methyl-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 564.2; 4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzene-1-sulfonamide, MS (ES+, m/z): 638.2; 3-methoxy-N-methyl-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide, MS (ES+, m/z): 515.2; 3-methoxy-N-methyl-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide, MS (ES+, m/z): 528.2; 4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide, MS (ES+, m/z): 602.4; 4-{[3-(4-{[1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide, MS (ES+, m/z): 572.3; 4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide, MS (ES+, m/z): 588.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 592.2; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 592.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 556.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 556.3; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 584.2; and 3-methoxy-4-{[3-(4-{[(1S,4S)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 584.2.


Example C45
General Procedure for Preparation of Compounds 123A, 124A, 149A, 150A, 157A, 158A, 185A, 186A, 303A, 304A, 407A, 408A, 489A, 663A, and 664A



embedded image


To a mixture of R-substituted alkyne (1-2 eq.) in DMSO (2 mL) was added i-Pr2NH (10˜30 eq.). CuI (1˜2 eq.), R1-substituted indole (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.) were then added to the mixture, and the mixture was stirred at 20-40° C. for 1-3 h under N2. The progress of the reaction was monitored by LC-MS or TLC analysis. The mixture was poured into a saturated EDTA solution (15 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3), and the combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC, prep-HPLC, or prep-TLC followed by prep-HPLC to afford the desired compounds.


2-{5-methanesulfonyl-2-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]phenoxy}acetonitrile, MS (ES+, m/z): 574.3; 1-(4-{[2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.6; 3-(fluoromethoxy)-N-methyl-4-{[3-(4-{[(1R,4R)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 618.3; 3-(fluoromethoxy)-N-methyl-4-{[3-(4-{[(1S,4S)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 618.3; 3-(fluoromethoxy)-4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-methylbenzamide, MS (ES+, m/z): 620.2; 3-(cyanomethoxy)-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 603.4; 3-(cyanomethoxy)-4-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 603.3; 2-(5-methanesulfonyl-2-{[3-(4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 644.2; 2-(5-methanesulfonyl-2-{[3-(4-{[(1S,4S)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 644.2; 2-(5-methanesulfonyl-2-{[3-(4-{[(1R,4R)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 646.2; 2-(5-methanesulfonyl-2-{[3-(4-{[(1S,4S)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 646.2; 2-(5-methanesulfonyl-2-{[3-(4-{[(1R,4R)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 656.2; 2-(5-methanesulfonyl-2-{[3-(4-{[(1R,4R)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 656.2; 2-(5-methanesulfonyl-2-{[3-(4-{[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 684.3; and 2-(5-methanesulfonyl-2-{[3-(4-{[(1S,4S)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 684.3.


Example C46
General Procedure for Preparation of Compounds 253A, 254A, 255A, 256A, 257A, 258A, 259A and 260A



embedded image


embedded image


Synthesis of 2-iodo-N-(1,4-dioxaspiro[4.5]decan-8-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (10 g, 29.40 mmol, 1 eq.) and 1,4-dioxaspiro[4.5]decan-8-one (11.48 g, 73.51 mmol, 2.5 eq.) in DMF (100 mL) was added BH3.THF (1 M, 88.21 mL, 3 eq.). The mixture was stirred at 0° C. for 1 h, TMSCl (7.99 g, 73.51 mmol, 9.33 mL, 2.5 eq.) was added to the reaction, and the mixture was stirred at 0° C. for 1 h. LC-MS and TLC analysis showed that the reaction was completed. The reaction mixture was poured into ice-water (1000 mL), and the aqueous phase was extracted with EtOAc (300 mL×3). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered and concentrated in vacuo to give a residue. The residue was washed with PE (20 mL) at 25° C. for 10 h and filtered to obtained desired compound 2-iodo-N-(1,4-dioxaspiro[4.5]decan-8-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (30 g, 61.84 mmol, 70.10% yield) as a light yellow solid.




embedded image


Synthesis of N-((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-N-(1,4-dioxaspiro[4.5]decan-8-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (5.5 g, 10.72 mmol, 1 eq.) and 2-oxa-6-azaspiro[3.3]heptan-6-ium oxalate (2.43 g, 12.86 mmol, 1.2 eq.) in THF (100 mL) were added MgSO4 (6.45 g, 53.59 mmol, 5 eq.) and i-Pr2NH (5.42 g, 53.59 mmol, 7.57 mL, 5 eq.). The mixture was stirred at 25° C. for 0.5 h. NaBH(OAc)3 (4.54 g, 21.43 mmol, 2 eq.) was added into the reaction, and the resulting mixture was stirred at 25° C. for 1 h, after which time TLC analysis indicated that the ketone starting material was completely consumed. The reaction mixture was then poured into water (200 mL), and the residue was extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine (100 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue that was purified by column chromatography (SiO2, PE:EtOAc=2:1 to EtOAc to DCM:MeOH=10:1) to afford desired diastereomers N-((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (3 g, 4.91 mmol, 91.63% yield) as yellow solid and N-((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1.7 g, 2.78 mmol, 51.92% yield) as yellow solids.




embedded image


Representative Procedure: To a solution of 245-methylsulfonyl-2-(prop2ynylamino)phenoxylacetonitrile (81.4 mg, 231 μmol, 1.5 eq.) in DMSO (2 mL) were added i-Pr2NH (4.62 mmol, 650 μL, 30 eq.), CuI (58.7 mg, 308 μmol, 2 eq.), 2-iodo-N-[4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (100 mg, 154 μmol, 1 eq.), and Pd(PPh3)4 (44.5 mg, 38.5 μmol, 0.25 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis (DCM:MeOH=20:1, Rf=0.21) indicated that the iodide was consumed completely, and one new spot was detected. The mixture was poured into a saturated aqueous EDTA solution (20 mL) and stirred at 25° C. for 1 h. The mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue, which was purified by prep-TLC (DCM:MeOH:TEA=150:10:0.5), then further purified by prep-HPLC to afford 2-[5-methylsulfonyl-2-[3-[4-[[4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]phenoxy]acetonitrile (10.1 mg, 13.9 μmol, 9.0% yield, FA salt) as a light yellow solid. The other analogs in the series were prepared using the same method.


3-(2-cyanoethoxy)-N-methyl-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 649.3; 3-(2-cyanoethoxy)-N-methyl-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 649.3; 2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, (ES+, m/z): 649.3; 2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, (ES+, m/z): 649.3; 3-(fluoromethoxy)-N-methyl-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, (ES+, m/z): 628.3; 3-(fluoromethoxy)-N-methyl-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, (ES+, m/z): 628.3; 3-(cyanomethoxy)-4-[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino -1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, (ES+, m/z): 657.4; and 3-(cyanomethoxy)-4-[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino -1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, (ES+, m/z): 657.4.


Example C47
General Procedure for Preparation of Compounds 389A and 390A



embedded image


Synthesis of N-((1R,4R)-4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((1S,4S)-4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one and 2-oxa-7-azaspiro[3.5]nonan-7-ium oxalate (1.15 g, 5.31 mmol, 5 eq.) in DCE (4 mL) were added MgSO4 (640 mg, 5.31 mmol, 5 eq.), molecular sieve powder (400 mg) and i-Pr2NH (10.6 mmol, 1.50 mL, 10 eq.). The mixture was heated and stirred at 50° C. for 0.5 h, and NaBH(OAc)3 (450.4 mg, 2.13 mmol, 2 eq.) was then added. The mixture was heated and stirred at 70° C.˜100° C. for 1 h, after which time LC-MS analysis indicated that the starting ketone was consumed completely, and one main peak pertaining to the desired product mass was detected. The reaction mixture was diluted with DCM (20 mL), filtered, and concentrated under reduced pressure to provide a residue that was purified by prep-HPLC to afford desired diastereomers N-((1R,4R)-4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 176 μmol, 8.0% yield) and N-((1S,4S)-4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 179 μmol, 8.2% yield) as yellow solids.




embedded image


Representative procedure for trans isomer: To a solution of 2-[5-methylsulfonyl-2-(prop-2-ynylamino)phenoxy]acetonitrile (44.6 mg, 143 μmol, 2eq.) in DMSO (1 mL) were added i-Pr2NH (2.15 mmol, 303 μL, 30 eq.), CuI (27.3 mg, 143 μmol, 2 eq.), 2-iodo-N-[4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (40 mg, 71.7 μmol, 1 eq.), and Pd(PPh3)4 (20.7 mg, 17.9 μmol, 0.25 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h under N2. TLC analysis (DCM:MeOH=10:1, Rf=0.25) indicated that the iodide starting material was consumed completely, and one new spot was detected. The mixture was poured into saturated aqueous EDTA (20 mL) and stirred at 25° C. for 1 h. The mixture was then extracted with EtOAc (3×20 mL). The combined organic layers were washed with brine (3×20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue that was purified by prep-TLC (DCM:MeOH=10:1, Rf=0.25), then further purified by prep-HPLC to afford 2-[5-methylsulfonyl-2-[3-[4-[[4-(2-oxa-7-azaspiro[3.5]nonan-7-yl)cyclohexyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]phenoxy]acetonitrile (18.0 mg, 24.4 μmol, 34.1% yield, FA salt) as a yellow solid.


The corresponding cis-isomer was synthesized using the method described above. MS (ES+, m/z): 538.2, 89.6% yield


2-(5-methanesulfonyl-2-{[3-(4-{[(1R,4R)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 684.2; and 2-(5-methanesulfonyl-2-{[3-(4-{[(1S,4S)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 684.2.


Example C48
General Procedure for Preparation of Compounds 162A, 163A, 322A, 323A, 350A, 351A, 424A, 425A, 436A, 437A, 442A, and 443A



embedded image


Representative procedure for reductive amination: To a solution of 4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]cyclohexanone (600 mg, 1.24 mmol, 1 eq.) in EtOH (3 mL) was added 4-methoxypiperidine (6.19 mmol, 59 μL, 5 eq.) and Ti(OEt)4 (6.19 mmol, 1.28mL, 5 eq.). The reaction mixture was heated and stirred at 50° C. for 4 h. Then to the reaction mixture was added NaBH3CN (389 mg, 6.19 mmol, 5 eq.) under N2. The reaction mixture was warmed stirred at 50° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf1=0.3, Rf2=0.25) showed that the starting material was consumed. The solution was dried under vacuum to give the crude product. The residue was purified by column chromatography (SiO2, PE:EtOAc=5:1 to 0:1) to afford the intermediate product 2-iodo-N-[4-(4-methoxy-1-piperidyl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (550 mg, 1.03 mmol, 83.0% yield) as a brown oil.


Step 2: The above specified R-substituted iodoindoles were coupled to 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline according to the general procedure specified in EXAMPLE C47. In each case, TLC/LC-MS analysis indicated that the starting material was completely consumed after heating at 45° C. for 2 h.


2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-(pyrrolidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 603.2; 2-{34-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-(pyrrolidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 603.2; (1R,4R)—N1,N1-diethyl-N4-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)cyclohexane-1,4-diamine, MS (ES+, m/z): 605.4; (1S,4S)—N1,N1-diethyl-N4-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)cyclohexane-1,4-diamine, MS (ES+, m/z): 605.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-(4-methoxypiperidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 647.3; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-(4-methoxypiperidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 647.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-[4-(trifluoromethyl)piperidin-1-yl]cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 685.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-[4-(trifluoromethyl)piperidin-1-yl]cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 685.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-(4-methanesulfonylpiperidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 695.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-(4-methanesulfonylpiperidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 695.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{6-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 659.2; and 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{6-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 659.2.


Example C49
General Procedure for Preparation of Compounds 144A, 145A, 318A, 319A, 352A, 353A, 420A, 421A, 438A, 439A, 444A, and 445A



embedded image


Compounds 144A, 145A, 318A, 319A, 352A, 353A, 420A, 421A, 438A, 439A, 444A, and 445A were prepared via a procedure analogous to the synthesis of the compounds described in EXAMPLE C32, using 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(pyrrolidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 582.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(pyrrolidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 582.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(diethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 584.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(diethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 584.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(4-methoxypiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 626.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(4-methoxypiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 626.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-[4-(trifluoromethyl)piperidin-1-yl]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 664.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-[4-(trifluoromethyl)piperidin-1-yl]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 664.2; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(4-methanesulfonylpiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 674.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(4-methanesulfonylpiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 674.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{6-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.3; and 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-{6-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.3.


Example C50
General Procedure for Preparation of Compounds 146A, 147A, 320A, 321A, 354A, 355A, 422A, 423A, 440A, 441A, 446A, and 447A



embedded image


Compounds 146A, 147A, 320A, 321A, 354A, 355A, 422A, 423A, 440A, 441A, 446A, and 447A were prepared via a procedure analogous to the synthesis of the compounds described in EXAMPLE C32, using 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


3-methoxy-4-{[3-(4-{[(1R,4R)-4-(pyrrolidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 604.3; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-(pyrrolidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 604.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(diethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 606.2; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-(diethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 606.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(4-methoxypiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 648.3; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-(4-methoxypiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 648.3; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-[4-(trifluoromethyl)piperidin-1-yl]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 686.2; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-[4-(trifluoromethyl)piperidin-1-yl]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 686.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(4-methanesulfonylpiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 696.2; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-(4-methanesulfonylpiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 696.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{6-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 660.3; and 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{6-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 660.3.


Example C51
Preparation of Compounds 194A and 195A



embedded image


Synthesis of N-((1R,4R)-4-(2-azaspiro[3.3]heptan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((1S,4S)-4-(2-azaspiro[3.3]heptan-2-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine:


Step 1: To a solution of 4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]cyclohexanone (600 mg, 1.24 mmol, 1 eq.) in EtOH (1 mL) were added 2-azaspiro[3.3]heptane oxalic acid salt (1.76 g, 6.20 mmol, 5 eq.), Ti(OEt)4 (6.20 mmol, 1.29 mL, 5 eq.), and i-Pr2NH (1.24 mmol, 175 μL, 1 eq.). The reaction mixture was stirred at 50° C. for 3 h. Then the reaction mixture was cooled, and NaBH3CN (389.6 mg, 6.20 mmol, 5 eq.) was added to the reaction under N2 at 0° C. The reaction mixture was stirred for 5 min, then warmed to 50° C. for 1 h. TLC analysis (EtOAc:TEA=20:1, Rf1=0.6, Rf2=0.55) showed that the starting material was completely consumed. The solution was dried under vacuum to give the crude product. The residue was purified by column chromatography (SiO2, PE:EtOAc=5:1 to 0:1) to provide the N-[4-(2-azaspiro[3.3]heptan-2-yl)cyclohexyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (600 mg, 1.16 mmol, 93.5% yield) as a brown oil.


Step 2: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (92.5 mg, 348 μmol, 1.2 eq.) in DMSO (3 mL) were added i-Pr2NH (2.90 mmol, 410 μL, 10 eq.), Pd(PPh3)4 (67.0 mg, 58 μmol, 0.2 eq.), N-[4-(2-azaspiro[3.3]heptan-2-yl)cyclohexyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (150 mg, 290 μmol, 1 eq.), and CuI (55.2 mg, 290 μmol, 1 eq.).The mixture was stirred at 25° C. for 2 h under N2. TLC analysis (EtOAc: TEA=20:1, Rf=0.3, Rf=0.2) showed that the starting material was completely consumed. The reaction mixture was quenched by addition of saturated aqueous EDTA (30 mL) and stirring the mixture at 25° C. for 2 h. The reaction mixture was partitioned with EtOAc, and the aqueous phase was extracted with EtOAc (3×10 mL). The organic phase was washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered and concentrated in vacuo to give the crude product. The residue was purified by prep-TLC (EtOAc:TEA=20:1, Rf=0.3, Rf=0.2), then further purified by prep-HPLC to give cis-N-[4-(2-azaspiro[3.3]heptan-2-yl)cyclohexyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (45.2 mg, 71.9 μmol, 24.8% yield) MS (ES+, m/z): 629.2, and trans-N-[4-(2-azaspiro[3.3]heptan-2-yl)cyclohexyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (46.5 mg, 74.0 μmol, 25.5% yield) MS (ES+, m/z): 629.2 as a yellow solid.


Example C52
Preparation of Compounds 196A and 197A



embedded image


The desired products were prepared via a procedure analogous to EXAMPLE C51, using 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{2-azaspiro[3.3]heptan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 608.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-{2-azaspiro[3.3]heptan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 608.3.


Example C53
Preparation of Compounds 198A and 199A



embedded image


The desired products were prepared via a procedure analogous to EXAMPLE C51, using 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


3-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-azaspiro[3.3]heptan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 630.3; and 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{2-azaspiro[3.3]heptan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 630.3.


Example C54
Preparation of Compounds 362A, 363A, 364A, and 365A



embedded image


embedded image


Synthesis of 1-(((difluoro-l3-methyl)-l2-fluoraneyl)methyl)-2-iodo-N-(4-thiomorpholinocyclohexyl)-1H-indol-4-amine: To a solution of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (1 g, 2.06 mmol, 1 eq.) in thiomorpholine (105.6 mmol, 10 mL, 51 eq.) was added AcOH (2.06 mmol, 118 μL, 1 eq.). The reaction mixture was stirred at 25° C. for 2 h, and NaBH3CN (5 eq.) was added under N2 at 0° C. The mixture was stirred further for 5 min, and then heated to 50° C. and stirred for 3 h, after which time TLC and LC-MS analysis indicated that the ketone starting material was completely consumed. The reaction was partitioned by adding water (100 mL) and EtOAc (20 mL). The residue was purified by column chromatography (SiO2) (PE:EtOAc=10:1 to 0:1) to afford 1-(((difluoro-λ3-methyl)-λ2-fluoraneyl)methyl)-2-iodo-N-(4-thiomorpholinocyclohexyl)-1H-indol-4-amine (1.1 g, crude) (ES+, m/z): 523.8.


Synthesis of 4-(4-((1-(((difluoro-λ3-methyl)-λ2-fluoraneyl)methyl)-2-iodo-1H-indol-4-yl)amino)cyclohexyl)thiomorpholine 1,1-dioxide: To a solution of 1-(((difluoro-λ3-methyl)-λ2-fluoraneyl)methyl)-2-iodo-N-(4-thiomorpholinocyclohexyl)-1H-indol-4-amine (1 g, 1.91 mmol, 1 eq.) in CHCl3 (20 mL) was added m-CPBA (2.06 g, 9.55 mmol, 80% purity, 5 eq.) at 0° C. The mixture was stirred at 0˜25° C. for 5 h, after which time TLC and LC-MS analysis indicated that the reaction was complete. The reaction was partitioned by adding a saturated aqueous solution of Na2CO3 (200 mL) and EtOAc (50 mL). The residue was purified by column chromatography (SiO2) (PE:EtOAc=5:1 to 0:1, DCM:MeOH=10:1) to afford 4-(4-((1-(((difluoro-l3-methyl)-l2-fluoraneyl)methyl)-2-iodo-1H-indol-4-yl)amino)cyclohexyl)thiomorpholine 1,1-dioxide (0.8 g, 1.44 mmol, 75.4% yield). MS (ES+, m/z): 555.7


Preparation of final products: 4-(4-((1-(((difluoro-λ3-methyl)-λ2-fluoraneyl)methyl)-2-iodo-1H-indol-4-yl)amino)cyclohexyl)thiomorpholine 1,1-dioxide was coupled to 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline according to the general procedure specified in EXAMPLE C51. In each case, TLC and LC-MS analysis indicated that the starting material was completely consumed after stirring the reaction mixture at 25° C. for 1 h. The resulting products were purified by prep-HPLC to afford the desired pure compounds.


4-[(1R,4R)-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]cyclohexyl]-1λ6-thiomorpholine-1,1-dione, MS (ES+, m/z): 667.2; 4-[(1S,4S)-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]cyclohexyl]-1λ6-thiomorpholine-1,1-dione, MS (ES+, m/z): 667.2; 4-[(1R,4R)-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]cyclohexyl]-1λ4-thiomorpholin-1-one, MS (ES+, m/z): 651.2; 4-[(1S,4S)-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]cyclohexyl]-1λ4-thiomorpholin-1-one, MS (ES+, m/z): 651.2.


Example C55
Preparation of Compounds 366A, 367A, 368A, and 369A



embedded image


embedded image


Compounds 366A, 367A, 368A, and 369A were prepared via a procedure analogous to Example C54, using 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


4-((3-(4-(((1S,4S)-4-(1,1-dioxidothiomorpholino)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino) -3-methoxy-N-methylbenzamide , MS (ES+, m/z): 646.2; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(1-oxo-1λ4-thiomorpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 630.6; and 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(1-oxo -1λ4-thiomorpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 630.2.


Example C56
Preparation of Compounds 370A, 371A, 372A, and 373A



embedded image


embedded image


Compounds 370A, 371A, 372A, and 373A were prepared via a procedure analogous to EXAMPLE C54, using 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


3-methoxy-4-{[3-(4-{[(1S,4S)-4-(1,1-dioxo-1λ6-thiomorpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 668.1; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-(1-oxo-1λ4-thiomorpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 652.2; and 3-methoxy-4-{[3-(4-{[(1S,4S)-4-(1-oxo-1λ4-thiomorpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 652.1.


Example C57
General Procedure for Preparation of Compounds 348A, 349A, 414A, and 415A



embedded image


Step 1: To a solution of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (1 eq.) and amine RH (2 eq.) in THF (2 mL) was added MgSO4 (5 eq.). The mixture was stirred at 25° C. for 0.5 h, and NaBH(OAc)3 (2 eq.) was added. The mixture was stirred at 25° C. for 1 h, after which time TLC/LC-MS analysis indicated that the starting material was completely consumed. The reaction mixture was diluted with water (10 mL) and extracted with EtOAc (2 mL×2). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to DCM:MeOH=10:1) to afford 2-iodo-N-[4-(3-methoxy-1-piperidyl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (600 mg, crude) was obtained as yellow solid.


Step 2: The above specified R-substituted iodoindoles were coupled to 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline according to the general procedure specified in EXAMPLE C51. In each case, TLC/LC-MS analysis indicated that the starting material was completely consumed after heating at 45° C. for 1 h.


2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-(3-methoxypiperidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 647.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-(3-methoxypiperidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 647.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{3-oxa-9-azaspiro[5.5]undecan-9-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 687.3; and 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{3-oxa-9-azaspiro[5.5]undecan-9-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 687.3.


Example C58
General Procedure for Preparation of Compounds 356A, 357A, 416A, and 417A



embedded image


Compounds 356A, 357A, 416A, and 417A were prepared via a procedure analogous to EXAMPLE C51, using 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(3-methoxypiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 626.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(3-methoxypiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop -2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 626.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{3-oxa-9-azaspiro[5.5]undecan-9-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop -2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 666.4; and 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-{3-oxa-9-azaspiro[5.5]undecan-9-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 666.3.


Example C59
General Procedure for Preparation of Compounds 358A, 359A, 418A, and 419A



embedded image


Compounds 358A, 359A, 418A, and 419A were prepared via a procedure analogous to EXAMPLE C51, using 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


3-methoxy-4-{[3-(4-{[(1R,4R)-4-(3-methoxypiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 648.3; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-(3-methoxypiperidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 648.3; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{3-oxa-9-azaspiro[5.5]undecan-9-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 688.3; and 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{3-oxa-9-azaspiro[5.5]undecan-9-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 688.3.


Example
General Procedure for Preparation of Compounds 188A, 189A, 336A, 337A, 383A, 384A, 432A, 433A, 451A, and 452A



embedded image


Representative Procedure:

Step 1: To a solution of 4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]cyclohexanone (600 mg, 1.31 mmol, 1 eq.) and 3-methoxypiperidine (301 mg, 2.61 mmol, 2 eq.) in THF (5 mL) was added MgSO4 (786.4 mg, 6.53 mmol, 5 eq.). The mixture was stirred at 25° C. for 0.5 h. NaBH(OAc)3 (553.9 mg, 2.61 mmol, 2 eq.) was added into the mixture and the mixture was stirred at 25° C. for 1 h. TLC analysis (DCM:MeOH=10:1) indicated that the ketone was completely consumed, and two major new spots with polarity greater than that of the starting material were detected. The reaction mixture was diluted with water (10 mL) and extracted with EtOAc (10 mL×2). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to DCM:MeOH=10:1) to afford 2-iodo-N-[4-(3-methoxy-1-piperidyl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (600 mg, crude) as yellow solid.


Step 2: The above specified R-substituted iodoindoles were coupled to 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline according to the general procedure specified in EXAMPLE C51. In each case, TLC/LC-MS analysis indicated that the starting material was completely consumed after heating at 45° C. for 1 h.


2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-(3-methanesulfonylazetidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 667.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-(3-methanesulfonylazetidin-1-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 667.2; 2-(3-((2-methoxy-4-(methyl-(methylene)sulfinyl)phenyl)amino)prop-1-yn-1-yl)-N-((1R,4R)-4-(3-methoxypyrrolidin-1-yl)cyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 633.2; 2-(3-((2-methoxy-4-(methyl-(methylene)sulfinyl)phenyl)amino)prop-1-yn-1-yl)-N-((1S,4S)-4-(3-methoxypyrrolidin-1-yl)cyclohexyl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 633.2; N-((1R,4R)-4-(2-oxa-8-azaspiro[4.5]decan-8-yl)cyclohexyl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-benzo[d]imidazol-4-amine, MS (ES+, m/z): 673.3; N-((1S,4S)-4-(2-oxa-8-azaspiro[4.5]decan-8-yl)cyclohexyl)-2-(3-42-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-benzo[d]imidazol-4-amine, MS (ES+, m/z): 673.3; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{1-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 659.3; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{1-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 659.3; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{hexahydro-1H-furo[3,4-c]pyrrol-5-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 645.2; and 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{hexahydro-1H-furo[3,4-c]pyrrol-5-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 645.2.


Example C60
General Procedure for Preparation of Compounds 192A, 193A, 385A, 386A, 428A, 429A, 434A, 435A, 453A, and 454A



embedded image


Compounds 192A, 193A, 385A, 386A, 428A, 429A, 434A, 435A, 453A, and 454A were prepared via a procedure analogous to the synthesis of the compounds described by EXAMPLE C51, using 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(3-methanesulfonylazetidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 646.2; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(3-methanesulfonylazetidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 646.2; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-(3-methoxypyrrolidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 612.3;


3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-(3-methoxypyrrolidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 612.3; 4-((3-(4-(((1R,4R)-4-(2-oxa-8-azaspiro[4.5]decan-8-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-benzo[d]imidazol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzamide, MS (ES+, m/z): 652.3; 4-((3-(4-(((1S,4S)-4-(2-oxa-8-azaspiro[4.5]decan-8-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-benzo[d]imidazol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzamide, MS (ES+, m/z): 652.3; 4-((3-(4-(((1S,4S)-4-(2-oxa-8-azaspiro[4.5]decan-8-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-benzo[d]imidazol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzamide, MS (ES+, m/z): 652.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{1-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-{1-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{hexahydro-1H-furo[3,4-c]pyrrol-5-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 624.3; and 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-{hexahydro-1H-furo[3,4-c]pyrrol-5-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 624.3.


Example C61
General Procedure for Preparation of Compounds 190A, 191A, 338A, 339A, 387A, 388A, 412A, 413A, 430A, and 431A

Compounds 190A, 191A, 338A, 339A, 387A, 388A, 412A, 413A, 430A, and 431A were prepared via a procedure analogous to EXAMPLE C51, using 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline.


3-methoxy-4-{[3-(4-{[(1R,4R)-4-(3-methanesulfonylazetidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 668.2; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-(3-methanesulfonylazetidin-1-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 668.2; 3-methoxy-4-((3-(4-(((1R,4R)-4-(3-methoxypyrrolidin-1-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 634.3; 3-methoxy-4-((3-(4-(((1S,4S)-4-(3-methoxypyrrolidin-1-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 634.3; 4-((3-(4-(((1R,4R)-4-(2-oxa-8-azaspiro[4.5]decan-8-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-benzo[d]imidazol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 674.3; 4-((3-(4-(((1S,4S)-4-(2-oxa-8-azaspiro[4.5]decan-8-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-benzo[d]imidazol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 674.3; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{1-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 660.3; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{1-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 660.3; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{hexahydro-1H-furo[3,4-c]pyrrol-5-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 646.3; and 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{hexahydro-1H-furo[3,4-c]pyrrol-5-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 646.3.


Example C62
General Procedure for Preparation of Compounds 206A, 207A, 208A, 209A, 606A, 607A, 624A, 627A, 628A, 761A, and 760A



embedded image


The R2-substituted alkynes were coupled to the R1-substituted iodoindoles specified above according to the general procedure specified in EXAMPLE C51. In each case, the reactions were deemed complete after stirring for 1 h at 30° C.


N-[3-methoxy-4-({3-[4-({1-[(2-oxo -1,3-dioxolan-4-yl)methyl]piperidin-4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-yl}amino)benzenesulfonyl]acetamide, MS (ES+, m/z): 678.2. N-((3-methoxy-4-((3-(4-((1-((2-oxo-1,3-dioxolan-4-yl)methyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)phenyl)sulfonyl)propionamide, MS (ES+, m/z): 692.2; N-(4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzenesulfonyl)-N-methylpropanamide, MS (ES+, m/z): 694.3; N-(3-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzenesulfonyl)acetamide, MS (ES+, m/z): 674.3; N-(3-methoxy-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzenesulfonyl)acetamide, MS (ES+, m/z): 674.3; N-(3-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzenesulfonyl)propanamide, MS (ES+, m/z): 688.4; and N-(3-methoxy-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzenesulfonyl)propanamide, MS (ES+, m/z): 688.4; N-(4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzenesulfonyl)acetamide, MS (ES+, m/z): 666.2; 1-methoxy-3-(4-{[2-(3-{[2-methoxy-4-(propanamidosulfonyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)propan-2-ylpropanoate, MS (ES+, m/z): 736.3; 1-(4-{[2-(3-{[2-methoxy-4-(propanamidosulfonyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)-3-(propanoyloxy)propan-2-ylpropanoate, MS (ES+, m/z): 778.1; and N-(4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzenesulfonyl)propanamide, MS (ES+, m/z): 680.3.


Example C63
General Procedure for Preparation of Compounds 94A, 100A, 109A, 112A, 115A, 116A, 233A, 245A, 246A, 488A, and 651A



embedded image


The R1-substituted iodoindoles specified above were coupled to the R2-substituted alkynes according to the general procedure specified in EXAMPLE C51. In each case, the reactions were deemed complete after stirring for 1 h at 45° C., and the crude compounds were first purified by prep-TLC and further purified by prep-HPLC.


(1R,4R)—N4-{2-[3-(2-amino -4-methanesulfonylphenoxy)prop-1-yn-1-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl}-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 563.2; (1S,4S)—N4-{2-[3-(2-amino-4-methanesulfonylphenoxy)prop-1-yn-1-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl}-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 563.1; N-(5-methanesulfonyl-2-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]oxy}phenyl)acetamide, MS (ES+, m/z): 605.2; N-(5-methanesulfonyl-2-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]oxy}phenyl)acetamide, MS (ES+, m/z): 605.2; 1-{4-[(2-{3-[4-methanesulfonyl-2-(methylamino)phenoxy]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol, MS (ES+, m/z): 623.4; (1R,4R)—N4-(2-{3-[4-methanesulfonyl-2-(methylamino)phenoxy]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 577.3; 2-{3-[4-methanesulfonyl-2-(methylamino)phenoxylprop-1-yn-1-yl}-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 631.2; 243-(2-amino-4-methanesulfonylphenoxy)prop-1-yn-1-yl]-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 617.2; 2-[3-(2-amino-4-methanesulfonylphenoxy)prop-1-yn-1-yl]-N-[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 617.1; (1R,4R)—N4-(2-{3-[2-(dimethylamino)-4-methanesulfonylphenoxy]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 591.2; and 2-{3-[2-(dimethylamino)-4-methanesulfonylphenoxy]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 563.2.


Example C64
General Procedure for Preparation of Compounds 164A, 165A, 166A, 167A, 168A, 169A, 261A, 262A, 299A, 300A, 316A, 317A, 340A, 341A, 342A, 343A, 344A, 345A, 379A, 380A, 381A, 382A, 391A, 392A, 490A, 666A, 667A, and 668A



embedded image


Preparation of (1R,4R)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine and (1S,4S)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine: A mixture of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (300 mg, 0.675 mmol, 1 eq.), 2-methoxy-N-methyl-ethanamine (2.70 mmol, 290 μL, 4 eq.), and Ti(OEt)4 (2.70 mmol, 560 μL, 4 eq.) in EtOH (3 mL) was stirred at 50° C. for 11 h. NaBH3CN (84.7 mg, 1.35 mmol, 2 eq.) was then added, and the mixture was stirred for an additional 1 h at 50° C. TLC analysis (PE:EtOAc=3:1, Rf=0.01) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated solution of NaHCO3 (60 mL) at 25° C., diluted with water (20 mL), and extracted with EtOAc (30 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (PE:EtOAc:TEA=5:5:1, Rf1=0.24, Rf2=0.43). (1R,4R)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine (90 mg,159 μmol, 23.6% yield) and (1S,4S)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4-(2-methoxyethyl)-N4-methylcyclohexane-1,4-diamine (130 mg, 231 μmol, 34.2% yield) were obtained as light yellow solids.




embedded image


Preparation of (1R,4R)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-bis(2-methoxyethyl)cyclohexane-1,4-diamine and (1S,4S)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-bis(2-methoxyethyl)cyclohexane-1,4-diamine: To a mixture of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexan-1-one (250 mg, 573 μmol, 1 eq.) and AcOH (1.15 mmol, 65.6 μL, 2 eq.) in neat bis(2-methoxyethyl)amine (16.93 mmol, 2.50 mL, 29.5 eq.) was added NaBH3CN (72.0 mg, 1.15 mmol, 2 eq.). The mixture was stirred at 50° C. for 1 h, after which time TLC analysis (PE:EtOAc=3:1, Rf1=0.18, Rf2=0.24) indicated that the reaction was complete. The reaction mixture was quenched with water (40 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide a residue that was purified by prep-TLC (SiO2, PE:EtOAc=3:1). (1R,4R)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-bis(2-methoxyethyl)cyclohexane-1,4-diamine (120 mg, 184 μmol, 32.2% yield) and (1S,4S)—N1-(2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N4,N4-bis(2-methoxyethyl)cyclohexane-1,4-diamine (110 mg, 179 μmol, 31.2% yield) were obtained as light yellow solids.




embedded image


Preparation of final products: To a mixture of R2 and R3 substituted alkyne (1˜2 eq.) in DMSO (5 mL) was added i-Pr2NH (1030 eq.). Then, CuI (1˜2 eq.), R1-substituted iodoindole (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.) were added into the mixture. The mixture was stirred at 20˜45° C. for 1˜3 h under N2. LC-MS or TLC analysis detected completion of the reaction. The mixture was poured into saturated EDTA solution 30 mL and stirred for 1 h. The aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by TLC, prep-HPLC, or TLC and prep-HPLC to afford the desired compound.


3-(cyanomethoxy)-4-{[3-(4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop -2-yn-1-yl]amino}benzene -1-sulfonamide , MS (ES+, m/z): 645.2; 3-(cyanomethoxy)-4-{[3-(4-{[(1S,4S)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 645.2; 3-(cyanomethoxy)-4-{[3-(4-{[(1R,4R)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 647.2; 3-(cyanomethoxy)-4-{[3-(4-{[(1S,4S)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 647.2; 3-(cyanomethoxy)-4-{[3-(4-{[(1R,4R)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 685.2; 3-(cyanomethoxy)-4-{[3-(4-{[(1S,4S)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-tri fluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 685.2; 3-(cyanomethoxy)-4-{[3-(4-{[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 685.2; 3-(cyanomethoxy)-4-{[3-(4-{[(1S,4S)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-tri fluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 685.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 638.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1S,4S)-4-(morpholin-4-yl)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 3-(fluoromethoxy)-4-{[3-(4-{[(1R,4R)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 640.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1S,4S)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 640.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 650.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 650.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1R,4R)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 678.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1S,4S)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 678.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 678.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1S,4S)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 678.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1R,4R)-4-[bis(2-methoxyethyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 684.2; 3-(fluoromethoxy)-4-{[3-(4-{[(1S,4S)-4-[bis(2-methoxyethyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 684.2; (2R)-1-(4-{[2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.2; (2S)-1-(4-{[2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.2; 2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 641.2; 2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[(1R,4R)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 677.3; 2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[(1S,4S)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 677.3; 2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[(1R,4R)-4-(morpholin-4-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 637.2; 2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[(1S,4S)-4-(morpholin-4-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 637.2; and 1-(4-{[2-(3-{[2-(difluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 659.2.


Example C65
General Procedure for Preparation of Compounds 139A, 138A, 287A, 288A, 289A, 290A, 708A, and 713A



embedded image


To a mixture of 4-methylsulfonyl-N-prop-2-ynyl-2-(trifluoromethyl)aniline (1-2.5 eq.) or 2-chloro-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1-2.5 eq.) in DMSO (2 mL) were added i-PrNH2 (10 eq.), CuI (1 eq.), R-substituted iodoindole (0.1 g, 195.57 μmol, 1 eq), and Pd(PPh3)4 (74.51 mg, 64.48 μmol, 0.3 eq.) in one portion under N2. The mixture was stirred at 25° C. for 60 min, after which time TLC analysis indicated that the reaction was complete. The reaction was diluted with EtOAc (20 mL) and then poured into aqueous 2M EDTA (20 mL) and stirred for 1 h. The mixture was extracted with EtOAc (20 mL×3), and the combined organic layers were washed with water (20 mL×2) and brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, EtOAc:TEA=100:2), and then further purified by prep-HPLC to obtain the desired products as white solids.


1-(4-{[2-(3-{[4-methanesulfonyl-2-(trifluoromethyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 661.3; (1R,4R)—N4-[2-(3-{[4-methanesulfonyl-2-(trifluoromethyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 615.3; (1S,4S)-N4-[2-(3-{[4-methanesulfonyl-2-(trifluoromethyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 615.3; 2-(3-{[4-methanesulfonyl-2-(trifluoromethyl)phenyl]amino}prop-1-yn-1-yl)-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 669.2; 2-(3-{[4-methanesulfonyl-2-(trifluoromethyl)phenyl]amino}prop-1-yn-1-yl)-N-[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 669.2; 1-{4-[(2-{3-[(2-chloro-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol, MS (ES+, m/z): 627.4; 2-{3-[(2-chloro-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 635.3; and 2-{3-[(2-chloro-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 635.2.


Example C66
General Procedure for Preparation of Compounds 67A, 68A, 480A, 582A, and 1002A



embedded image


2-Methoxy-4-(morpholinosulfonyl)-N-(prop-2-yn-1-yl)aniline was coupled to the R1-substituted iodoindoles specified above according to the general procedure specified in EXAMPLE C51. In each case, the reactions were deemed complete after stirring for 1 h at 30° C., and the crude compounds were purified by prep-TLC and further purified by prep-HPLC.


3-(4-{[2-(3-{[2-methoxy-4-(morpholine-4-sulfonyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)propane-1,2-diol, MS (ES+, m/z): 680.2; 2-(3-{[2-methoxy-4-(morpholine-4-sulfonyl)phenyl]amino}prop-1-yn-1-yl)-N-(oxan-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 607.2; 2-(3-{[2-methoxy-4-(morpholine-4-sulfonyl)phenyl]amino}prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 620.2; (1R,4R)—N4-[2-(3-{[2-methoxy-4-(morpholine-4-sulfonyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 648.2; and (1S,4S)—N4-[2-(3-{[2-methoxy-4-(morpholine-4-sulfonyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 648.3.


Example C67
General Procedure for Preparation of Compounds 69A, 70A, 483A, 595A, and 1007A



embedded image


N,N-bis(2-hydroxyethyl)-3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide was coupled to the R1-substituted iodoindoles specified above according to the general procedure specified in Example C51. In each case, the reactions were deemed complete after stirring for 1 h at 30° C., and the crude compounds were first purified by prep-TLC and further purified by prep-HPLC.


N,N-bis(2-hydroxyethyl)-3-methoxy-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 666.2; N,N-bis(2-hydroxyethyl)-3-methoxy-4-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 666.3; N,N-bis(2-hydroxyethyl)-4-{[3-(4-{[1(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 682.2; N,N-bis(2-hydroxyethyl)-3-methoxy-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 625.2; and N,N-bis(2-hydroxyethyl)-3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 638.2.


Example C68
General Procedure for Preparation of Compounds 76A, 485A, 559A, 1048A, and 1011A



embedded image


2-methoxy-4-((4-methylpiperazin-1-yl)sulfonyl)-N-(prop-2-yn-1-yl)aniline was coupled to the R1-substituted iodoindoles specified above according to the general procedure specified in EXAMPLE C51. In each case, the reactions were deemed complete after stirring for 1 h at 45° C., and the crude compounds were first purified by prep-TLC and further purified by prep-HPLC.


3-[4-({2-[3-({2-methoxy-4-[(4-methylpiperazin-1-yl)sulfonyl]phenyl}amino)prop-1-yn-1-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl}amino)piperidin-1-yl]propane-1,2-diol, MS (ES+, m/z): 693.3; 4-({2-[3-({2-methoxy-4-[(4-methylpiperazin-1-yl)sulfonyl]phenyl}amino)prop-1-yn-1-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl}amino)-1λ6-thiane-1,1-dione, MS (ES+, m/z): 668.2; 2-[3-({2-methoxy-4-[(4-methylpiperazin-1-yl)sulfonyl]phenyl}amino)prop-1-yn-1-yl]-N-(oxan-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 620.4; 2-[3-({2-methoxy-4-[(4-methylpiperazin-1-yl)sulfonyl]phenyl}amino)prop-1-yn-1-yl]-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 633.3; and (1R,4R)—N4-{2-[3-({2-methoxy-4-[(4-methylpiperazin-1-yl)sulfonyl]phenyl}amino)prop-1-yn-1-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl}-N1,N1-dimethylcyclohexane-1,4-diamine, MS (ES+, m/z): 661.4.


Example C69
General Procedure for Preparation of Compounds 63A and 64A



embedded image


Synthesis of 2-iodo-N-(1,4-dioxaspiro[4.5]decan-8-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (500 mg, 1.47 mmol, 1 eq.) in MeOH (5 mL) were added 1,4-dioxaspiro[4.5]decan-8-one (1.15 g, 7.35 mmol, 5 eq.), and SnCl2.2H2O (66.4 mg, 294 μmol, 0.2 eq.). Polymethylhydrosiloxane (PMHS) (197.2 mg, 2.94 mmol, 2 eq.) was then added in one portion, and the resulting mixture was heated and stirred for 1 h at 70° C., after which time LC-MS analysis indicated that reaction was complete. The mixture was dried over anhydrous sodium sulfate, filtered with diatomite, and concentrated in vacuo. The residue was purified by silica gel chromatography (SiO2, PE:EtOAc=50:1 to 5:1) to afford 2-iodo-N-(1,4-dioxaspiro[4.5]decan-8-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (800 mg, 1.33 mmol, 90.6% yield) as a yellow oil.


Preparation of final products: To a mixture of R-substituted alkyne (1.2 eq.) in DMSO (2 mL) were added diisopropylamine (3.12 mmol, 441 μL, 10 eq.), CuI (59.5 mg, 312 μmol, 1 eq.), 2-iodo-N-(1,4-dioxaspiro[4.5]decan-8-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (150 mg, 312 μmol, 1 eq.), and Pd(PPh3)4 (72.2 mg, 62.5 μmol, 0.2 eq.) under N2. The mixture was stirred at 25° C. for 1 h, after which time LC-MS and TLC analysis indicated that the reaction was complete. 10 mL of EtOAc was then added, and the mixture was poured into a saturated EDTA solution (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (40 mL×2), and the organic phase was poured into a saturated EDTA solution (40 mL) and stirred for 1 h. The aqueous phase was again extracted with EtOAc (40 mL×3), and the combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, treated with activated carbon, filtered, and concentrated in vacuo. The residue was purified by prep-TLC, and then further purified by prep-HPLC to afford the desired compounds.


4-({3-[4-({1,4-dioxaspiro[4.5]decan-8-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-yl}amino)-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 593.2; and N-{1,4-dioxaspiro[4.5]decan-8-yl}-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 592.2.


Example C70
General Procedure for Preparation of Compounds 56A, 57A, 202A, 203A, 204A, 205A, 212A, 213A, 293A, 294A, 313A, 374A, 398A, 399A, 400A, 401A, and 1047A



embedded image


Representative procedure for reductive amination reaction: A solution of 4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]cyclohexanone (380 mg, 854 μmol, 1 eq.), 6-oxa-3-azabicyclo[3.1.1]heptane (308 mg, 1.28 mmol, 1.5 eq.), NaOAc (140 mg, 1.71 mmol, 2 eq.), and tetraethoxytitanium (1.71 mmol, 354 μL, 2 eq.) in EtOH (10 mL) was stirred for 1 h at 25° C. NaBH3CN (107.3 mg, 1.71 mmol, 2 eq.) was then added to the reaction, and the resulting reaction mixture was stirred at 25° C. for 1 h. TLC analysis showed that the ketone was consumed completely, and two new spot were detected. The reaction mixture was poured into a saturated NaHCO3 (20 mL) and filtered, and the filtrate was extracted with EtOAc (20 mL×2). The organic layers were concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=2:1 to 1:1).


Representative procedure for Sonogashira coupling reaction: To a mixture of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (874.9 mg, 3.33 mmol, 1.2 eq.) and 2-iodo-N-[4-(6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (1.8 g, 2.77 mmol, 1 eq.) in DMSO (30 mL) were added CuI (528 mg, 2.77 mmol, 1 eq.) and N-isopropylpropan-2-amine (27.7 mmol, 3.92 mL, 10 eq.), and Pd(PPh3)4 (640.8 mg, 555 μmol, 0.2 eq.) under N2. The reaction mixture was stirred for 1 h at 25° C. LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched by adding saturated aqueous EDTA (50 mL) and stirred at 25° C. for 1 h, then extracted with EtOAc (50 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=2:1 to 1:1) and further purified by prep-HPLC to afford the desired product as a yellow solid.


2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 631.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-}-N-[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 631.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 632.2; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 632.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 631.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 631.2; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 632.2; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 632.2; 4-[(2-{3-[(2-methoxy-4-{2-oxa-6-azaspiro[3.3]heptane-6-sulfonyl}phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-1λ6-thiane-1,1-dione, MS (ES+, m/z): 667.1; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 596.1; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 596.1; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 659.3; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 659.4; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1R,4R)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 659.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(1S,4S)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 659.3; (1R,4R)—N4-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N1-(2-methoxyethyl)-N1-methylcyclohexane-1,4-diamine, MS (ES+, m/z): 621.3; and (1S,4S)—N4-(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)-N1-(2-methoxyethyl)-N1-methylcyclohexane-1,4-diamine, MS (ES+, m/z): 621.3.


Example C71
General Procedure for Preparation of Compounds 21A and 22A



embedded image


Synthesis of tert-butyl 6-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.5 g, 1.47 mmol, 1 eq.) in MeOH (5 mL) were added tert-butyl 6-oxo-2-azaspiro[3.3]heptane-2-carboxylate (776.5 mg, 3.68 mmol, 2.5 eq.) and SnCl2.2H2O (66.4 mg, 294 μmol, 0.20 eq.). Polymethylhydrosiloxane (PMHS) (352.9 mg, 5.88 mmol, 4 eq.) was then added, and the mixture was stirred at 70° C. for 3 h, after which time TLC analysis indicated that the reaction was complete. The mixture was evaporated to afford the crude product, which was then purified by column chromatography to afford tert-butyl 6-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate as white solid.


Synthesis of tert-butyl 6-((2-(3-((2-methoxy-4-sulfamoylphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate and tert-butyl 6-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-azaspiro[3.3]heptane-2-carboxylate: To a mixture of 2-iodo-N-[4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (50 mg, 86.7 1 eq.) and 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (27.3 mg, 104 μmol, 1.2 eq.) in DMSO (3 mL) were added CuI (16.5 mg, 86.7 μmol, 1 eq.), N-isopropylpropan-2-amine (86.7 μmol, 12.2 μL, 1 eq.), and Pd(PPh3)4 (2.0 mg, 1.73 μmol, 0.02 eq.) under N2. The reaction mixture was stirred for 1 h at 25° C. LC-MS analysis indicated that all of the iodide was consumed. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (60 mL) at 25° C. and stirring the mixture for 1 h, followed by extraction with EtOAc (20 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf1=0.43, Rf2=0.37) and purified further by prep-HPLC to obtain the desired product as a yellow solid.


General procedure for preparation of final products: A solution of the Boc-protected amine (1 eq.) in DCM was added into 2,2,2-trifluoroacetic acid (174.7 eq.) at 20° C. and stirred for 16 h. LC-MS analysis indicated that the starting material was consumed, and one main mass with desired compound was observed. The reaction mixture was concentrated under reduced pressure, and the residue was purified by prep-HPLC to afford the compounds as yellow solids.


N-{2-azaspiro[3.3]heptan-6-yl}-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 547.2; and 4-({3-[4-({2-azaspiro[3.3]heptan-6-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-yl}amino)-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 548.2.


Example C72
General Procedure for Preparation of Compounds 151A, 152A, 295A, 296A, 375A, and 376A



embedded image


Representative procedure: To a mixture of 3-methoxy-N-methyl-4-(prop-2-ynylamino)benzamide (38.6 mg, 159 μmol, 1.5 eq.) and N1-[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]-N4-(2-methoxyethyl)-N4-methyl-cyclohexane-1,4-diamine (60.0 mg, 106.0 μmol, 1 eq.) in DMSO (3 mL) were added N-isopropylpropan-2-amine (106 μmol, 15 μL, 1 eq.) and Pd(PPh3)4 (2.5 mg, 2.1 μmol, 0.02 eq.), followed by CuI (20.2 mg, 106 μmol, 1 eq.) under N2. The reaction mixture was stirred for 1 h at 45° C. and monitored by TLC analysis (DCM:MeOH=10:1). The reaction mixture was quenched by adding a saturated EDTA solution (40 mL), and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1), and further purified by prep-HPLC to give 3-methoxy-4-[3-[4-[[4-[2-methoxyethyl(methyl)amino]cyclohexyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-N-methyl-benzamide (17.0 mg, 27.5 μmol, 26.0% yield) as light yellow solid.


3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 600.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-[(2-methoxyethyl)(methyl)amino]cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 600.3; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.4; 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.4; 3-methoxy-N-methyl-4-{[3-(4-{[(1R,4R)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.4; and 3-methoxy-N-methyl-4-{[3-(4-{[(1S,4S)-4-{2-oxa-7-azaspiro[3.5]nonan-7-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 638.3.


Example C73
General Procedure for Preparation of Compounds 297A, 298A, 400A, and 401A



embedded image


Representative procedure for reductive amination: To a solution of 4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]cyclohexanone (5 g, 11.1 mmol, 1 eq) and 7-oxa-2-azaspiro[3.5]nonane oxalic acid (4.60 g, 13.3 mmol, 1.2 eq.) in THF (100 mL) were added i-Pr2NH (55.6 mmol, 7.86 mL, 5 eq.) and MgSO4 (6.69 g, 55.6 mmol, 5 eq.). The mixture was heated and stirred at 35° C. for 0.5 h, and NaBH(OAc)3 (4.71 g, 22.2 mmol, 2 eq) was added to the reaction. The resulting mixture was stirred further at 35° C. for 1 h. TLC analysis (PE:EtOAc=3:1) showed that the reaction was complete. The reaction mixture was poured into water (100 mL), and the aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 0:1) to give the desired product 2-iodo-N-[4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (10 g, 16.4 mmol, 49.3% yield) as light yellow solid.


Representative Procedure for Sonogashira coupling: To a solution of 3-methoxy-4-(prop-2-ynylamino)benzenesulfonamide (1.58 g, 5.92 mmol, 1.2 eq.) in DMSO (30 mL) were added i-Pr2NH (49.3 mmol, 6.97 mL, 10 eq.) and CuI (939 mg, 4.93 mmol, 1 eq) at 45° C. under N2. Then, 2-iodo-N-[4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (3 g, 4.93 mmol, 1 eq) and Pd(PPh3)4 (1.14 g, 986 μmol, 0.2 eq) were added to the reaction. The resulting mixture was stirred at 45° C. for 1 h. TLC analysis (DCM:MeOH=10:1) showed that the reaction was complete. The mixture was poured into a saturated aqueous EDTA solution (100 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (60 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The resulting residue was purified by prep-TLC and prep-HPLC to give the desired product 3-methoxy-4-[3-[4-[[4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2ynylamino]benzenesulfonamide (6 g, 8.64 mmol, 58.4% yield).


3-methoxy-4-{[3-(4-{[(1R,4R)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 660.3; 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{7-oxa-2-azaspiro[3.5]nonan-2-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 660.3; 3-methoxy-4-{[3-(4-{[(1R,4R)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 632.2; and 3-methoxy-4-{[3-(4-{[(1S,4S)-4-{6-oxa-3-azabicyclo[3.1.1]heptan-3-yl}cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 632.2.


Example C74
Preparation of Compounds 210A and 211A



embedded image


Compounds 210A and 211A were prepared via a procedure analogous to the synthesis of Compounds 389A and 390A according to EXAMPLE C47, starting from N-(4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and 2-(2-fluoroethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline. (2-(3-{[2-(2-fluoroethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[(1R,4R)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine) was purified by column chromatography (SiO2, PE:EtOAc=2:1 to EtOAc to DCM:MeOH=10:1, Rf=0.3) and further purified by prep-HPLC to obtain the desired product in 50.8% yield (830.2 mg, 1.25 mmol, MS (ES+, m/z): 663.2) as a yellow solid. (2-(3-{[2-(2-fluoroethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[(1S,4S)-4-{2-oxa-6-azaspiro[3.3]heptan-6-yl}cyclohexyl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine) was purified by prep-TLC (DCM:MeOH=20:1) and further purified by prep-HPLC to obtain the desired product in 17.4% yield (10.3 mg, 14.26 μmol, MS (ES+, m/z): 663.2) as a yellow solid.


Example C75
General Procedure for Preparation of Compounds 48A, 50A, 54A, 55A, 469A, 471A, 472A, 473A, 477A, 479A, 528A, 529A, 544A, 547A, 551A, 553A, 555A, 564A, 572A, 577A, 718A, 726A, 992A, 994A, 996A, 999A, 1000A, 1001A, 1015A, 1036A, 1037A, 1038A, 1039A, 1040A, 1042A, 1043A, 1044A, 1045A, 1046A, 1052A, and 1053A



embedded image


embedded image


Representative Procedure: To a mixture of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (18.4 mg, 66.9 μmol, 0.87 eq., HCl) in DMSO (2 mL) were added i-Pr2NH (769 μmol, 108 μL, 10 eq), CuI (14.6 mg, 76.9 μmol, 1 eq), 2-iodo-N-(1-tetrahydropyran-4-yl-4-piperidyl)-1-(2,2,2-trifluoroethyl)indol-4-amine (50.0 mg, 76.9 μmol, 1 eq.), and Pd(PPh3)4 (88.8 mg, 76.9 μmol, 1 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h. TLC and LC-MS analysis showed that the reaction was complete. EtOAc (10 mL) was poured into the mixture, and the mixture was poured into saturated aqueous EDTA (30 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (30 mL×2). The organic layer was poured into saturated aqueous EDTA (30 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, treated with activated carbon, filtered and concentrated in vacuo. The residue was purified by prep-TLC and prep-HPLC to afford 2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-N-(1-tetrahydropyran-4-yl-4-piperidyl)-1-(2,2,2-trifluoroethyl)indol-4-amine (13.3 mg, 20.2 μmol, 26.3% yield) as light yellow solid. The other compounds were prepared using the same procedure.


2-(2-((3-(4-((1,1-dioxidotetrahydro-2H-thiopyran-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxy)acetamide, MS (ES+, m/z): 627.2; 2-(2-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-(methylsulfonyl)phenoxy)acetamide, MS (ES+, m/z): 592.2; 4-((3-(4-((1,1-dioxidotetrahydro-2H-thiopyran-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-N-(2-hydroxyethyl)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 629.2; N-(2-hydroxyethyl)-3-methoxy-4-((3-(4-((tetrahydro-2H-pyran-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 581.2; N-(2-hydroxyethyl)-3-methoxy-4-((3-(4-((1-(tetrahydro-2H-pyran-4-yl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 664.3; 4-((3-(4-((1-(2,3-dihydroxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-N-(2-hydroxyethyl)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 654.2; 2-[2-(2-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}ethoxy)ethoxy]ethan-1-ol, MS (ES+, m/z): 667.2; N-(2-hydroxyethyl)-3-methoxy-4-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, MS (ES+, m/z): 594.2; 3-methoxy-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-N-(1,2-oxazol-3-yl)benzene-1-sulfonamide, MS (ES+, m/z): 604.2; 4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-N-(2-hydroxyethyl)-3-methoxy-N-methylbenzene-1-sulfonamide, MS (ES+, m/z): 643.1; 4-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(1,2-oxazol-3-yl)benzene-1-sulfonamide, MS (ES+, m/z): 604.2; 3-methoxy-N-(1,2-oxazol-3-yl)-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 645.3; 3-methoxy-N-(1,2-oxazol-3-yl)-4-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 645.2; 3-methoxy-N-(5-methyl-1,2-oxazol-3-yl)-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 631.2; 3-methoxy-N-(5-methyl-1,2-oxazol-3-yl)-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 618.2; 4-({2-[3-({2-[2-(dimethylamino)ethoxy]-4-methanesulfonylphenyl}amino)prop-1-yn-1-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl}amino)-1λ6-thiane-1,1-dione, MS (ES+, m/z): 641.2; 4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxy-N-(5-methyl-1,2-oxazol-3-yl)benzene-1-sulfonamide, MS (ES+, m/z): 666.2; 4-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(5-methyl-1,2-oxazol-3-yl)benzene-1-sulfonamide, MS (ES+, m/z): 691.2; 4-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(2-hydroxyethyl)-3-methoxy-N-methylbenzene-1-sulfonamide, MS (ES+, m/z): 668.2; 4-{[2-(3-{[2-methoxy-4-(morpholine-4-sulfonyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}-1λ6-thiane-1,1-dione, MS (ES+, m/z): 655.3; 4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxy-N-(1,2-oxazol-3-yl)benzene-1-sulfonamide, MS (ES+, m/z): 652.1; 3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-N-(1,2-oxazol-3-yl)benzene-1-sulfonamide, MS (ES+, m/z): 617.2; N-[2-(dimethylamino)ethyl]-4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxy-N-methylbenzene-1-sulfonamide, MS (ES+, m/z): 670.2; 3-methoxy-N-(2-methoxyethyl)-N-methyl-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 622.2; N-(2,3-dihydroxypropyl)-4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 659.1; 3-methoxy-N-(5-methyl-1,2-oxazol-3-yl)-4-{[3-(4-{[(1R,4R)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 659.3; 3-methoxy-N-(5-methyl-1,2-oxazol-3-yl)-4-{[3-(4-{[(1S,4S)-4-(dimethylamino)cyclohexyl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 659.2; N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 595.2; N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 608.2; N-(2-hydroxyethyl)-3-methoxy-N-methyl-4-{[3-(4-{[1-(oxan-4-yl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 678.3; 3-methoxy-N,N-dimethyl-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 578.2; 4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxy-N,N-dimethylbenzene-1-sulfonamide, MS (ES+, m/z): 613.1; 3-methoxy-N,N-dimethyl-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 565.2; 4-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N,N-dimethylbenzene-1-sulfonamide, MS (ES+, m/z): 638.3; 1-(4-{3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzenesulfonyl}piperazin-1-yl)ethan-1-one, MS (ES+, m/z): 661.3; 4-({2-[3-({4-[(4-acetylpiperazin-1-yl)sulfonyl]-2-methoxyphenyl}amino)prop-1-yn-1-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl}amino)-1λ6-thiane-1,1-dione, MS (ES+, m/z): 696.2; 1-(4-{3-methoxy-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzenesulfonyl}piperazin-1-yl)ethan-1-one, MS (ES+, m/z): 648.2; 1-[4-(4-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzenesulfonyl)piperazin-1-yl]ethan-1-one, MS (ES+, m/z): 721.3; 4-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxy-N-(2-methoxyethyl)-N-methylbenzene-1-sulfonamide, MS (ES+, m/z): 657.2; 3-methoxy-N-(2-methoxyethyl)-N-methyl-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 609.2; and 4-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(2-methoxyethyl)-N-methylbenzene-1-sulfonamide, MS (ES+, m/z): 682.2.


Example C76
Synthesis of Compounds 263A, 264A, 327A, 328A, and 617A



embedded image


Representative Procedure for Reductive Amination: Preparation of 2-iodo-4-(R-substituted)-1-(2,2,2-trifluoroethyl)-1H-indole: A mixture of 4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]cyclohexanone (2.5 g, 5.73 mmol, 1 eq.), 7-oxa-2-azaspiro[3.5]nonane oxalic acid salt (1.97 g, 5.73 mmol, 1 eq.), and NaBH(OAc)3 (2.43 g, 11.5 mmol, 2 eq.) and MgSO4 (3.45 g, 28.7 mmol, 5 eq.) in THF (10 mL) was stirred 1 h at 25° C. Then, i-Pr2NH (28.7 mmol, 4.05 mL, 5 eq.) was added to the reaction and stirred for an additional 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous NaHCO3 solution (40 mL) at 25° C. The mixture was diluted with water (100 mL) and extracted with EtOAc (100 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by chromatography over silica gel (SiO2, DCM:MeOH=10:1, Rf1=0.28, Rf2=0.24) to give 2-iodo-N-[4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (3 g, 5.48 mmol, 47.8% yield) as a light yellow solid. 1H NMR (400 MHz, DMSO) δ=7.24 (s, 1H), 6.90-6.86 (m, 1H), 6.75-6.73 (d, 2H), 6.13-6.11 (d, 1H), 5.57-5.35 (d, 1H), 5-4.94 (m, 2H), 3.50-3.48 (m, 4H), 3.39 (s, 1H), 3.17-3.16 (d, 2H), 2.89 (m, 4H), 2.39 (m, 1H), 2.16 (m, 1H), 1.67-1.59 (m, 10H), 1.57-1.41 (m, 1H).


Representative Procedure (Sonogashira Coupling): To a mixture of N-[3-methoxy-4-(prop-2-ynylamino)phenyl]sulfonylacetamide (43.0 mg, 137 μmol, 1.5 eq.) in DMSO (2 mL) were added i-Pr2NH (913 μmol, 129 μL, 10 eq.), CuI (8.7 mg, 46 0.5 eq.), 2-iodo-N-[4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (50 mg, 91.3 μmol, 1 eq.), and Pd(PPh3)4 (21.1 mg, 18.3 μmol, 0.2 eq.) at 25° C. The mixture was stirred for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.6) showed that the reaction was complete. EtOAc (10 mL) was poured into the reaction, and the mixture was poured into a saturated aqueous EDTA solution (30 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (30 mL×2). The organic layer was poured into a saturated aqueous EDTA solution (30 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, and concentrated in vacuo. The mixture was purified by prep-TLC (DCM:MeOH=10:1, Rf=0.5) followed by prep-HPLC to afford the desired products as a white solid (18.5 mg, 24.2 μmol, formic acid salt).


3-methoxy-4-{[3-(4-{[1-(2-methoxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-methylbenzene-1-sulfonamide, MS (ES+, m/z): 608.2; 4-((3-(4-(((1R,4R)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzenesulfonamide, MS (ES+, m/z): 674.3; 4-((3-(4-(((1S,4S)-4-(7-oxa-2-azaspiro[3.5]nonan-2-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzenesulfonamide, MS (ES+, m/z): 674.3; 4-((3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzenesulfonamide, and MS (ES+, m/z): 646.2; 4-((3-(4-(((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzenesulfonamide, MS (ES+, m/z): 646.3.


Example C77
Synthesis of Compounds 267A and 268A



embedded image


To a mixture of 3-methoxy-N,N-dimethyl-4-(prop-2-ynylamino)benzenesulfonamide (31.0 mg, 115.5 μmol, 1.2 eq.) in DMSO (3 mL) were added i-Pr2NH (963 μmol, 136 μL, 10 eq), CuI (3.7 mg, 19.6 μmol, 0.2 eq.), followed by 2-iodo-N-[4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (50 mg, μmol, 1 eq) and Pd(PPh3)4 (11.1 mg, 9.63 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was stirred with a saturated aqueous EDTA solution (50 mL) and EtOAc (25 mL) at 25° C. for 1 h, then extracted with EtOAc (25 mL×2). The organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, stirred with activated carbon, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, PE:EtOAc:TEA=1:1:0.2) and further purified by prep-HPLC to give the product 3-methoxy-N,N-dimethyl-4-[3-[4-[[4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2 ynylamino]benzenesulfonamide (17.2 mg, 26.1 μmol, 27.1% yield).


4-((3-(4-(((1R,4R)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop -2-yn-1-yl)amino)-3-methoxy-N,N-dimethylbenzene sulfonamide, MS (ES+, m/z): 660.2; 4-((3-(4-(((1S,4S)-4-(2-oxa-6-azaspiro[3.3]heptan-6-yl)cyclohexyl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N,N-dimethylbenzenesulfonamide, MS (ES+, m/z): 660.2.


TABLE 3 shows compounds with a 2-ethynyl-N-(cycloalkyl)-1H-indole-4-amine core.












TABLE 3





Com-





pound


LC-MS


No.
Structure
IUPAC
(ES+, m/z)







18A


embedded image


3-methoxy-4-{3-[4- ({2-oxaspiro[3.3]heptan- 6-yl}amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl]prop-2-yn-1- yl}amino)benzene- 1-sulfonamide
549.2





19A


embedded image


[1-(chloromethyl)-3-[(2- {3-[(4-methanesulfonyl- 2-methoxyphenyl) amino]prop-1-yn- 1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)amino] cyclobutyl]methanol
584.2





20A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop- 1-yn-1-yl}-N-{2- oxaspiro[3.3]heptan-6- yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-amine
548.2





21A


embedded image


4-({3-[4-({2- azaspiro[3.3]heptan- 6-yl}amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl]prop-2-yn- 1-yl}amino)-3- methoxybenzene-1- sulfonamide
548.2





22A


embedded image


N-{2-azaspiro[3.3] heptan-6-yl}-2- {3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop- 1-yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-amine
547.2





23A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-(methylamino)cyclo- hexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
542.2





24A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-aminocyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
528.2





25A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1S,4S-4- aminocyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
528.2





26A


embedded image


rel-(1R,3R)-N1-(2-{3- [(4-methanesulfonyl- 2-methoxyphenyl)amino] prop-1-yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)cyclohexane- 1,3-diamine
548.9





27A


embedded image


rac-(1R,3S)-N1-(2-{3- [(4-methanesulfonyl- 2-methoxyphenyl) amino]prop-1-yn- 1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)cyclohexane- 1,3-diamine
548.9





28A


embedded image


(1R,2S)-N1-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)- 1H-indol-4-yl)cyclo- hexane-1,2-diamine
548.9





29A


embedded image


rac-(1R,2S)-N1-(2-{3- [(4-methanesulfonyl-2- methoxyphenyl)amino] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)- 1H-indol-4-yl)cyclo- hexane-1,2-diamine
548.9





30A


embedded image


rel-(1R,3S)-3-[(2-{3- [(4-methanesulfonyl- 2-methoxyphenyl)amino] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino] cyclohexan-1-ol
549.9





31A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1R,4R)-4- hydroxy-4-methyl- cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
543.2





32A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1S,4S)-4- hydroxy-4-methyl- cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
543.2





33A


embedded image


4-[(3-{4-[(4-cyano- cyclohexyl)amino]-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop- 2-yn-1-yl)amino]-3- methoxy-N- methylbenzamide
538.2





34A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1R,4R)-4- cyanocyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
538.2





35A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1S,4S)-4- cyanocyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
538.2





36A


embedded image


3-[(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)amino] cyclohexane-1- carboxylic acid
577.9





37A


embedded image


2-fluoro-N1-(2-(3-((2- methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-yl)cyclohexane-1,4- diamine
567.2





38A


embedded image


(1R,2R,4S)-2-fluoro-N1- (2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl) cyclohexane-1,4-diamine
567.2





39A


embedded image


2-fluoro-N1-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)-1H- indol-4-yl)-N4-methyl- cyclohexane-1,4-diamine
581.3





40A


embedded image


(1R,2R,4S)-2-fluoro- N1-(2-(3-((2- methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-yl)-N4- methylcyclohexane- 1,4-diamine
581.3





41A


embedded image


2-fluoro-N1-(2-(3- ((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl)- N4,N4-dimethyl- cyclohexane-1,4- diamine
595.3





42A


embedded image


(1R,2R,4S)-2-fluoro-N1- (2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1-yl)- 1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl)- N4,N4-dimethylcyclo- hexane-1,4-diamine
595.3





43A


embedded image


(3S,4R)-3-fluoro-4-[(2- {3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)amino] cyclohexan-1-ol
568.2





44A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-[bis(2- hydroxyethyl)amino] cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
638.3





45A


embedded image


3-methoxy-4-{[3-(4- {[(1S,4S)-4-[bis(2- hydroxyethyl)amino] cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
638.3





46A


embedded image


4-((3-(4-(((1R,4R)-4- (dimethylamino)cyclohexyl) amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1-yl)amino)- 3-methoxybenzene- sulfonamide
578.2





47A


embedded image


4-((3-(4-(((1S,4S)-4- (dimethylamino)cyclohexyl) amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1-yl)amino)- 3-methoxybenzene- sulfonamide
578.3





48A


embedded image


3-methoxy-N-(1,2-oxazol- 3-yl)-4-{[3-(4-{[(1R,4R)- 4-(dimethylamino)cyclo- hexyl]amino}-l- (2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
645.3





49A


embedded image


3-methoxy-N-(oxan-4-yl)- 4-{[3-(4-{[(1R,4R)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
662.2





50A


embedded image


3-methoxy-N-(1,2-oxazol- 3-yl)-4-{[3-(4-{[(1S,4S)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
645.2





51A


embedded image


3-methoxy-N-(oxan-4-yl)- 4-{[3-(4-{[(1S,4S)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
662.3





52A


embedded image


N-(3-(4-(((1S,4S)- 4-(dimethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1-yl)-N- (2-hydroxy-4- (methylsulfonyl)phenyl) propionamide
619.1





53A


embedded image


N-(3-(4-(((1R,4R)- 4-(dimethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1-yl)-N- (2-hydroxy-4- (methylsulfonyl)phenyl) propionamide






54A


embedded image


3-methoxy-N-(5-methyl- 1,2-oxazol-3-yl)-4-{[3- (4-{[(1S,4S)-4- (dimethylamino)cyclohexyl] amino}-l-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
659.2





55A


embedded image


3-methoxy-N-(5-methyl- 1,2-oxazol-3-yl)-4-{[3- (4-{[(1R,4R)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
659.3





56A


embedded image


(1S,4S)-N4-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop- 1-yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)-N1-(2- methoxyethyl)- N1-methylcyclohexane- 1,4-diamine
621.3





57A


embedded image


(1R,4R)-N4-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop- 1-yn-1-yl}-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl)- N1-(2-methoxyethyl)- N1-methylcyclohexane- 1,4-diamine
621.3





58A


embedded image


3-methoxy-4-{[3-(4- {[(1S,4S)-4-[(3S,4S)- 3,4-dihydroxypyrrolidin- 1-yl]cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino}benzene- 1-sulfonamide
636.2





59A


embedded image


4-((3-(4-(((1R,4R)-4- ((3R,4R)-3,4- dihydroxypyrrolidin-1- yl)cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxybenzene- sulfonamide
636.2





60A


embedded image


4-((3-(4-(((1R,4S)-4- ((3S,4S)-3,4- dihydroxypyrrolidin-1- yl)cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxybenzene- sulfonamide
636.2





61A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-[bis(2- methoxyethyl)amino]cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
666.3





62A


embedded image


3-methoxy-4-{[3-(4- {[(1S,4S)-4-[bis(2- methoxyethyl)amino]cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
666.3





63A


embedded image


4-({3-[4-({1,4- dioxaspiro[4.5]decan-8- yl}amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl]prop-2-yn-1- yl}amino)-3-methoxy- benzene-1-sulfonamide
593.2





64A


embedded image


N-{1,4- dioxaspiro[4.5]decan-8- yl}-2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-amine
592.2





65A


embedded image


3-methoxy-4-[(3-{4- [(4-oxocyclohexyl)amino]- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop- 2-yn-1-yl)amino]benzene- 1-sulfonamide
549.1





66A


embedded image


4-[(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl)amino]cyclo- hexan-1-one
548.2





67A


embedded image


(1R,4R)-N4-[2-(3-{[2- methoxy-4-(morpholine- 4-sulfonyl)phenyl] amino}prop-1-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4- yl]-N1,N1-dimethyl- cyclohexane-1,4-diamine
648.2





68A


embedded image


(1S,4S)-N4-[2-(3-{[2- methoxy-4-(morpholine- 4-sulfonyl)phenyl] amino}prop-1-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol- 4-yl]-N1,N1-dimethyl- cyclohexane-1,4-diamine
648.3





69A


embedded image


N,N-bis(2-hydroxyethyl)- 3-methoxy-4-{[3-(4- {[(1S,4S)-4-(dimethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- 1-sulfonamide
666.3





70A


embedded image


N,N-bis(2-hydroxyethyl)- 3-methoxy-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino}benzene- 1-sulfonamide
666.2





71A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino} benzene-1-sulfonamide
592.2





72A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1S,4S)-4- (dimethylamino)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
592.3





73A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzamide
542.2





74A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1R,4R)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
556.3





75A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1S,4S)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
556.3





76A


embedded image


(1R,4R)-N4-{2-[3-({2- methoxy-4-[(4- methylpiperazin-1- yl)sulfonyl]phenyl}amino) prop-1-yn-1-yl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-yl}-N1,N1-dimethyl- cyclohexane-1,4-diamine
661.4





77A


embedded image


(1R,4R)-N4-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop- 1-yn-1-yl}-1-[(oxiran-2- yl)methyl]-1H-indol-4- yl)-N1,N1-dimethylcyclo- hexane-1,4-diamine
551.1





78A


embedded image


2-[(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-4-{[(1R,4R)-4- (dimethylamino)cyclohexyl] amino}-1H-indol-1- yl)methyl]prop-2- enenitrile
560.4





79A


embedded image


5-methanesulfonyl-2-{[3- (4-{[(1S,4S)-4-(dimethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}phenol
563.1





80A


embedded image


5-methanesulfonyl-2-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}phenol
563.2





81A


embedded image


2-(5-methanesulfonyl-2- {[3-(4-{[(1R,4R)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl] amino}phenoxy)acetonitrile
602.3





82A


embedded image


2-(5-methanesulfonyl-2- {[3-(4-{[(1S,4S)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl] amino}phenoxy)acetonitrile
602.2





83A


embedded image


N-(3-methoxy-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzenesulfonyl) acetamide
620.1





84A


embedded image


N-(3-methoxy-4-{[3-(4- {[(1S,4S)-4-(dimethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzenesulfonyl) acetamide
620.3





85A


embedded image


N-(3-methoxy-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzenesulfonyl) propanamide
634.3





86A


embedded image


N-(3-methoxy-4-{[3-(4- {[(1S,4S)-4-(dimethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzenesulfonyl) propanamide
634.2





87A


embedded image


2-(5-methanesulfonyl-2- {[3-(4-{[(1R,4R)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}phenoxy)ethan- 1-ol
607.1





88A


embedded image


2-(5-methanesulfonyl-2- {[3-(4-{[(1S,4S)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl] amino}phenoxy)ethan- 1-ol
607.4





89A


embedded image


(1R,4R)-N4-[2-(3-{[4- methanesulfonyl-2-(2- methoxyethoxy)phenyl] amino}prop-1-yn-1-yl)- 1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl]- N1,N1-dimethylcyclo- hexane-1,4-diamine
621.4





90A


embedded image


N-(3-(4-(((1R,4R)-4- (dimethylamino)cyclohexyl) amino)-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl)-N-(2- hydroxy-4-(methyl- sulfonyl)phenyl)iso- butyramide
633.3





91A


embedded image


N-(3-(4-(((1S,4S)-4- (dimethylamino)cyclohexyl) amino)-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl)-N- (2-hydroxy-4- (methylsulfonyl)phenyl) isobutyramide
633.3





92A


embedded image


(1R,4R)-N4-[2-(3-{[4- methanesulfonyl-2- (2,2,2-trifluoroethoxy) phenyl]amino}prop-1- yn-1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl]- N1,N1-dimethylcyclo- hexane-1,4-diamine
645.3





93A


embedded image


(1S,4S)-N4-[2-(3-{[4- methanesulfonyl-2- (2,2,2-trifluoroethoxy) phenyl]amino}prop-1- yn-1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl]- N1,N1-dimethylcyclo- hexane-1,4-diamine
645.3





94A


embedded image


(1S,4S)- N4-{2-[3- (2-amino-4-methane- sulfonylphenoxy)prop- 1-yn-1-yl]-1-(2,2,2- trifluoroethyl)- 1H-indol-4-yl}-N1,N1- dimethylcyclohexane- 1,4-diamine
563.1





95A


embedded image


(1R,4R)-N4-(2-{3- [(2-ethoxy-4-methane- sulfonylphenyl)amino] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)- 1H-indol-4-yl)-N1,N1- dimethylcyclohexane- 1,4-diamine
591.2





96A


embedded image


(1S,4S)-N4-(2-{3- [(2-ethoxy-4-methane- sulfonylphenyl)amino] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)- 1H-indol-4-yl)-N1,N1- dimethylcyclohexane- 1,4-diamine
591.2





97A


embedded image


3-hydroxy-N-methyl- 4-{[3-(4-{[(1S,4S)-4- (dimethylamino)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzamide
542.2





98A


embedded image


3-hydroxy-N-methyl- 4-{[3-(4-{[(1R,4R)-4- (dimethylamino)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
542.2





99A


embedded image


3-(2-methoxyethoxy)- N-methyl-4-{[3-(4- {[(1S,4S)-4-(dimethyl- amino)cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
600.3





100A


embedded image


(1R,4R)-N4-{2-[3- (2-amino-4-methane- sulfonylphenoxy)prop- 1-yn-1-yl]-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl}-N1,N1- dimethylcyclohexane- 1,4-diamine
563.2





101A


embedded image


N-ethyl-3-methoxy-4- {[3-(4-{[(1R,4R)-4- (dimethylamino)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
570.3





102A


embedded image


N-ethyl-3-methoxy-4- {[3-(4-{[(1S,4S)-4- (dimethylamino)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
570.3





103A


embedded image


3-(2-methoxyethoxy)- N-methyl-4-{[3- (4-{[(1R,4R)-4- (dimethylamino)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
600.3





104A


embedded image


3-(2-fluoroethoxy)- N-methyl-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
588.3





105A


embedded image


3-(2-fluoroethoxy)-N- methyl-4-{[3-(4- {[(1S,4S)-4-(dimethyl- amino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
588.3





106A


embedded image


3-(fluoromethoxy)-N- methyl-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
574.3





107A


embedded image


3-(fluoromethoxy)-N- methyl-4-{[3-(4- {[(1S,4S)-4-(dimethyl- amino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
574.3





108A


embedded image


(1S,4S)-N4-(2-{3-[4- methanesulfonyl-2- (methylamino)phenoxy] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)-1H- indol-4-yl)-N1,N1- dimethylcyclohexane- 1,4-diamine
577.3





109A


embedded image


(1R,4R)-N4-(2-{3-[4- methanesulfonyl-2- (methylamino)phenoxy] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)-1H- indol-4-yl)-N1,N1- dimethylcyclohexane- 1,4-diamine
577.3





110A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1S,4S)-4- (methylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
542.2





111A


embedded image


(1S,4S)-N4-(2-{3-[2- (dimethylamino)-4- methanesulfonyl- phenoxy]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)-N1,N1- dimethylcyclohexane- 1,4-diamine
591.2





112A


embedded image


(1R,4R)-N4-(2-{3-[2- (dimethylamino)-4- methanesulfonyl- phenoxy]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)-N1,N1- dimethylcyclohexane- 1,4-diamine
591.2





113A


embedded image


3-(cyanomethoxy)-N- methyl-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
581.3





114A


embedded image


3-(2-cyanoethoxy)-N- methyl-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
595.3





115A


embedded image


N-(5-methanesulfonyl- 2-{[3-(4-{[(1R,4R)-4- (dimethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]oxy}phenyl)acetamide
605.2





116A


embedded image


N-(2-((3-(4- (((1S,4S)-4-(dimethyl- amino)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl)oxy)-5-(methyl- sulfonyl)phenyl)acetamide
605.2





117A


embedded image


(1R,4R)-N1-(2-(3-((2- (fluoromethoxy)-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl)- N4,N4-dimethylcyclo- hexane-1,4-diamine
595.2





118A


embedded image


(1S,4S)-N1-(2-(3-((2- (fluoromethoxy)-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1-yl)- 1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl)- N4,N4-dimethylcyclo- hexane-1,4-diamine
595.2





119A


embedded image


(1R,4R)-N4-[2-(3-{[4- (ethanesulfonyl)-2- methoxyphenyl]amino} prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl]-N1,N1- dimethylcyclohexane- 1,4-diamine
591.4





120A


embedded image


(1S,4S)-N4-[2-(3-{[4- (ethanesulfonyl)-2- methoxyphenyl]amino} prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl]-N1,N1- dimethylcyclohexane- 1,4-diamine
591.3





121A


embedded image


2-(3-methoxy-4-{[3- (4-{[(1R,4R)-4- (dimethylamino)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}phenyl)-2- methylpropanenitrile
566.2





122A


embedded image


2-(4-((3-(4-(((1S,4S)- 4-(dimethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1-yl)amino)- 3-methoxyphenyl)-2- methylpropanenitrile
566.2





123A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1R,4R)-4- (dimethylamino)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
603.4





124A


embedded image


3-(cyanomethoxy)-4- ((3-(4-(((1S,4S)-4- (dimethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)benzene- sulfonamide
603.3





125A


embedded image


3-(3-(4-(((1R,4R)- 4-(dimethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1-yl)-6- (methylsulfonyl) benzo[d]oxazol- 2(3H)-one
589.2





126A


embedded image


3-(3-(4-(((1S,4S)- 4-(dimethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1-yl)-6- (methylsulfonyl) benzo[d]oxazol- 2(3H)-one
589.2





127A


embedded image


3-methoxy-N,N- dimethyl-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino} benzene-1-sulfonamide
606.2





128A


embedded image


(1R,4R)-N1-(2-(3- (((3S,4R)-3-methoxy- tetrahydro-2H-pyran-4- yl)amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl)- N4,N4-dimethylcyclo- hexane-1,4-diamine
507.3





129A


embedded image


(1S,4S)-N1-(2-(3- (((3S,4R)-3-methoxy- tetrahydro-2H-pyran-4- yl)amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl)- N4,N4-dimethylcyclo- hexane-1,4-diamine
507.3





130A


embedded image


(1R,4R)-N4-(2-{3- [(4-chloro-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2,2,2-trifluoro- ethyl)-1H-indol-4- yl)-N1,N1-dimethylcyclo- hexane-1,4-diamine
533.2





131A


embedded image


(1S,4S)-N1-(2-(3-((4- chloro-2-methoxy- phenyl)amino)prop-1- yn-1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4- yl)-N4,N4-dimethylcyclo- hexane-1,4-diamine
533.2





132A


embedded image


4-((3-(4-(((1R,4R)- 4-(dimethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)- 2-fluoro-5-methoxy- benzamide
560.2





133A


embedded image


4-((3-(4-(((1S,4S)- 4-(dimethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)- 2-fluoro-5-methoxy- benzamide
560.2





134A


embedded image


(1R,4R)-N4-[2-(3-{[2- methoxy-4-(trifluoro- methyl)phenyl]amino} prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-yl]-N1,N1- dimethylcyclohexane- 1,4-diamine
567.2





135A


embedded image


(1S,4S)-N1-(2-(3-((2- methoxy-4-(trifluoro- methyl)phenyl)amino) prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-yl)-N4,N4- dimethylcyclohexane- 1,4-diamine
567.2





136A


embedded image


2-fluoro-5-methoxy-N- methyl-4-{[3-(4- {[(1R,4R)-4-(dimethyl- amino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
574.3





137A


embedded image


4-((3-(4-(((1S,4S)- 4-(dimethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1-yl) amino)-2-fluoro-5- methoxy-N-methyl- benzamide
574.2





138A


embedded image


(1S,4S)-N4-[2-(3- {[4-methanesulfonyl- 2-(trifluoromethyl) phenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl]-N1,N1- dimethylcyclohexane- 1,4-diamine
615.3





139A


embedded image


(1R,4R)-N4-[2-(3- {[4-methanesulfonyl- 2-(trifluoromethyl) phenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H- indol-4-yl]-N1,N1- dimethylcyclohexane- 1,4-diamine
615.3





140A


embedded image


(1R,4R)-N4-(2-{3-[(4- methanesulfonyl-2- methylphenyl)amino] prop-1-yn-1-yl}- 1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)-N1,N1- dimethylcyclohexane- 1,4-diamine
561.3





141A


embedded image


(1S,4S)-N1,N1-dimethyl- N4-(2-(3-((2-methyl-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1-yl)- 1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)cyclo- hexane-1,4-diamine
561.3





142A


embedded image


(1R,4R)-N4-[2-(3- {[4-methanesulfonyl- 2-(trifluoromethoxy) phenyl]amino}prop-1- yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-yl]-N1,N1-dimethyl- cyclohexane-1,4- diamine
631.1





143A


embedded image


(1S,4S)-N1,N1-dimethyl- N4-(2-(3-((4-(methyl- sulfonyl)-2-(trifluoro- methoxy)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-yl)cyclohexane-1,4- diamine
631.1





144A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-([(1R,4R)-4- (diethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
584.3





145A


embedded image


4-((3-(4-(((1S,4S)- 4-(diethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)- 3-methoxy-N-methyl- benzamide
584.3





146A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-(diethyl- amino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- 1-sulfonamide
606.2





147A


embedded image


4-((3-(4-(((1S,4S)- 4-(diethylamino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)- 3-methoxybenzene- sulfonamide
606.2





148A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1R,4R)-4- (diethylamino)cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl] amino}benzene- 1-sulfonamide
620.2





149A


embedded image


2-(5-methanesulfonyl-2- {[3-(4-{[(1R,4R)-4-[(2- methoxyethyl)(methyl) amino]cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino} phenoxy)acetonitrile
646.2





150A


embedded image


2-(5-methanesulfonyl- 2-{[3-(4-{[(1S,4S)-4- [(2-methoxyethyl)(methyl) amino]cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1-yl] amino}phenoxy)acetonitrile
646.2





151A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-[(2-methoxyethyl) (methyl)amino]cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
600.3





152A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1S,4S)- 4-[(2-methoxyethyl) (methyl)amino]cyclo hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
600.3





153A


embedded image


N-ethyl-3-methoxy- 4-{[3-(4-{[(1R,4R)- 4-[(2-methoxyethyl) (methyl)amino]cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
614.4





154A


embedded image


N-ethyl-3-methoxy-4- ((3-(4-(((1S,4S)-4-((2- methoxyethyl)(methyl) amino)cyclohexyl) amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)benzamide
614.4





155A


embedded image


(1R,4R)-N1-(2-(3- ((2-(fluoromethoxy)- 4-(methylsulfonyl) phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-yl)-N4-(2-methoxy- ethyl)-N4-methylcyclo- hexane-1,4-diamine
639.3





156A


embedded image


(1S,4S)-N1-(2-(3-((2- (fluoromethoxy)-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-yl)-N4- (2-methoxyethyl)-N4- methylcyclohexane- 1,4-diamine
639.3





157A


embedded image


3-(fluoromethoxy)-N- methyl-4-{[3-(4- {[(1R,4R)-4-[(2- methoxyethyl)(methyl) amino]cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
618.3





158A


embedded image


3-(fluoromethoxy)-N- methyl-4-{[3-(4- {[(1S,4S)-4-[(2- methoxyethyl)(methyl) amino]cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
618.3





159A


embedded image


3-(fluoromethoxy)-4- ((3-(4-(((1S,4S)-4- ((2-methoxyethyl) (methyl)amino)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-N-methyl- benzamide
618.3





160A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-[(2- methoxyethyl)(methyl) amino]cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl]amino}benzene- 1-sulfonamide
622.2





161A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-((2- methoxyethyl)(methyl) amino)cyclohexyl) amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)benzene- sulfonamide
622.2





162A


embedded image


(1R,4R)-N1,N1-diethyl- N4-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino] prop-1-yn-1-yl}-1- (2,2,2-trifluoroethyl)-1H- indol-4-yl)cyclohexane- 1,4-diamine
605.4





163A


embedded image


(1S,4S)-N1,N1-diethyl- N4-(2-(3-((2-methoxy- 4-(methylsulfonyl) phenyl)amino)prop-1- yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-yl)cyclohexane-1,4- diamine
605.2





164A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1R,4R)-4- [(2-methoxyethyl) (methyl)amino]cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
647.2





165A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1S,4S)-4- [(2-methoxyethyl)(methyl) amino]cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
647.2





166A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1R,4R)- 4-[bis(2-methoxyethyl) amino]cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzene-1-sulfonamide
684.3





167A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1S,4S)-4-[bis(2- methoxyethyl)amino]cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzene- 1-sulfonamide
684.2





168A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1R,4R)-4- [(2-methoxyethyl)(methyl) amino]cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino}benzene- 1-sulfonamide
640.2





169A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1S,4S)-4-[(2- methoxyethyl)(methyl) amino]cyclohexyl] amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
640.2





170A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-(morpholin- 4-yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
584.2





171A


embedded image


3-methoxy-4-{[3-(4- {[(1S,4S)-4-(morpholin- 4-yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
584.2





172A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1R,4R)-4- (morpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
598.3





173A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1S,4S)- 4-(morpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
598.3





174A


embedded image


2-(2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-4-{[(1R,4R)-4- (morpholin-4-yl)cyclo- hexyl]amino}-1H-indol- 1-yl)acetonitrile
576.3





175A


embedded image


4-({3-[1-(2-fluoro- ethyl)-4-{[(1R,4R)- 4-(morpholin-4- yl)cyclohexyl]amino}- 1H-indol-2-yl]prop- 2-yn-1-yl}amino)-3- methoxy-N- methylbenzamide
562.3





176A


embedded image


1-(2-fluoroethyl)-2- {3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)-4- (morpholin-4-yl)cyclo- hexyl]-1H-indol-4-amine
583.3





177A


embedded image


4-({3 -[1-(cyanomethyl)- 4-{[(1R,4R)-4-(morpholin- 4-yl)cyclohexyl]amino}- 1H-indol-2-yl]prop- 2-yn-1-yl}amino)-3- methoxy-N-methyl- benzamide
555.3





178A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-propyl-N- [(1R,4R)-4-(morpholin- 4-yl)cyclohexyl]-1H- indol-4-amine
579.3





179A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-1-(2-methyl- propyl)-N-[(1R,4R)- 4-(morpholin-4- yl)cyclohexyl]-1H-indol- 4-amine
593.3





180A


embedded image


1-(2,2-difluoroethyl)- 2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)-4- (morpholin-4-yl)cyclo- hexyl]-1H-indol-4-amine
601.3





181A


embedded image


3-methoxy-4-((3-(4- (((1R,4R)-4-morpholino- cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl)amino)benzene- sulfonamide
620.2





182A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-morpholino- cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl)amino)benzene- sulfonamide
620.2





183A


embedded image


N-ethyl-3-methoxy-4- {[3-(4-{[(1R,4R)-4- (morpholin-4-yl)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
612.3





184A


embedded image


N-ethyl-3-methoxy-4- ((3-(4-(((1S,4S)-4- morpholinocyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)benzamide
612.3





185A


embedded image


2-(5-methanesulfonyl- 2-{[3-(4-{[(1R,4R)- 4-(morpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl) prop-2-yn-1- yl]amino}phenoxy) acetonitrile
644.2





186A


embedded image


2-(5-methane- sulfonyl-2-{[3-(4- {[(1S,4S)-4-(morpholin- 4-yl)cyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}phenoxy) acetonitrile
644.2





187A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-(morpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
634.3





188A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop- 1-yn-1-yl}-N- [(1R,4R)-4-(3- methanesulfonyl- azetidin-1- yl)cyclohexyl]-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
667.2





189A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn- 1-yl)-N-((1S,4S)-4-(3- (methylsulfonyl)azetidin- 1-yl)cyclohexyl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
667.2





190A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4- (3-methanesulfonyl- azetidin-1-yl)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
668.2





191A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(3-(methyl- sulfonyl)azetidin-1- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl)prop- 2-yn-1-yl)amino) benzenesulfonamide
668.2





192A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-(3-methanesulfonyl- azetidin-1-yl)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
646.2





193A


embedded image


3-methoxy-N-methyl- 4-((3-(4-(((1S,4S)- 4-(3-(methyl- sulfonyl)azetidin-1- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl)amino)benzamide
646.2





194A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1R,4R)-4-{2- azaspiro[3.3]heptan-2- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
629.2





195A


embedded image


N-((1S,4S)-4-(2- azaspiro[3.3]heptan-2- yl)cyclohexyl)-2-(3-((2- methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
629.2





196A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-{2-azaspiro[3.3]heptan- 2-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
608.3





197A


embedded image


4-((3-(4-(((1S,4S)-4-(2- azaspiro[3.3]heptan-2- yl)cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl)amino)-3-methoxy- N-methylbenzamide
608.3





198A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{2- azaspiro[3.3]heptan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
630.3





199A


embedded image


4-((3-(4-(((1S,4S)-4- (2-azaspiro[3.3]heptan- 2-yl)cyclohexyl)amino)- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl)amino)-3-methoxy- benzenesulfonamide
630.3





200A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-N-(2-azaspiro[3.3] heptan-6-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
547.2





201A


embedded image


4-((3-(4-((2- azaspiro[3.3]heptan- 6-yl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy- benzenesulfonamide
548.2





202A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclohexyl]- 1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
631.2





203A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1S,4S)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
631.2





204A


embedded image


3-methoxy-4-{[3-(4- {[(1S,4S)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- 1-sulfonamide
632.2





205A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
632.2





206A


embedded image


N-(3-methoxy-4-{[3- (4-{[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl]amino}benzene- sulfonyl)propanamide
688.4





207A


embedded image


N-(3-methoxy-4-{[3- (4-{[(1S,4S)-4-{2- oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2- yn-1-yl]amino}benzene- sulfonyl)propanamide
688.4





208A


embedded image


N-(3-methoxy-4-{[3-(4- {[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzene- sulfonyl)acetamide
674.3





209A


embedded image


N-(3-methoxy-4-{[3- (4-{[(1S,4S)-4-{2-oxa- 6-azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- sulfonyl)acetamide
674.3





210A


embedded image


N-((1R,4R)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((2- (2-fluoroethoxy)-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1-yl)- 1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
663.2





211A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((2- (2-fluoroethoxy)-4- (methylsulfonyl)phenyl) amino)prop-1-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine






212A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{2-oxa- 6-azaspiro[3.3]heptan- 6-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
596.1





213A


embedded image


3-methoxy-4-{[3-(4- {[(1S,4S)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
596.1





214A


embedded image


5-methanesulfonyl-2- {[3-(4-{[(1R,4R)-4-{2- oxa-6-azaspiro[3.3] heptan-6-yl}cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino}phenol
617.2





215A


embedded image


5-methanesulfonyl-2- {[3-(4-{[(1S,4S)-4- {2-oxa-6-azaspiro [3.3]heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn- 1-yl]amino}phenol
617.3





216A


embedded image


N-(3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl)-N-(2-hydroxy-4- (methylsulfonyl)phenyl) propionamide
673.1





217A


embedded image


N-(3-(4-(((1R,4R)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)-N-(2-hydroxy-4- (methylsulfonyl)phenyl) propionamide






218A


embedded image


N-(2-hydroxy-4- methanesulfonylphenyl)- 2-methyl-N-[3-(4- {[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]propanamide
687.2





219A


embedded image


N-(3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl)-N-(2-hydroxy-4- (methylsulfonyl)phenyl) isobutyramide
687.2





220A


embedded image


2-(3-{[4-methane- sulfonyl-2-(2- methoxyethoxy)phenyl] amino}prop-1-yn-1- yl)-N-[(1R,4R)-4-{2-oxa- 6-azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
675.4





221A


embedded image


2-(3-{[4-methane- sulfonyl-2-(2- methoxyethoxy)phenyl] amino}prop-1-yn-1- yl)-N-[(1S,4S)-4-{2-oxa- 6-azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
675.4





222A


embedded image


2-(5-methanesulfonyl-2- {[3-(4-{[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}phenoxy) acetonitrile
656.4





223A


embedded image


2-(5-methanesulfonyl-2- {[3-(4-{[(1S,4S)- 4-{2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}phenoxy) acetonitrile
656.4





224A


embedded image


5-methanesulfonyl-2- {[3-(4-{[(1S,4S)-4-{2- oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}phenyl 2- methylpropanoate
687.4





225A


embedded image


2-(5-methanesulfonyl-2- {[3-(4-{[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}phenoxy)ethan- 1-ol
661.3





226A


embedded image


2-(5-methanesulfonyl-2- {[3-(4-{[(1S,4S)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}phenoxy)ethan- 1-ol
661.1





227A


embedded image


N-(3-(4-(((1S,4S)-4-(2- oxa-6-azaspiro[3.3]heptan- 6-yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)-N-(2-hydroxy- 4-(methylsulfonyl)phenyl) acetamide






228A


embedded image


5-methanesulfonyl-2-{[3- (4-{[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl]amino}phenyl 2- methylpropanoate
687.3





229A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
610.3





230A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1S,4S)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn- 1-yl]amino}benzamide
610.3





231A


embedded image


2-(3-{[4-methane- sulfonyl-2-(2,2,2-trifluoro- ethoxy)phenyl]amino}prop- 1-yn-1-yl)-N-[(1R,4R)-4- {2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
699.3





232A


embedded image


2-(3-{[4-methane- sulfonyl-2-(2,2,2-trifluoro- ethoxy)phenyl]amino}prop- 1-yn-1-yl)-N-[(1S,4S)-4- {2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
699.0





233A


embedded image


2-[3-(2-amino-4- methanesulfonyl- phenoxy)prop-1-yn-1- yl]-N-[(1S,4S)-4-{2-oxa- 6-azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
617.1





234A


embedded image


2-{3-[(2-ethoxy-4- methanesulfonyl- phenyl)amino]prop- 1-yn-1-yl}-N-[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
645.2





235A


embedded image


2-{3-[(2-ethoxy-4- methanesulfonyl- phenyl)amino]prop- 1-yn-1-yl}-N-[(1S,4S)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
645.2





236A


embedded image


3-(2-methoxyethoxy)- N-methyl-4-{[3-(4- {[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
654.3





237A


embedded image


3-(2-methoxyethoxy)- N-methyl-4-{[3-(4- {[(1S,4S)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
654.3





238A


embedded image


N-ethyl-3-methoxy-4- {[3-(4-{[(1R,4R)-4-{2- oxa-6-azaspiro[3.3] heptan-6-yl}cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
624.3





239A


embedded image


N-ethyl-3-methoxy-4- {[3-(4-{[(1S,4S)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
624.3





240A


embedded image


3-(2-fluoroethoxy)-N- methyl-4-{[3-(4- {[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
642.3





241A


embedded image


3-(2-fluoroethoxy)-N- methyl-4-{[3-(4- {[(1S,4S)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
642.3





242A


embedded image


3-(cyanomethoxy)-N- methyl-4-{[3-(4- {[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
635.2





243A


embedded image


3-(cyanomethoxy)-N- methyl-4-{[3-(4- {[(1S,4S)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
635.3





244A


embedded image


2-{3-[4-methanesulfonyl- 2-(methylamino)phenoxy] prop-1-yn-1-yl}-N- [(1S,4S)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
631.3





245A


embedded image


2-{3-[4-methanesulfonyl- 2-(methylamino)phenoxy] prop-1-yn-1-yl}-N- [(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
631.2





246A


embedded image


2-[3-(2-amino-4- methanesulfonyl- phenoxy)prop-1-yn-1- yl]-N-[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
617.2





247A


embedded image


N-((1R,4R)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-(2- amino-4-(methyl- sulfonyl)phenoxy)prop-1- yn-1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
617.2





248A


embedded image


3-hydroxy-N-methyl-4- {[3-(4-{[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn- 1-yl]amino}benzamide
596.2





249A


embedded image


3-methoxy-4-[(3-{4-[(4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl}prop-2-yn- 1-yl)amino]benzonitrile
578.2





250A


embedded image


3-methoxy-4-{[3-(4- {[(1S,4S)-4-(2-oxa- 6-azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzonitrile
578.3





251A


embedded image


2-(3-methoxy-4-{[3-(4- {[(1R,4R)-4-{2-oxa- 6-azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl]amino}phenyl)-2- methylpropanenitrile
620.3





252A


embedded image


2-(4-((3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3- methoxyphenyl)-2- methylpropanenitrile
620.3





253A


embedded image


3-(fluoromethoxy)-N- methyl-4-{[3-(4- {[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
628.3





254A


embedded image


4-((3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3- (fluoromethoxy)-N- methylbenzamide
628.3





255A


embedded image


3-(2-cyanoethoxy)-N- methyl-4-{[3-(4- {[(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
649.3





256A


embedded image


4-((3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop- 2-yn-1-yl)amino)-3-(2- cyanoethoxy)-N-methyl- benzamide
649.3





257A


embedded image


2-(3-{[2-(fluoro- methoxy)-4-methane- sulfonylphenyl]amino}prop- 1-yn-1-yl)-N-[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
649.3





258A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((2- (fluoromethoxy)-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
649.3





259A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
657.4





260A


embedded image


4-((3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn- 1-yl)amino)-3- (cyanomethoxy)benzene- sulfonamide
657.4





261A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
650.2





262A


embedded image


3-(fluoromethoxy)-4-{[3- (4-{[(1S,4S)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
650.2





263A


embedded image


4-((3-(4-(((1R,4R)-4-(2- oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy-N- methylbenzene- sulfonamide
646.2





264A


embedded image


4-((3-(4-(((1S,4S)-4-(2- oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy-N- methylbenzene- sulfonamide
646.3





265A


embedded image


N-((1R,4R)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((4- chloro-2-methoxy- phenyl)amino)prop-1-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
587.2





266A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((4- chloro-2-methoxy- phenyl)amino)prop-1-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
587.2





267A


embedded image


4-((3-(4-(((1R,4R)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy- N,N-dimethylbenzene- sulfonamide
660.2





268A


embedded image


4-((3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy- N,N-dimethylbenzene- sulfonamide
660.2





269A


embedded image


N-((1R,4R)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((4- (ethylsulfonyl)-2-methoxy- phenyl)amino)propl-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
645.2





270A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((4- (ethylsulfonyl)-2-methoxy- phenyl)amino)prop-1-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
645.2





271A


embedded image


N-((1R,4R)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3- (((3S,4R)-3-methoxy- tetrahydro-2H-pyran-4- yl)amino)prop-1-yn-1-yl)- 1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
561.3





272A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3- (((3S,4R)-3-methoxy- tetrahydro-2H-pyran-4- yl)amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
561.3





273A


embedded image


2-fluoro-5-methoxy-4- {[3-(4-{[(1R,4R)-4-{2- oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzamide
614.2





274A


embedded image


4-((3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-2-fluoro-5- methoxybenzamide
614.2





275A


embedded image


2-fluoro-5-methoxy- N-methyl-4-{[3-(4- {[( R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
628.2





276A


embedded image


4-((3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-2-fluoro-5- methoxy-N-methyl- benzamide
628.2





277A


embedded image


2-(3-{[2-methoxy-4- (trifluoromethyl)phenyl] amino}prop-1-yn-1-yl)-N- [(1R,4R)-4-{2-oxa- 6-azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
621.2





278A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((2- methoxy-4-(trifluoro- methyl)phenyl)amino) prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
621.2





279A


embedded image


4-((3-(4-(((1R,4R)-4-(2- oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxybenzoic acid
597.2





280A


embedded image


4-((3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy- benzoic acid
597.2





281A


embedded image


2-fluoro-5-methoxy-4- {[3-(4-{[(1R,4R)-4-{2- oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzoic acid
615.2





282A


embedded image


4-((3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl)amino)-2-fluoro-5- methoxybenzoic acid
615.2





283A


embedded image


2-{3-[(4-methane- sulfonyl-2-methyl- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)- 4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
615.3





284A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((2- methyl-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
615.3





285A


embedded image


2-(3-{[4-methane- sulfonyl-2-(trifluoro- methoxy)phenyl]amino} prop-1-yn-1-yl)-N- [(1R,4R)-4-{2-oxa-6- azaspiro[3.3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
685.2





286A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((4- (methylsulfonyl)-2- (trifluoromethoxy)phenyl) amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
685.2





287A


embedded image


2-(3-{[4-methane- sulfonyl-2-(trifluoro- methyl)phenyl]amino} prop-1-yn-1-yl)-N- [(1R,4R)-4-{2-oxa- 6-azaspiro[3,3]heptan-6- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
669.2





288A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((4- (methylsulfonyl)-2- (trifluoromethyl)phenyl) amino)prop-1-yn-1-yl)- 1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
669.2





289A


embedded image


2-{3-[(2-chloro-4- methanesulfonyl- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)-4- {2-oxa-6-azaspiro[3.3] heptan-6-yl}cyclo- hexyl]-1-(2,2,2-trifluo- roethyl)-1H-indol- 4-amine
635.3





290A


embedded image


N-((1S,4S)-4-(2-oxa-6- azaspiro[3.3]heptan-6- yl)cyclohexyl)-2-(3-((2- chloro-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
635.2





291A


embedded image


3-(3-(4-(((1R,4R)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2- yn-1-yl)-6-(methyl- sulfonyl)benzo[d]oxazol- 2(3H)-one
643.2





292A


embedded image


3-(3-(4-(((1S,4S)-4- (2-oxa-6-azaspiro[3.3] heptan-6-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl)-6-(methyl- sulfonyl)benzo[d]oxazol- 2(3H)-one
643.2





293A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1S,4S)-4- {7-oxa-2-azaspiro[3.5] nonan-2-yl}cyclo- hexyl]-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
659.4





294A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)-4- {7-oxa-2-azaspiro[3.5] nonan-2-yl}cyclo- hexyl]-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
659.3





295A


embedded image


3-methoxy-N-methyl-4- {[3-(4-{[(1R,4R)-4- {7-oxa-2-azaspiro[3.5] nonan-2-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzamide
638.4





296A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1S,4S)- 4-{7-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
638.4





297A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{7-oxa- 2-azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
660.3





298A


embedded image


3-methoxy-4-{[3-(4- {[(1S,4S)-4-{7-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
660.3





299A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1R,4R)-4- {7-oxa-2-azaspiro[3.5] nonan-2-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
685.2





300A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1S,4S)-4- {7-oxa-2-azaspiro[3.5] nonan-2-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
685.2





301A


embedded image


2-(3-methoxy-4-{[3- (4-{[(1R,4R)-4-{7-oxa- 2-azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}phenyl)- 2-methylpropanenitrile
648.4





302A


embedded image


2-(4-((3-(4-(((1S,4S)- 4-(7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxyphenyl)-2- methylpropanenitrile
648.4





303A


embedded image


2-(5-methane- sulfonyl-2-{[3-(4- {[(1R,4R)-4-{7-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} phenoxy)acetonitrile
684.3





304A


embedded image


2-(5-methanesulfonyl- 2-{[3-(4-{[(1S,4S)- 4-{7-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} phenoxy)acetonitrile
684.3





305A


embedded image


N-((4-((3-(4-(((1R,4R)- 4-(7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxyphenyl) sulfonyl)acetamide
702.3





306A


embedded image


N-((4-((3-(4-(((1S,4S)- 4-(7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxyphenyl) sulfonyl)acetamide
702.3





307A


embedded image


N-((4-((3-(4-(((1R,4R)- 4-(7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxyphenyl)sulfonyl)- 2-aminoacetamide
717.3





308A


embedded image


N-((4-((3-(4-(((1S,4S)- 4-(7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxyphenyl)sulfonyl)- 2-aminoacetamide
717.3





309A


embedded image


methyl 2-(5-methane- sulfonyl-2-{[3-(4- {[(1R,4R)-4-{7-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}phenoxy) acetate
717.2





310A


embedded image


methyl 2-(2-((3-(4- (((1S,4S)-4-(7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-5- (methylsulfonyl) phenoxy)acetate






311A


embedded image


2-(5-methanesulfonyl- 2-{[3-(4-{[(1R,4R)- 4-{7-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} phenoxy)acetic acid
703.2





312A


embedded image


2-(2-((3-(4-(((1S,4S)- 4-(7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl) prop-2-yn-1-yl)amino)- 5-(methylsulfonyl) phenoxy)acetic acid






313A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
659.2





314A


embedded image


2-(3-{[4-(ethane- sulfonyl)-2-methoxy- phenyl]amino}prop-1- yn-1-yl)-N-[(1R,4R)- 4-{7-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
673.4





315A


embedded image


2-(3-{[4-(ethane- sulfonyl)-2-methoxy- phenyl]amino}prop-1-yn- 1-yl)-N-[(1S,4S)-4-{7- oxa-2-azaspiro[3.5] nonan-2-yl}cyclo- hexyl]-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
673.3





316A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1R,4R)-4- {7-oxa-2-azaspiro[3.5] nonan-2-yl}cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl]amino}benzene-1- sulfonamide
678.3





317A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1S,4S)-4- {7-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl) prop-2-yn-1-yl]amino} benzene-1-sulfonamide
678.2





318A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-{6-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
638.3





319A


embedded image


4-((3-(4-(((1S,4S)-4- (6-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl)amino)-3-methoxy- N-methylbenzamide
638.3





320A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{6-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl) prop-2-yn-1-yl]amino} benzene-1-sulfonamide
660.3





321A


embedded image


4-((3-(4-(((1S,4S)-4- (6-oxa-2- azaspiro[3.5]nonan- 2-yl)cyclohexyl) amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxybenzene- sulfonamide
660.3





322A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)- 4-{6-oxa-2- azaspiro[3.5]nonan-2- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
659.2





323A


embedded image


N-((1S,4S)-4-(6-oxa- 2-azaspiro[3.5]nonan- 2-yl)cyclohexyl)-2-(3- ((2-methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
659.2





324A


embedded image


N-((1R,4R)-4-(7-oxa- 2-azaspiro[3.5]nonan- 2-yl)cyclohexyl)-2-(3- ((2-(fluoromethoxy)-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
677.3





325A


embedded image


N-((1S,4S)-4-(7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)-2-(3-((2- (fluoromethoxy)-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
677.3





326A


embedded image


4-(3-(4-(((1R,4R)-4- (7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl)-7-(methylsulfonyl)- 2H-benzo[b][1,4]oxazin- 3(4H)-one
685.3





327A


embedded image


4-((3-(4-(((1R,4R)-4- (7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxy-N-methyl- benzenesulfonamide
674.3





328A


embedded image


4-((3-(4-(((1S,4S)-4- (7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl)amino)-3-methoxy- N-methylbenzene- sulfonamide
674.3





329A


embedded image


N-((1R,4R)-4-(7-oxa- 2-azaspiro[3.5]nonan- 2-yl)cyclohexyl)-2-(3- ((2-ethoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
673.3





330A


embedded image


N-((1S,4S)-4-(7-oxa- 2-azaspiro[3.5]nonan- 2-yl)cyclohexyl)-2-(3- ((2-ethoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
673.3





331A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{7- oxa-2-azaspiro[3.5] nonan-2-yl}cyclohexyl] amino}-1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
624.3





332A


embedded image


4-((3-(4-(((1S,4S)- 4-(7-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxybenzamide
624.3





333A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{6-oxa- 2-azaspiro[3.5]nonan-2- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
624.3





334A


embedded image


4-((3-(4-(((1S,4S)- 4-(6-oxa-2- azaspiro[3.5]nonan-2- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxybenzamide
624.3





335A


embedded image


2-fluoro-5-methoxy- N-methyl-4-{[3- (4-{[(1R,4R)-4-{7-oxa- 2-azaspiro[3.5]nonan- 2-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
656.3





336A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-N-((1R,4R)-4-(3- methoxypyrrolidin-1- yl)cyclohexyl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
633.2





337A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-N-((1S,4S)-4-(3- methoxypyrrolidin-1- yl)cyclohexyl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
633.2





338A


embedded image


3-methoxy-4-((3-(4- (((1R,4R)-4-(3- methoxypyrrolidin-1- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino) benzenesulfonamide
634.3





339A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(3-methoxy- pyrrolidin-1-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H- indol-2-yl)prop- 2-yn-1-yl)amino) benzenesulfonamide
634.3





340A


embedded image


2-(3-{[2-(fluoro- methoxy)-4-methane- sulfonylphenyl]amino} prop-1-yn-1-yl)-N- [(1R,4R)-4-(morpholin- 4-yl)cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol-4- amine
637.2





341A


embedded image


2-(3-{[2-(fluoro- methoxy)-4-methane- sulfonylphenyl]amino} prop-1-yn-1-yl)-N- [(1S,4S)-4-(morpholin- 4-yl)cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol-4- amine
637.2





342A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1R,4R)-4- (morpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- 1-sulfonamide
645.2





343A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1S,4S)- 4-(morpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- 1-sulfonamide
645.2





344A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1R,4R)- 4-(morpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- 1-sulfonamide
638.2





345A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1S,4S)- 4-(morpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- 1-sulfonamide
638.2





346A


embedded image


2-(3-((2-ethoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-N-((1R,4R)-4- morpholinocyclohexyl)- 1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
633.2





347A


embedded image


2-(3-((2-ethoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-N-((1S,4S)-4- morpholinocyclohexyl)- 1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
633.2





348A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1R,4R)-4-(3- methoxypiperidin-1- yl)cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
647.2





349A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-N-((1S,4S)-4-(3- methoxypiperidin-1- yl)cyclohexyl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
647.2





350A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1R,4R)-4-(4- methoxypiperidin-1- yl)cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
647.3





351A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-N-((1S,4S)-4-(4- methoxypiperidin-1- yl)cyclohexyl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
647.2





352A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-(4-methoxypiperidin- 1-yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
626.3





353A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(4- methoxypiperidin-1- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-N- methylbenzamide
626.3





354A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-(4- methoxypiperidin-1- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- 1-sulfonamide
648.3





355A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(4- methoxypiperidin-1- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino) benzenesulfonamide
648.3





356A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-(3-methoxypiperidin- 1-yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} benzamide
626.3





357A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(3- methoxypiperidin-1- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-N- methylbenzamide
626.3





358A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-(3- methoxypiperidin-1- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl]amino}benzene- 1-sulfonamide
648.3





359A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(3- methoxypiperidin-1- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino) benzenesulfonamide
648.3





360A


embedded image


3-methoxy-4-((3-(4- (((1R,4R)-4-morpholino- cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)-1H- indol-2-yl)prop-2-yn-1- yl)amino)benzene- sulfonamide
620.3





361A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-morpholino- cyclohexyl)amino)-1- (2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino) benzenesulfonamide
620.3





362A


embedded image


4-[(1R,4R)-4-[(2-{3- [(4-methanesulfonyl- 2-methoxyphenyl)amino] prop-1-yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino]cyclohexyl]-1λ6- thiomorpholine-1,1-dione
667.2





363A


embedded image


4-((1S,4S)-4-((2-(3- ((2-methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-yl)amino)cyclohexyl) thiomorpholine 1,1-dioxide
667.2





364A


embedded image


4-[(1R,4R)-4-[(2-{3- [(4-methanesulfonyl- 2-methoxyphenyl)amino] prop-1-yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino]cyclohexyl]-1λ4- thiomorpholin-1-one
651.2





365A


embedded image


4-[(1S,4S)-4-[(2-{3- [(4-methanesulfonyl-2- methoxyphenyl)amino] prop-1-yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino]cyclohexyl]-1λ4- thiomorpholin-1-one
651.2





366A


embedded image


4-((3-(4-(((1R,4R)- 4-(1,1-dioxidothio- morpholino)cyclohexyl) amino)-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)- 3-methoxy-N-methyl- benzamide






367A


embedded image


4-((3-(4-(((1S,4S)- 4-(1,1-dioxidothio- morpholino)cyclohexyl) amino)-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)- 3-methoxy-N-methyl- benzamide
646.2





368A


embedded image


4-((1S,4S)-4-((2-(3- ((2-methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-yl)amino)cyclohexyl) thiomorpholine 1-oxide
651.2





369A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-(1-oxo-1λ4- thiomorpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
630.3





370A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-(1-oxo- 1λ4-thiomorpholin-4- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoro- ethyl)-1H-indol-2-yl) prop-2-yn-1-yl]amino} benzene-1-sulfonamide
652.2





371A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(1-oxidothio- morpholino)cyclohexyl) amino)-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1- yl)amino)benzene- sulfonamide






372A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-(1,1- dioxo-1λ6-thiomorpholin- 4-yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
668.2





373A


embedded image


4-((3-(4-(((1S,4S)- 4-(1,1-dioxidothio- morpholino)cyclohexyl) amino)-1-(2,2,2-trifluoro- ethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)- 3-methoxybenzene- sulfonamide
668.1





374A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1S,4S)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
659.3





375A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
638.4





376A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1S,4S)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
638.3





377A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{2-oxa- 7-azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
660.2





378A


embedded image


4-((3-(4-(((1S,4S)- 4-(2-oxa-7- azaspiro[3.5]nonan-7- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxybenzene- sulfonamide
660.2





379A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1R,4R)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
685.2





380A


embedded image


3-(cyanomethoxy)-4- {[3-(4-{[(1S,4S)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
685.2





381A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1R,4R)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
678.2





382A


embedded image


3-(fluoromethoxy)-4- {[3-(4-{[(1S,4S)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
678.2





383A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)- 4-{1-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
659.3





384A


embedded image


N-((1S,4S)-4-(1-oxa-7- azaspiro[3.5]nonan-7- yl)cyclohexyl)-2-(3-((2- methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
659.3





385A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-{1-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
638.3





386A


embedded image


4-((3-(4-(((1S,4S)-4- (1-oxa-7-azaspiro[3.5] nonan-7-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy-N- methylbenzamide
638.3





387A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{1-oxa- 7-azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
660.3





388A


embedded image


4-((3-(4-(((1S,4S)-4- (1-oxa-7-azaspiro[3.5] nonan-7-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy- benzenesulfonamide
660.3





389A


embedded image


2-(5-methanesulfonyl- 2-{[3-(4-{[(1R,4R)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} phenoxy)acetonitrile
684.2





390A


embedded image


2-(5-methanesulfonyl- 2-{[3-(4-{[(1S,4S)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} phenoxy)acetonitrile
684.2





391A


embedded image


2-(3-{[2-(fluoro- methoxy)-4-methane- sulfonylphenyl]amino} prop-1-yn-1-yl)-N- [(1R,4R)-4-(2-oxa- 7-azaspiro[3.5]nonan-7- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
677.3





392A


embedded image


2-(3-{[2-(fluoro- methoxy)-4-methane- sulfonylphenyl]amino} prop-1-yn-1-yl)-N- [(1S,4S)-4-{2-oxa- 7-azaspiro[3.5]nonan-7- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
677.3





393A


embedded image


N-((1R,4R)-4-(2-oxa-7- azaspiro[3.5]nonan-7- yl)cyclohexyl)-2-(3-((2- ethoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
673.2





394A


embedded image


N-((1S,4S)-4-(2-oxa-7- azaspiro[3.5]nonan-7- yl)cyclohexyl)-2-(3-((2- ethoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine






395A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-{2-oxa-7- azaspiro[3.5]nonan-7- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
674.2





396A


embedded image


N-((1R,4R)-4-(2-oxa-7- azaspiro[3.5]nonan-7- yl)cyclohexyl)-2-(3-((4- (ethylsulfonyl)-2-methoxy- phenyl)amino)prop-1-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
673.2





397A


embedded image


N-((1S,4S)-4-(2-oxa-7- azaspiro[3.5]nonan-7- yl)cyclohexyl)-2-(3-((4- (ethylsulfonyl)-2-methoxy- phenyl)amino)prop-1-yn- 1-yl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4-amine
673.2





398A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1R,4R)-4{6-oxa- 3-azabicyclo[3.1.1]heptan- 3-yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
631.2





399A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1S,4S)-4-{6-oxa- 3-azabicyclo[3.1.1]heptan- 3-yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
631.2





400A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{6-oxa-3- azabicyclo[3.1.1]heptan- 3-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
632.2





401A


embedded image


3-methoxy-4-{[3-(4- {[(1S,4S)-4-{6-oxa-3- azabicyclo[3.1.1]heptan- 3-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
632.2





402A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-{6-oxa-3- azabicyclo[3.1.1]heptan- 3-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
610.3





403A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1S,4S)- 4-{6-oxa-3- azabicyclo[3.1.1]heptan- 3-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
610.3





404A


embedded image


2-{3-[(2-ethoxy-4- methanesulfonyl- phenyl)amino] prop-1-yn-1-yl}-N- [(1R,4R)-4-{6-oxa- 3-azabicyclo[3.1.1]heptan- 3-yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
645.3





405A


embedded image


2-{3-[(2-ethoxy-4- mcthanesulfonyl- phenyl)amino] prop-1-yn-1-yl}-N- [(1S,4S)-4-{6-oxa- 3-azabicyclo[3.1.1]heptan- 3-yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
645.3





406A


embedded image


N-ethyl-3-methoxy-4- {[3-(4-{[(1R,4R)- 4-{6-oxa-3- azabicyclo[3.1.1]heptan-3- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
624.3





407A


embedded image


2-(5-methanesulfonyl- 2-{[3-(4-{[(1R,4R)- 4-{6-oxa-3- azabicyclo[3.1.1]heptan- 3-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl]amino} phenoxy)acetonitrile
656.2





408A


embedded image


2-(2-((3-(4-(((1S,4S)- 4-(6-oxa-3- azabicyclo[3.1.1]heptan-3- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-5- (methylsulfonyl) phenoxy)acetonitrile
656.2





409A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-{2-oxa-8- azaspiro[4.5]decan-8- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
652.3





410A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)- 4-{2-oxa-8- azaspiro[4.5]decan-8- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
673.3





411A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{2-oxa- 8-azaspiro[4.5]decan-8- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
674.3





412A


embedded image


4-((3-(4-(((1R,4R)- 4-(2-oxa-8- azaspiro[4.5]decan-8- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-benzo[d]imidazol- 2-yl)prop-2-yn- 1-yl)amino)-3-methoxy- benzenesulfonamide
674.3





413A


embedded image


4-((3-(4-(((1S,4S)- 4-(2-oxa-8- azaspiro[4.5]decan-8- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-benzo[d]imidazol- 2-yl)prop-2-yn- 1-yl)amino)-3-methoxy- benzenesulfonamide
674.3





414A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)- 4-{3-oxa-9- azaspiro[5.5]undecan-9- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
687.3





415A


embedded image


N-((1S,4S)-4-(3-oxa-9- azaspiro[5.5]undecan-9- yl)cyclohexyl)-2-(3- ((2-methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1- (2,2,2-trifluoroethyl)- 1H-indol-4-amine
687.3





416A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-{3-oxa-9- azaspiro[5.5]undecan-9- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
666.4





417A


embedded image


4-((3-(4-(((1S,4S)-4- (3-oxa-9-azaspiro[5.5] undecan-9-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy-N- methylbenzamide
666.3





418A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{3-oxa- 9-azaspiro[5.5]undecan- 9-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
688.3





419A


embedded image


4-((3-(4-(((1S,4S)- 4-(3-oxa-9- azaspiro[5.5]undecan-9- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino)-3- methoxybenzene- sulfonamide
688.3





420A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-(pyrrolidin-1- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
582.3





421A


embedded image


3-methoxy-N-methyl- 4-((3-(4-(((1S,4S)- 4-(pyrrolidin-1- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl)amino)benzamide
582.3





422A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-(pyrrolidin- 1-yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
604.3





423A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(pyrrolidin- 1-yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2- yn-1-yl)amino)benzene- sulfonamide
604.2





424A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)- 4-(pyrrolidin-1- yl)cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
603.2





425A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn- 1-yl)-N-((1S,4S)-4- (pyrrolidin-1-yl)cyclo- hexyl)-1-(2,2,2-trifluoro- ethyl)-1H-indol-4- amine
603.2





426A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1R,4R)-4-(3- methoxypyrrolidin-1- yl)cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
633.2





427A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-(3- methoxypyrrolidin-1- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
634.3





428A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-(3-methoxypyrrolidin- 1-yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
612.3





429A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(3-methoxy- pyrrolidin-1-yl)cyclo- hexyl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)-N- methylbenzamide
612.3





430A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-{hexahydro- 1H-furo[3,4-c]pyrrol- 5-yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
646.3





431A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(tetrahydro- 1H-furo[3,4-c]pyrrol- 5(3H)-yl)cyclohexyl) amino)-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)benzene- sulfonamide
646.3





432A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1- yn-1-yl}-N-[(1R,4R)-4- {hexahydro-1H- furo[3,4-c]pyrrol-5- yl}cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
645.2





433A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1-yl)- N-((1R,4R)-4-(tetrahydro- 1H-furo[3,4-c]pyrrol- 5(3H)-yl)cyclohexyl)- 1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
645.2





434A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-{hexahydro-1H- furo[3,4-c]pyrrol-5- yl}cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
624.3





435A


embedded image


3-methoxy-N-methyl- 4-((3-(4-(((1S,4S)- 4-(tetrahydro-1H- furo[3,4-c]pyrrol-5(3H)- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl)amino)benzamide
624.4





436A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1R,4R)-4-[4- (trifluoromethyl)piperidin- 1-yl]cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
685.2





437A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoro- ethyl)-N-((1S,4S)-4-(4- (trifluoromethyl)piperidin- 1-yl)cyclohexyl)-1H-indol- 4-amine
685.2





438A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-[4-(trifluoro- methyl)piperidin-1- yl]cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
664.3





439A


embedded image


3-methoxy-N-methyl- 4-((3-(1-(2,2,2-trifluoro- ethyl)-4-(((1S,4S)-4- (4-(trifluoromethyl) piperidin-1-yl)cyclo- hexyl)amino)-1H-indol- 2-yl)prop-2-yn-1- yl)amino)benzamide
664.2





440A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4-[4- (trifluoromethyl)piperidin- 1-yl]cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
686.2





441A


embedded image


3-methoxy-4-((3-(1-(2,2,2- trifluoroethyl)-4-(((1S,4S)- 4-(4-(trifluoro- methyl)piperidin-1- yl)cyclohexyl)amino)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino) benzenesulfonamide
686.2





442A


embedded image


2-{3-[(4-methane- sulfonyl-2-methoxy- phenyl)amino]prop-1-yn- 1-yl}-N-[(1R,4R)-4-(4- methanesulfonylpiperidin- 1-yl)cyclohexyl]-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
695.2





443A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1-yl)- N-((1S,4S)-4-(4- (methylsulfonyl)piperidin- 1-yl)cyclohexyl)-1-(2,2,2- trifluoroethyl)-1H-indol- 4-amine
695.2





444A


embedded image


3-methoxy-N-methyl- 4-{[3-(4-{[(1R,4R)- 4-(4-methane- sulfonylpiperidin-1- yl)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl]amino}benzamide
674.3





445A


embedded image


3-methoxy-N-methyl- 4-((3-(4-(((1S,4S)-4-(4- (methylsulfonyl)piperidin- 1-yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn- 1-yl)amino)benzainide
674.3





446A


embedded image


3-methoxy-4-{[3-(4- {[(1R,4R)-4- (4-methanesulfonyl- piperidin-1-yl)cyclo- hexyl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol- 2-yl)prop-2-yn- 1-yl]amino}benzene-1- sulfonamide
696.2





447A


embedded image


3-methoxy-4-((3-(4- (((1S,4S)-4-(4-(methyl- sulfonyl)piperidin-1- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop- 2-yn-1-yl)amino) benzenesulfonamide
696.2





448A


embedded image


1-[(1S,3R)-3-[(2- {3-[(4-methanesulfonyl- 2-methoxyphenyl) amino]prop-1-yn-1-yl}- 1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]cyclo- hexyl]-4,5-dihydro-1H- 1,2,3,4-tetrazol-5-one
618.9





449A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl) amino)prop-1-yn-1-yl)- N-((1R,4R)-4-morpholino- cyclohexyl)-1-(oxiran- 2-ylmethyl)-1H-indol- 4-amine






450A


embedded image


2-((2-(3-((2-methoxy- 4-(methylsulfonyl) phenyl)amino)prop-1- yn-1-yl)-4-(((1R,4R)-4- morpholinocyclohexyl) amino)-1H-indol-1- yl)methyl)acrylonitrile






451A


embedded image


N-((1R,4R)-4-(2-oxa-8- azaspiro[4.5]decan-8- yl)cyclohexyl)-2-(3-((2- methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H- benzo[d]imidazol- 4-amine
673.3





452A


embedded image


N-((1S,4S)-4-(2-oxa-8- azaspiro[4.5]decan-8- yl)cyclohexyl)-2-(3- ((2-methoxy-4-(methyl- sulfonyl)phenyl)amino) prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H- benzo[d]imidazol- 4-amine
673.3





453A


embedded image


4-((3-(4-(((1R,4R)- 4-(2-oxa-8- azaspiro[4.5]decan-8- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-benzo[d]imidazol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy-N- methylbenzamide
652.3





454A


embedded image


4-((3-(4-(((1S,4S)- 4-(2-oxa-8- azaspiro[4.5]decan-8- yl)cyclohexyl)amino)- 1-(2,2,2-trifluoroethyl)- 1H-benzo[d]imidazol- 2-yl)prop-2-yn-1- yl)amino)-3-methoxy-N- methylbenzamide
652.3









D. Compounds with 2-ethynyl-N-(N-heterocyclyl)-1H-indole-4-amine Core
Example D1
Synthesis of 2-(3-((4-methoxypyridin-3-yl)amino)prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 527A)



embedded image


Preparation of tert-butyl (4-methoxypyridin-3-yl)(3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate: To a solution of 2-iodo-N-(1-methyl-4-piperidyl)-1-(2,2,2-trifluoroethyl)indol-4-amine (80 mg, 183 μmol, 1 eq.) in DMSO (3 mL) were added tert-butyl N-(4-methoxy-3-pyridyl)-N-prop-2-ynyl-carbamate (96.0 mg, 366 μmol, 2 eq.), CuI (34.9 mg, 183 μmol, 1 eq.), Pd(PPh3)4 (21.1 mg, 18.3 μmol, 0.10 eq.), and N-isopropylpropan-2-amine (1.10 mmol, 154.3 μL, 6 eq.). The mixture was stirred at 40° C. for 2 h. The reaction mixture was partitioned by adding a saturated EDTA solution (20 mL). The mixture was stirred for 2 h, and EtOAc was added to the mixture (20 mL). The organic phase was separated, washed with water (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC to afford tert-butyl N-(4-methoxy-3-pyridyl)-N-[3-[4-[(1-methyl-4-piperidyl)amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]carbamate (70 mg, 122.5 μmol, 66.9% yield) as a dark yellow solid. MS (ES+, m/z): 572.2.


Preparation of 2-[3-[(4-methoxy-3-pyridyl)amino]prop-1-ynyl]-N-(1-methyl-4-piperidyl)-1-(2,2,2-trifluoroethyl)indol-4-amine: To a solution of tert-butyl N-(4-methoxy-3-pyridyl)-N-[3-[4-[(1-methyl-4-piperidyl)amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]carbamate (40 mg, 70.0 μmol, 1 eq.) in EtOAc (2 mL) was added HCl/EtOAc (4 M, 4 mL, 1 eq.). The mixture was stirred at 25° C. for 2 h. TLC analysis showed that the starting material was consumed, and one new spot corresponding to the desired product was detected. The reaction mixture was concentrated under reduced pressure and purified by prep-HPLC to afford 2-[3-[(4-methoxy-3-pyridyl)amino]prop-1-ynyl]-N-(1-methyl-4-piperidyl)-1-(2,2,2-trifluoroethyl)indol-4-amine (9.8 mg, 20.6 μmol, 29.5% yield) as a white solid. MS (ES+, m/z): 472.2.


Example D2
Synthesis of 2-{3-[(5-fluoro-4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 522A)



embedded image


A mixture of 5-fluoro-2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (90.2 mg, 315.6 μmol, 3 eq.) in DMSO (2 mL) were added i-Pr2NH (1.05 mmol, 150 μL, 10 eq.), CuI (10.0 mg, 52.6 μmol, 0.5 eq.), 2-iodo-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (50 mg, 105.2 μmol, 1 eq.), and Pd(PPh3)4 (2.43 mg, 2.10 μmol, 0.02 eq.). The mixture was stirred at 40° C. for 1.5 h under N2. TLC analysis (PE:EtOAc:TEA=100:100:1, Rf=0.5) indicated that 50% of the starting material remained, and one major new spot with polarity greater than that of the starting material was detected. The reaction mixture was poured into a saturated EDTA solution (50 mL), and the resulting mixture was stirred at 25° C. for 1 h. The mixture was extracted with EtOAc (90 mL×3). The combined organic layers were washed with brine (90 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (PE:EtOAc:DCM:MeOH=10:10:10:1, Rf=0.5) and prep-HPLC to afford 2-{3-[(5-fluoro-4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (19.6 mg, 33.5 μmol, 37.1% yield) as a light yellow solid. MS (ES+, m/z): 567.2.


Example D3
Synthesis of Compounds 537A and 538A



embedded image


Synthesis of N-(1-ethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (150 mg, 1 eq.) in DMF (1 mL) was added K2CO3 (147 mg, 1.06 mmol, 3 eq.). Bromoethane (53 μL, 2 eq.) was then added to the mixture, and the reaction mixture was stirred at 25° C. for 3 h. TLC analysis in MeOH indicated that the starting material was consumed completely, and one new spot had formed. The reaction mixture was diluted with water (40 mL) and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford crude N-(1-ethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (150 mg) as a brown solid.


Representative procedure for Sonogashira coupling reaction: To a mixture of N-(1-ethyl-4-piperidyl)-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (150 mg, 266 μmol, 1 eq) and 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (159.1 mg, 531.8 μmol, 2eq.) in DMSO (3 mL) were added N-isopropylpropan-2-amine (266 μmol, 38 μL, 1 eq.) and Pd(PPh3)4 (6.2 mg, 5.3 μmol, 0.02 eq.) followed by CuI (50.6 mg, 266 μmol, 1 eq.) under N2. The reaction mixture was stirred for 1 h at 45° C. LC-MS analysis showed that the reaction was complete. The mixture was poured into a saturated aqueous EDTA solution (20 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) and prep-HPLC to give the desired product (17.8 mg, 30.9 μmol, 11.6% yield). N-(1-ethylpiperidin-4-yl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 563.2; and 4-[(3-{4-[(1-ethylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 564.2.


Example D3
Synthesis of 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[1-(propan-2-yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 542A)



embedded image


Synthesis of tert-butyl 4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1.92 g, 8.03 mmol, 1.2 eq.) in DMSO (70 mL) were added i-Pr2NH (6.77 g, 66.9 mmol, 9.45 mL, 10 eq.), CuI (382.1 mg, 2.01 mmol, 0.3 eq.), tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (3.5 g, 6.69 mmol, 1 eq.), and Pd(PPh3)4 (772.8 mg, 669 μmol, 0.1 eq.). The resulting mixture was stirred for 1 h at 40° C. under N2. TLC analysis showed that the reaction was complete. The reaction mixture was diluted with EtOAc (500 mL) and an 2M aqueous EDTA solution (500 mL) and stirred further at 20° C. for 1 h. The mixture was extracted with EtOAc (500 mL×3), washed with brine (500 mL), dried over anhydrous sodium sulfate, and concentrated under reduced pressure to give the crude product. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=4:1 to 1:0) to afford tert-butyl 4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (9 g, 14.18 mmol) as a yellow solid.


Synthesis of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: The solution of tert-butyl 4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (3 g, 4.73 mmol, 1 eq.) in EtOAc (20 mL) was added HCl/EtOAc (4 M, 60 mL, 50.78 eq.). The resulting mixture was stirred for 1 h at 25° C. under N2. TLC analysis showed that the reaction was complete. The reaction was quenched with saturated aqueous NaHCO3 (200 mL), and the mixture was extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (200 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:1 to 5% TEA in EtOAc) to afford 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (6.6 g, 12.1 mmol) as a black-brown solid.


1H NMR (400 MHz, DMSO-d6) δ ppm 7.39 (dd, J=8.38, 1.90 Hz, 1H) 7.26 (d, J=1.96 Hz, 1H) 7.13 (s, 1H) 7.01 (t, J=7.49 Hz, 1H) 6.89 (d, J=8.44 Hz, 1H) 6.72 (d, J=8.31 Hz, 1H) 6.50 (t, J=6.24 Hz, 1H) 6.21 (d, J=7.82 Hz, 1H) 5.69 (d, J=7.95 Hz, 1H) 4.94 (q, J=9.05 Hz, 2H) 4.36 (d, J=6.24 Hz, 2H) 3.88-4.08 (m, 3H) 3.49-3.64 (m, 1H) 3.08-3.27 (m, 5H) 2.81-3.06 (m, 2H) 1.96-2.06 (m, 2H) 1.48-1.64 (m, 2H).


Synthesis of N-(1-isopropylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.25 g, 468 μmol, 1 eq.) in DMF (5 mL) were added 2-bromopropane (1723 mg, 1.40 mmol, 3 eq.) and K2CO3 (193.9 mg, 1.40 mmol, 3 eq.). The resulting mixture was stirred for 6 h at 25° C. under N2. TLC analysis showed 15% of the starting material remained, and 60% of the desired product was detected. The reaction was quenched with water (20 mL), and the mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (SiO2, DCM:MeOH=20:1) and then by prep-HPLC (neutral conditions) to afford 2-{34-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[1-(propan-2-yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.0545 g, 91.3 μmol, 19.5% yield) as a light yellow solid. MS (ES+, m/z): 577.3.


1H NMR (400 MHz, DMSO-d6) δ ppm 7.39 (dd, J=8.38, 1.90 Hz, 1H) 7.25 (d, J=1.96 Hz, 1H) 7.08 (s, 1H) 6.99 (t, J=8.01 Hz, 1H) 6.89 (d, J=8.44 Hz, 1H) 6.67 (d, J=8.44 Hz, 1H) 6.49 (t, J=6.17 Hz, 1H) 6.15 (d, J=7.82 Hz, 1H) 5.46 (d, J=8.07 Hz, 1H) 4.92 (q, J=9.13 Hz, 2H) 4.35 (d, J=6.11 Hz, 2H) 3.89 (s, 3H) 3.21-3.31 (m, 1H) 3.09 (s, 3H) 2.62-2.83 (m, 2H) 2.53-2.60 (m, 1H) 2.21 (br t, J=10.58 Hz, 2H) 1.93 (br d, J=11.98 Hz, 2H) 1.36-1.48 (m, 2H) 0.97 (d, J=6.60 Hz, 6H).


Example D4
Synthesis of 1-methoxy-3-(4-{[2-(3-{[2-methoxy-4-(trifluoromethyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)propan-2-ol (Compound 689A)



embedded image


A mixture of 1-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-3-methoxy-propan-2-ol (0.05 g, 97.8 μmol, 1 eq.), 2-methoxy-N-prop-2-ynyl-4-(trifluoromethyl) aniline (44.8 mg, 195.6 μmol, 2 eq.), CuI (9.3 mg, 48.9 μmol, 0.5 eq.), Pd(dppf)Cl2 (7.2 mg, 9.78 μmol, 0.1 eq.), and i-Pr2NH (196 μmol, 27.6 μL, 2 eq.) in DMSO (1 mL) was degassed and purged with N2 three times. The mixture was then stirred at 20° C. for 4 h under a N2 atmosphere. LC-MS and HPLC analysis showed that the starting material was consumed, and the desired product was detected. To the mixture was added an 2M aqueous EDTA solution (15 mL). The resulting mixture was stirred for 1.5 h. The mixture was then extracted with EtOAc (10 mL×8). The organic layer was washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (SiO2, EtOAc:TEA=50:1) and prep-HPLC to afford 1-methoxy-3-[4-[[2-[3-[2-methoxy-4-(trifluoromethyl)anilino]prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]propan-2-ol (15.3 mg, 24.5 μmol, 25.1% yield) as a white solid. MS (ES+, m/z): 613.3.


Example D5
Synthesis of 1-{4-[(2-{3-[(5-fluoro-4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol (Compound 677A)



embedded image


A solution of 5-fluoro-2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (83.0 mg, 290 μmol, 3 eq.) in DMSO (2 mL) were added i-Pr2NH (968 μmol, 137 μL, 10 eq.), CuI (9.2 mg, 48.4 μmol, 0.5 eq.), 1-(4-((2-iodo -1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (50 mg, 96.81 μmol, 1 eq.), and Pd(PPh3)4 (2.2 mg, 1.94 μmol, 0.02 eq.). The reaction mixture was stirred at 40° C. for 1.5 h under N2. LC-MS analysis showed that 24% of the starting material remained. Several new peaks were observed, and 36% of the desired product was detected. The reaction mixture was poured into a saturated EDTA solution (120 mL). The mixture was stirred at 25° C. for 1 h. The mixture was extracted with EtOAc (90 mL×3). The combined organic layers were washed with brine (200 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (PE:EtOAc:TEA=100:100:1, Rf=0.45) and prep-HPLC to afford 1-{4-[(2-{3-[(5-fluoro-4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol (27.5 mg, 63.1 μmol) as a light-yellow solid. MS (ES+, m/z): 641.2.


Example D6
Synthesis of 3-methoxy-N-methyl-4-({3-[4-({1-[(2-oxo-1,3-dioxolan-4-yl)methyl]piperidin-4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-yl}amino)benzamide (Compound 762A)



embedded image


Preparation of 4-((4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)methyl)-1,3-dioxolan-2-one: To the solution of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)propane-1,2-diol (150 mg, 272 μmol, 1 eq) in DMF (3 mL) was added 1,1′-carbonyldiimidazole (CDI) (88.0 mg, 543 μmol, 2 eq.) at 0° C. The mixture was stirred at 0° C. for 2 h. TLC analysis (EtOAc:TEA=20:1, Rf=0.43) indicated that the reaction was complete. The reaction mixture was diluted with water (30 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was obtained as a light-yellow oil (200 mg, crude) and was used without further purification.


Preparation of 3-methoxy-N-methyl-4-({3-[4-({1-[(2-oxo-1,3-dioxolan-4-yl)methyl]piperidin-4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-yl}amino)benzamide: To a mixture of 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (100.1 mg, 458.6 μmol, 2 eq.) and 4-((4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)cyclohexyl)methyl)-1,3-dioxolan-2-one (150 mg, 229 μmol, 1 eq.) in DMSO (3 mL) were added i-Pr2NH (229 μmol, 32.4 μL, 1 eq.), Pd(PPh3)4 (5.3 mg, 4.6 μmol, 0.02 eq.), and CuI (43.7 mg, 229 μmol, 1 eq.) under N2. The resulting mixture was stirred for 1 h at 45° C. TLC analysis (DCM:MeOH=10:1, Rf=0.24) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (40 mL) at 25° C. and then extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford 3-methoxy-N-methyl-4-({3-[4-({1-[(2-oxo-1,3-dioxolan-4-yl)methyl]piperidin-4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-yl}amino)benzamide (40 mg, 64.4 μmol, 28.1% yield) as a light-yellow solid. MS (ES+, m/z): 614.3.


Example D7
Synthesis of Compounds 777A and 778A



embedded image


To a solution of methyl 4-((3-(4-((3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.6 g, 1.13 mmol, 1 eq.) and paraformaldehyde (67.7 mg, 2.25 mmol, 2eq.) in MeOH (5 mL) were added NaBH3CN (212.4 mg, 3.38 mmol, 3eq.) and AcOH (1.13 mmol, 64 μL, 1 eq.). The mixture was stirred at 50° C. for 2 h. TLC analysis (Rf=0.65, EtOAc:TEA=10:1) showed that the reaction was complete. The mixture was poured into a saturated aqueous solution of NaHCO3 (80 mL), and the mixture was extracted with EtOAc (80 mL×3). The combined organic layers were washed with brine (30 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC to afford the desired products.


rac-Methyl 4-{[3-(4-{[(3R,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, MS (ES+, m/z): 547.3; and rac-methyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, MS (ES+, m/z): 547.2.


Example D8
Synthesis of 3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-ol (Compound 895A)



embedded image


To a solution of prop-2-yn-1-ol (14.8 mg, 263.6 μmol, 1.2 eq.) in DMSO (3 mL) were added i-Pr2NH (2.20 mmol, 189 μL, 10 eq), CuI (8.4 mg, 43.9 μmol, 0.2 eq.), N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine ((0.1 g, 220 μmol, 1 eq.)), and Pd(PPh3)4 (12.7 mg, 11.0 μmol, 0.05 eq.). The mixture was heated and stirred at 40° C. for 1 h. TLC analysis indicated that some starting material remained, and one major new spot was detected. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (30 mL), and the mixture was stirred further at 20° C. for 1 h. The mixture was then diluted with water (10 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1), followed by prep-HPLC to afford 3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-ol (0.03 g, 77.9 μmol, 35.5% yield). MS (ES+, m/z): 384.1.


Example D9
Synthesis of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonic acid (Compound 931A)



embedded image


Preparation of ((4-((tert-butoxycarbonyl)(3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate: To a mixture of ((4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)mEtOAc (113.5 mg, 285.6 μmol, 1.3 eq.) in DMSO (3 mL), were added i-Pr2NH (2.20 mmol, 310 μL, 10 eq.), CuI (8.8 mg, 43.9 μmol, 0.2 eq.), N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 220 μmol, 1 eq.), and Pd(PPh3)4 (25.4 mg, 22 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was stirred with saturated EDTA solution (100 mL) and EtOAc (50 mL) at 25° C. The mixture was then extracted with EtOAc (50 mL×2), and the organic layer was washed with brine (100 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford ((4-((tert-butoxycarbonyl)(3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)mEtOAc (0.14 g, 193.2 μmol, 87.9% yield) as a yellow solid.


Preparation of ((4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate: To a solution of ((4-((tert-butoxycarbonyl)(3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate (30 mg, 41.4 μmol, 1 eq.) in EtOAc (0.5 mL) was added HCl/EtOAc (4 M, 0.5 mL, 48.32 eq.). The mixture was stirred at 25° C. for 1 h under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was diluted with saturated NaHCO3 and the pH was adjusted to 8. The resulting mixture was extracted with EtOAc (50 mL×2), and The combined organic layers were washed with water (50 mL×2) and brine (50 mL×2). The organic phase was then dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford ((4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate (40 mg, crude) as a yellow solid. The crude product as used directly in the next step without purification. MS (ES+, m/z): 625.2.


Preparation of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonic acid: To a solution of ((4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxyphenyl)sulfonyl)methyl acetate (30 mg, 48.0 μmol, 1 eq.) in THF (2 mL) and water (0.4 mL) was added LiOH.H2O (6.1 mg, 144 μmol, 3 eq.). The mixture was stirred at 25° C. for 30 min under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was diluted with saturated NaHCO3, and the pH of the mixture was adjusted to 8. The reaction mixture was then extracted with EtOAc (50 mL×2), and The combined organic layers were washed with water (50 mL×2) and brine (50 mL×2). The organic phase was then dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonic acid (8.6 mg, 14.6 μmol, 30.4% yield) as a white solid. MS (ES+, m/z): 569.2.


Example D10
Synthesis of Compounds 922A and 923A



embedded image


Preparation of tert-butyl (3S,4R)-4-{[2-(3-{[4-(ethanesulfonyl)-2-methoxyphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}-3-fluoropiperidine-1-carboxylate: To a solution of 4-(ethylsulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline (103 mg, 406 μmol, 1.1 eq.) in DMSO (2 mL) were added i-Pr2NH (3.69 mmol, 522 μL, 10 eq.), CuI (7.0 mg, 37 μmol, 0.1 eq.), tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.2 g, 369 μmol, 1 eq.), and Pd(PPh3)4 (8.5 mg, 7.39 μmol, 0.02 eq.). The solution was degassed and purged with N2 three times. The mixture was stirred at 25° C. for 1 h. TLC analysis (PE:EtOAc=1:1, Rf=0.35) indicated that the starting material was consumed, and one new spot was detected. The reaction mixture was quenched by adding a 2M EDTA solution (20 mL), and the resulting mixture was stirred for 0.5 h. The mixture was extracted with EtOAc (25 mL×3), and The combined organic layers were washed with brine (15 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) to afford tert-butyl (3S,4R)-4-{[2-(3-{[4-(ethanesulfonyl)-2-methoxyphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}-3-fluoropiperidine-1-carboxylate as a light-yellow solid. 63% yield, MS (ES+, m/z): 667.3.


Preparation of 2-(3-((4-(ethylsulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-N-((3S,4R)-3-fluoropiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of tert-butyl (3S,4R)-4-{[2-(3-{[4-(ethanesulfonyl)-2-methoxyphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}-3-fluoropiperidine-1-carboxylate (0.1 g, 150 μmol, 1 eq.) in 4M HCl/EtOAc (5 mL) was stirred at 25° C. for 1 h. TLC analysis (PE:EtOAc=0:1, Rf=0.12) indicated that the starting material was consumed completely and that one new spot had formed. The reaction mixture was quenched by adding a saturated solution of Na2CO3 to adjust the pH of the mixture to 8. The mixture was then extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford 2-(3-((4-(ethylsulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-N-((3S,4R)-3-fluoropiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine as a yellow solid. MS (ES+, m/z): 567.2.


Example D11
Synthesis of Compounds 786A and 787A



embedded image


embedded image


Preparation of tert-butyl (3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(5-fluoro-2-methoxy-4-(methylcarbamoyl)phenyl)carbamate: To a solution of tert-butyl N-[5-fluoro-2-methoxy-4-(methylcarbamoyl)phenyl]-N-prop-2-ynyl-carbamate (1.38 g, 4.09 mmol, 1.1 eq.) in DMSO (15 mL) were added i-Pr2NH (11.2 mmol, 1.58 mL, 3eq.), CuI (212.4 mg, 1.12 mmol, 0.3 eq.), 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (1.4 g, 3.72 mmol, 1 eq., HCl salt), and Pd(PPh3)4 (214.8 mg, 186 μmol, 0.05 eq.). The mixture was stirred for 0.5 h at 40° C. under N2. TLC analysis showed that the reaction was complete. The reaction was quenched by adding saturated aqueous EDTA (30 mL), and the mixture was extracted with EtOAc (30 mL×3).The combined organic layers were washed with brine (30 mL×2), dried over anhydrous sodium sulfate, filtered and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=4:1 to 1:1) to afford the desired intermediate.


Preparation of tert-butyl (3R,4S)-((4(2-(3-((tert-butoxycarbonyl)(5-fluoro-2-methoxy-4-(methylcarbamoyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: To a mixture of tert-butyl (3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(5-fluoro-2-methoxy-4-(methylcarbamoyl)phenyl)carbamate (1.5 g, 2.73 mmol, 1 eq.) and tert-butyl 3-fluoro-4-oxo-piperidine-1-carboxylate (2.97 g, 13.7 mmol, 5 eq.) in DMF (30 mL) was added TMSCl (27.4 mmol, 3.47 mL, 10 eq.) at 0° C. The mixture was stirred for 1 h under N2, and BH3.THF (1 M, 5.47 mL, 2 eq.) was added at 0° C. The resulting mixture was stirred for 0.5 h at 0° C. TLC analysis showed that the reaction was complete. The reaction was quenched with water (100 mL), and the mixture was extracted with EtOAc (50 mL×3).The combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford the crude product. The crude product was purified by prep-HPLC to afford tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(5-fluoro-2-methoxy-4-(methylcarbamoyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (0.7 g, 934 μmol, 34.1% yield) as a yellow solid.


Preparation of 2-fluoro-4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-methoxy-N-methylbenzamide: A solution of tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(5-fluoro-2-methoxy-4-(methylcarbamoyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (0.6 g, 800 μmol, 1 eq.) was treated with HCl/EtOAc (4 M, 30 mL, 150 eq.) and stirred for 0.5 h at 25° C. TLC analysis showed that the reaction was complete. The reaction was quenched with a saturated NaHCO3 aqueous solution (50 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford 2-fluoro-4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-methoxy-N-methylbenzamide (0.5 g, crude) as a yellow oil.


Preparation of 2-fluoro-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-methoxy-N-methylbenzamide: To a solution of afford 2-fluoro-4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-methoxy-N-methylbenzamide (0.45 g, 819 μmol, 1 eq.) in MeOH (10 mL) were added paraformaldehyde (98.4 mg, 3.28 mmol, 4 eq.), AcOH (2.3 μL, 0.05 eq.), and NaBH3CN (257 mg, 4.09 mmol, 5 eq.). The mixture was heated and stirred for 6 h at 50° C. under N2. TLC analysis showed that the reaction was complete. The reaction was quenched with saturated aqueous NaHCO3 (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-HPLC to afford 2-fluoro-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-methoxy-N-methylbenzamide (0.25 g, 444 μmol, 54.2% yield) as a light-yellow solid.


2-fluoro-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-methoxy-N-methylbenzamide was separated by SFC to afford the desired products as white solids.


2-fluoro-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-methoxy-N-methylbenzamide, MS (ES+, m/z): 564.3; and 2-fluoro-4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-5-methoxy-N-methylbenzamide, MS (ES+, m/z): 564.3.


Example D12
Synthesis of Compounds 928A and 941A



embedded image


Preparation of tert-butyl (3S,4R)-4-[(2-{3-[(2-ethoxy-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-3-fluoropiperidine-1-carboxylate: To a solution of 2-ethoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1.2 eq.) in DMSO (3 mL) were added i-Pr2NH (10 eq.), CuI (0.2 eq.), tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.2 g, 369 μmol, 1 eq.) and Pd(PPh3)4 (0.05 eq.). The mixture was stirred at 40° C. for 1 h under N2. TLC analysis (PE:EtOAc=1:3, Rf=0.4) indicated that the starting material was consumed completely, and that one new spot had formed. The reaction mixture was quenched by adding a saturated EDTA solution (30 mL), and the mixture was stirred at 20° C. for 1 h. The mixture was then diluted with water (10 mL) and extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) and prep-HPLC to afford tert-butyl (3S,4R)-4-[(2-{3-[(2-ethoxy-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-3-fluoropiperidine-1-carboxylate as a yellow solid. MS (ES+, m/z): 611.2 (M−tert-But).


Preparation of 2-{3-[(2-ethoxy-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-N-[(3S,4R)-3-fluoropiperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A mixture of tert-butyl (3S,4R)-4-[(2-{3-[(2-ethoxy-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-3-fluoropiperidine-1-carboxylate (1 eq.) and HCl/EtOAc (4 M, 2 mL) in EtOAc (1 mL) was stirred at 20° C. for 0.5 h. TLC analysis indicated that the starting material was consumed completely and that one new spot had formed. The reaction mixture was quenched by adding an aqueous saturated Na2CO3 solution to adjust the pH of the mixture to >7. The mixture was then diluted with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford 2-{3-[(2-ethoxy-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-N-[(3S,4R)-3-fluoropiperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine as a yellow solid. 51% yield, MS (ES+, m/z): 567.3.


Example D13
Synthesis of Compounds 460A, 609A, 622A, and 730A



embedded image


Preparation of desired products: To a mixture of R1-substituted 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (30 mg, 58.7 μmol, 1 eq.) and 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide or 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (20.4 mg, 64.5 μmol, 1.1 eq.) in DMSO (3 mL) were added CuI (11.2 mg, 59 μmol, 1 eq.), N-isopropylpropan-2-amine (559 μmol, 8.3 μL, 1 eq.) and Pd(PPh3)4 (1.36 mg, 1.17 μmol, 0.02 eq.) under N2. The mixture was stirred for 1 h at 25° C. TLC analysis indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (60 mL) at 25° C. and stirring the mixture for 1 h. The mixture was then extracted with EtOAc (20 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC to afford the desired products as light-yellow solids.


4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N,N-dimethylbenzene -1-sulfonamide, MS (ES+, m/z): 652.4; 4-{[3-(4-{[1-(2-hydroxyacetyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N,N-dimethylbenzene-1-sulfonamide , MS (ES+, m/z): 622.4; 3-methoxy-N,N-dimethyl-4-[(3-{4-[(piperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene -1-sulfonamide, MS (ES+, m/z): 564.3; and 4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzene-1-sulfonamide, MS (ES+, m/z): 638.2.


Example D14
Synthesis of Compounds 570A and 571A



embedded image


Preparation of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol and 1-ethoxy-3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol: To a solution of compound 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (10 g, 22.45 mmol, 1 eq.) in DMF (300 mL) were added 2-(methoxymethyl)oxirane or 2-(ethoxy methyl)oxirane (5 eq.) and K2CO3 (3 eq.). The mixture was stirred at 50° C. for 12 h. TLC or LC-MS analysis showed that the starting material was consumed completely. The reaction mixture was diluted by adding water (500 mL) and extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (40 mL), dried over anhydrous sodium sulfate, filtered, and concentrated. The crude residue was purified by prep-TLC to afford the desired products.


Preparation of 1-(4-((2-(3-((4-(ethylsulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol and 1-ethoxy-3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol: To a mixture of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline or 4-(ethylsulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline (64.6 mg, 178 μμmol, 1.2 eq.) in DMSO (3 mL) were added i-Pr2NH (10 eq.), CuI (1 eq.), 1-(4-42-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol or 1-ethoxy-3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol (1 eq.), and Pd(PPh3)4 (0.2 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (30 mL) at 25° C. and stirring the mixture for 2 h. The reaction mixture was partitioned by adding EtOAc (10 mL). The aqueous phase was extracted with EtOAc (10 mL×3). The organic phase was washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC, confirmed by HPLC and LC-MS, then purified by prep-HPLC to give solutions of the desired products, which were isolated by lyophilization.


1-(4-((2-(3-((4-(ethylsulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 637.2; 1-ethoxy-3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol, MS (ES+, m/z): 637.3.


Example D15
Synthesis of Compounds 880A and 884A



embedded image


embedded image


embedded image


Preparation of 2-iodo-1H-indol-4-amine: To a solution of 2-iodo-4-nitro-1H-indole (4 g, 13.9 mmol, 1 eq.) in EtOH (32 mL) were added a saturated solution of NH4Cl (8 mL) and Fe (2.33 g, 41.7 mmol, 3 eq.). The mixture was stirred at 60° C. for 0.5 h. TLC analysis showed that the reaction was complete. The reaction mixture was filtered, extracted with EtOAc (100 mL×2), and washed with water (250 mL×2) and brine (250 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 8:1) to afford 2-iodo-1H-indol-4-amine (3.2 g, 12.40 mmol, 89.3% yield) as an off-white solid.


Preparation of 2-iodo-1-propyl-1H-indol-4-amine: To a solution of 2-iodo-1H-indol-4-amine (2 g, 7.75 mmol, 1 eq.) in DMF (15 mL) at 0° C. was added NaH (930 mg, 23.3 mmol, 60% in mineral oil, 3 eq.). The reaction mixture was stirred at 0° C. for 0.5 h, and 1-bromopropane (11.6 mmol, 1.06 mL, 1.5 eq.) was added at 25° C. The resulting mixture was stirred at 25° C. for 0.5 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched with saturated aqueous NH4Cl (100 mL) at 0° C. The mixture was extracted with EtOAc (100 mL×2) and washed with water (250 mL×2) and brine (250 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=30:1 to 10:1) to afford 2-iodo-1-propyl-1H-indol-4-amine (2.1 g, 7 mmol, 90.3% yield) as a brown solid.


Preparation of tert-butyl (3-(4-amino-1-propyl-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate and tert-butyl (3-(4-amino-1-propyl-1H-indol-2-yl)prop-2-yn-1-yl)(2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)carbamate: To a solution of tert-butyl (2-methoxy-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate (1.53 g, 4.50 mmol, 1.5 eq.) or tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate (857.36 mg, 2.40 mmol, 1.2 eq.) in DMSO (8-10 mL) were added i-Pr2NH (10 eq.), CuI (0.2 eq.), 2-iodo-1-propyl-1H-indol-4-amine (1 eq.), and Pd(PPh3)4 (0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was partitioned by adding a saturated EDTA solution (150 mL) and EtOAc (50 mL) at 25° C. The resulting mixture was filtered, extracted with EtOAc (250 mL×2), and washed with water (100 mL×2) and brine (100 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=20:1 to 2:1) to afford the desired products as yellow solids. tert-Butyl (3-(4-amino-1-propyl-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate, 78.2% yield; and tert-butyl (3-(4-amino-1-propyl-1H-indol-2-yl)prop-2-yn-1-yl)(2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)carbamate, 63.3% yield.


Preparation of tert-butyl 4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate and tert-butyl 4-((2-(3-((tert-butoxycarbonyl)(2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: To a solution of tert-butyl (3-(4-amino-1-propyl-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate or tert-butyl (3-(4-amino-1-propyl-1H-indol-2-yl)prop-2-yn-1-yl)(2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)carbamate (1.56 mmol, 1 eq.) in DMF (10 mL) were added tert-butyl 3-fluoro-4-oxopiperidine-1-carboxylate (5 eq.) and TMSCl (10 eq.). The mixture was stirred at 0° C. for 1 h, and BH3.THF (1 M, 10 eq.) was added. The resulting mixture was stirred at 25° C. for 1 h. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding ice water (150 mL) and extracting the mixture with EtOAc (100 mL×2). The combined organic layers were washed with water (250 mL×2) and brine (250 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford the desired products.


Preparation of tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate and tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: tert-Butyl 4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate and tert-butyl 4-((2-(3-((tert-butoxycarbonyl)(2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate were purified by prep-HPLC. The pH of the solutions were adjusted to 8 using a saturated aqueous Na2CO3 solution. Then the aqueous phase was extracted with EtOAc (100 mL×2). The combined organic layers were washed with brine (250 mL×2) dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford the desired products as yellow solids.


tert-Butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate, 33% yield, MS (ES+, m/z): 713.3; and tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate, 21.1% yield, MS (ES+, m/z): 731.4.


Preparation of N-(((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-amine and 2-(3-((2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-((3R,4S)-3-fluoropiperidin-4-yl)-1-propyl-1H-indol-4-amine: To a solution of tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (350.70 μmol 1 eq.) or tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (1 eq.) in EtOAc (3 mL) was added HCl/EtOAc (4 M, 3 mL). The mixture was stirred at 25° C. for 0.5 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched with water (100 mL) and the pH of the mixture was adjusted to 8 using a saturated aqueous Na2CO3 solution. The resulting mixture was extracted with EtOAc (250 mL×2). The combined organic layers were washed with brine (250 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired products as yellow solids.


Preparation of (2R)-1-[(3RS,4SR)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-propyl-1H-indol-4-yl)amino]piperidin-1-yl]-3-methoxypropan-2-ol and (2R)-1-[(3RS,4SR)-3-fluoro-4-[(2-{3-[(2-fluoro-4-methanesulfonyl-6-methoxyphenyl)amino]prop-1-yn-1-yl}-1-propyl-1H-indol-4-yl)amino]piperidin-1-yl]-3-methoxypropan-2-ol: To a solution of N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-amine or 2-(3-((2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-((3R,4S)-3-fluoropiperidin-4-yl)-1-propyl-1H-indol-4-amine (1 eq.) in EtOH (3 mL) was added (2R)-2-(methoxymethyl)oxirane (6 eq.). The mixture was stirred at 90° C. for 2 h. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched with water (50 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desired products as white solids.


N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-propyl-1H-indol-4-amine, MS (ES+, m/z): 601.2; and 2-(3-((2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-((3R,4S)-3-fluoropiperidin-4-yl)-1-propyl-1H-indol-4-amine, MS (ES+, m/z): 619.3.


Example D16
Synthesis of (R)-1-((3R,4S)-4-((1-allyl-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1H-indol-4-yl)amino)-3-fluoropiperidin-1-yl)-3-methoxypropan-2-ol (Compound 881A)



embedded image


Preparation of 1-allyl-2-iodo-1H-indol-4-amine: To a solution of 2-iodo-1H-indol-4-amine (187.5 mg, 1.55 mmol, 0.5 eq.) in DMF (15 mL) was added NaH (372 mg, 9.30 mmol, 60% in mineral oil, 3 eq.) in one portion at 0° C. under N2. The mixture was stirred at 0° C. for 30 min, and 3-bromoprop-1-ene (3.10 mmol, 18 μL, 1 eq.) was added. The mixture was stirred for 0.5 h at 0° C. TLC analysis showed that 30% of the starting material remained, and two new spots with polarity lower than that of the starting material were detected. An additional portion of 3-Bromoprop-1-ene (1.55 mmol, 0.5 eq.) was added to the reaction, and the resulting mixture was stirred for another 0.5 h at 0° C. TLC analysis showed that 10% of the starting material remained. The reaction was diluted with water (20 mL) and extracted with EtOAc (25 mL×2). The combined organic layers were washed with brine (25 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated to give a residue. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=6:1 to 4:1) to afford the desired product (530 mg, 1.78 mmol, 57.4% yield) as a brown solid.


Preparation of tert-butyl (3-(1-allyl-4-amino-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate: To a solution of tert-butyl (2-methoxy-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate (724.1 mg, 2.13 mmol, 1.2 eq.) in DMSO (10 mL) were added i-Pr2NH (10.7 mmol, 1.51 mL, 6 eq.) and CuI (338.6 mg, 1.78 mmol, 1 eq.) under N2. Then, 1-allyl-2-iodo-1H-indol-4-amine (530 mg, 1.78 mmol, 1 eq.) and Pd(PPh3)4 (205.4 mg, 178 μmol, 0.1 eq.) were added, and the mixture was stirred at 25° C. for 60 mins. TLC analysis showed that the reaction was complete. The reaction was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The organic phase was washed with water (30 mL×3) and brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated to give a residue. The crude residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) to afford the desired product (460 mg, 903 μmol, 50.8% yield) as a brown solid.


Preparation of tert-butyl (3R,4S)-4-((1-allyl-2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: To a mixture of tert-butyl (3-(1-allyl-4-amino-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (400 mg, 785 μmol, 1 eq.) and tert-butyl (3R)-3-fluoro-4-oxo-piperidine-1-carboxylate (511.5 mg, 2.35 mmol, 3 eq.) in DMF (10 mL) was added TMSCl (7.85 mmol, 996 μL, 10 eq.) in one portion at 0° C. under N2. The mixture was stirred at 0° C. for 60 min, and BH3.THF (1 M, 7.85 mL, 10 eq.) was added. The mixture was stirred further at 20° C. for 2 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was poured into water (30 mL) water and extracted with EtOAc (30 mL×3). The organic phase was washed with water (30 mL×2) and brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give a residue. The crude residue was purified by prep-HPLC to afford the desired product (150 mg, 211 μmol, 26.9% yield) as a brown solid. MS (ES+, m/z): 711.3.


Preparation of 1-allyl-N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1H-indol-4-amine: To a solution of tert-butyl (3R,4S)-4-((1-allyl-2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (140 mg, 197 μmol, 1 eq.) in HCl/EtOAc (4 M, 5 mL, 102 eq.) was stirred at 25° C. for 0.5 h. TLC analysis showed that the reaction was complete. The reaction mixture was adjusted to pH=8 by adding a saturated NaHCO3 solution (20 mL), and the organic phase was extracted with EtOAc (25 mL×3). The combined organic layers were washed with brine (25 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated to give the desired product (90 mg, 176 μmol, 89.5% yield) as a brown gum. MS (ES+, m/z): 511.2.


Preparation of (R)-1-((3R,4S)-4-((1-allyl-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1H-indol-4-yl)amino)-3-fluoropiperidin-1-yl)-3-methoxypropan-2-ol: A mixture of 1-allyl-N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1H-indol-4-amine (50 mg, 97.9 μmol, 1 eq.) and (2R)-2-(methoxymethyl)oxirane (490 μmol, 44 μL, 5 eq.) in EtOH (2 mL) was heated to 90° C. and stirred for 2 h. TLC analysis showed that the reaction was complete. The reaction was diluted with water (20 mL) and extracted with EtOAc (20 mL×2). The combined organic layers were washed with water (20 mL×2) and brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated to give a residue. The crude residue was purified by prep-HPLC to afford the desired product (12.1 mg, 20.2 μmol, 20.6% yield) as a white solid. MS (ES+, m/z): 599.3.


Example D17
Synthesis of rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(2-hydroxy-3-methoxypropyl)-3-methoxybenzamide (Compound 816A)



embedded image


Preparation of 1-amino-3-methoxypropan-2-ol: 2-(Methoxymethyl)oxirane (5.68 mmol, 505 μL, 1 eq.) was added to a solution of NH3 (7 M, 811 μL, 1 eq.) in MeOH (20 mL). The solution was stirred at 20° C. for 18 h. The mixture was concentrated, and the crude residue was used directly without purification.




embedded image


Preparation of rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(2-hydroxy-3-methoxypropyl)-3-methoxybenzamide: To a mixture of 4-[3-[4-[[(3R,4S)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl) indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoic acid (0.1 g, 178 μmol, 1 eq.), 1-amino-3-methoxy-propan-2-ol (37.5 mg, 357 μmol, 2 eq.), and TEA (1.43 mmol, 28.5 μL, 8 eq.) in DMF (3 mL) was added T3P® (357 μmol, 106.1 μL, 2 eq., 50% (wt %) purity in EtOAc) at 0° C. The mixture was stirred at 20° C. for 16 h. TLC analysis (Rf=0.5, DCM:MeOH=10:1) showed that half the starting material remained, and some of the desired product was detected. The mixture was extracted with water (10 mL) and EtOAc (15 mL×3). The combined organic layers were washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated. The crude residue was purified by prep-HPLC to afford the desired product (0.026 g, 40.1 μmol, 22.5% yield) as a yellow solid. MS (ES+, m/z): 620.4.


Example D18
Synthesis of rac-N-(2-{bis[(pyridin-2-yl)methyl]amino}ethyl)-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide (Compound 830A)



embedded image


Preparation of tert-butyl (2-(bis(pyridin-2-ylmethyl)amino)ethyl)carbamate: A mixture of 2-(chloromethyl)pyridine (5 g, 30.5 mmol, 1 eq., HCl), tert-butyl-N-(2-aminoethyl)carbamate (2.44 g, 15.2 mmol, 2.39 mL, 0.5 eq.), and Na2CO3 (16.15 g, 152.4 mmol, 5 eq.) in EtOH (150 mL) was degassed and purged with N2 three times, and the mixture was stirred at 80° C. for 12 h under N2. TLC analysis (Rf=0.5, EtOAc:TEA=10:1) showed that the reaction was complete. The mixture was concentrated, and the crude residue was extracted with saturated Na2CO3 (100 mL) and EtOAc (80 mL×3). The combined organic layers were washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=2:1 to 0:1) to afford tert-butyl N-[2-[bis(2-pyridylmethyl)amino]ethyl]carbamate (3.5 g, 9.20 mmol, 30.2% yield) as a yellow oil.


Preparation of N′,N′-bis(pyridin-2-ylmethyl)ethane-1,2-diamine: To a solution of tert-butyl N-[2-[bis(2-pyridylmethyl)amino]ethyl]carbamate (0.5 g, 1.31 mmol, 1 eq.) in DCM (50 mL) was added TFA (5 mL) at 20° C. The mixture was stirred at 20° C. for 1 h. The mixture was concentrated to afford the desired product (0.43 g, 1.09 mmol, 82.6% yield, TFA) as a yellow oil. The crude product was used without purification.




embedded image


Preparation of rac-N-(2-{bis[(pyridin-2-yl)methyl]amino}ethyl)-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide: To a solution of 4-[3-[4-[[(3R,4S)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl) indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoic acid (0.1 g, 187.8 μmol, 1 eq.) in DCM (10 mL) were added EDCI (108 mg, 563 μmol, 3 eq.), N′,N′-bis(2-pyridylmethyl)ethane-1,2-diamine (54.6 mg, 225.3 μmol, 1.2 eq.), and DMAP (22.9 mg, 187.8 μmol, 1 eq.) at 20° C. The mixture was stirred at 20° C. for 6 h. LC-MS and HPLC analysis showed that the reaction was complete. The mixture was extracted with water (15 mL) and DCM (15 mL×3). The organic layer was washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated. The crude residue was purified by prep-HPLC to afford the desired product (0.031 g, 37.7 μmol, 20.1% yield) as a yellow solid. MS (ES+, m/z): 757.4.


Example D19
Synthesis of 4-hydroxy-9-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-2-oxa-6λ5-azaspiro[5.5]undecan-6-ylium (Compound 674A)



embedded image


Preparation of 2-((fluoromethoxy)methyl)oxirane: To a solution of oxiran-2-ylmethanol (1 g, 13.50 mmol, 1 eq.) in DMF (10 mL) were added NaOH (539.9 mg, 13.5 mmol, 1 eq.) and bromofluoromethane (1.52 g, 13.5 mmol, 1 eq.) at 25° C. The mixture was stirred at 25° C. for 2 h. TLC analysis (PE:EtOAc=1:1, Rf=0.5) showed that the reaction was complete. The reaction was quenched with a saturated NH4Cl solution (20 mL) and extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated to afford the desired product (500 mg, crude) as a light-yellow oil.




embedded image


Preparation of 1-(fluoromethoxy)-3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol: To a solution of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine hydrochloride (200 mg, 350.2 μmol, 1 eq., HCl) in DMF (4 mL) were added 2-((fluoromethoxy)methyl)oxirane (371.6 mg, 3.50 mmol, 10 eq.) and K2CO3 (242.0 mg, 1.75 mmol, 5 eq.) at 25° C. The mixture was heated to 50° C. and stirred further for 12 h. LC-MS analysis showed that 50% of the starting material was converted to the product. The reaction was quenched with saturated solution of NH4Cl (20 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated to afford 1-(fluoromethoxy)-3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol (300 mg, crude) as a black-brown oil.


Preparation of 4-hydroxy-9-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-2-oxa-6λ5-azaspiro[5.5]undecan-6-ylium: To a solution of 1-(fluoromethoxy)-3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol (250 mg, 390.2 μmol, 1 eq.) in ACN (3 mL) and water (3 mL) was added K2CO3 (53.9 mg, 390.2 μmol, 1 eq.) in one portion at 25° C. The mixture was stirred at 25° C. for 12 h. LC-MS and HPLC analysis showed that the reaction was complete. The reaction was quenched with water (20 mL) and extracted with EtOAc (30 mL×3). The desired product was found in the aqueous phase, which was concentrated and purified by prep-HPLC to afford the desired product (7.0 mg, 10.5 μmol, 2.7% yield) as a white solid. MS (ES+, m/z): 622.2.


Example D20
Synthesis of 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-(2,2,2-trifluoroethoxy)propan-2-ol (Compound 673A)



embedded image


Preparation of 2-((2,2,2-trifluoroethoxy)methyl)oxirane: To a solution of oxiran-2-ylmethanol (1 g, 13.5 mmol, 1 eq.) in DMF (10 mL) were added NaOH (540 mg, 13.5 mmol, 1 eq.) and CF3CH2OTf (3.13 g, 13.5 mmol, 1 eq.) at 25° C. The mixture was stirred at 25° C. for 2 h. TLC analysis (PE:EtOAc=1:1, Rf=0.5) showed that the reaction was complete. The reaction was quenched with a saturated NH4Cl solution (20 mL) and extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated to afford 2-((2,2,2-trifluoroethoxy)methyl)oxirane (700 mg, crude) as a light-yellow oil.




embedded image


Preparation of 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-(2,2,2-trifluoroethoxy)propan-2-ol: To a solution of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine hydrochloride (200 mg, 350.2 μmol, 1 eq., HCl) in DMF (3 mL) were added 2-((2,2,2-trifluoroethoxy)methyl)oxirane (547 mg, 3.50 mmol, 10 eq.) and K2CO3 (242.0 mg, 1.75 mmol, 5 eq.) at 25° C. The mixture was heated to 50° C. and stirred for 12 h. LC-MS analysis showed that the reaction was complete. The reaction was quenched with a saturated NH4Cl solution (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by prep-HPLC to afford the desired product (33.7 mg, 44.7 μmol, 12.8% yield) as a yellow solid. MS (ES+, m/z): 691.2.


Example D21
Synthesis of Compounds 519A and 714A



embedded image


embedded image


Preparation of tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)(3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate and tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)(3-(4-((1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate: To a solution of tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)(prop-2-yn-1-yl)carbamate (1.2 eq.) in DMSO (1 mL) were added i-Pr2NH (30 eq.), CuI (2 eq.), 2-iodo-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (114 μmol), 1 eq.), and Pd(PPh3)4 (0.25 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h under N2. The reaction mixture was poured into saturated EDTA solution (10 mL), and the mixture was stirred at 25° C. for 1 h and extracted with EtOAc. The combined organic layers were washed with brine (20 mL×3) dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC to afford the desired products.


Preparation of 1-{4-[(2-{3-[(2-fluoro-4-methanesulfonyl-6-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol and 2-{3-[(2-fluoro-4-methanesulfonyl-6-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)(3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate or tert-butyl (2-fluoro-6-methoxy-4-(methylsulfonyl)phenyl)(3-(4-((1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate (1 eq) in HCl/EtOAc (4 M, 2 mL) was stirred at 25° C. for 0.5 h. A saturated Na2CO3 solution (100 mL) was added to the solution dropwise to adjust the pH of the mixture to >7. The mixture was extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC or prep-HPLC to afford the desired products. 1-{4-[(2-{3-[(2-fluoro-4-methanesulfonyl-6-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol, MS (ES+, m/z): 641.2; and 2-{3-[(2-fluoro-4-methanesulfonyl-6-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 567.2.


Example D22
Synthesis of 2-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-ol (Compound 693A)



embedded image


Preparation of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (4 g, 11.8 mmol, 1 eq.) and tert-butyl 4-oxopiperidine-1-carboxylate (11.8 g, 58.8 mmol, 5 eq.) in MeOH (100 mL) were added SnCl2.2H2O (530.8 mg, 2.35 mmol, 0.20 eq.) and PMHS (CAS [9004-73-3], 3.53 g, 58.81 mmol, 5 eq.). The mixture was stirred at 70° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely, and that one main peak with desired MS data was detected. The reaction mixture was concentrated under reduced pressure. To the crude residue was added PE (700 mL), and the resulting mixture was stirred at 15° C. for 1 h. The mixture was filtered and concentrated to afford tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (4.40 g, 7.99 mmol, 67.9% yield) as a gray solid. MS (ES+, m/z): 524.1.


Preparation of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (2.40 g, 4.59 mmol, 1 eq.) in CF3COOH (4 mL) and DCM (16 mL) was prepared. The reaction mixture was stirred at 25° C. for 30 min. LC-MS analysis showed that the starting material was consumed completely, and that one main peak with desired MS data was detected. The reaction mixture was concentrated under reduced pressure to afford 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1.70 g, 3.44 mmol, 75.0% yield) as a gray solid. MS (ES+, m/z): 424.1.


Preparation of 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-ol: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (500 mg, 1.18 mmol, 1 eq.) in DMF (10 mL) were added K2CO3 (816.4 mg, 5.91 mmol, 5 eq.) and 2-bromoethanol (1.77 mmol, 125.8 μL, 1.50 eq.). The mixture was stirred at 50° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely, and that one main peak with desired MS data was detected. The reaction mixture was partitioned using water (50 mL) and EtOAc (50 mL). The organic phase was separated. The aqueous phase was washed with EtOAc (10 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:1) to afford the desired product (400 mg, 856.0 μmol, 72.6% yield) as a brown solid. MS (ES+, m/z): 468.2.


Preparation of 2-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-ol: A solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (265.6 mg, 963 μmol, 1.50 eq., HCl) in DMSO (5 mL) was flushed with N2. CuI (122.3 mg, 642 μmol, 1 eq.) and N-isopropylpropan-2-amine (1.93 mmol, 270 μL, 3 eq.) were added to the mixture. 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-ol (300 mg, 642 μmol, 1 eq.) was added, the mixture was flushed with N2, and 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (265.6 mg, 963 μmol, 1.50 eq., HCl) was added again. The reaction mixture was flushed with N2 again and stirred at 45° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with desired MS data was detected. The reaction mixture was partitioned using a saturated EDTA solution (20 mL) and EtOAc (20 mL). The organic phase was separated, and the aqueous phase was washed with EtOAc (5 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desired product (52.2 mg, 90.2 μmol, 14.1% yield) as a white solid. MS (ES+, m/z): 579.2.


Example D23
Synthesis of 4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (Compound 705A)



embedded image


A mixture of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, 3-methoxy-4-(prop-2-ynylamino)benzoic acid (48.16 mg, 234.68 μmol, 1.2 eq.), CuI (37.25 mg, 195.57 μmol, 1 eq.), Pd(PPh3)4 (45.20 mg, 39.11 μmol, 0.2 eq.), and i-Pr2NH (197.90 mg, 1.96 mmol, 276.39 μL, 10 eq.) in DMSO (3 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 1 h. under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.02) indicated that the starting material was consumed completely, and one major new spot was detected. The crude reaction mixture was added to a saturated aqueous EDTA solution and stirred at 20° C. for 1 h. The mixture was extracted with EtOAc (15 mL×3) and The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (SiO2, EtOAc:TEA=15:1) and by prep-HPLC to afford the desired product: 4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (40 mg, 67.28 μmol, 34.40% yield) as a yellow solid. MS (ES+, m/z): 589.3.


Example D24
Synthesis of 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[1-(3-methanesulfonylpropyl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)4H-indol-4-amine (Compound 706A)



embedded image


Preparation of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A mixture of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.2 g, 472.57 μmol, 1 eq.), 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (135.70 mg, 567.09 μmol, 1.2 eq.), CuI (90 mg, 472.57 μmol, 1 eq.), i-Pr2NH (478.20 mg, 4.73 mmol, 667.87 μL, 10 eq.), and Pd(PPh3)4 (109.22 mg, 94.51 μmol, 0.2 eq.) in DMSO (3 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 1 h. under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.1) indicated that the starting material was consumed completely, and one major new spot was detected. A saturated aqueous EDTA solution was added to the crude reaction mixture, and the resulting mixture was stirred at 20° C. for 1 h. The mixture was extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.11 g, 185.19 μmol, 39.19% yield) was obtained as a yellow solid and used in the next step without further purification.




embedded image


A mixture of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 187.06 μmol, 1 eq.), 3-methylsulfonylpropyl methanesulfonate (121.37 mg, 561.18 μmol, 3 eq.), and K2CO3 (129.26 mg, 935.29 μmol, 5 eq.) in DMF (3 mL) was stirred at 80° C. for 2 h. under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.25) indicated that one major new spot was detected. The mixture was filtered and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desired product 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[1-(3-methanesulfonylpropyl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.025 g, 37.80 μmol, 20.21% yield) as a yellow solid. MS (ES+, m/z): 655.2.


Example D25
Synthesis of Compounds 586A, 587A, 588A, and 589A



embedded image


embedded image


Preparation of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)4H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol: To a mixture of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (2 g, 4.54 mmol, 1 eq.) in DMF (20 mL) were added oxiran-2-ylmethanol (1.68 g, 22.72 mmol, 1.50 mL, 5 eq.) and K2CO3 (1.88 g, 13.63 mmol, 3 eq.). The mixture was stirred at 50° C. for 5 h. TLC and LC-MS analysis showed that the starting material was consumed completely. The reaction was partitioned by adding water (100 mL) and EtOAc (100 mL). The aqueous phase was extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine (100 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated to afford the crude product (1.2 g, 2.22 mmol, 48.85% yield) as a black-brown oil. MS (ES+, m/z): 497.8.


Preparation of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)4H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl dipropionate and 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl bis(2-methylpropanoate): To a mixture of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol (200 mg, 361.96 μmol, 1 eq.) in DCM (3 mL) was added propionic anhydride (117.76 mg, 904.90 μmol, 116.60 μL, 2.5 eq.) or isobutyric anhydride (143.15 mg, 904.90 μmol, 150.05 μL, 2.5 eq.). The mixture was stirred at 50° C. for 5 h. TLC and LC-MS analysis showed that the starting material was consumed completely. The reaction was partitioned by adding water (100 mL) and EtOAc (20 mL). The aqueous phase was extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (100 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude product was purified by prep-TLC (PE:EtOAc=1:1, Rf=0.63) to afford the desired products (120 mg, crude) as light-brown oils. 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl dipropionate, MS (ES+, m/z): 609.9; 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl bis(2-methylpropanoate), MS (ES+, m/z): 638.3.


Preparation of 3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl dipropionate: To a solution of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl dipropionate (60 mg, 98.45 μmol, 1 eq.) in DMSO (2 mL) were added 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (31.41 mg, 118.15 μmol, 1.2 eq.), i-PrNH2 (58.20 mg, 984.54 μmol, 84.59 μL, 10 eq.), CuI (18.75 mg, 98.45 μmol, 1 eq.), and Pd(PPh3)4 (22.75 mg, 19.69 μmol, 0.2 eq.). The mixture was stirred at 25° C. for 2 h under N2. LC-MS and TLC analysis (PE:EtOAc=1:1, Rf=0.5) showed that the starting material was consumed completely. The reaction mixture was quenched by addition of a saturated aqueous EDTA solution (20 mL) at 25° C. and stirring for 2 h. The reaction mixture was partitioned between EtOAc and water. The aqueous phase was extracted with EtOAc (5 mL×3) and the organic phase was washed with brine 30 mL (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give the crude product. The residue was purified by prep-TLC and lyophilized to give the product [3-[4-[[2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-2-propanoyloxy-propyl] propanoate (21.5 mg, 27.92 μmol, 28.36% yield) as a yellow solid. The remaining compounds were synthesized using an analogous method.


1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-(propanoyloxy)propan-2-yl propanoate, (21.5 mg, 28.4% yield) MS (ES+, m/z): 721.3; 1-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-(propanoyloxy)propan-2-yl propanoate, (58.1 mg, 53.8% yield) MS (ES+, m/z): 722.2; 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-[(2-methylpropanoyl)oxy]propan-2-yl 2-methylpropanoate, (21.4 mg, 21.7% yield) MS (ES+, m/z): 749.3; and 1-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-[(2-methylpropanoyl)oxy]propan-2-yl 2-methylpropanoate, (23.8 mg, 26.6% yield) MS (ES+, m/z): 750.3.


Example D26
Synthesis of Compounds 590A and 591A



embedded image


embedded image


Preparation of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol: To a mixture of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (2 g, 4.63 mmol, 1 eq.) in DMF (20 mL) were added 1-bromopropan-2-ol (9.20 g, 46.31 mmol, 10 eq.) and K2CO3 (3.20 g, 23.16 mmol, 5 eq.) at 25° C. The mixture was stirred at 50° C. for 12 h. TLC and LC-MS analysis showed that the starting material was consumed completely. The reaction was partitioned by adding water (20 mL) and EtOAc (50 mL). The aqueous phase was extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford the desired product 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol (3.8 g, crude) as a black-brown oil. MS (ES+, m/z): 482.0.


Preparation of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-yl isobutyrate: To a solution of 1-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]propan-2-ol (0.1 g, 187 μmol, 1 eq.) in DCM (5 mL) was added 2-methylpropanoyl 2-methylpropanoate (118.33 mg, 747.99 μmol, 124.03 4 eq.), and the reaction mixture was stirred at 50° C. for 10 h. TLC analysis showed that the reaction was completed (EtOAc, Rf=0.6). The reaction mixture was quenched by adding water (10 mL) and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (50 mL) and water (50 mL), dried over anhydrous sodium sulfate, filtered and concentrated to give the crude product. The crude product was purified by prep-TLC (EtOAc, Rf=0.6) to afford [2-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-1-methyl-ethyl]2-methylpropanoate (90 mg, 163.23 μmol, 87.29% yield) as a yellow oil. MS (ES+, m/z): 552.0. 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-yl propionate was prepared followed the procedure described above. 160 mg, 89.57% yield) MS (ES+, m/z): 538.2.


Preparation of 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-2-yl propanoate and 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-2-yl 2-methylpropanoate: To a mixture of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (39.84 mg, 166.49 1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (82.01 mg, 1.39 mmol, 119.20 μL, 10 eq.), CuI (26.42 mg, 138.74 μmol, 1 eq.), 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-yl propionate (90 mg, 138.74 μmol, 1 eq.) or 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-yl isobutyrate and Pd(PPh3)4 (32.06 mg, 27.75 μmol, 0.2 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h. under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (20 mL) at 25° C. and stirred for 2 h. The reaction mixture was partitioned by adding EtOAc (5 mL) and the aqueous phase was extracted with EtOAc (5 mL×3). The organic phase was washed with brine (5 mL×3) dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to obtain the crude product (100 mg). The crude residue was purified by prep-TLC (DCM:MeOH=20:1, Rf=0.5) and prep-HPLC to afford the desired products as light-yellow solids.


1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-2-ylpropanoate (6.3 mg, 6.98% yield), MS (ES+, m/z): 649.3; and 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-2-yl 2-methylpropanoate (11.6 mg, 12.11% yield) MS (ES+, m/z): 663.3.


Example D27
Synthesis of 2-hydroxy-3-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propyl 2-methylpropanoate (Compound 592A)



embedded image


Preparation of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol: To a mixture of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine) (2 g, 4.54 mmol, 1 eq.) in DMF (15 mL) were added oxiran-2-ylmethanol (1.77 g, 22.68 mmol, 1.58 mL, 5 eq.) and K2CO3 (1.88 g, 13.61 mmol, 3 eq.) at 25° C. The mixture was stirred at 50° C. for 12 hrs. TLC and LC-MS analysis showed that the starting material was consumed completely. The reaction was partitioned by adding water (20 mL) and EtOAc (10 mL) The aqueous phase was extracted with EtOAc (20 mL×3) The combined organic layers were washed with brine (20 mL×3) dried over anhydrous sodium sulfate, filtered, and dried in vacuo to afford the desired product 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol (2.1 g, 83.7% yield) as a black-brown oil.


Preparation of 2-hydroxy-3-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]propyl] 2-methylpropanoate: To a solution of 3-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]propane-1,2-diol (120 mg, 217.18 μmol, 1 eq.) in DCM (3 mL) was added 2-methylpropanoyl 2-methylpropanoate (30.92 mg, 195.46 μmol, 32.41 μL, 0.9 eq.). The mixture was stirred at 25° C. for 5 h. TLC analysis (PE:EtOAc=1:1, Rf=0.63) showed that the staring material was consumed completely, and the product was detected. The reaction mixture was partitioned by adding water (100 mL) and EtOAc (10 mL). The aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated by vacuum to give the crude product. The crude was purified by prep-TLC (PE:EtOAc=1:1, Rf=0.63) to give the desired product [2-hydroxy-3-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]propyl] 2-methylpropanoate (70 mg, crude) as a light brown oil. MS (ES+, m/z): 568.2.


Preparation of 2-hydroxy-3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propyl isobutyrate: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (39.36 mg, 148.05 μmol, 1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (72.93 mg, 1.23 mmol, 106 μL, 10 eq.), CuI (23.50 mg, 123.37 μmol, 1 eq.), [2-hydroxy-3-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]propyl] 2-methylpropanoate (70 mg, 123.37 μmol, 1 eq.), and Pd(PPh3)4 (28.51 mg, 24.67 μmol, 0.2 eq.) at 25° C. The mixture was stirred at 25° C. for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (20 mL) at 25° C. and stirring the mixture for 2 h. The reaction mixture was partitioned by adding EtOAc (10 mL). The aqueous phase was extracted with EtOAc (5mL×3). The organic phase was washed with brine (10 mL×3) dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC and by prep-HPLC to afford the desired product (9.4 mg, 12.82 μmol, 10.39% yield) as a light-yellow solid. MS (ES+, m/z): 679.3.


Example D28
Synthesis of (4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoyl)-L-glutamic acid (Compound 973A)



embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.08 g, 150.23 μmol, 1 eq.) in DMF (2 mL) were added TEA (45.60 mg, 450.68 μmol, 62.73 μL, 3 eq.) and HATU (85.68 mg, 225.34 μmol, 1.5 eq.) at 25° C. The mixture was stirred at 25° C. for 0.5 h. Then diethyl L-glutamate hydrochloride (43.21 mg, 180.27 μmol, 1.2 eq., HCl) was added and the mixture was stirred at 50° C. for 2 h. TLC analysis showed that the starting material was completely consumed. NaOH (12.02 mg, 300.45 μmol, 2 eq.) in water (0.5 mL) was added to the mixture, and the mixture was stirred for 0.5 h at 50° C. LC-MS analysis showed that the reaction was complete. The mixture was purified without workup by prep-HPLC to afford the desired product (4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoyl)-L-glutamic acid (0.033 g, 47.77 μmol, 31.80% yield) as a yellow solid. MS (ES+, m/z): 662.3.


Example D29
Synthesis of (4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoyl)-L-glutamine (Compound 974A)



embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.08 g, 150.23 μmol, 1 eq.) in DMF (3 mL) were added TEA (45.60 mg, 450.68 μmol, 62.73 μL, 3 eq.) and HATU (85.68 mg, 225.34 μmol, 1.5 eq.) at 25° C. The mixture was stirred for 0.5 h. Then, L-glutamine (26.35 mg, 180.27 μmol, 1.2 eq.) was added, and the resulting mixture was stirred at 50° C. for 4 h. LC-MS analysis showed that the starting material was consumed completely. The mixture was purified directly by prep-HPLC to afford the desired product (0.031 g, 46.11 μmol, 30.69% yield) as a white solid. MS (ES+, m/z): 661.3.


Example D30
Synthesis of (4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoyl)-L-glutamine (Compound 975A)



embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (100 mg, 187.78 μmol, 1 eq.) in DMF (3 mL) were added TEA (57.01 mg, 563.35 μmol, 78.41 μL, 3 eq.) and HATU (107.10 mg, 281.67 μmol, 1.5 eq.) at 20° C. The mixture was stirred at 25° C. for 0.5 h. Dimethyl L-glutamate (47.69 mg, 225.34 μmol, 1.2 eq., HCl) was added and the resulting mixture was warmed to 50° C. with stirring over 2 h. LC-MS analysis showed that the starting material was consumed completely. The mixture was purified by prep-HPLC to afford the desired product (41 mg, 58.79 μmol, 31.31% yield) as a white solid. MS (ES+, m/z): 690.4.


Example D31
Synthesis of Compounds 474A and 475A



embedded image


embedded image


embedded image


Preparation of 4-bromo-6-fluoro-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indole: To a mixture of NaH (2.80 g, 70.08 mmol, 60% in mineral oil, 3 eq.) in THF (80 mL) was added into a solution of 4-bromo-6-fluoro-1H-indole (5 g, 23.36 mmol, 1 eq.) in THF ((80 mL) at 0° C. The mixture was stirred for 1 h. then SEMC1 (6.62 g, 39.71 mmol, 7.03 mL, 1.7 eq.) was added at 0° C. The mixture was stirred for 1 h at 0° C. LC-MS analysis indicated that the starting material was consumed completely, and that the desired product was detected. The reaction mixture was quenched by adding a saturated aqueous NH4Cl solution (100 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=1:0 to 20:1) to afford the desired product (10 g, 29.04 mmol, 62.17% yield) as a light-yellow oil.


Preparation of 6-fluoro-N-(1-methylpiperidin-4-yl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indol-4-amine: To a mixture of 4-bromo-6-fluoro-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indole (7 g, 20.33 mmol, 1 eq.), 1-methylpiperidin-4-amine (23.22 g, 203.31 mmol, 10 eq.), t-BuONa (2.54 g, 26.43 mmol, 1.3 eq.), and ditert-butyl-(2-phenylphenyl)phosphane (1.21 g, 4.07 mmol, 0.2 eq.) in toluene (10 mL) was added Pd2(dba)3 (2.79 g, 3.05 mmol, 0.15 eq.) at 20° C. The mixture was flushed with N2 and was stirred at 60° C. for 12 h. in a sealed tube. LC-MS analysis indicated that the starting material was consumed. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (200 mL) at 25° C. for 1 h and extracted with EtOAc (20 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, DCM:MeOH=1:0 to 25:1, Rf=0.43) to afford the desired product (4.3 g, 11.39 mmol, 56.01% yield) as a black brown oil. MS (ES+, m/z): 378.1.


Preparation of tert-butyl (6-fluoro-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate: A solution of 6-fluoro-N-(1-methylpiperidin-4-yl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indol-4-amine (2 g, 5.30 mmol, 1 eq.) in t-BuOH (2 mL) was added into (Boc)2O (34.68 g, 158.91 mmol, 36.51 mL, 30 eq.) at 20° C. The mixture was stirred at 100° C. for 24 h. LC-MS analysis indicated that the starting material was consumed, and that one new major spot was detected. The reaction mixture was concentrated under reduced pressure, and the crude residue was purified by column chromatography (SiO2, DCM:MeOH=1:0 to 20:1, Rf=0.43) to afford the desired product (3 g, 4.40 mmol, 41.50% yield) as a black brown solid. MS (ES+, m/z): 478.3.


Preparation of tert-butyl (6-fluoro-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate: A solution of tert-butyl (6-fluoro-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (1.6 g, 2.34 mmol, 1 eq.) in THF (3 mL) was added into TBAF (1 M, 9.38 mL, 4 eq.) at 20° C. The mixture was stirred for 10 h at 80° C. LC-MS analysis indicated that the starting material was consumed, and one major spot with a mass of the desired product was detected. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (100 mL) at 25° C. and extracted with EtOAc (30 mL×7). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, DCM:MeOH=50:1 to 20:1) to afford the desired product (1.8 g, 3.11 mmol, 66.29% yield) as a black brown oil.


Preparation of tert-butyl (6-fluoro-1-(phenylsulfonyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate: A mixture of NaH (310.86 mg, 7.77 mmol, 60% in mineral oil, 3 eq.) in THF (5 mL) was added into a solution of tert-butyl (6-fluoro-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (1.5 g, 2.59 mmol, 1 eq.) in THF (5 mL) at 0° C. The mixture was stirred for 1 h. then benzenesulfonyl chloride (915.06 mg, 5.18 mmol, 663.09 μL, 2 eq.) was added at 0° C. The resulting mixture was stirred at 0° C. for 1 h. LC-MS analysis indicated that the starting material was consumed, and one desired product was detected. The reaction mixture was quenched by adding a saturated aqueous NH4Cl solution (100 mL) at 20° C. and extracted with EtOAc (20 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.43) to afford the desired product (1.1 g, 1.80 mmol, 34.84% yield) as a black brown oil. MS (ES+, m/z): 488.1.


Preparation of tert-butyl (6-fluoro-2-iodo-1-(phenylsulfonyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate: To a solution of tert-butyl (6-fluoro-1-(phenylsulfonyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (300 mg, 492.22 μmol, 1 eq.) in THF (3 mL) at −78° C. was added LDA (2 M, 861.39 μL, 3.5 eq.). The mixture was stirred at −78° C. for 1 h, and a solution of I2 (499.72 mg, 1.97 mmol, 396.60 μL, 4 eq.) in THF (2 mL) was added, and the resulting mixture was stirred for 1 h at −78° C. LC-MS analysis indicated that the starting material was consumed completely. The reaction mixture was quenched by adding a saturated aqueous NH4Cl solution (60 mL) at 20° C. and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude product was obtained as a black brown oil (1 g, 489.01 μmol, 49.67% yield) and was used in the next step without further purification. MS (ES+, m/z): 613.9.


Preparation of tert-butyl (6-fluoro-2-iodo-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate: A mixture of tert-butyl (6-fluoro-2-iodo-1-(phenylsulfonyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (800 mg, 782.42 μmol, 1 eq.) and K2CO3 (540.68 mg, 3.91 mmol, 5 eq.) in MeOH (3 mL) was stirred at 60° C. for 2 h. LC-MS analysis indicated that the starting material was consumed completely, and one spot for the desired compound was detected. The reaction mixture was quenched by adding water (100 mL) at 20° C. and extracted with EtOAc (30 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=8:1, Rf=0.43) to afford the desired product (160 mg, 250.15 μmol, 31.97% yield) as a black brown oil. MS (ES+, m/z): 473.9.


Preparation of tert-butyl (6-fluoro-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate: To a mixture of NaH (30.02 mg, 750.44 μmol, 60% in mineral oil, 3 eq.) in THF (2 mL) at 0° C. was added a solution of tert-butyl (6-fluoro-2-iodo-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (0.16 g, 250.15 μmol, 1 eq.) in THF (1 mL). The mixture was stirred for 1 h. at 0° C., and 2,2,2-trifluoroethyl trifluoromethanesulfonate (290.30 mg, 1.25 mmol, 5 eq.) was added and the mixture was stirred at 0° C. for 1 h. LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated NH4Cl solution (15 mL) and was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (5 mL), dried over anhydrous sodium sulfate, and concentrated in vacuo. The crude residue (0.16g, crude) was obtained as a yellow solid and used in the next step without purification. MS (ES+, m/z): 555.8.


Preparation of tert-butyl (6-fluoro-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate and tert-butyl (6-fluoro-2-(3-((2-methoxy-4-sulfamoylphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate: To a solution of tert-butyl (6-fluoro-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (80 mg, 122.45 μmol, 1 eq.) in DMSO (3 mL) were added 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (42.26 mg, 160.71 μmol, 1.5 eq.) or 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (73.55 mg, 244.89 μmol, 2 eq.), CuI (25.65 mg, 134.69 μmol, 1.10 eq.), N-isopropylpropan-2-amine (12.39 mg, 122.45 μmol, 17.30 μL, 1 eq.) and Pd(PPh3)4 (28.30 mg, 24.49 μmol, 0.20 eq.) under N2. The mixture was stirred at 45° C. for 1 h. LC-MS analysis indicated that the starting material was consumed completely, and one new major spot with a mass of the desired product was detected. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (100 mL) at 25° C. The mixture was stirred for 1 h and extracted with EtOAc (50 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC to afford the desired product as a black brown solid.


tert-Butyl (6-fluoro-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (25.0 mg, 28% yield), MS (ES+, m/z): 667.0; and tert-butyl (6-fluoro-2-(3-((2-methoxy-4-sulfamoylphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (35.0 mg, 38.5% yield), MS (ES+, m/z): 668.0.


Preparation of 4-[(3-{6-fluoro-4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide and 6-fluoro-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of tert-butyl (6-fluoro-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (20 mg, 24 μmol, 1 eq.) or tert-butyl (6-fluoro-2-(3-((2-methoxy-4-sulfamoylphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(1-methylpiperidin-4-yl)carbamate (35 mg, 47.18 μmol, 1 eq.) in EtOAc (0.5 mL) was added into HCl/EtOAc (4 M, 2 mL, 169.58 eq.) at 20° C. and stirred for 20 min. LC-MS analysis indicated that the starting material was consumed completely, and one main spot with a mass of the desired product was detected. The reaction mixture was concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desire products as light-yellow solids. 4-[(3-{6-fluoro-4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide (0.6 mg, 3.9% yield), MS (ES+, m/z): 567.2; and 6-fluoro-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (3.8 mg, 13.9% yield), MS (ES+, m/z): 568.2.


Example D32
Synthesis of 4-[(3-{4-[(1-acetylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide (Compound 749A)



embedded image


Preparation of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-one: To a mixture of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 226.84 μmol, 1 eq.) in DCM (3 mL) was added acetic anhydride (20.84 mg, 204.15 μmol, 19.12 μL, 0.9 eq.). The mixture was stirred at 25° C. for 4 h. TLC and LC-MS analysis showed that the starting material was consumed completely. The reaction was concentrated to give the crude product as a black brown oil (110.0 mg) and used in the next step without purification. MS (ES+, m/z): 466.1.


Preparation of 4-((3-(4-((1-acetylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide: To a solution of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-one (110 mg, 236.43 μmol, 1 eq.) and 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (85.21 mg, 283.72 μmol, 1.2 eq.) in DMSO (3 mL) were added i-Pr2NH (139.76 mg, 2.36 mmol, 203.13 μL, 10 eq.), CuI (45.03 mg, 236.43 μmol, 1 eq.), and Pd(PPh3)4 (54.64 mg, 47.29 μmol, 0.2 eq.) The mixture was stirred at 25° C. for 1 h. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (20 mL) at 25° C. and stirring for 2 h. The reaction mixture was partitioned by adding EtOAc (10 mL), and the aqueous phase was extracted with EtOAc (5 mL×3). The organic phase was washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (PE:EtOAc=0:1, Rf=0.35), and prep-HPLC to give the desired product 18.3 mg, 12.9% yield, as a light yellow solid. MS (ES+, m/z): 578.1.


Example D33
Synthesis of 4-[(3-{4-[(1-acetylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxy-N,N-dimethylbenzene-1-sulfonamide (Compound 755A)



embedded image


To a mixture of 3-methoxy-N,N-dimethyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (119.79 mg, 290.17 μmol, 1.5 eq.) in DMSO (1˜10 mL) (4 mL) were added i-Pr2NH (195.75 mg, 1.93 mmol, 273.39 μL, 10 eq.), CuI (36.84 mg, 193.44 μmol, 1 eq.), 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-one (100 mg, 193.44 μmol, 1 eq.), and Pd(PPh3)4 (44.71 mg, 38.69 μmol, 0.2 eq.) at 20° C. The mixture was stirred at 20° C. for 1 h. EtOAc (10 mL) was added to the mixture, and the resulting mixture was then poured into a saturated EDTA solution (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (40 mL×2), and the organic layer was poured to a 2N aqueous EDTA solution (40 mL) and stirred further for 1 h. The aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, mixed with activated carbon, filtered, and concentrated in vacuo. The mixture was purified by prep-HPLC to afford the desired product in 31.6 mg, 26.8% yield. MS (ES+, m/z): 606.2.


Example D34
Synthesis of 1-(4-{[2-(3-{[2-methoxy-4-(morpholine-4-sulfonyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}piperidin-1-yl)ethan-1-one (Compound 758A)



embedded image


To a solution of 2-methoxy-4-(morpholinosulfonyl)-N-(prop-2-yn-1-yl)aniline (72.77 mg, 232.13 μmol, 1.5 eq.) in DMSO (2 mL) were added i-Pr2NH (156.60 mg, 1.55 mmol, 218.71 μL, 10 eq.), CuI (29.47 mg, 154.76 μmol, 1 eq.), 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-one (80 mg, 154.76 μmol, 1 eq.), and Pd(PPh3)4 (35.77 mg, 30.95 μmol, 0.2 eq.) at 20° C. The mixture was stirred at 20° C. for 1 h. LC-MS analysis showed that the reaction was complete. EtOAc (10 mL) was added into the mixture, and the resulting mixture was then poured into a saturated aqueous EDTA solution (40 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, mixed with activated carbon, filtered, and concentrated in vacuo. The mixture was purified by prep-TLC or column chromatography, then purified by prep-HPLC to afford the desired product (28.04 mg, 30.5% yield), MS (ES+, m/z): 648.2.


Example D35
Synthesis of 1-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-methylpiperidin-1-yl)ethan-1-one (Compound 738A)



embedded image


Preparation of 2-iodo-N-(2-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-methylpiperidine-1-carboxylate (320 mg, 595.51 μmol, 1 eq.) in DCM (2 mL) was added TFA (2.04 g, 17.87 mmol, 1.32 mL, 30 eq.). The mixture was stirred at 20° C. for 2 h. TLC analysis (PE:EtOAc=1:1, Rf=0.1) showed that the reaction was complete. The reaction mixture was poured into a saturated NaHCO3 solution (20 mL), and the aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue (370 mg, crude) was obtained as light yellow solid and used in the next step without purification. MS (ES+, m/z): 437.9.


Preparation of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-methylpiperidin-1-yl)ethan-1-one: A mixture of 2-iodo-N-(2-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and Et3N (256.89 mg, 2.54 mmol, 353.35 μL, 3 eq.) in DCM (4 mL) under N2 at 0° C. was prepared. A solution of acetyl chloride (66.43 mg, 846.22 μmol, 60.39 μL, 1 eq.) in DCM (1 mL) was added dropwise to the mixture. The reaction mixture was stirred at 20° C. for 2 h. LC-MS and TLC analysis (PE:EtOAc=1:1, Rf=0.43) showed that the reaction was complete. The mixture was poured into a saturated NaHCO3 solution (20 mL). The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (40 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (PE:EtOAc=1:1, Rf=0.43) to afford the desired product (160 mg, 282.09 μmol, 33.34% yield) as a light yellow solid.


Preparation of 1-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-methylpiperidin-1-yl)ethan-1-one: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (103.02 mg, 370.25 μmol, 1.5 eq.) in DMSO (5 mL) were added i-Pr2NH (249.77 mg, 2.47 mmol, 348.84 μL, 10 eq.), CuI (47.01 mg, 246.83 μmol, 1 eq.), 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-2-methylpiperidin-1-yl)ethan-1-one (140 mg, 246.83 μmol, 1 eq.), and Pd(PPh3)4 (57.05 mg, 49.37 μmol, 0.2 eq.) at 20° C. The mixture was stirred at 20° C. for 1 h. EtOAc (10 mL) was added into the mixture, and the resulting mixture was then poured into a 2N aqueous EDTA solution (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (40 mL×2). The organic layer was poured to a 2N aqueous EDTA solution (40 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, mixed with activated carbon, filtered, and concentrated in vacuo. The mixture was purified by prep-TLC (PE:EtOAc=0:1, Rf=0.42). then purified by prep-HPLC to afford the desired product (14.9 mg,16.1% yield), MS (ES+, m/z): 591.2.


Example D36
Synthesis of 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]azepan-1-yl}-3-methoxypropan-2-ol (Compound 989A)



embedded image


Preparation of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)azepane-1-carboxylate: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.5 g, 1.47 mmol, 1 eq.) in DMF (5 mL) were added tert-butyl 4-oxoazepane-1-carboxylate (627.12 mg, 2.94 mmol, 2 eq.) and TMSCl (479.19 mg, 4.41 mmol, 559.80 μL, 3 eq.). The reaction mixture was stirred for 0.5 h. at 20° C. under N2. BH3.Me2S (10 M, 441.07 μL, 3 eq.) was then added dropwise to the reaction mixture at 0° C. and stirring for 0.5 h under N2. LC-MS analysis showed that the reaction was complete. The reaction was quenched with ice water (20 mL), and the mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=20:1 to 10:1) to afford tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)azepane-1-carboxylate (0.69 g, 1.28 mmol, 87.34% yield) as a red oil. MS (ES+, m/z): 538.1.


Preparation of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)azepane-1-carboxylate: To a solution of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)azepane-1-carboxylate (0.6 g, 1.12 mmol, 1 eq.) in DCM (10 mL) was added TFA (7.70 g, 67.53 mmol, 5 mL, 60.48 eq.). The mixture was stirred for 0.5 h at 20° C. under N2. LC-MS analysis showed that the reaction was complete. The reaction was quenched with a cold saturated aqueous NaHCO3 solution (20 mL), and the mixture was extracted with DCM (20 mL×3). The combined organic layers were washed with brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)azepane-1-carboxylate (0.55 g, crude) as a red solid. MS (ES+, m/z): 438.2.


Preparation of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)azepan-1-yl)-3-methoxypropan-2-ol: To a solution of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)azepane-1-carboxylate (0.45 g, 1.03 mmol, 1 eq.) in DMF (10 mL) were added 2-(methoxymethyl)oxirane (453.38 mg, 5.15 mmol, 457.96 μL, 5 eq.) and K2CO3 (426.72 mg, 3.09 mmol, 3 eq.). The mixture was stirred for 8 h at 50° C. under N2. TLC analysis showed 60% of the desired product and 20% of the starting material. The reaction was quenched with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford 1-(4-((42-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)azepan-1-yl)-3-methoxypropan-2-ol (0.22 g, 418.77 μmol, 40.69% yield) as a yellow oil.


Preparation of 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]azepan-1-yl}-3-methoxypropan-2-ol: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (43.73 mg, 182.74 μmol, 1.2 eq.) in DMSO (5 mL) were added i-Pr2NH (154.09 mg, 1.52 mmol, 215.21 μL, 10 eq.), CuI (8.70 mg, 45.68 μmol, 0.3 eq.), 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)azepan-1-yl)-3-methoxypropan-2-ol (0.08 g, 152.28 μmol, 1 eq.), and Pd(PPh3)4 (8.80 mg, 7.61 μmol, 0.05 eq.). The mixture was stirred for 0.5 h at 40° C. under N2. LC-MS analysis showed that the reaction was complete. The reaction was diluted with EtOAc (20 mL) and saturated EDTA solution (20 mL) and stirred at 20° C. for 1 h. The mixture was then extracted with EtOAc (20 mL×3) and washed with brine (50 mL), dried over anhydrous sodium sulfate, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]azepan-1-yl}-3-methoxypropan-2-ol (0.0223 g, 32.82 μmol, 21.55% yield) as a yellow solid. MS (ES+, m/z): 637.2.


Example D37
Synthesis of 3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol (Compound 556A)



embedded image


To a solution of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (10.5 g, 19.64 mmol, 1 eq.) in acetonitrile (100 mL) were added K2CO3 (5.43 g, 39.28 mmol, 2 eq.) and oxiran-2-ylmethanol (2.91 g, 39.28 mmol, 2.60 mL, 2 eq.; added dropwise) under N2. The reaction mixture was stirred at 80° C. for 12 h. TLC analysis (PE:EtOAc=0:1) showed that the starting material was consumed completely. The reaction was quenched with aqueous Na2CO3 (500 mL) and extracted with DCM (50 mL×2). The combined organic layers were washed with brine (100 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, DCM:MeOH=1000:1 to 20:1) and prep-HPLC to afford the desired product (3.6 g, 5.86 mmol, 29.81% yield) as a yellow solid. MS (ES+, m/z): 609.3.



1H NMR (400 MHz, DMSO-d6) δ ppm 7.39-7.36 (dd, 1H), 7.23-7.22 (d, J=1.6 Hz, 1H), 7.05 (s, 1H), 6.99-6.86 (t, J=8.4 Hz, 1H), 6.77-6.47 (d, J=8.4 Hz, 1H), 6.47-6.49 (m, 1H), 6.47-6.34 (t, J=8.4 Hz, 1H), 6.16-6.14 (d, J=8.0 Hz, 1H), 4.92-4.85 (q, J=26.8 Hz, 2H), 4.35-4.34 (d, J=5.2 Hz, 2H), 3.87 (s, 3H), 3.61-3.58 (m, 1H), 3.33-3.30 (m, 3H), 3.01 (s, 3H), 2.85-2.67 (m, 2H), 2.36-2.26 (m, 2H), 2.11-2.10 (m, 2H), 1.91-1.89 (m, 2H) 1.49-1.44 (m, 2H).


Example D38
Synthesis of 3-(2-hydroxy-3-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propoxy)propane-1,2-diol (Compound 669A)



embedded image


To a solution of 2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-N-(4-piperidyl)-1-(2,2,2-trifluoroethyl)indol-4-amine hydrochloride (0.5 g, 875.5 μmol, 1 eq.) in acetonitrile (20 mL) were added K2CO3 (484.05 mg, 3.50 mmol, 4 eq.) and oxiran-2-ylmethanol (129.72 mg, 1.75 mmol, 115.82 μL, 2 eq.) under N2. The reaction mixture was stirred at 80° C. for 16 h. TLC analysis (PE:EtOAc=0:1) showed that the starting material was consumed completely. The reaction was quenched with a saturated aqueous Na2CO3 solution (100 mL) and extracted with DCM (20 mL×2). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to give the desired product (0.3 g, 443.59 μmol, 50.66% yield) as a yellow solid. MS (ES+, m/z): 683.2.



1H NMR (400 MHz, DMSO-d6) δ ppm 7.39-7.36 (dd, 1H), 7.23-7.22 (d, J=1.6 Hz, 1H), 7.05 (s, 1H), 6.99-6.86 (t, J=8.4 Hz, 1H), 6.77-6.47 (d, J=8.4 Hz, 1H), 6.47-6.49 (m, 1H), 6.47-6.34 (t, J=8.4 Hz, 1H), 6.16-6.14 (d, J=8.0 Hz, 1H), 4.92-4.85 (q, J=26.8 Hz, 2H), 4.35-4.34 (d, J=5.2 Hz, 2H), 3.87 (s, 3H), 3.61-3.58 (m, 1H), 3.33-3.30 (m, 3H), 3.01 (s, 3H), 2.85-2.67 (m, 2H), 2.36-2.26 (m, 2H), 2.11-2.10 (m, 2H), 1.91-1.89 (m, 2H) 1.49-1.44 (m, 2H).


Example D39
Synthesis of 3-methoxy-4-((3-(4-((1-(2-methoxyethyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide (Compound 614A)



embedded image


Preparation of 2-iodo-N-(1-(2-methoxyethyl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 222.11 μmol, 1 eq.) in DMF (2 mL) were added K2CO3 (153.48 mg, 1.11 mmol, 5 eq.) and 1-bromo-2-methoxyethane (61.74 mg, 444.22 μmol, 41.72 μL, 2 eq.). The reaction mixture was stirred at 50° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.43) indicated that the reaction was complete. The reaction mixture was quenched by adding water (40 mL) at 25° C. and extracting the mixture with EtOAc (10 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (80 mg, 141.29 μmol, 63.61% yield) as a light-yellow oil. MS (ES+, m/z): 481.9.


Preparation of 3-methoxy-4-((3-(4-((1-(2-methoxyethyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide: To a mixture of 2-iodo-N-(1-(2-methoxyethyl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (70 mg, 123.63 μμmol, 1 eq.) and 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (41.94 mg, 148.35 μmol, 1.2 eq.) in DMSO (3 mL) were added CuI (23.54 mg, 123.63 μmol, 1 eq.), N-isopropylpropan-2-amine (12.51 mg, 123.63 μmol, 17.47 μL, 1 eq.), and Pd(PPh3)4 (2.86 mg, 2.47 μmol, 0.02 eq.) under N2. The mixture was stirred for 1 h at 25° C. TLC analysis (DCM:MeOH=10:1, Rf=0.30) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (60 mL) at 25° C. and stirring the mixture for 1 h. The mixture was then extracted with EtOAc (20 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired product (16.1 mg, 25.19 μmol, 20.38% yield) as a light yellow solid. MS (ES+, m/z): 594.3.


Example D40
Synthesis of Compounds 600A, 608A, and 618A



embedded image


Preparation of 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-ol: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 g, 2.22 mmol, 1 eq.) in DMF (10 mL) were added into K2CO3 (460.47 mg, 3.33 mmol, 1.5 eq.) and 2-bromoethan-1-ol (555.12 mg, 4.44 mmol, 315.41 μL, 2 eq.). The reaction mixture was stirred at 50° C. for 4 h. TLC analysis (DCM:MeOH=10:1, Rf=0.24) indicated that the reaction was complete. The reaction mixture was quenched by adding water (200 mL) at 25° C. and extracting the mixture with EtOAc (40 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (1.2 g, crude) was obtained as a black brown oil and used in the next step without further purification. MS (ES+, m/z): 468.2.


Preparation of 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)EtOAc, 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethyl propionate, and 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethyl isobutyrate: To a solution of 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-ol (100 mg, 192.61 μmol, 1 eq.) in DCM (3 mL) was added acetic anhydride (13.93 mg, 136.43 μmol, 12.78 μL, 0.5 eq.) or propionic anhydride (23.67 mg, 181.91 μmol, 23.44 μL, 1 eq.) or isobutyric anhydride (152.35 mg, 963.05 μmol, 159.69 μL, 5 eq.) at 50° C. The mixture was stirred at 50° C. for 2 h. TLC analysis (DCM:MeOH=10:1, Rf=0.50) indicated that the reaction was complete. The reaction mixture was concentrated under reduced pressure and purified by prep-TLC (SiO2, EtOAc:PE=8:1, Rf=0.43) to afford the desired products as light-yellow solids. 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)EtOAc (60 mg, 106.03 μmol, 38.9% yield), MS (ES+, m/z): 510.1; 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethyl propionate, (60 mg, 103.19 μmol, 56.72% yield), MS (ES+, m/z): 524.1; and 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethyl isobutyrate, (95 mg, 159.11 μmol, 82.61% yield).


Preparation of 2-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}EtOAc, 2-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}ethyl propanoate, and 2-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}ethyl 2-methylpropanoate: To a solution of 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)EtOAc (60 mg, 106.03 μmol, 1 eq.) or 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethyl propionate (60 mg, 97.45 μmol, 1 eq.); or 2-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethyl isobutyrate (95 mg, 159.11 μmol, 1 eq.) and 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (35.97 mg, 127.23 μmol, 1.2 eq.) in DMSO (3 mL) were added CuI (20.19 mg, 106.03 μmol, 1 eq.), N-isopropylpropan-2-amine (10.73 mg, 106.03 μmol, 14.98 μL, 1 eq.), and Pd(PPh3)4 (2.45 mg, 2.12 μmol, 0.02 eq.) under N2. The mixture was stirred for 1 h at 25° C. LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (60 mL) at 25° C. and stirring the mixture for 1 h. The mixture was then extracted with EtOAc (20 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.30) and prep-HPLC to afford the desired products as light-yellow solids. 2-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}EtOAc (22.9 mg, 36.06 μmol, 34.01% yield) MS (ES+, m/z): 622.3; 2-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}ethyl propanoate (20 mg, 25.17 μmol, 25.83% yield), MS (ES+, m/z): 636.2; and 2-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}ethyl 2-methylpropanoate (20.5 mg, 31.24 μmol, 19.63% yield), MS (ES+, m/z): 650.3.


Example D41
Synthesis of Compounds 534A and 541A



embedded image


Preparation of N-(1-ethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (200 mg, 448.95 μmol, 1 eq.) in DMF (8 mL) were added K2CO3 (186.14 mg, 1.35 mmol, 3 eq.) and bromoethane (489.19 mg, 4.49 mmol, 335.06 μL, 10 eq.) in one portion under N2. The mixture was stirred at 40° C. for 60 min. LC-MS analysis showed that the reaction was complete. The reaction was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with water (25 mL×2) and brine (25 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.29) to afford the desired product (140 mg, 310.24 μmol, 69.10% yield) as a yellow gum. MS (ES+, m/z): 452.2.




embedded image


Preparation of 2-iodo-N-(1-isopropylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (200 mg, 448.95 μmol, 1 eq.) in DMF (2 mL) were added K2CO3 (186.15 mg, 1.35 mmol, 3 eq.) and 2-bromopropane (552.16 mg, 4.49 mmol, 421.50 μL, 10 eq.) in one portion under N2. The mixture was stirred at 40° C. for 60 min. LC-MS analysis showed that 15% of the starting material remained, and the desired product was detected. The reaction was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with water (25 mL×2) and brine (25 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.29) to afford the desired product (130 mg, 279.39 μmol, 62.23% yield) as a yellow solid. MS (ES+, m/z): 466.1.




embedded image


Preparation of N-(1-ethylpiperidin-4-yl)-2-(3-{[12-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and 2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[1-(propan-2-yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of N-(1-ethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (50 mg, 110.80 μmol, 1 eq.) or 2-iodo-N-(1-isopropylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (50 mg, 107.46 μmol, 1 eq.) and 2-(fluoromethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (34.21 mg, 132.96 μmol, 1.2 eq.) in DMSO (3 mL) were added N-isopropylpropan-2-amine (112.12 mg, 1.11 mmol, 156.59 μL, 10 eq.), CuI (63.31 mg, 332.40 μmol, 3 eq.), and Pd(PPh3)4 (64.02 mg, 55.40 μmol, 0.5 eq.) in one portion under N2. The mixture was stirred at 25° C. for 60 min under N2. LC-MS and TLC analysis showed that the reaction was completed. The reaction mixture was diluted with EtOAc (20 mL), and the resulting mixture was poured into a saturated aqueous EDTA solution (10 mL) and stirred further for 0.5 h. The organic layer was poured into a saturated aqueous EDTA solution (20 mL) and stirred for 1 h, and the aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with water (25 mL×3) and brine (15 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC and prep-HPLC to obtain the desired products as white solids. N-(1-ethylpiperidin-4-yl)-2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (15.4 mg, 25.59 μmol, 23.10% yield), MS (ES+, m/z): 581.3; and 2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-N-[1-(propan-2-yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (11.0 mg, 18.04 μmol, 16.78% yield), MS (ES+, m/z): 595.2.


Example D42
Synthesis of N-(1,5-dihydroxypentan-3-yl)-4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide (Compound 965A)



embedded image


Preparation of 3-aminopentane-1,5-diol: To a solution of dimethyl 3-aminopentanedioate (0.2 g, 1.14 mmol, 1 eq.) in THF (10 mL) was added LiAlH4 (86.66 mg, 2.28 mmol, 2 eq.) at −20° C. The mixture was warmed to 25° C. and stirred for 16 h. Sodium sulfate.10H2O (0.5 g) was slowly added to the mixture, and it was stirred for 0.5 h. The mixture was filtered and concentrated. The residue was dissolved in CH3CN (20 mL) and concentrated to remove water. The crude product (0.12 g, crude) was obtained as a yellow oil and used in the next step without purification.




embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.06 g, 112.67 μmol, 1 eq.) in DMF (2 mL) were added TEA (34.20 mg, 338.01 μmol, 47.05 μL, 3 eq.) and HATU (64.26 mg, 169 μmol, 1.5 eq.). Then, 3-aminopentane-1,5-diol (16.11 mg, 135.20 μmol, 1.2 eq.) was added, and the mixture was warmed to 50° C. and stirred for 1.5 h. The mixture was purified directly using prep-HPLC to afford the desired product (0.033 g, 47.88 μmol, 42.49% yield) as a yellow solid. MS (ES+, m/z): 634.3.


Example D43
Synthesis of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-N-((S)-2-hydroxypropyl)-3-methoxybenzamide (Compound 959A)



embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.06 g, 112.67 μmol, 1 eq.) in DMF (1 mL) were added TEA (22.80 mg, 225.34 μmol, 31.36 μL, 2 eq.) and HATU (64.26 mg, 169 μmol, 1.5 eq.) at 25° C. The mixture was stirred for 0.5 h. Then, (S)-1-aminopropan-2-ol (10.16 mg, 135.20 μmol, 10.64 μL, 1.2 eq.) was added, and the mixture was warmed to 50° C. and stirred for 1 h. The reaction mixture was purified directly using prep-HPLC and chiral SFC to afford the desired product (0.030 g, 46.70 μmol, 41.45% yield) as a yellow solid. MS (ES+, m/z): 590.2.


Example D44
Synthesis of N-[(2S)-2,3-dihydroxypropyl]-4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide (Compound 964A)



embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.07 g, 131.45 μmol, 1 eq.) in DMF (2 mL) were added TEA (39.90 mg, 394.34 μmol, 54.89 μL, 3 eq.) and HATU (74.97 mg, 197.17 μmol, 1.5 eq.) at 25° C. The mixture was stirred for 0.5 h. Then, (S)-3-aminopropane-1,2-diol (13.17 mg, 144.59 μmol, 11.16 μL, 1.1 eq.) was added, and the mixture was stirred at 25° C. for 11.5 h. The reaction mixture was purified directly using prep-HPLC to afford the desired product (0.031 g, 50.09 μmol, 38.10% yield) as a yellow solid. MS (ES+, m/z): 606.2.


Example D45
Synthesis of Compound 951A, 952A, 953A, 954A, and 955A



embedded image


Preparation of tert-butyl (3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate: To a solution of tert-butyl prop-2-yn-1-ylcarbamate (204.55 mg, 1.32 mmol, 1.2 eq.) in DMSO (5 mL) were added i-Pr2NH ((1.11 g, 10.98 mmol, 1.55 mL, 10 eq.), CuI (41.84 mg, 219.67 μmol, 0.2 eq.), N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.5 g, 1.10 mmol, 1 eq.), and Pd(PPh3)4 (63.46 mg, 54.92 μmol, 0.05 eq.). The mixture was stirred at 40° C. for 1 h. TLC analysis indicated that the starting material was consumed completely, and one new spot had formed. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (30 mL) solution and stirring the mixture at 20° C. for 1 h. The reaction mixture was diluted with water (10 mL) and extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 0:1) to afford the desired product as a yellow solid. (0.45 g, 774.07 μmol, 70.48% yield).


Preparation of 2-(3-aminoprop-1-yn-1-yl)-N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A mixture of tert-butyl (3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate (0.35 g, 725.37 μmol, 1 eq.) and 4M HCl/EtOAc (3 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 1 h under N2. TLC analysis indicated that the starting material was consumed completely, and that one new spot had formed. The reaction mixture was quenched by adding a saturated aqueous Na2CO3 solution to adjust the pH of the mixture to >7. The mixture was then diluted with water (10 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford the desired product as a yellow solid (0.25 g, 588.39 μmol, 81.12% yield).


Preparation of desired products: To a mixture of 2-(3-aminoprop-1-yn-1-yl)-N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.05 g, 130.75 μmol, 1 eq.) and cyclopropanecarboxylic acid (11.26 mg, 130.75 μmol, 10.33 μL, 1 eq.) in DMF (3 mL) were added TEA (66.15 mg, 653.77 μmol, 91 μL, 5 eq.) and HATU (59.66 mg, 156.90 μmol, 1.2 eq.). The mixture was stirred at 20° C. for 20 min. TLC analysis (DCM:MeOH=10:1, Rf=0.5) indicated that the starting material was consumed. The reaction mixture was quenched by adding water (10 mL) and extracting the mixture with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired products as yellow solids.


N-[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]cyclopropanecarboxamide, (0.018 g, 39.24 μmol, 30% yield), MS (ES+, m/z): 451.2; (1R,2R)-N-[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]-2-phenylcyclopropane-1-carboxamide, (0.026 g, 48.64 μmol, 37% yield), MS (ES+, m/z): 527.3; N-[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]-1-methyl-1H-pyrrole-3-carboxamide, (0.021 g, 42.34 μmol, 32% yield), MS (ES+, m/z): 490.2; 1-ethyl-N-[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]-1H-pyrrole-3-carboxamide, (0.021 g, 40.87 μmol, 31% yield), MS (ES+, m/z): 504.2; and 1-tert-butyl-N-[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]-1H-pyrrole-3-carboxamide (0.016 g, 29.68 μmol, 23% yield), MS (ES+, m/z): 532.3.


Example D46
Synthesis of 2-(34(4-methoxy-6-(methylsulfonyl)pyridin-3-yl)amino)prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 476A)



embedded image


Preparation of 2-(3-((4-methoxy-6-(methylsulfonyl)pyridin-3-yl)amino)prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of 4-methoxy-6-(methylsulfonyl)-N-(prop-2-yn-1-yl)pyridin-3-amine (50 mg, 180.68 μmol, 1.2 eq., HCl) in DMSO (2 mL) was flushed with N2. To the mixture were added CuI (28.67 mg, 150.56 μmol, 1 eq.), N-isopropylpropan-2-amine (45.71 mg, 451.69 μmol, 63.84 μL, 3 eq.), and 2-iodo-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (65.83 mg, 150.56 μmol, 1 eq.), and Pd(PPh3)4(13.92 mg, 12.05 μmol, 0.08 eq.) was added. The reaction mixture was flushed again with N2 and stirred at 45° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the desired mass was detected. A saturated aqueous EDTA solution (20 mL) was added, and the mixture was stirred at 15° C. for 1 h. Then EtOAc (20 mL) was added. The organic phase was separated, washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to afford the desired product (9.6 mg, 17.47 μmol, 12% yield) as a white solid. MS (ES+, m/z): 550.1.


Example D47
Synthesis of Compounds 468A and 554A



embedded image


To a solution of 2-[4-methoxy-5-(prop-2-ynylamino)-2-pyridyl]-2-methyl-propanenitrile (44.26 mg, 193.05 μmol, 1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (162.79 mg, 1.61 mmol, 227.35 μL, 10 eq.), CuI (30.64 mg, 160.87 μmol, 1 eq.), 3-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]propane-1,2-diol (80 mg, 160.87 μmol, 1 eq.), and Pd(PPh3)4 (37.18 mg, 32.17 μmol, 0.2 eq.) in one portion at 25° C. under N2. The mixture was stirred at 45° C. for 1 h. LC-MS and TLC analysis (EtOAc:MeOH=2:1, Rf=0.45) showed that the reaction was complete. EtOAc (10 mL) was poured into the mixture, and the resulting mixture was poured into a saturated aqueous EDTA solution (40 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (40 mL×2). The organic layer was poured to a saturated aqueous EDTA solution (40 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (EtOAc:MeOH=2:1, Rf=0.45) then purified further by prep-HPLC to afford the desired products.


2-{4-methoxy-5-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]pyridin-2-yl}-2-methylpropanenitrile (3.2 mg, 5.68 μmol, 3% yield), MS (ES+, m/z): 539.3; 2-(5-{[3-(4-{[1-(2,3-dihydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-4-methoxypyridin-2-yl)-2-methylpropanenitrile (22.8 mg, 37.17 μmol, 23% yield), MS (ES+, m/z): 599.3; and 2-{5-[(3-{4-[(1,1-dioxo-1λ6-thian-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-4-methoxypyridin-2-yl}-2-methylpropanenitrile (3.5 mg, 6.04 μmol, 4% yield), MS (ES+, m/z): 574.2.


Example D48
Synthesis of Compounds 530A, 692A, 719A, 720A, and 763A



embedded image


To a solution of 2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (50 mg, 99.68 μmol, 1 eq.) and 1-methylpiperidine-2,4-dione (95.05 mg, 598.06 μmol, 6 eq.) in DMF (3 mL) was added (27.07 mg, 249.19 μmol, 31.63 μL, 2.5 eq.). The mixture was stirred at 0° C. for 2 h. Then, BH3.THF (1 M, 498.38 μL, 5 eq.) was added under N2, and the mixture was stirred at 25° C. for 2 h. LC-MS or TLC analysis indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous Na2CO3 solution (30 mL). The resulting mixture was then diluted with water (10 mL) and extracted with EtOAc (20 mL×2). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to afford the desired products as light yellow solids.


2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[1-(4-methyl-1,3-thiazol-2-yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (30 mg, 45.83 μmol, 21% yield), MS (ES+, m/z): 632.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[1-(2-methoxy-2-methylpropyl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (31.7 mg, 50 μmol, 50% yield) MS (ES+, m/z): 621.2; 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(octahydroindolizin-7-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (10 mg, 17.14 μmol, 39% yield), MS (ES+, m/z): 575.2; N-(1-cyclopropylpiperidin-4-yl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, (61 mg, 104.03 μmol, 58% yield), MS (ES+, m/z) 575.2; 4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-1-methylpiperidin-2-one (23.7 mg, 41.75 μmol, 42% yield), MS (ES+, m/z): 563.2.


Example D49
Synthesis of Compounds 491A, 492A, 496A, 497A, 498A, and 499A



embedded image


To a solution of 3-methoxy-4-[3-[4-[(1-methyl-4-piperidyl)amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]benzoic acid (150 mg, 87.46 μmol, 1 eq.) and 2-aminoethanol (8.01 mg, 131.19 μmol, 7.93 μL, 1.5 eq.) in DCM (5 mL) was added Et3N (53.10 mg, 524.74 μmol, 73.04 μL, 6 eq.). The mixture was cooled to 0° C., and propylphosphonic anhydride (T3P) (83.48 mg, 131.19 μmol, 78.02 μL, 50% purity, 1.5 eq.) was added. The resulting mixture was stirred at 20° C. for 1˜2 h. The reaction mixture was diluted with water (30 mL) and extracted with DCM (10 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and further purified by prep-HPLC to afford the desired products.


N-(2-hydroxyethyl)-3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide (15.1 mg, 26.60 μmol, 30% yield), MS (ES+, m/z): 558.2; 3-methoxy-N-(2-methoxyethyl)-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide (20.2 mg, 35.03 μmol, 40% yield) MS (ES+, m/z): 572.2; 3-methoxy-N-(1-methylpiperidin-4-yl)-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide (14.3 mg, 23.25 μmol, 27% yield), MS (ES+, m/z): 611.3; 2-(3-{[2-methoxy-4-(morpholine-4-carbonyl)phenyl]amino}prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (23.1 mg, 39.14 μmol, 34% yield) MS (ES+, m/z): 584.3; 1-{3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzoyl}piperidin-4-ol (19.6 mg, 32.37 μmol, 21% yield), MS (ES+, m/z): 598.3; 2-[3-({4-[4-(dimethylamino)piperidine-1-carbonyl]-2-methoxyphenyl}amino)prop-1-yn-1-yl]-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (22.1 mg, 34.95 μmol, 30% yield) MS (ES+, m/z): 625.3.


Example D50
Synthesis of 3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-N-(oxan-4-yl)benzamide (Compound 500A)



embedded image


Preparation of 3-methoxy-4-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzoic acid: A mixture of 2-iodo-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1.3 g, 2.97 mmol, 1 eq.), 3-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid (610.13 mg, 2.97 mmol, 1 eq.), N-isopropylpropan-2-amine (601.71 mg, 5.95 mmol, 840.38 μL, 2 eq.), CuI (283.12 mg, 1.49 mmol, 0.5 eq.), and Pd(PPh3)4 (343.57 mg, 297.32 μmol, 0.1 eq.) in DMSO (15 mL) was degassed and purged with N2 three times. The mixture was then stirred at 20° C. for 1 h under N2. TLC analysis (THF:MeOH=5:2, Rf=0.1) showed that the reaction was complete. A saturated aqueous EDTA solution (100 mL) was added to the mixture, and the resulting mixture was stirred for 1 h. The mixture was extracted with EtOAc (150 mL×8). The combined organic layers were washed with brine (50 mL×2), and dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (2 g, 2.33 mmol, 78% yield) was obtained as a yellow solid and used without purification.


Preparation of 3-methoxy-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-N-(oxan-4-yl)benzamide: To a mixture of 3-methoxy-4-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzoic acid (0.15 g, 291.52 μmol, 1 eq.), tetrahydropyran-4-amine (44.23 mg, 437.29 μmol, 1.5 eq.), and TEA (88.50 mg, 874.57 μmol, 121.73 μL, 3 eq.) in DCM (10 mL) was added T3P® (278.27 mg, 437.29 μmol, 260.07 μL, 50% purity, 1.5 eq.). The mixture was stirred at 20° C. for 1 h under N2. LC-MS analysis detected presence of the desired product. The mixture was diluted with water (15 mL) and was extracted with DCM (20 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desired product (0.013 g, 20.66 μmol, 7% yield) as a white solid. MS (ES+, m/z): 598.3.


Example D51
Synthesis of 2-{3-[(2-methoxy-4-{2-oxa-6-azaspiro[3.3]heptane-6-carbonyl}phenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 502A)



embedded image


To a mixture of 3-methoxy-4-((3-(4-((l-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzoic acid (0.15 g, 291.52 μmol, 1 eq.), 2-oxa-6-azaspiro[3.3]heptan-6-ium oxalate (82.72 mg, 437.29 μmol, 1.5 eq.), TEA (147.50 mg, 1.46 mmol, 202.88 μL, 5 eq.) in DCM (20 mL) was added T3P® (propanephosphonic acid anhydride) (278.27 mg, 437.29 μmol, 260 μL, 50% purity, 1.5 eq.) dropwise under N2. The mixture was stirred at 20° C. for 1 h under N2. LC-MS and HPLC analysis detected presence of the desired product. The mixture was diluted with water (40 mL) and extracted with DCM (50 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desired product (0.043 g, 68.58 μmol, 23.52% yield) as a yellow solid. MS (ES+, m/z): 596.3.


Example D52
Synthesis of 2-(3-{[2-methoxy-4-(4-methylpiperazine-1-carbonyl)phenyl]amino}prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 501A)



embedded image


To a mixture of 3-methoxy-4-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzoic acid (0.15 g, 291.52 μmol, 1 eq.),1-methylpiperazine (44 mg, 437.29 μmol, 48.50 μL, 1.5 eq.), TEA (88.50 mg, 874.57 μmol, 121.73 μL, 3 eq.) in DCM (20 mL) was added T3P® (propanephosphonic acid anhydride) (278.27 mg, 437.29 μmol, 260 μL, 50% purity, 1.5 eq.) dropwise under N2. The mixture was stirred at 20° C. for 1 h under N2. LC-MS and HPLC analysis detected presence of the desired product. The mixture was diluted with water (40 mL) and extracted with DCM (50 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desired product (0.021 g, 33.43 μmol, 11.47% yield) as a yellow solid. MS (ES+, m/z): 597.3.


Example D53
Synthesis of 2-{3-[(2-methoxy-4-{7-oxa-2-azaspiro[3.5]nonane-2-carbonyl}phenyl)amino]prop-1-yn-1-yl}-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 511A)



embedded image


To a mixture of 3-methoxy-4-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzoic acid (0.1 g, 194.35 μmol, 1 eq.), 7-oxa-2-azaspiro[3.5]nonan-2-ium oxalate (80.32 mg, 233.22 μmol, 1.2 eq.), TEA (98.33 mg, 971.75 μmol, 135.26 μL, 5 eq.) in DCM (20 mL) was added T3P® (propanephosphonic acid anhydride) (185.51 mg, 291.52 μmol, 173.38 μL, 50% purity, 1.5 eq.) dropwise under N2. The mixture was stirred at 20° C. for 1 h under N2. LC-MS and HPLC analysis detected presence of the desired product. The mixture was diluted with water (40 mL) and extracted with DCM (50 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desired product (0.026 g, 38.71 μmol, 19.92% yield) as a yellow solid. MS (ES+, m/z): 624.3.


Example D54
Synthesis of 3-methoxy-4-{[3-(4-{[1-(oxan-4-yl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzoic acid (Compound 724A)



embedded image


A mixture of 2-iodo-N-(1-(tetrahydro-2H-pyran-4-yl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 197.11 μmol, 1 eq.), 3-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid (49 mg, 236.53 μmol, 1.2 eq.) CuI (38 mg, 197.11 μmol, 1 eq.), Pd(PPh3)4 (49.89 mg, 43.17 μmol, 0.2 eq.), and i-Pr2NH (218.42 mg, 2.16 mmol, 305.06 μL, 10 eq.) in DMSO (3 mL) was degassed and purged with N2 three times. The mixture was stirred at 25° C. for 1 h under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.1) indicated that the starting material was consumed, and one new spot was detected. A saturated aqueous EDTA solution (20 mL) was added to the reaction mixture and stirred at 20° C. for 1 h under N2. The reaction mixture was extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=15:1) and prep-HPLC to afford the desired product (0.03 g, 54.77 25.38% yield) as a yellow solid. MS (ES+, m/z): 585.3.


Example D55
Synthesis of 4-[(3-{4-[(1-cyclopropylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzoic acid (Compound 721A)



embedded image


A mixture of 3-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid (53 mg, 259.02 1.2 eq.), N-(1-cyclopropylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 215.85 μmol, 1 eq.), CuI (37.54 mg, 197.11 μmol, 1 eq.), Pd(PPh3)4 (45.55 mg, 39.42 μmol, 0.2 eq.), and i-Pr2NH (199.46 mg, 1.97 mmol, 278.57 μL, 10 eq.) in DMSO (3 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 1 h under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.05) indicated that the starting material was consumed, and one new spot was detected. A saturated aqueous EDTA solution (20 mL)was added, and the resulting mixture was stirred at 20° C. for 1 h under N2. The reaction mixture was quenched by adding water (20 mL) and was extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=15:1) and prep-HPLC to give the desired product (0.04 g, 67.53 34.26% yield) as a yellow solid. MS (ES+, m/z): 541.2.


Example D56
Synthesis of 4-{[3-(4-{[1-(3-methanesulfonylpropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (Compound 707A)



embedded image


Preparation of 2-iodo-N-(1-(3-(methylsulfonyl)propyl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.2 g, 472.57 μmol, 1 eq.) in DMF (3 mL) were added K2CO3 (195.94 mg, 1.42 mmol, 3 eq.) and 3-(methylsulfonyl)propyl methanesulfonate (306.62 mg, 1.42 mmol, 3 eq.). The mixture was stirred at 80° C. for 2 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.7) indicated that the starting material was consumed, and one new spot was detected. The reaction mixture was quenched by adding water (20 mL) and was extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, EtOAc=1) to afford the desired product (0.13 g, 191.39 μmol, 40.50% yield) as a yellow oil.


Preparation of 4-{[3-(4-{[1-(3-methanesulfonylpropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid: A mixture of 2-iodo-N-(1-(3-(methylsulfonyl)propyl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 184.03 μmol, 1 eq.), 3-methoxy-4-(prop-2-yn-1-ylamino)benzoic acid (0.1 g, 184.03 μmol, 1 eq.), CuI (35.05 mg, 184.03 μmol, 1 eq.), Pd(PPh3)4 (42.53 mg, 36.81 μmol, 0.2 eq.), and i-Pr2NH (186.22 mg, 1.84 mmol, 260.09 μL, 10 eq.) in DMSO (3 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 1 h under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0) indicated that the starting material was consumed completely, and one major new spot was detected. The reaction mixture was quenched by adding water (20 mL) and was extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by prep-HPLC to afford the desired product (0.035 g, 56.39 μmol, 30.64% yield) as a yellow solid. MS (ES+, m/z): 621.3.


Example D57
Synthesis of 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-3-methyl-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (Compound 520A)



embedded image


Preparation of (E)-1-(3-nitrophenyl)-2-propylidenehydrazine: An aqueous 2M NaOH solution (90 mL) was added slowly to a stirred suspension of (3-nitrophenyl) hydrazine hydrochloride (13 g, 68.57 mmol, 1 eq.) in EtOH (200 mL) until the pH was 6. AcOH (37 mL) was added to the mixture, followed by propanal (4.78 g, 82.28 mmol, 5.99 mL, 1.2 eq.). The mixture was then stirred for 3 h at 20° C. TLC analysis (Rf=0.65, PE:EtOAc=2:1) showed that the starting material was consumed, and one new spot was detected. The mixture was poured into ice-water (800 mL), and the resulting precipitate was isolated via filtration, washed with water, and dried in vacuo. The crude product was obtained (11.5 g, 53.57 mmol, 78.13% yield) as a yellow solid and used without purification.


Preparation of 3-methyl-4-nitro-1H-indole: A mixture of (E)-1-(3-nitrophenyl)-2-propylidenehydrazine (2 g, 10.35 mmol, 1 eq.) and H3PO4 (15 mL) in toluene (15 mL) was stirred at 100° C. for 2 h. TLC analysis (PE:EtOAc=2:1) showed that the reaction was complete. The mixture was concentrated to remove toluene. Then, 10 N NaOH (5 mL) was added to adjust the pH of the mixture to 8. The mixture was diluted with water (10 mL) and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by prep-HPLC to afford the desired product (6 g) as a yellow solid. MS (ES+, m/z): 177.1.


Preparation of 3-methyl-4-nitro-1-(phenylsulfonyl)-1H-indole: To a solution of 3-methyl-4-nitro-1H-indole (5 g, 28.38 mmol, 1 eq.) in DMF (6 mL) and THF (60 mL) was added NaH (1.70 g, 42.57 mmol, 60% in mineral oil, 1.5 eq.) at 0° C. under N2. The mixture was stirred at 0° C. for 0.5 h, and benzenesulfonyl chloride (5.51 g, 31.22 mmol, 4 mL, 1.1 eq.) was added to the reaction mixture at 0° C. The resulting mixture was stirred at 0° C. for 1 h. TLC analysis (PE:EtOAc=2:1, Rf=0.6) detected one major new spot. The reaction mixture was poured into a saturated NH4Cl solution (15 mL), and the aqueous phase was extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford the crude product (8.5 g, 24.18 mmol, 85.21% yield) as a yellow solid, which was used without purification.


Preparation of 2-iodo-3-methyl-4-nitro-1-(phenylsulfonyl)-1H-indole: To a solution of 3-methyl-4-nitro-1-(phenylsulfonyl)-1H-indole (5 g, 15.81 mmol, 1 eq.) in THF (150 mL) was added LDA (2 M, 31.61 mL, 4 eq.; slow addition) at −60° C. The mixture was stirred at −40° C. for 0.5 h. Then the mixture was cooled to −60° C., and a solution of I2 (6.02 g, 23.71 mmol, 4.78 mL, 1.5 eq.) in THF (150 mL) was slowly added over 1 h. The mixture was stirred at −60° C. for 4 h. HPLC analysis showed that reaction was complete. Water (300 mL) was slowly added to the reaction, and the mixture was extracted with EtOAc (300 mL×3). The combined organic layers were washed with brine (200 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford the crude product (6.5 g, crude) as a yellow solid, which was used without purification.


Preparation of 2-iodo-3-methyl-4-nitro-1H-indole: A mixture of 2-iodo-3-methyl-4-nitro-1-(phenylsulfonyl)-1H-indole (6.5 g, 14.70 mmol, 1 eq.) and NaOH (5.88 g, 146.98 mmol, 10 eq.) in dioxane (75 mL) and water (25 mL) was stirred at 100° C. for 3 h under N2. TLC analysis (Rf=0.35, PE:EtOAc=4:1) showed that most of the starting material was almost consumed. The mixture was extracted with water (100 mL) and EtOAc (120 mL×3). The organic layer was washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=80:1 to 50:1) to afford the desired product (2 g, 5.96 mmol, 40.54% yield) as a yellow solid.


Preparation of 2-iodo-3-methyl-4-nitro-1-(2,2,2-trifluoroethyl)-1H-indole: A mixture of 2-iodo-3-methyl-4-nitro-1H-indole (0.4 g, 1.32 mmol, 1 eq.), 2,2,2-trifluoroethyl trifluoromethanesulfonate (922.05 mg, 3.97 mmol, 3 eq.), and K2CO3 (915.07 mg, 6.62 mmol, 5 eq.) in DMF (5 mL) was stirred at 20° C. for 3 h. under N2 atmosphere. TLC analysis (Rf=0.35, PE:EtOAc=4:1) showed that the reaction was complete. The reaction mixture was poured into water (200 mL) and extracted with EtOAc (150 mL×3). The organic layers were washed with brine (30 mL×5), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=40:1 to 30:1) to afford 2-iodo-3-methyl-4-nitro-1-(2,2,2-trifluoroethyl)indole (0.25 g, 650.89 μmol, 49% yield) as a yellow solid.


Preparation of 2-iodo-3-methyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-3-methyl-4-nitro-1-(2,2,2-trifluoroethyl)-1H-indole (1.2 g, 3.12 mmol, 1 eq.) in EtOH (30 mL), NH4Cl (10 mL), and saturated aqueous solution of NH4Cl (2.5 mL) was added Fe (872.37 mg, 15.62 mmol, 5 eq.) at 60° C. The mixture was stirred at 60° C. for 1 h. TLC analysis (PE:EtOAc=4:1, Rf=0.35) showed that the reaction was complete. The mixture was poured into EtOAc (30 mL) and extracted with water (20 mL) and EtOAc (10 mL×2). The organic layer was washed with brine (15 mL), dried over anhydrous sodium sulfate, filtered, and concentrated. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=20:1 to 5:1) to afford the desired product (0.75 g, 1.91 mmol, 61.01% yield) as a yellow solid.


Preparation of 2-iodo-3-methyl-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-iodo-3-methyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.05 g, 141.20 μmol, 1 eq.) and 1-methylpiperidin-4-one (39.94 mg, 353 μmol, 41.05 μL, 2.5 eq.) in EtOH (5 mL) was added Ti(OEt)4 (96.63 mg, 423.60 μmol, 87.84 μL, 3 eq.) under N2 at 50° C. The mixture was stirred for 16 h. NaBH3CN (26.62 mg, 423.60 μmol, 3 eq.) was added into the mixture, and the mixture was stirred further at 50° C. for 3 h under N2. The mixture was poured into a saturated NaHCO3 solution (15 mL) and extracted with EtOAc (25 mL×3). The combined organic layers were filtered through silica, and the filtrate was concentrated. The crude residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1) to afford the desired product (0.038 g, 75.79 μmol, 53.67% yield) as a brown oil.


Preparation of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-3-methyl-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A mixture of 2-iodo-3-methyl-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.038 g, 75.79 μmol, 1 eq.), 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (27.20 mg, 113.68 μmol, 1.5 eq.), i-Pr2NH (76.69 mg, 757.87 μmol, 107.11 μL, 10 eq.), CuI (14.43 mg, 75.79 μmol, 1 eq.), and Pd(PPh3)4 (17.52 mg, 15.16 μmol, 0.2 eq.) in DMSO (1.5 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 1 h under N2. TLC analysis (Rf=0.25, EtOAc:TEA=10:1) showed that the reaction was complete. A saturated EDTA solution (15 mL) was added to the mixture, and the resulting mixture was stirred for 1 h. The mixture was then extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (3 mL×5), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1, Rf=0.25) and prep-HPLC to afford the desired product (0.0205 g, 36.44 μmol, 48.08% yield) as a yellow solid. MS (ES+, m/z): 563.3.


Example D58
Synthesis of 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-3-methyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol (Compound 676A)



embedded image


Preparation of 1-(4-((2-iodo-3-methyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol: To a mixture of 2-iodo-3-methyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.05 g, 141.20 μmol, 1 eq.) and 1-(2-hydroxy-3-methoxypropyl)piperidin-4-one (66.09 mg, 353 μmol, 2.5 eq.) in EtOH (3 mL) was added Ti(OEt)4 (64.42 mg, 282.40 μmol, 58.56 μL, 2 eq.) under N2 at 50° C. The mixture was stirred for 16 h. NaBH3CN (26.62 mg, 423.60 μmol, 3 eq.) was added to the mixture, and the mixture was stirred at 50° C. for 3 h under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.3) showed that little starting material remained, and the desired product was detected. The mixture was poured into a saturated aqueous NaHCO3 (15 mL) solution and extracted with EtOAc (30 mL×3). The combined organic layers were filtered through silica, and the filtrate was concentrated. The crude residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1) to afford the desired product (0.041 g, 70.24 μmol, 49.74% yield) as a brown oil.


Preparation of 1-methoxy-3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-3-methyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol: A mixture of 1-(4-((2-iodo-3-methyl-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (0.041 g, 78.04 μmol, 1 eq.), 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (28.01 mg, 117.07 μmol, 1.5 eq.), i-Pr2NH (78.97 mg, 780.44 μmol, 110.30 μL, 10 eq.), CuI (14.86 mg, 78.04 μmol, 1 eq.), and Pd(PPh3)4 (18.04 mg, 15.61 μmol, 0.2 eq.) in DMSO (1 mL) was degassed and purged with N2 three times. The mixture was then stirred at 20° C. for 1 h under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.2) showed that the reaction was complete. Saturated aqueous EDTA solution (15 mL) was added to the mixture, and the resulting mixture was stirred for 1 h. The mixture was then extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (3 mL×5), dried over anhydrous sodium sulfate, filtered, and concentrated. The crude residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1, Rf=0.25) and prep-HPLC to afford the desired product (0.023 g, 35.69 μmol, 45.73% yield) as a yellow solid. MS (ES+, m/z): 637.2.


Example D59
Synthesis of Compounds 462A, 583A, 725A, 727A, and 728A



embedded image


To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzamide (27.89 mg, 129.72 1.5 eq.) in DMSO (1mL) were added i-Pr2NH (262.52 mg, 2.59 mmol, 364.61 μL, 30 eq.), CuI (32.94 mg, 172.95 μmol, 2 eq.), 2-iodo-N-[1-(1-methyl-4-piperidyl)-4-piperidyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (50 mg, 86.48 μmol, 1 eq.), and Pd(PPh3)4 (24.98 mg, 21.62 μmol, 0.25 eq.). The mixture was stirred at 20° C. for 1 h under N2. TLC or LC-MS analysis were used to detect completion of the reaction. The reaction mixture was poured into a saturated EDTA solution (20 mL) and the resulting mixture was stirred for 15 min at 20° C. The mixture was extracted with EtOAc (30 mL×3), and the combined organic layers were concentrated under reduced pressure to a volume of 30 mL. The organic solution was poured into a saturated EDTA solution (20 mL) and stirred for 1 h at 20° C. The mixture was extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine, dried over anhydrous sodium sulfate, mixed with active carbon, filtered, and concentrated under reduced pressure to give a residue. The crude residue as purified by prep-TLC and prep-HPLC to afford the desired product.


3-methoxy-4-((3-(4-((1,4′-methyl-[1,4′-bipiperidin]-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzamide (11 mg, 16.91 20% yield, FA)MS (ES+, m/z): 597.3; 3-methoxy-4-((3-(4-((1-(2-(4-methylpiperazin-1-yl)-2-oxoethyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzamide (6.90 mg, 8.95 μmol, 10% yield, FA)MS (ES+, m/z): 640.3; 3-methoxy-4-((3-(4-(piperidin-4-ylamino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzamide (29 mg, 53.16 μmol, 46% yield, FA)MS (ES+, m/z): 500.3; 4-({3-[4-({1-[(2R)-2,3-dihydroxypropyl]piperidin-4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-yl}amino)-3-methoxybenzamide (95.5 mg, 165.82 μmol, 56% yield) MS (ES+, m/z): 574.2.; 3-methoxy-4-[3-[4-[(1-tetrahydropyran-4-yl-4-piperidyl)amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]benzamide, (8.40 mg, 13.07 μmol, 15.79% yield, FA) MS (ES+, m/z): 584.3.


Example D60
Synthesis of Compounds 849A and 850A



embedded image


Preparation of tert-butyl 4-((2-(3-((4-carbamoyl-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: A mixture of tert-butyl 3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (100 mg, 184.73 μmol, 1 eq.), 3-methoxy-4-(prop-2-yn-1-ylamino)benzamide (56.59 mg, 277.10 μmol, 1.5 eq.), CuI (35.18 mg, 184.73 μmol, 1 eq.), Pd(PPh3)4 (35.18 mg, 184.73 μmol, 1 eq.) and i-Pr2NH (186.93 mg, 1.85 mmol, 261.08 μL, 10 eq.) in DMSO (25 mL) was degassed and purged with N2 three times. The mixture was stirred at 25° C. for 1 h under N2. TLC and LC-MS analysis showed that the reaction was complete. The reaction mixture was added to a saturated aqueous EDTA solution (30 mL) and stirred for 1 h. The mixture was then extracted with EtOAc (30 mL×3). The combined organic layers were separated, washed with water (30 mL×2) and brine (30 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=20:1) to afford the desired product (63.10% yield) as a light yellow solid. MS (ES+, m/z): 618.2.


A solution of tert-butyl 4-((2-(3-((4-carbamoyl-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (100 mg, 161.91 μmol, 1 eq.) in DCM (2mL) and TFA (2mL) was stirred at 25° C. for 1 h. TLC and LC-MS analysis showed that the reaction was complete. The reaction mixture was poured onto ice water (20 mL), and a saturated aqueous Na2CO3 solution was slowly added to the mixture to adjust the pH to 8˜9. The mixture was then extracted with DCM (30 mL×3). The combined organic layers were separated, washed with water (30 mL×2) and brine (30 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford the desired products as light yellow solids.


4-{[3-(4-{[(3S,4R)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide (28.9 mg, 53.61 μmol, 33% yield), MS (ES+, m/z): 518.2; and 4-{[3-(4-{[(3R,4S)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide (39.9 mg, 77.10 μmol, 60% yield), MS (ES+, m/z): 518.2.


Example D61
Synthesis of Compounds 733A and 736A



embedded image


Preparation of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidine-1-carboxylate: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (0.5 g, 1.47 mmol, 1 eq.) and tert-butyl 3-methyl-4-oxo-piperidine-1-carboxylate (940.68 mg, 4.41 mmol, 3 eq.) in DMF (5 mL) was added TMSCl (399.32 mg, 3.68 mmol, 466.50 μL, 2.5 eq.) at 0° C. The mixture was stirred at 0° C. for 2 h, then BH3.THF (1 M, 7.35 mL, 5 eq.) was added to the solution under N2 at 0° C. The resulting mixture was stirred further at 25° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was poured into a saturated aqueous Na2CO3 solution (8 mL) at 0° C. and extracted with EtOAc (10 mL×3). The organic phase was washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=1:0 to 10:1) and prep-HPLC to afford the desired product (0.365 g, 665.67 μmol, 45.28% yield) as a yellow solid.


Preparation of 2-iodo-N-(3-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidine-1-carboxylate (0.1 g, 182.37 μmol, 1 eq.) in DCM (3 mL) was added TFA (1.51 g, 13.24 mmol, 980 μL, 72.58 eq.). The mixture was stirred at 25° C. for 0.5 h. TLC analysis showed that the reaction was complete. A saturated aqueous Na2CO3 solution was added to the mixture to adjust the pH of the mixture to 9. The mixture was then extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (0.08 g) was obtained as a yellow solid and used without purification.


Preparation of N-(1,3-dimethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-iodo-N-(3-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.08 g, 182.97 μmol, 1 eq.) and formaldehyde (54.94 mg, 1.83 mmol, 50.40 μL, 10 eq.) in MeOH (3 mL) was added into AcOH (10.99 ug, 1.83e-1 μmol, 1.05e-2 μL, 0.001 eq.) and stirred at 50° C. for 1 h. Then, NaBH3CN (57.49 mg, 914.83 μmol, 5 eq.) was added, and the mixture was stirred further at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was poured into water (10 mL) and extracted with EtOAc (10 mL×3). The organic layer was washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (0.07 g, 155.12 μmol, 85% yield) as a yellow solid.


Preparation of N-(1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (44.54 mg, 186.14 μmol, 1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (156.96 mg, 1.55 mmol, 219.22 μL, 10 eq.), CuI (29.54 mg, 155.12 mol, 1 eq.), N-(1,3-dimethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.07 g, 155.12 μmol, 1 eq.), and Pd(PPh3)4 (71.70 mg, 62.05 μmol, 0.4 eq.). The mixture was stirred at 25° C. for 1 h under N2. LC-MS or TLC analysis showed that the reaction was complete. The mixture was poured into a saturated aqueous EDTA solution (15 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by pre-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired products.


N-((3S,4S)-1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 16.6 mg, 14.6% yield, MS (ES+, m/z): 563.2; and N-((3R,4S)-1,3-dimethylpiperidin-4-yl)-2-(3-42-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 17.6 mg, 20.1% yield, MS (ES+, m/z): 563.2.


Example D62
Synthesis of Compounds 701A and 702A



embedded image


Preparation of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidine-1-carboxylate: To a mixture of 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (0.1 g, 294.05 μmol, 1 eq.) and tert-butyl 3-methyl-4-oxo-piperidine-1-carboxylate (940.68 mg, 4.41 mmol, 3 eq.) in EtOH (5 mL) was added Ti(OEt)4 (1.68 g, 7.35 mmol, 1.52 mL, 5 eq.). The mixture was stirred at 50° C. for 12 h, and NaBH3CN (461.96 mg, 7.35 mmol, 5 eq.) was added to the reaction. The mixture was stirred further at 50° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was poured into a saturated aqueous Na2CO3 solution (8 mL) at 0° C., then extracted with EtOAc (10 mL×3). The organic layer was washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:0 to 10:1) and prep-HPLC to afford the desired product (0.262 g, 438.82 μmol, 29.85% yield) as a light yellow solid.


Preparation of 2-iodo-N-(3-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidine-1-carboxylate (0.15 g, 273.56 μmol, 1 eq.) in DCM (3 mL) was added TFA (1.51 g, 13.24 mmol, 980 μL, 48.38 eq.). The mixture was stirred at 25° C. for 0.5 h. TLC analysis showed that the reaction was complete. A saturated aqueous Na2CO3 solution was added to the reaction mixture to adjust the pH of the mixture to 9. The mixture was then extracted with EtOAc (20 mL×3), washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (0.1 g) was obtained as a yellow solid and used without purification. MS (ES+, m/z): 438.1.


Preparation of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidin-1-yl)-3-methoxypropan-2-ol: To a solution of 2-iodo-N-(3-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4- (0.1 g, 224.13 μmol, 1 eq.) in EtOH (3 mL) was added 2-(methoxymethyl)oxirane (29.62 mg, 336.20 μmol, 29.92 μL, 1.5 eq.). The reaction mixture was stirred at 90° C. for 2 h. TLC analysis showed that the reaction was complete. The reaction mixture was concentrated under reduced pressure and purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (0.08 g, 152.28 μmol, 68% yield) as a yellow oil.


Preparation of 1-methoxy-3-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidin-1-yl)propan-2-ol: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline 2(43.73 mg, 182.74 μmol, 1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (154.09 mg, 1.52 mmol, 215.21 μL, 10 eq.), CuI (29 mg, 152.28 μmol, 1 eq.), 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidin-1-yl)-3-methoxypropan-2-ol (0.08 g, 152.28 μmol, 1 eq.), and Pd(PPh3)4 (70.39 mg, 60.91 μmol, 0.4 eq.). The mixture was stirred at 25° C. for 1 h under N2. LC-MS or TLC analysis showed that the reaction was complete. The mixture was poured into a saturated aqueous EDTA solution (15 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired products


rac-1-[(3R,4R)-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-3-methylpiperidin-1-yl]-3-methoxypropan-2-ol, 6 mg, 18.5% yield, MS (ES+, m/z): 637.3; and rac-1-[(3R,4S)-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-3-methylpiperidin-1-yl]-3-methoxypropan-2-ol, 20 mg, 48.9% yield, MS (ES+, m/z): 637.3.


Example D63
Synthesis of Compounds 675A, 682A, 686A, and 687A



embedded image


To a solution of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 187.06 μmol, 1 eq.) in DMF (3 mL) were added K2CO3 (51.71 mg, 374.12 μmol, 2 eq.) and 4-bromobutanenitrile (83.05 mg, 561.18 μmol, 40.08 μL, 3 eq.). The mixture was stirred at 50° C. for 2 h. LC-MS or TLC analysis indicated that the reaction was complete. The reaction mixture was quenched by adding water (40 mL) to the reaction mixture at 25° C. and extracting the mixture with EtOAc (10 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.43) and prep-HPLC to afford the desired products a light yellow solids.


2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[1-(3-methoxypropyl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 15.3 mg, 26.8% yield, MS (ES+, m/z): 607.2; 3-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propanenitrile, 20.4 mg, 17.0% yield, MS (ES+, m/z): 588.2; 4-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)butanenitrile, 24.6 mg, 21.4% yield, MS (ES+, m/z): 602.2; and 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(1-((tetrahydrofuran-2-yl)methyl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 24.0 mg, 20.4% yield, MS (ES+, m/z): 619.2.


Example D64
Synthesis of Compounds 678A and 679A



embedded image


To a mixture of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 187.06 μmol, 1 eq.) and oxetan-3-one (40.44 mg, 561.18 μmol, 3 eq.) or dihydrofuran-3(2H)-one (48.31 mg, 561.18 μmol, 3 eq.) in THF (3 mL) was added MgSO4 (112.58 mg, 935.29 μmol, 5 eq.). The reaction mixture was stirred at 40° C. for 2 h, then NaBH(OAc)3 (198.23 mg, 935.29 μmol, 5 eq.) was added, and the reaction mixture was stirred further for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.43) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous NaHCO3 solution (40 mL) at 25° C. and extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.43) and prep-HPLC to afford the desired products as light yellow solids.


2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[1-(oxetan-3-yl)piperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 13.2 mg, 11.4% yield, MS (ES+, m/z): 591.2; and 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(1-(tetrahydrofuran-3-yl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 20.5 mg, 18.0% yield, MS (ES+, m/z): 605.3.


Example D65
Synthesis of 4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-N,N-dimethylpiperidine-1-carboxamide (Compound 754A)



embedded image


To a solution of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 187.06 μmol, 1 eq.) in DCM (3 mL) were added TEA (37.86 mg, 374.12 μmol, 52.07 μL, 2 eq.) and dimethylcarbamic chloride (40.23 mg, 374.12 μmol, 34.39 μL, 2 eq.). The mixture was stirred at 25° C. for 1 h. LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched by adding water (40 mL) at 25° C. and extracting the mixture with EtOAc (30 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to afford the desired product (23.0 mg, 37.97 μmol, 20.30% yield) as a light yellow solid. MS (ES+, m/z): 606.2.


Example D66
Synthesis of 2-(4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzenesulfonyl)ethan-1-ol (Compound 939A)



embedded image


To a solution 2-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)ethan-1-ol (52.06 mg, 193.31 μmol, 1.1 eq.) in DMSO (1 mL) were added i-Pr2NH (266.74 mg, 2.64 mmol, 372.54 μL, 15 eq.), CuI (3.35 mg, 17.57 μmol, 0.1 eq.), N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.08 g, 175.73 μmol, 1 eq.), and Pd(PPh3)4 (3.05 mg, 2.64 μmol, 0.015 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis (DCM:MeOH=10:1, Rf=0.4) indicated that 10% of the starting material remained, and one major new spot with polarity greater than that of the starting material was detected. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (120 mL) and stirred for 1 h. The mixture was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1 and reversed-phase HPLC to afford the desired product (28.5 mg, 47.29 μmol, 26.91% yield) as a yellow solid. MS (ES+, m/z): 597.2.


1H NMR (400 MHz, DMSO-d6) δ ppm 1.64-1.75 (m, 1H) 1.84-2.00 (m, 1H) 2.11-2.26 (m, 5H) 2.30-2.37 (m, 1H) 2.78-2.86 (m, 1H) 3.01-3.09 (m, 1H) 3.28-3.35 (m, 2H) 3.61-3.65 (m, 2H) 3.81-3.93 (m, 3H) 4.28-4.41 (m, 2H) 4.68-4.79 (m, 1H) 4.82-4.95 (m, 2H) 6.15-6.31 (m, 1H) 6.72 (d, J=8.07 Hz, 1H) 6.88 (d, J=8.44 Hz, 1H) 6.95-7.07 (m, 1H) 7.12-7.23 (m, 2H) 7.27-7.38 (m, 1H) 8.14-8.26 (m, 1H).


Example D67
Synthesis of Compounds 847A and 848A



embedded image


Preparation of tert-butyl 4-[[2-[3-(N-tert-butoxycarbonyl-2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-3-fluoro-piperidine-1-carboxylate: To a solution of tert-butyl N-[3-[4-amino-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]-N-(2-methoxy-4-methylsulfonyl-phenyl)carbamate (20 g, 36.26 mmol, 1 eq.) in AcOH (160 mL) and DCE (80 mL) was added tert-butyl 3-fluoro-4-oxo-piperidine-1-carboxylate (23.63 g, 108.78 mmol, 3 eq.) at 50° C. The mixture was stirred at 50° C. for 10 min, and NaBH(OAc)3 (7.68 g, 36.26 mmol, 1 eq.) was added into the mixture. After 15 min of stirring, a second batch of NaBH(OAc)3 (3.84 g, 18.13 mmol, 0.5 eq.) was added to the reaction, and three additional batches were added in 15 min intervals (1.92 g, 9.06 mmol, 0.25 eq.; 3.84 g, 18.13 mmol, 0.5 eq.; and 960.61 mg, 4.53 mmol, 0.125 eq.). The mixture was stirred at 50° C. for 25 min. TLC analysis indicated that 3% of the starting material was remained, and one major new spot with polarity lower than that of the starting material was detected. The reaction mixture was quenched by adding water (2000 mL) and diluting the mixture with NaOH (120 g) in water (500 mL) to adjust the pH of the solution to pH>10. The resulting mixture was extracted with EtOAc (500 mL×3). The combined organic layers were washed with brine (500 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=5:1 to EtOAc: DCM=2:1). The product was triturated with PE:EtOAc=120 mL:40 mL at 25° C. for 12 h. The residue was then purified by reversed-phase HPLC to give compound tert-butyl 4-[[2-[3-(N-tert-butoxycarbonyl-2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-3-fluoro-piperidine-1-carboxylate (35 g, 45.98 mmol, 63% yield) as a yellow solid.


Preparation of tert-butyl (3S,4R)-4-[[2-[3-(N-tert-butoxycarbonyl-2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-3-fluoro-piperidine-1-carboxylate: tert-butyl 4-[[2-[3-(N-tert-butoxycarbonyl-2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-3-fluoro-piperidine-1-carboxylate (35 g, 46.49 mmol, 1 eq.) was further separated by SFC to afford the desired compounds. Tert-butyl (3S,4R)-4-[[2-[3-(N-tert-butoxycarbonyl-2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-3-fluoro-piperidine-1-carboxylate (16 g, 21.10 mmol, 45% yield) was obtained as a red solid. Tert-butyl (3R,4S)-4-[[2-[3-(N-tert-butoxycarbonyl-2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-3-fluoro-piperidine-1-carboxylate (16 g, 20.36 mmol, 44% yield) was obtained as a yellow solid.


Preparation of N-[(3S,4R)-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine: A mixture of tert-butyl (3S,4R)-4-[[2-[3-(N-tert-butoxycarbonyl-2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-3-fluoro-piperidine-1-carboxylate (15 g, 19.93 mmol, 1 eq.), 4M HCl/EtOAc (373.60 mL, 75 eq.) in EtOAc (75 mL) was stirred at 20° C. for 1 h. under N2. TLC analysis indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was filtered to give a solid and dried under reduced pressure. The crude product was triturated with EtOH (150 mL) at 20° C. for 12 h. N-[(3S,4R)-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine was obtained as a yellow solid (10.4 g, 16.29 mmol, 82% yield, 2HCl). MS (ES+, m/z): 553.2.


Example D68
Synthesis of Compounds 834A and 835A



embedded image


To a solution of N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (200 mg, 347.33 μmol, 1 eq.) in DCM (2 mL) was added BBr3 (304.55 mg, 1.22 mmol, 117.13 μL, 3.5 eq.; dropwise addition) at 0° C. The mixture was stirred at 0° C. for 2 h. TLC analysis (DCM:MeOH:TEA=100:5:2, Rf=0.4) showed that some of the starting material remained, and one major new spot with polarity greater than that of the starting material was detected. An additional portion of BBr3 (304.55 mg, 1.22 mmol, 117.13 μL, 3.5 eq.) was added to the reaction, and the mixture was stirred at 0° C. for 2 h. TLC analysis indicated that 30% of the starting material remained. A third portion of BBr3 (304.55 mg, 1.22 mmol, 117.13 μL, 3.5 eq.) was added, and the reaction mixture was stirred further at 0° C. for 6 h. TLC analysis indicated that the starting material was consumed completely. A saturated NaHCO3 solution was added into the mixture to adjust the pH of the solution to 8. The mixture extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH:TEA=100:5:2) and SFC to afford 2-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-5-methanesulfonylphenol (40 mg, 70.65 μmol, 20.34% yield) and 2-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-5-methanesulfonylphenol (40 mg, 71.30 μmol, 20.53% yield) as yellow solids.


2-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-5-methanesulfonylphenol, MS (ES+, m/z): 553.2; and 2-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-5-methanesulfonylphenol, MS (ES+, m/z): 553.2.


Example D69
Synthesis of Compounds 800A and 801A



embedded image


embedded image


Preparation of 4-((3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzamide: A mixture of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine hydrochloride (1 g, 2.94 mmol, 1 eq.), 3-methoxy-4-(prop-2-yn-1-ylamino)benzamide (720.62 mg, 3.53 mmol, 1.2 eq.), CuI (672.01 mg, 3.53 mmol, 1.2 eq.), Pd(PPh3)4 (679.58 mg, 588.09 μmol, 0.2 eq.), and i-Pr2NH (2.98 g, 29.40 mmol, 4.16 mL, 10 eq.) in DMSO (10 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 1 h under N2. TLC analysis (PE:EtOAc=5:1, Rf=0) showed one major new spot. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (100 mL) and stirring the mixture for 1 h. The mixture was extracted with EtOAc (60 mL×4). The combined organic layers were washed with brine (20 mL×2), filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:1 to 0:1) to afford the desired product (1 g, 2.16 mmol, 73.51% yield) as a yellow solid.


Preparation of tert-butyl (3R,4S)-4-((2-(3-((4-carbamoyl-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: To a mixture of 4-((3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzamide (0.8 g, 1.92 mmol, 1 eq.), tert-butyl 3-fluoro-4-oxopiperidine-1-carboxylate (2.09 g, 9.61 mmol, 5 eq.), TMSCl (532.46 mg, 4.80 mmol, 622.03 μL, 98% purity, 2.5 eq.) in DMF (10 mL) was added BH3.THF (1 M, 5.76 mL, 3 eq.). The mixture was stirred at 0° C. for 1 h under N2. TLC analysis (PE:EtOAc=0:1, Rf=0.3) indicated that the starting material remained, and one major new spot was detected. The reaction mixture was quenched by adding water (100 mL) and a saturated Na2CO3 solution (20 mL). The mixture was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (20 mL×4), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 0:1) and prep-HPLC to afford the desired product (0.58 g) as a yellow solid.


Preparation of 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzamide: A solution of tert-butyl (3R,4S)-4-((2-(3-((4-carbamoyl-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (0.58 g, 939.07 μmol, 1 eq.) in HCl/EtOAc (20 mL) was stirred at 20° C. for 1 h under N2. TLC analysis (DCM:MeOH=10:1, Rf=0.10) indicated that one major new spot had formed. The reaction mixture was quenched by adding water (15 mL) and a saturated aqueous Na2CO3 solution (15 mL). The mixture was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (20 mL×2), filtered, and concentrated under reduced pressure. The crude product (0.4 g, crude) was obtained as a yellow solid and used without purification.


Preparation of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide and 4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide: To a mixture of 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzamide (0.3 g, 579.69 μmol, 1 eq.), and (CH2O)n (174.08 mg, 5.80 mmol, 10 eq.) in MeOH (3 mL) was added AcOH (34.81 mg, 579.69 μmol, 1 eq.). The reaction mixture was stirred at 20° C. for 10 h, NaBH3CN (109.28 mg, 1.74 mmol, 3 eq) was added, and the mixture was stirred further at 20° C. for 2 h under N2. TLC analysis (DCM:MeOH=10:1, Rf=0.35) indicated that the starting material remained, and one major new spot was detected. The reaction mixture was quenched by adding a saturated Na2CO3 solution (50 mL) and extracted with EtOAc (40 mL×4). The combined organic layers were washed with brine (20 mL×2), filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and SFC to afford the desired products as yellow solids.


4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide (0.066g, 122.55 μmol, 50.11% yield), MS (ES+, m/z): 532.2; and 4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide (0.063 g, 116.39 μmol, 47.59% yield), MS (ES+, m/z): 532.2.


Example D70
Synthesis of Compounds 814A and 815A



embedded image


To a mixture of 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.1 g, 187.78 μmol, 1 eq.), N-methylmethanamine hydrochloride (30.63 mg, 375.57 μmol, 2 eq.) or 2-methoxyethanamine (28.21 mg, 375.57 μmol, 32.65 μL, 2 eq.), TEA (114.01 mg, 1.13 mmol, 156.82 μL, 6 eq.) in DMF (5 mL) was added and T3P® (239 mg, 375.57 μmol, 223.36 μL, 50% purity, 2 eq.). The mixture was stirred at 20° C. for 3 h under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.37) indicated that one major new spot had formed. The reaction mixture was quenched by adding water (20 mL) and extracted with EtOAc (25 mL×4). The combined organic layers were washed with brine (10 mL×3), filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1) and prep-HPLC to afford the desired products as yellow solids.


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(2-methoxyethyl)benzamide (0.04 g, 71.12 μmol, 37.87% yield), MS (ES+, m/z): 590.4; rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N,N-dimethylbenzamide (0.04 g, 67.37 μmol, 35.87% yield), MS (ES+, m/z): 560.3.


Example D71
Synthesis of Compounds 697A and 698A



embedded image


Preparation of 2-iodo-1-propyl-1H-indol-4-amine and 1-(2-fluoroethyl)-2-iodo-1H-indol-4-amine: To a solution of 2-iodo-1H-indol-4-amine (80 mg, 310.01 μmol, 1 eq.) in DMF (3 mL) was added NaH (37.20 mg, 930.02 μmol, 60% in mineral oil, 3 eq.) at 0° C. The mixture was stirred at 0° C. for 30 min. Then, 1-bromopropane (142.98 mg, 1.16 mmol, 105.91 μL, 1.5 eq.) or 1-bromo-2-fluoroethane (59.04 mg, 465.01 μmol, 1.5 eq.) was added, and the mixture was stirred at 25° C. for 30 min. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous NH4Cl solution (50 mL) at 0° C. and extracted with EtOAc (50 mL×2). The organic layer was washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was (SiO2, PE:EtOAc=4:1) to afford the desired products.


2-iodo-1-propyl-indol-4-amine (0.17 g, 566.41 μmol, 73% yield) was obtained as a black brown oil. 1-(2-fluoroethyl)-2-iodo-indol-4-amine (70 mg, 230.19 μmol, 74% yield) was obtained as a yellow solid.


Preparation of 1-(4-((2-iodo-1-propyl-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol and 1-(4-((1-(2-fluoroethyl)-2-iodo-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol: To a solution of 2-iodo-1-propyl-1H-indol-4-amine (0.15 g, 499.77 μmol, 1 eq.) and 1-(2-fluoroethyl)-2-iodo-1H-indol-4-amine (60 mg, 197.30 μmol, 1 eq.) in EtOH (3 mL) were added 1-(2-hydroxy-3-methoxypropyl)piperidin-4-one (147.77 mg, 789.21 μmol, 4 eq.) and tetraethoxytitanium (90.01 mg, 394.60 μmol, 81.83 μL, 2 eq.). The mixture was stirred at 50° C. for 1 h, and NaBH3CN (24.80 mg, 394.60 μmol, 2 eq.) was added. The resulting mixture was stirred further at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous NaHCO3 solution (100 mL) and extracting the mixture with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product.


1-[4-[(2-iodo-1-propyl-indol-4-yl)amino]-1-piperidyl]-3-methoxy-propan-2-ol (0.18 g, 381.86 μmol, 76% yield) was obtained as a yellow oil. 1-[4-[[1-(2-fluoroethyl)-2-iodo-indol-4-yl]amino]-1-piperidyl]-3-methoxy-propan-2-ol (70 mg, 147.26 μmol, 75% yield) was obtained as a yellow oil.


Preparation of 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-propyl-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol and 1-(4-{[1-(2-fluoroethyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1H-indol-4-yl)]amino}piperidin-1-yl)-3-methoxypropan-2-ol: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (38.07 mg, 159.11 μmol, 1.5 eq.) in DMSO (3 mL) were added i-Pr2NH (107.34 mg, 1.06 mmol, 149.91 μL, 10 eq.), CuI (4.04 mg, 21.21 μmol, 0.2 eq.), 1-(4-((2-iodo-1-propyl-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (50 mg, 106.07 μmol, 1 eq.) or 1-(4-((1-(2-fluoroethyl)-2-iodo-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (50 mg, 105.19 μmol, 1 eq.), and Pd(PPh3)4 (12.16 mg, 10.52 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated EDTA solution (50 mL) and EtOAc (25 mL) at 25° C. The aqueous layer was filtered and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired product as a white solid.


1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-propyl-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol, 18.1 mg, 29.3% yield, MS (ES+, m/z): 583.3; and 1-(4-{[1-(2-fluoroethyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol, 21.5 mg, 34.8% yield, MS (ES+, m/z): 587.2.


Example D72
Synthesis of 1-(4-{[1-(2-chloroethyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol (Compound 700A)



embedded image


Preparation of 1-(2-chloroethyl)-2-iodo-1H-indol-4-amine: To a solution of 2-iodo-1H-indol-4-amine (0.2 g, 775.02 μmol, 1 eq.) in DCE (4 mL) were added KOH (130.45 mg, 2.33 mmol, 3 eq.) and TBAI (57.25 mg, 155 0.2 eq.). The mixture was stirred at 25° C. for 2 h. TLC analysis showed that the reaction was complete. The reaction mixture was diluted with water (100 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=4:1) to afford the desired product (0.2 g, 623.92 μmol, 80.50% yield) as a brown solid.


Preparation of 1-(4-((1-(2-chloroethyl)-2-iodo-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol: To a solution of 1-(2-chloroethyl)-2-iodo-1H-indol-4-amine (0.18 g, 561.52 μmol, 1 eq.) in EtOH (4 mL) were added 1-(2-hydroxy-3-methoxypropyl)piperidin-4-one (420.55 mg, 2.25 mmol, 4 eq.) and tetraethoxytitanium (256.18 mg, 1.12 mmol, 232.89 μL, 2 eq.). The mixture was stirred at 50° C. for 1 h, then NaBH3CN (70.57 mg, 1.12 mmol, 2 eq.) was added. The resulting mixture was stirred at 50° C. for 3 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous NaHCO3 solution (100 mL) and EtOAc (50 mL). The organic layer was filtered under reduced pressure to give liquid phase, which was extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (0.22 g, 447.34 μmol, 79.67% yield) as a yellow oil.


Preparation of 1-(4-{[1-(2-chloroethyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (36.49 mg, 152.50 1.5 eq.) in DMSO (3 mL) were added i-Pr2NH (102.88 mg, 1.02 mmol, 143.69 μL, 10 eq.), CuI (3.87 mg, 20.33 μmol, 0.2 eq.), 1-(4-((1-(2-chloroethyl)-2-iodo-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (50 mg, 101.67 μmol, 1 eq.), and Pd(PPh3)4 (11.75 mg, 10.17 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was stirred by adding a saturated aqueous EDTA solution (50 mL) and EtOAc (25 mL) at 25° C. The aqueous layer was filtered and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired product (16.1 mg, 26.69 μmol, 26.25% yield) as a white solid. MS (ES+, m/z): 603.2.


Example D73
Synthesis of 1-(4-{[1-(2,2-difluoroethyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol (Compound 709A)



embedded image


Preparation of 1-(2,2-difluoroethyl)-2-iodo-4-nitro-1H-indole: To a solution of 2-iodo-4-nitro-1H-indole (0.5 g, 1.74 mmol, 1 eq.) in acetone (5 mL) were added 1,1-difluoro-2-iodo-ethane (3.33 g, 17.36 mmol, 9.64 μL, 10 eq.) and K2CO3 (719.74 mg, 5.21 mmol, 3 eq.). The mixture was stirred at 80° C. for 16 h. TLC analysis showed that the reaction was complete. The reaction mixture was diluted with water (100 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was washed by PE to afford the desired product (0.52 g, 1.48 mmol, 85.08% yield) as a yellow solid.


Preparation of 1-(2,2-difluoroethyl)-2-iodo-1H-indol-4-amine: To a solution of 1-(2,2-difluoroethyl)-2-iodo-4-nitro-1H-indole (0.45 g, 1.28 mmol, 1 eq.) in EtOH (4 mL) were added a saturated aqueous solution of NH4Cl (68.37 mg, 1.28 mmol, 1 mL) and Fe (214.13 mg, 3.83 mmol, 3 eq.). The mixture was stirred at 60° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was filtered and extracted with EtOAc (50 mL×2). The organic layer was washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=4:1) to afford the desired product (0.38 g, 1.18 mmol, 92.31% yield) as a yellow solid.


Preparation of 1-(4-((1-(2,2-difluoroethyl)-2-iodo-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol: To a solution of 1-(2,2-difluoroethyl)-2-iodo-1H-indol-4-amine (0.15 g, 465.71 μmol, 1 eq.) in EtOH (4 mL) were added 1-(2-hydroxy-3-methoxypropyl)piperidin-4-one (348.79 mg, 1.86 mmol, 4 eq.) and tetraethoxytitanium (212.46 mg, 931.41 μmol, 193.15 μL, 2 eq.). The mixture was stirred at 50° C. for 1 h, and NaBH3CN (58.53 mg, 931.41 μmol, 2 eq.) was added to the reaction. The resulting mixture was stirred at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous NaHCO3 solution (100 mL) and EtOAc (50 mL). The mixture was filtered under reduced pressure and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to give the desired product (0.18 g, 364.87 μmol, 78.35% yield) as a yellow oil.


Preparation of 1-(4-{[1-(2,2-difluoroethyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (36.38 mg, 152.03 μmol, 1.5 eq.) in DMSO (3 mL) were added i-Pr2NH (102.56 mg, 1.01 mmol, 143.24 μL, 10 eq.), CuI (3.86 mg, 20.27 μmol, 0.2 eq.), 1-(4-((1-(2,2-difluoroethyl)-2-iodo-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (50 mg, 101.35 μmol, 1 eq.), and Pd(PPh3)4 (11.71 mg, 10.14 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (50 mL) and EtOAc (25 mL) at 25° C. The mixture was filtered and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to give the desired product (23.6 mg, 38.13 μmol, 37.62% yield) as a white solid. MS (ES+, m/z): 605.2.


Example D74
Synthesis of 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(3,3,3-trifluoropropyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol (Compound 711A)



embedded image


Preparation of 2-iodo-4-nitro-1-(3,3,3-trifluoropropyl)-1H-indole: To a solution of 2-iodo-4-nitro-1H-indole (0.5 g, 1.74 mmol, 1 eq.) in DMF (5 mL) was added 1,1,1-trifluoro-3-iodopropane (3.11 g, 13.89 mmol, 1.63 mL, 8 eq.). Then, K2CO3 (719.74 mg, 5.21 mmol, 3 eq.) was added, and the mixture was stirred at 80° C. for 5 h. TLC analysis showed that 60% of the starting material remained, and 30% of the desired product was detected. The reaction mixture was diluted with water (150 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=4:1) to afford the desired product (0.15 g, 390.53 μmol, 22.50% yield) as a white solid.


Preparation of 2-iodo-1-(3,3,3-trifluoropropyl)-1H-indol-4-amine: To a solution of 2-iodo-4-nitro-1-(3,3,3-trifluoropropyl)-1H-indole (0.12 g, 312.42 μmol, 1 eq.) in EtOH (2 mL) were added aqueous NH4Cl (4.18 mg in 0.5 mL of water, 78.11 μmop and Fe (52.35 mg, 937.27 μmol, 3 eq.). The mixture was stirred at 60° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was filtered and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (0.12 g, crude) was obtained as a white solid and used without purification.


Preparation of 1-(4-((2-iodo-1-(3,3,3-trifluoropropyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol: To a solution of 2-iodo-1-(3,3,3-trifluoropropyl)-1H-indol-4-amine (0.1 g, 282.40 μmol, 1 eq.) in EtOH (2 mL) were added 1-(2-hydroxy-3-methoxy-propyl)piperidin-4-one (211.50 mg, 1.13 mmol, 4 eq.) and tetraethoxytitanium (128.83 mg, 564.80 μmol, 117.12 μL, 2 eq.). The mixture was stirred at 50° C. for 1 h, and NaBH3CN (35.49 mg, 564.80 μmol, 2 eq.) was added. The mixture was stirred at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous NaHCO3 solution (100 mL) and EtOAc (50 mL). The mixture was filtered under reduced pressure to give liquid phase and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (0.11 g, 209.39 μmol, 74.15% yield) as a yellow oil.


Preparation of 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(3,3,3-trifluoropropyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (34.16 mg, 142.76 μmol, 1.5 eq.) in DMSO (3 mL) were added i-Pr2NH (96.31 mg, 951.76 μmol, 134.51 μL, 10 eq.), CuI (3.63 mg, 19.04 μmol, 0.2 eq.), 1-(4-((2-iodo-1-(3,3,3-trifluoropropyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (50 mg, 95.18 μmol, 1 eq.), and Pd(PPh3)4 (11 mg, 9.52 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was stirred by adding a saturated aqueous EDTA solution (50 mL) and EtOAc (25 mL) at 25° C. The mixture was filtered and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired product (19.9 mg, 31.25 μmol, 32.84% yield) as a white solid. MS (ES+, m/z): 637.3.


Example D75
Synthesis of 1-(4-{[1-(2,2-difluoropropyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol (Compound 712A)



embedded image


Preparation of 2,2-difluoropropyl trifluoromethanesulfonate: To a solution of 2,2-difluoropropan-1-ol (0.5 g, 5.20 mmol, 1 eq.) in DCM (5 mL) were added TEA (1.05 g, 10.41 mmol, 1.45 mL, 2 eq.) and trifluoromethylsulfonyl trifluoromethanesulfonate (1.91 g, 6.77 mmol, 1.12 mL, 1.3 eq.) dropwise at −20° C. The mixture was stirred at −20° C.˜0° C. for 12 h. The reaction mixture was diluted by adding DCM (20 mL), and the resulting mixture was poured into ice water (100 mL) and extracted with DCM (25 mL×2). The combined organic layers were washed with 20% aqueous Na2CO3 (100 mL×2), water (100 mL×2), and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (0.6 g, crude) was obtained as a black brown oil and used in the next step without purification.


Preparation of 1-(2,2-difluoropropyl)-2-iodo-4-nitro-1H-indole: To a solution of 2-iodo-4-nitro-1H-indole (0.2 g, 694.34 μmol, 1 eq.) in DMF (3 mL) were added 2,2-difluoropropyl trifluoromethanesulfonate (396.02 mg, 1.74 mmol, 2.5 eq.) and K2CO3 (287.89 mg, 2.08 mmol, 3 eq.). The mixture was stirred at 80° C. for 2 h. TLC analysis showed that the reaction was complete. The reaction mixture was diluted with water (100 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=4:1) to afford the desired product (0.2 g, 546.30 μmol, 78.68% yield) as a yellow solid.


Preparation of 1-(2,2-difluoropropyl)-2-iodo-1H-indol-4-amine: To a solution of 1-(2,2-difluoropropyl)-2-iodo-4-nitro-1H-indole (0.18 g, 491.67 μmol, 1 eq.) in EtOH (4 mL) were added aqueous NH4Cl (68.37 mg in 1 mL of water, 1.28 mmol) and Fe (82.38 mg, 1.47 mmol, 3 eq.). The mixture was stirred at 60° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was filtered and extracted with EtOAc (50 mL×2) and washed with water (100 mL×2) and brine (100 mL×2). The organic layer was dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude product (0.18 g, crude) was obtained as a brown solid and used without purification. MS (ES+, m/z): 337.0.


Preparation of 1-(4-((1-(2,2-difluoropropyl)-2-iodo-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol: To a mixture of 1-(2,2-difluoropropyl)-2-iodo-1H-indol-4-amine (0.15 g, 357.02 μmol, 1 eq.) in EtOH (3 mL) were added 1-(2-hydroxy-3-methoxy-propyl)piperidin-4-one (267.38 mg, 1.43 mmol, 4 eq.) and tetraethoxytitanium (162.88 mg, 714.03 μmol, 148.07 μL, 2 eq.). The mixture was stirred at 50° C. for 1 h, and NaBH3CN (44.87 mg, 714.03 μmol, 2 eq.) was added. The resulting mixture was stirred at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous NaHCO3 solution (100 mL) and EtOAc (50 mL). The mixture was filtered and concentrated under reduced pressure. The solution was extracted with EtOAc (50 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (0.15 g, 295.65 μmol, 82.81% yield) as a brown oil. MS (ES+, m/z): 508.2.


Preparation of 1-(4-{[1-(2,2-difluoropropyl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1H-indol-4-yl]amino}piperidin-1-yl)-3-methoxypropan-2-ol: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (35.37 mg, 147.83 μmol, 1.5 eq.) in DMSO (3 mL) were added i-Pr2NH (99.72 mg, 985.50 μmol, 139.28 μL, 10 eq.), CuI (3.75 mg, 19.71 μmol, 0.2 eq.), 1-(4-((1-(2,2-difluoropropyl)-2-iodo-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (50 mg, 98.55 μmol, 1 eq.), and Pd(PPh3)4 (11.39 mg, 9.86 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (50 mL) and EtOAc (25 mL) at 25° C. The mixture was filtered and extracted with EtOAc (50 mL×2), washed with water (100 mL×2) and brine (100 mL×2). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to obtain the desired product (23.3 mg, 37.66 μmol, 38.21% yield) as a white solid. MS (ES+, m/z): 619.3.


Example D76
Synthesis of Compounds 466A, 467A, 991A, 1035A, and 1051A



embedded image


Preparation of 4-(methylsulfonyl)-1-nitro-2-(2,2,2-trifluoroethoxy)benzene: To a solution of 5-(methylsulfonyl)-2-nitrophenol (1.50 g, 6.91 mmol, 1 eq.) in DMF (10 mL) were added K2CO3 (2.87 g, 20.73 mmol, 3 eq.) and 2,2,2-trifluoroethyl trifluoromethanesulfonate (2.41 g, 10.37 mmol, 1.50 eq.). The mixture was stirred at 50° C. for 3 h. HPLC analysis showed that the reaction was complete. The residue was poured into water (50 mL), and the aqueous phase was extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford the desired product (1.70 g, crude) as a yellow solid.


Preparation of 4-(methylsulfonyl)-2-(2,2,2-trifluoroethoxy)aniline: To a solution of 4-(methylsulfonyl)-1-nitro-2-(2,2,2-trifluoroethoxy)benzene (1.70 g, 5.68 mmol, 1 eq.) in EtOH (20 mL) was added an aqueous NH4Cl solution (3.04 g in 2 mL of water, 56.81 mmol, 10 eq.). The mixture was heated to 70° C., and Fe (3.17 g, 56.81 mmol, 10 eq.) was added to the mixture. The resulting reaction mixture was stirred further at 70° C. for 2 h. LC-MS and HPLC analysis showed that the starting material remained. An additional portion of Fe (3.17 g, 56.81 mmol, 10 eq.) was added to the reaction, and the mixture was stirred further at 70° C. for 3 h. LC-MS analysis showed that the reaction was complete. The residue was poured into a saturated aqueous NaHCO3 solution (100 mL), and EtOAc was added (40 mL). The mixture was filtered through a pad of diatomite, and the aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford the desired product (1.30 g, crude) as a black brown oil. MS (ES+, m/z): 270.1.


Preparation of 4-(methylsulfonyl)-N-(prop-2-yn-1-yl)-2-(2,2,2-trifluoroethoxy)aniline: To a solution of 4-(methylsulfonyl)-2-(2,2,2-trifluoroethoxy)aniline (1.20 g, 4.46 mmol, 1 eq.) in DMF (15 mL) were added 3-bromoprop-1-yne (1.06 g, 8.92 mmol, 768.93 μL, 2 eq.) and K2CO3 (1.85 g, 13.38 mmol, 3 eq.). The mixture was heated to 70° C. and stirred for 12 h. TLC analysis showed that 60% of the starting material remained. An additional portion of 3-bromoprop-1-yne (1.06 g, 8.92 mmol, 768.93 μL, 2 eq.) was added to the reaction, and the mixture was stirred at 70° C. for 3 h. TLC analysis showed that 40% of the starting material remained. A third portion of 3-bromoprop-1-yne (1.06 g, 8.92 mmol, 768.93 μL, 2 eq.) was added to the reaction, and the mixture was stirred at 70° C. for 3 h. TLC analysis showed that 20% of the starting material remained. The residue was poured into water (50 mL), and the aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by silica gel chromatography (PE:EtOAc=10:1 to 5:1) to afford the desired product (800 mg, 2.21 mmol, 49.56% yield) as a yellow solid.




embedded image


Preparation of 4-(methylsulfonyl)-2-(trifluoromethoxy)aniline: To a mixture of 4-bromo-2-(trifluoromethoxy)aniline (0.5 g, 1.95 mmol, 295.86 μL, 1 eq.) and sodium methylsulfate (598.13 mg, 5.86 mmol, 3 eq.) in DMSO (8 mL) were added proline (112.42 mg, 976.49 μmol, 0.5 eq.) and CuI (148.78 mg, 781.19 μmol, 0.4 eq.). The reaction mixture was stirred at 100° C. for 16 h. LC-MS and TLC analysis (PE:EtOAc=1:1, Rf=0.4) indicated that 50% of the starting material remained, and one major new spot with polarity greater than that of the starting material was detected. The reaction mixture was poured into a saturated aqueous EDTA solution (50 mL) and stirred at 20° C. for 1 h. The mixture was then extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 1:1) to afford the desired product (0.13 g, 509.38 μmol, 26.08% yield) as a white solid. MS (ES+, m/z): 258.2.


Preparation of N,N-di(tert-butoxycarbonyl)-4-(methylsulfonyl)-2-(trifluoromethoxy)aniline: A mixture of 4-(methylsulfonyl)-2-(trifluoromethoxy)aniline (0.08 g, 313.46 μmol, 1 eq.) and di-tert-butyl dicarbonate (136.82 mg, 626.92 μmol, 144.03 μL, 2 eq.) in dioxane (2 mL) was added DMAP (38.30 mg, 313.46 μmol, 1 eq.). The mixture was stirred at 110° C. for 12 h. LC-MS analysis showed that the starting material was consumed completely, and two new main peaks with desired the desired mass was detected. The reaction mixture was poured into water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine 30 mL (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (PE:EtOAc=2:1, Rf2=0.4) to afford the desired product (0.12 g, 233.44 μmol, 93.09% yield) as a white solid.


Preparation of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)carbamate: A mixture of N,N-di(tert-butoxycarbonyl)-4-(methylsulfonyl)-2-(trifluoromethoxy)aniline (120 mg, 231.86 μmol, 4.68 eq.) and K2CO3 (34.23 mg, 247.66 μmol, 5 eq.) in MeOH (5 mL) was stirred at 20° C. for 2 h. TLC analysis (PE:EtOAc=2:1, Rf=0.4) indicated that the starting material was consumed completely, and one new spot for the desired product was detected. The reaction mixture was concentrated under reduced pressure to remove solvent. The residue was diluted with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give the crude product (0.075 g, crude) as a yellow solid.


Preparation of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)(prop-2-yn-1-yl)carbamate: To a solution of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)carbamate (0.24 g, 675.43 μmol, 1 eq.) in DMF (8 mL) was added NaH (54.03 mg, 1.35 mmol, 60% in mineral oil, 2 eq.) at 0° C. The mixture was stirred at 0° C. for 0.5 h. A solution of 3-bromoprop-1-yne (120.52 mg, 1.01 mmol, 87.34 μL, 1.5 eq.) in DMF (1 mL) was added dropwise into the reaction mixture, and the mixture was stirred at 0° C. for 0.5 h and at 20° C. for 0.5 h. TLC analysis (PE:EtOAc=2:1, Rf=0.3) indicated that the starting material was consumed completely. The reaction mixture was poured into water (10 mL) and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 2:1) to afford the desired product (0.24 g, 488.08 μmol, 72.26% yield) as a light yellow oil.


Preparation of 4-(methylsulfonyl)-N-(prop-2-yn-1-yl)-2-(trifluoromethoxy)aniline: A mixture of tert-butyl (4-(methylsulfonyl)-2-(trifluoromethoxy)phenyl)(prop-2-yn-1-yl)carbamate (0.05 g, 101.68 μmol, 1 eq.) and HCl/EtOAc (4 M, 2 mL, 78.68 eq.) was stirred at 20° C. for 2 h. HPLC analysis showed that the starting material was consumed completely, and one main peak was detected. The reaction mixture was concentrated under reduced pressure to give the desired product (0.03 g, crude, HCl) as a light yellow solid.




embedded image


To a mixture of 4-(methylsulfonyl)-N-(prop-2-yn-1-yl)-2-(2,2,2-trifluoroethoxy)aniline (62.08 mg, 171.53 μmol, 1.5 eq.), 4-(methylsulfonyl)-N-(prop-2-yn-1-yl)-2-(trifluoromethoxy)aniline (50.01 mg, 138.16 μmol, 1.5 eq.), or 4-(methylsulfonyl)-N-(prop-2-yn-1-yl)-2-(trifluoromethoxy)aniline (29.93 mg, 90.76 μmol, 0.77 eq., HCl) in DMSO (1-10 mL) were added i-Pr2NH (115.71 mg, 1.14 mmol, 161.61 μL, 10 eq.), CuI (21.78 mg, 114.35 μmol, 1 eq.), 2-iodo-N—R2-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (50 mg, 114.35 μmol, 1 eq.), and Pd(PPh3)4 (26.43 mg, 22.87 μmol, 0.20 eq.) at 20˜45° C. The mixture was stirred at 20˜45° C. temperature for 1˜4 h. TLC or LC-MS analysis was used to detect completion of the reaction. EtOAc (10 mL) was poured into the mixture, and the resulting mixture was poured into a saturated aqueous solution of EDTA (40 mL). The mixture was stirred for 15 min, and the aqueous phase was extracted with EtOAc (40 mL×2). The organic layer was poured into to a saturated aqueous solution of EDTA solution (40 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, mixed with activated carbon, filtered, and concentrated in vacuo. The mixture was purified by prep-TLC or column chromatography, then purified again once or twice by prep-HPLC to afford the desired products.


N-(1-methylpiperidin-4-yl)-2-(3-((4-(methylsulfonyl)-2-(2,2,2-trifluoroethoxy)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 24.7 mg, 31.7% yield, MS (ES+, m/z): 617.2; 4-((2-(3-((4-(methylsulfonyl)-2-(2,2,2-trifluoroethoxy)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide, 8.1 mg, 13.5% yield, MS (ES+, m/z): 652.1; 2-(3-{[4-methanesulfonyl-2-(trifluoromethoxy)phenyl]amino}prop-1-yn-1-yl)-N-(oxan-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 18.1 mg, 26.1% yield, MS (ES+, m/z): 590.3; 2-(3-{[4-methanesulfonyl-2-(trifluoromethoxy)phenyl]amino}prop-1-yn-1-yl)-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 38.2 mg, 49.0% yield, MS (ES+, m/z): 603.1; 4-{[2-(3-{[4-methanesulfonyl-2-(trifluoromethoxy)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl]amino}-1λ6-thiane-1,1-dione and, 16.7 mg, 24.7% yield, MS (ES+, m/z): 638.1.


Example D77
Synthesis of Compounds 680A and 681A



embedded image


Preparation of 2-iodo-N-(1-(tetrahydrofuran-3-yl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (10 g, 23.63 mmol, 1 eq.) and tetrahydrofuran-3-one (8.14 g, 94.51 mmol, 4 eq.) in MeOH (100 mL) were added NaBH3CN (4.45 g, 70.89 mmol, 3 eq.) and AcOH (1.42 g, 23.63 mmol, 1.35 mL, 1 eq.). The mixture was stirred at 20° C. for 16 h. TLC analysis (Rf=0.6, EtOAc:TEA=10:1) showed that most of the starting material was consumed. The mixture was extracted with a saturated NaHCO3 solution (300 mL) and EtOAc (350 mL×3). The organic layer was washed with brine (300 mL), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 0:1) to afford the desired product (8.3 g, 15.14 mmol, 64.09% yield) as an off-white solid.


Preparation of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A mixture of 2-iodo-N-(1-(tetrahydrofuran-3-yl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (6 g, 12.16 mmol, 1 eq.), 2-methoxy-4-methylsulfonyl-N-prop -2-ynyl-aniline (3.78 g, 15.81 mmol, 1.3 eq.), i-Pr2NH (12.31 g, 121.63 mmol, 17.19 mL, 10 eq.), CuI (1.16 g, 6.08 mmol, 0.5 eq.), and Pd(PPh3)4 (1.41 g, 1.22 mmol, 0.1 eq.) in DMSO (60 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 1 h under N2. TLC analysis (Rf=0.4, EtOAc:TEA=10:1) showed that the reaction was complete. Saturated aqueous EDTA (200 mL) and EtOAc (200 mL) were added to the mixture and stirred for 1 h. Then the mixture was extracted with EtOAc (200 mL×3). The organic layer was washed with brine (150 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 0:1) and prep-HPLC. The purified residue was purified further by SFC to obtain the desired products.


(R)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(1-(tetrahydrofuran-3-yl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.075 g, 124.03 μmol, 1.02% yield), MS (ES+, m/z): 605.3; (S)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-(1-(tetrahydrofuran-3-yl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.085 g, 140.57 μmol, 1.16% yield), MS (ES+, m/z): 605.3.


Example D78
Synthesis of Compounds 878A and 879A



embedded image


To a mixture of methyl 4-((3-(4-(((3S,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.15 g, 281.67 μmol, 1 eq.) and (2R)-2-(methoxymethyl)oxirane (124.08 mg, 1.41 mmol, 125.33 5 eq.) in DMF (5 mL) was added K2CO3 (116.79 mg, 845.02 μmol, 3 eq.). The mixture was stirred at 50° C. for 12 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.75) detected one new spot. The reaction mixture was quenched by addition water (10 mL), and then extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to afford methyl 4-[3-[4-[[(3R,4S)-3-fluoro-1-[(2R)-2-hydroxy-3-methoxy-propyl]-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoate (0.07 g, 107.15 μmol, 38.04% yield) was obtained as a yellow solid.


The residue was separated by SFC to afford methyl 4-[3-[4-[[(3R,4S)-3-fluoro-1-[(2R)-2-hydroxy-3-methoxy-propyl]-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoate (0.03 g, 47.76 μmol, 41% yield). MS (ES+, m/z): 621.3. and methyl 4-[3-[4-[[(3S,4R)-3-fluoro-1-[(2R)-2-hydroxy-3-methoxy-propyl]-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoate (0.03 g, 46.69 μmol, 40% yield). MS (ES+, m/z): 621.4.


Example D79
Synthesis of Compounds 783A and 784A



embedded image


embedded image


Preparation of 4-((3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzamide: A mixture of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine hydrochloride (1 g, 2.94 mmol, 1 eq.), 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide (770.11 mg, 3.53 mmol, 1.2 eq.), CuI (560.01 mg, 2.94 mmol, 1 eq.), Pd(PPh3)4 (679.58 mg, 588.09 μmol, 0.2 eq.), and i-Pr2NH (2.98 g, 29.40 mmol, 4.16 mL, 10 eq.) in DMSO (10 mL) was degassed and purged with N2 three times. The mixture was stirred at 20° C. for 1 h under N2. TLC analysis (PE:EtOAc=5:1, Rf=0; PE:EtOAc=0:1, Rf=0.5) indicated that one major new spot had formed. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (40 mL) with stirring for 1 h. The mixture was diluted with EtOAc (20 mL), and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude product was triturated with DCM at 20° C. for 10 min. The residue was purified by column chromatography (SiO2, PE:EtOAc=2:1 to 0:1) to afford the desired product (1.1 g, 2.04 mmol, 69.53% yield) as a yellow solid.


Preparation of tert-butyl (3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylcarbamoyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a mixture of 4-((3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzamide (0.9 g, 2.09 mmol, 1 eq.) and tert-butyl 3-fluoro-4-oxopiperidine-1-carboxylate (2.27 g, 10.45 mmol, 5 eq.) in DMF (10 mL) was added TMSCl (567.92 mg, 5.23 mmol, 663.46 μL, 2.5 eq.) at 0° C. The resulting mixture was stirred at 0° C. for 1 h, and BH3.THF (1 M, 6.27 mL, 3 eq.) was added to the reaction at 0° C. The mixture was stirred further at 0° C. for 1 h. TLC analysis (PE:EtOAc=0:1, Rf=0.55) indicated that the starting material remained, and one new spot was detected. The reaction mixture was quenched by adding saturated aqueous Na2CO3 (30 mL), diluted with water (30 mL), and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 0:1) and prep-HPLC afford the desired product and tert-butyl (3S,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylcarbamoyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate a yellow solid.


Preparation of 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzamide: A solution of tert-butyl (3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylcarbamoyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.65 g, 1.03 mmol, 1 eq.) in HCl/EtOAc (20 mL, 4 M) was stirred at 20° C. for 0.5 h under N2. TLC analysis (DCM:MeOH=10:1, Rf=0.1) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding a saturated aqueous solution of NaHCO3 (30 mL), diluting the mixture with water (30 mL), and extracted the mixture with EtOAc (40 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude product (0.5 g, 846.59 μmol, 82.27% yield) was obtained as a yellow solid and used without purification.


Preparation of 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzamide: To a solution of 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzamide (169.49 mg, 5.64 mmol, 10 eq.) and paraformaldehyde (169.49 mg, 5.64 mmol, 10 eq.) in MeOH (3 mL) were added NaBH3CN (106.40 mg, 1.69 mmol, 3 eq.) and AcOH (33.89 mg, 564.39 μmol, 32.28 μL, 1 eq.). The mixture was degassed and purged with N2 three times, then was stirred at 20° C. for 12 h under N2. TLC analysis (DCM:MeOH=10:1, Rf=0.6) indicated that the starting material remained, and one major new spot was detected. The reaction mixture was quenched by adding a saturated aqueous solution of Na2CO3 (30 mL), diluted with water (30 mL), and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (0.11 g, 189.53 μmol, 33.58% yield) as a yellow solid.


The residue was separated by SFC to afford 4-[3-[4-[[(3R,4S)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-N-methyl-benzamide (0.06 g, 107.34 μmol, 45% yield) yellow solid. MS (ES+, m/z): 546.3 and 4-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-N-methyl-benzamide (0.055 g, 98.90 μmol, 42% yield). MS (ES+, m/z): 546.3.


Example D80
Synthesis of 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-N-isopropyl-3-methoxybenzamide (Compound 807A)



embedded image


To a mixture of 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.1 g, 187.78 μmol, 1 eq.), propan-2-amine (22.20 mg, 375.57 μmol, 32.27 μL, 2 eq.), TEA (114.01 mg, 1.13 mmol, 156.82 μL, 6 eq.) in DMF (3 mL) was added T3P® (358.49 mg, 563.35 μmol, 335.04 μL, 50% purity, 3 eq.). The mixture was stirred at 50° C. for 3 h under N2. TLC analysis (DCM:MeOH=10:1, Rf=0.36) indicated that the starting material was consumed, and one major new spot was detected. The reaction mixture was quenched by adding water (30 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, EtOAc: TEA=10:1) and purified further by prep-HPLC to afford 4-[3-[4-[[(3R,4S)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-N-isopropyl-3-methoxy-benzamide (0.04 g, 68.97 μmol, 37% yield) white solid. MS (ES+, m/z): 574.2.


Example D81
Synthesis of (4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoyl)glycine (Compound 896A)



embedded image


Preparation of (4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoyl)glycine: To a mixture of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.1 g, mmol, 1 eq.) and methyl 2-aminoacetate hydrochloride (35.71 mg, 220.38 μmol, 1.2 eq., HCl) in DMF (2 mL) were added DIPEA (71.21 mg, 3 eq.) and HATU (104.75 mg, 1.5 eq.) in one portion at 25° C. under N2. The mixture was stirred at 25° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.4) showed that the reaction was complete. The residue was poured into water (10 mL), and the aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×1), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude product (0.1 g, crude) was obtained as light yellow solid and used in the next step without purification.


Preparation of methyl (4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoyl)glycinate: To a solution of (4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoyl)glycine (80 mg, 132.54 μmol, 1 eq.) in THF (1 mL), water (1 mL), and MeOH (1 mL) were added NaOH (10.60 mg, 265.07 μmol, 2 eq.) and LiOH.H2O (11.12 mg, 265.07 μmol, 2 eq.). The mixture was stirred at 50° C. for 2 h. TLC analysis (DCM:MeOH=10:1, Rf=0.1) showed that the reaction was complete. The residue was poured into water (10 mL), and 1M aqueous HCl was added to the mixture to adjust the pH to 5. The aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×1), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-HPLC to give the desired product as a light yellow solid (44%). MS (ES+, m/z): 590.2.


Example D82
Synthesis of Compounds 906A, 907A, 917A, and 962A



embedded image


To a mixture of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (80 mg, 146.92 μmol, 1 eq.) R-amine (33.35 mg, 176.31 μmol, 1.2 eq.) and TEA (74.34 mg, 734.61 μmol, 102.25 μL, 5 eq.) in DMF (3 mL) was added T3P® (140.24 mg, 220.38 μmol, 131.07 μL, 50% purity, 1.5 eq.) dropwise at 0° C. under N2. The mixture was stirred at 25° C. for 1 h. TLC analysis indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding water (5 mL) and extracted with EtOAc (5 mL×3). The combined organic layers were washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to give the desired products as yellow solids.


N-[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]-2-{3-[(2-methoxy-4-{2-oxa-6-azaspiro[3.3]heptane-6-carbonyl}phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, (28.3 mg, 36.9% yield) MS (ES+, m/z): 614.3; N-[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]-2-{3-[(2-methoxy-4-{7-oxa-2-azaspiro[3.5]nonane-2-carbonyl}phenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, (13.7 mg, 13.9% yield) MS (ES+, m/z): 642.3; N-(2,3-dihydroxypropyl)-4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide, (32.7 mg, 36.5% yield) MS (ES+, m/z): 606.3; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(1,3-thiazol-2-yl)benzamide, (13.7 mg, 14.9% yield) MS (ES+, m/z): 615.2.


Example D83
Synthesis of Compounds 957A, 960A, and 963A



embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (70 mg, 130 μmol, 1 eq.) and Amines (19.53 mg, 260 μmol, 20.47 μL, 2 eq.) in DMF (2 mL) were added Et3N (39.46 mg, 390.01 mol, 54.28 μL, 3 eq.) and HATU (74.15 mg, 195 μmol, 1.5 eq.) in one portion at 25° C. under N2. The mixture was stirred for 0.5 h, and R-amine (2 eq.) was added. The resulting reaction mixture was stirred at 50° C. for 1 h. TLC analysis indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched with water (5 mL) and extracted with EtOAc (5 mL×3). The combined organic layers were washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to give the desired products as yellow solids. p 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-N—((R)-2-hydroxypropyl)-3-methoxybenzamide, (28.8 mg, 37.1% yield), MS (ES+, m/z): 590.2; N-[(2R)-2,3-dihydroxypropyl]-4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide, (32.7 mg, 47.0% yield), MS (ES+, m/z): 606.2; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(2-hydroxy-3-methoxypropyl)-3-methoxybenzamide, (34.3 mg, 49.4% yield). MS (ES+, m/z): 620.3.


Example D84
Synthesis of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-((2R,3R,4R,5S,6R)-2,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-3-yl)benzamide (Compound 948A)



embedded image


Preparation of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-((2R,3R,4R,5S,6R)-2,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-3-yl)benzamide: To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.1 g, 183.65 μmol, 1 eq.) in CH2Cl2 (0.5 mL) and THF (0.5 mL) were added DIPEA (118.68 mg, 918.26 μmol, 159.94 μL, 5 eq.), HATU (139.66 mg, 367.30 μmol, 2 eq.), and [(2R,3S,4R,5R,6S)-3,4,6-triacetoxy-5-aminotetrahydropyran-2-yl]mEtOAc hydrochloride (154.36 mg, 367.30 μmol, 2 eq., HCl) at 25° C. under N2. The mixture was stirred at 50° C. for 2 h. LC-MS analysis showed that the reaction was complete. The residue was poured into water (10 mL), and the aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×1), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (SiO2, DCM:MeOH=20:1, Rf=0.4) to give the desired product (150 mg, 147.94 μmol, 80.55% yield) as a light yellow solid.


Preparation of (2S,3R,4R,5S,6R)-6-(acetoxymethyl)-3-(4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzamido)tetrahydro-2H-pyran-2,4,5-triyl triacetate: To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-((2R,3R,4R,5S,6R)-2,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-3-yl)benzamide (140 mg, 138.08 μmol, 1 eq.) in THF (10 mL) and MeOH (30 mL) was added NaOMe (2.98 g, 13.81 mmol, 4 mL, 25% purity, 100 eq.) at 0° C. The mixture was stirred at 25° C. for 2 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was adjusted to pH 5 by adding citric acid (100 mL) dropwise and was then lyophilized. The residue was purified by prep-HPLC to give the desired product (26.9 mg, 37.62 μmol, 1 eq.) as a light yellow solid. MS (ES+, m/z): 694.3.


Example D85
Synthesis of Compounds 790A, 791A, 837A, 838A, 841A, 842A,843A, and 844A



embedded image


Preparation of N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (4.5 g, 10.20 mmol, 1 eq.) and formaldehyde (1.53 g, 51 mmol, 1.40 mL, 5 eq.) in MeOH (70 mL) was added AcOH (612.49 mg, 10.20 mmol, 583.33 μL, 1 eq.) dropwise at 25° C. Then, NaBH3CN (1.28 g, 20.40 mmol, 2 eq.) was added to the mixture. The mixture was stirred at 50° C. for 1 h. TLC analysis indicated that the starting material was consumed completely, and one new spot was detected. The mixture was poured into a saturated aqueous solution of Na2CO3 (500 mL), and the mixture was stirred at 25° C. for 0.5 h. The mixture was extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (200 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated to give the residue. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 2:1 to EtOAc:MeOH:TEA=10:1:0.1) to give N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine as a white solid (3.9 g, 78.9% yield).


N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine was separated by SFC to afford the desired products. N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, (1.7 g, 42.9% yield); and N-((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, (1.8 g, 43.9% yield).


Preparation of final products: To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide; N-((3-methoxy-4-(prop-2-yn-1-ylamino)phenyl)sulfonyl)acetamide; 2-ethoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (71.23 mg, 253.06 μmol, 1.2 eq.); or 2-(fluoromethoxy)-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (67.82 mg, 263.60 μmol, 1.2 eq.) in DMSO (4 mL) were added i-Pr2NH (129.85 mg, 2.20 mmol, 188.73 μL, 10 eq.), CuI (8.37 mg, 43.93 μmol, 0.2 eq.), N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 219.67 μmol, 1 eq.) or N-((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 219.67 μmol, 1 eq.) and Pd(PPh3)4 (12.69 mg, 10.98 μmol, 0.05 eq.). The mixture was stirred at 40° C. for 1 h. TLC analysis indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (30 mL) and was stirred at 20° C. for 1 h. The mixture was then diluted with water (20 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (25 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired products. residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired products.


4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, 28 mg, 25% yield, MS (ES+, m/z): 568.3; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, 28.1 mg, 23% yield, MS (ES+, m/z): 568.3; N-(4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzenesulfonyl)acetamide, 30 mg, 21% yield, MS (ES+, m/z): 610.2; N-(4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzenesulfonyl)acetamide, 30 mg, 21% yield, MS (ES+, m/z): 610.2; 2-{3-[(2-ethoxy-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-N-[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 22 mg, 18% yield, MS (ES+, m/z): 581.1; 2-{3-[(2-ethoxy-4-methanesulfonylphenyl)amino]prop-1-yn-1-yl}-N-[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 38 mg, 25% yield, MS (ES+, m/z): 581.1; N-[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]-2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 35 mg, 27% yield, MS (ES+, m/z): 585.3; and N-[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]-2-(3-{[2-(fluoromethoxy)-4-methanesulfonylphenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 34.0 mg, MS (ES+, m/z): 585.3.


Example D86
Synthesis of Compounds 924A, 933A, 949A, 956A, and 969A



embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.07 g, 127.50 μmol, 1 eq.) in DMF (2 mL) were added 2-morpholinoethanamine (33.20 mg, 255 μmol, 33.47 μL, 2 eq.), HATU (42.84 mg, 112.67 μmol, 1.2 eq.), and TEA (95.01 mg, 938.92 μmol, 130.69 μL, 10 eq.). The mixture was stirred at 2550° C. for 2˜3 h. TLC analysis (DCM:MeOH=10:1, Rf=0.30) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding water (15 mL) and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL×1), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to afford the desired products as yellow solids.


2-[3-({4-[4-(dimethylamino)piperidine-1-carbonyl]-2-methoxyphenyl}amino)prop-1-yn-1-yl]-N-[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 38.0 mg 44.1% yield, MS (ES+, m/z): 643.3; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-[2-(morpholin-4-yl)ethyl]benzamide, 25.0 mg 41.1% yield, MS (ES+, m/z): 645.4; 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-N-(1-hydroxypropan-2-yl)-3-methoxybenzamide, 40.0 mg, MS (ES+, m/z): 590.3; methyl (2S)-4-carbamoyl-2-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxyphenyl)formamido]butanoate, 3.0 mg MS (ES+, m/z): 675.3; and 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(2-methanesulfonylethyl)-3-methoxybenzamide, 25.7% yield, MS (ES+, m/z): 638.1. [4-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-phenyl]-(2-oxa-6-azaspiro[3.3]heptan-6-yl)methanone (0.02 g, 32.23 μmol, 79% yield), MS (ES+, m/z): 614.3. Compound [4-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-phenyl]-(7-oxa-2-azaspiro[3.5]nonan-2-yl)methanone (0.025 g, 38.96 μmol, 42% yield) was obtained as a yellow solid. MS (ES+, m/z): 642.3.


Example D87
Synthesis of Compounds 812A and 813A



embedded image


Preparation of N-((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (150 mg, 271.45 μmol, 1 eq.) in DMF (2 mL) was added K2CO3 (112.55 mg, 814.36 μmol, 3 eq.) and iodoethane (84.67 mg, 542.90 μmol, 43.42 μL, 2 eq.). The reaction mixture was stirred at 35° C. for 1 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with desired the desired mass was observed. The reaction mixture was quenched by adding a saturated solution of NaHCO3 (20 mL) at 25° C. and then extracted with EtOAc (20 mL). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (DCM:MeOH=10:1) and prep-HPLC to afford the desired product (100 mg, 172.22 μmol, 63% yield) as a white solid. MS (ES+, m/z): 581.3.


N-((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine was purified by SFC to obtain the final desired products as white solids. N-[(3R,4S)-1-ethyl-3-fluoropiperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (19 mg, 32.72 μmol, 1 eq.), MS (ES+, m/z): 581.3; and N-[(3S,4R)-1-ethyl-3-fluoropiperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, (19 mg, 32.72 μmol, 1 eq.), MS (ES+, m/z): 581.3.


Example D88
Synthesis of 2-((3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)acetamide (Compound 916A)



embedded image


To a solution of N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (150 mg, 271.45 μmol, 1 eq.) in DMF (1 mL) were added K2CO3 (112.55 mg, 814.36 μmol, 3 eq.) and 2-chloroacetamide (76.15 mg, 814.36 μmol, 57.90 μL, 3 eq.). The reaction mixture was stirred at 50° C. for 1 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the desired mass was observed. The reaction mixture was filtered and concentrated in vacuo and purified by prep-HPLC to obtain the desired product (25 mg, 40.60 μmop as a white solid. MS (ES+, m/z): 610.2.


Example D89
Synthesis of Compounds 808A, 819A, 909A, 910A, 918A, 919A, 924A, and 947A



embedded image


To a mixture of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.07 g, 127.50 μmol, 1 eq.), 1-methylpiperidin-4-amine (29.12 mg, 255.01 μmol, 25.96 μL, 2 eq.), TEA (129.02 mg, 1.28 mmol, 177.47 μL, 10 eq.) in DMF (3 mL) was added T3P® (243.42 mg, 382.51 μmol, 227.49 μL, 50% purity, 3 eq.). The mixture was stirred at 2550° C. for 2 h under N2. TLC analysis indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding water (5 mL) and extracted with EtOAc (5 mL×3). The combined organic layers were washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to afford the desired products as yellow solids.


4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(propan-2-yl)benzamide, 20.0 mg, 18% yield, MS (ES+, m/z): 574.4; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(2-hydroxyethyl)-3-methoxybenzamide, 3.0 mg, 3.8% yield, MS (ES+, m/z): 576.3; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-[2-(morpholin-4-yl)ethyl]benzamide, 25 mg, 12% yield, MS (ES+, m/z): 645.4; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(oxan-4-yl)benzamide, 50 mg, 54% yield, MS (ES+, m/z): 616.3; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(1-methylpiperidin-4-yl)benzamide, 35.0 mg, 42% yield, MS (ES+, m/z): 629.3; N-[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]-2-(3-{[2-methoxy-4-(4-methylpiperazine -1-carbonyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 45 mg, 53% yield, MS (ES+, m/z): 615.4; N-[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]-2-(3-{[2-methoxy-4-(morpholine-4-carbonyl)phenyl]amino}prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 45 mg, 56% yield, MS (ES+, m/z): 602.3 and 1-(4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoyl)piperidin-4-ol, 31 mg, 30% yield, MS (ES+, m/z): 616.3.


Example D90
Synthesis of 3-methoxy-4-{[3-(4-{[1-(2-methoxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-methylbenzene-1-sulfonamide (Compound 617A)



embedded image


Preparation of 2-iodo-N-(1-(2-methoxyethyl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 222.11 μmol, 1 eq) in DMF (2 mL) were added K2CO3 (153.48 mg, 1.11 mmol, 5 eq) and 1-bromo-2-methoxyethane (61.74 mg, 444.22 μmol, 41.72 μL, 2 eq). The reaction mixture was stirred at 50° C. for 1 hr. TLC analysis (DCM:MeOH=10:1, Rf=0.43) indicated that the reaction was complete. The reaction mixture was quenched by adding water (40 mL) at 25° C. and extracting the mixture with EtOAc (10 mL×3). The combined organic layer was dried over sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (80 mg, 141.29 μmol, 63.61% yield) as a light-yellow oil. MS (ES+, m/z): 481.9.


Preparation of 3-methoxy-4-{[3-(4-{[1-(2-methoxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-methylbenzene-1-sulfonamide: To a solution of 3-methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzenesulfonamide (31.70 mg, 124.66 μmol, 1.2 eq.) in DMSO (3 mL) were added i-Pr2NH (105.12 mg, 1.04 mmol, 146.82 μL, 10 eq.), CuI (3.96 mg, 20.78 μmol, 0.2 eq.), 2-iodo-N-(1-(2-methoxyethyl)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (50 mg, 103.89 μmol, 1 eq.), and Pd(PPh3)4 (12 mg, 10.39 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (50 mL) and EtOAc (25 mL) at 25° C. The mixture was extracted with EtOAc (25 mL×2). The combined organic layers were washed with water (100 mL×2) and brine (100 mL×2), dried over anhydrous sodium sulfate, stirred with activated carbon, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired product (23.4 mg, 38.51 μmol, 37.07% yield) as a white solid. MS (ES+, m/z): 608.2.


Example D91
Synthesis of Compounds 845A, 846A, 847A, and 848A



embedded image


Preparation of tert-butyl (3S,4R)-4-((2-(3-((4-(R-sulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate and tert-butyl (3R,4S)-4-((2-(3-((4-(R-sulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide or 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (99.46 mg, 415.65 μmol, 1.5 eq.) in DMSO (2 mL) were added i-Pr2NH (280.40 mg, 2.77 mmol, 391.62 μL, 10 eq.) and CuI (52.77 mg, 277.10 μmol, 1 eq.) in one portion under N2. Then, tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (150 mg, 277.10 mol, 1 eq.) or tert-butyl (3R,4S)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (150 mg, 277.10 μmol, 1 eq.) and Pd(PPh3)4 (32.02 mg, 27.71 μmol, 0.1 eq.) were added to the mixture. The mixture was purged with N2 three times and stirred at 20° C. for 1 h. LC-MS analysis showed that some starting material remained, and the desired product was detected. EtOAc (20 mL) was poured into the mixture, and the resulting mixture was poured into a saturated aqueous EDTA solution (30 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give a residue. The residue was purified by prep-TLC (SiO2, PE:EtOAc=2:1) to afford the desired product (170 mg).


Preparation of final products: To a mixture of tert-butyl (3S,4R)-4-((2-(3-((4-(R-sulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate or tert-butyl (3R,4S)-4-((2-(3-((4-(R-sulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (100 mg, 153.21 μmol, 1 eq.) in DCM (3 mL) was added TFA (1 mL) in one portion at 20° C. under N2. The mixture was stirred at 20° C. for 60 min. TLC analysis showed that the reaction was complete. The reaction was quenched by adding a saturated aqueous solution of Na2CO3 to adjust the pH of the mixture to 9 and was extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (15 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-HPLC to afford the desired products as white solids.


N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 32.7 mg, 38% yield, MS (ES+, m/z): 553.2; N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 39.7 mg, 31% yield, MS (ES+, m/z): 553.2; 4-{[3-(4-{[(3S,4R)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, 36.6 mg, 42% yield, MS (ES+, m/z): 554.2; 4-{[3-(4-{[(3R,4S)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, 37 mg, 29% yield, MS (ES+, m/z): 554.2.


Example D92
Synthesis of Compounds 864A, 865A, 866A, and 867A



embedded image


embedded image


Preparation of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((3R,4S)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (1 g, 1.85 mmol, 1 eq.) or tert-butyl (3R,4S)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (1 g, 1.85 mmol, 1 eq.) in DCM (9 mL) was added TFA (3 mL) in one portion. The mixture was stirred at 20° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction was quenched by adding a saturated aqueous solution of Na2CO3, adjusting the pH of the mixture to 8, and extracting the mixture with EtOAc (20 mL×3). The organic layer was washed with brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford the desired products.


Preparation of R-substituted N-((3S,4R)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and R-substituted N-((3R,4S)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or N-((3R,4S)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (150 mg, 339.98 μmol, 1 eq.) in DCM (4 mL) were added Et3N (103.21 mg, 1.02 mmol, 141.96 μL, 3 eq.) and propanoyl chloride (37.75 mg, 407.97 μmol, 37.75 μL, 1.2 eq.) in one portion at 0° C. The reaction mixture was stirred at 0° C. for 0.5 h. TLC analysis showed that the reaction was complete. The reaction was diluted with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:2) to afford the desired product 1-[(3S,4R)-3-fluoro-4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]propan-1-one (140 mg, 281.54 μmol, 82.81% yield).


Preparation of final products: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (96.24 mg, 402.20 μmol, 2 eq.) in DMSO (2 mL) were added i-Pr2NH (203.49 mg, 2.01 mmol, 284.21 μL, 10 eq.) and CuI (38.30 mg, 201.10 μmol, 1 eq.) in one portion under N2. Then R-substituted N-((3S,4R)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 201.10 mol, 1 eq.) or R-substituted N-((3R,4S)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 201.10 μmol, 1 eq.) and Pd(PPh3)4 (23.24 mg, 20.11 μmol, 0.1 eq.) were added. The mixture was purged with N2 three times, and the reaction mixture was stirred at 20° C. for 1 h. TLC analysis showed that the reaction was complete. EtOAc (20 mL) was poured into the reaction, and the resulting mixture was poured into a saturated aqueous EDTA solution (30 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC and prep-HPLC to afford the desired products.


1-[(3S,4R)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]propan-1-one, 36.7 mg, 30% yield, MS (ES+, m/z): 609.3; 1-[(3R,4S)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]propan-1-one, 29.3 mg, 24% yield, MS (ES+, m/z): 609.3; 1-[(3S,4R)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]-2-methoxyethan-1-one, 26.1 mg, 21% yield, MS (ES+, m/z): 625.3; and 1-[(3R,4S)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]-2-methoxyethan-1-one, 20.4 mg, 17% yield, MS (ES+, m/z): 625.3.


Example D93
Synthesis of Compounds 732A, 742A, 743A, 744A, 745A, 746A, 747A, 748A, 750A, 751A, 752A, 753A 756A, and 757A



embedded image


Preparation of 2-iodo-N-(1-(R2-substituted)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 226.84 μmol, 1 eq.) in DMF (3 mL) were added 2-methylpropanoic acid (21.98 mg, 249.52 μmol, 23.14 μL, 1.1 eq.), DIEA (58.63 mg, 453.67 μmol, 79.02 μL, 2 eq.), and HATU (129.37 mg, 340.25 μmol, 1.5 eq.). The mixture was stirred at 25° C. for 1 h. TLC and LC-MS analysis showed that the starting material was consumed completely. The reaction was partitioned by adding water (50 mL) and EtOAc (5 mL). The aqueous phase was extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate and filtered to give a filter liquor. The filter liquor was dried in vacuo to give the crude product 1-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-2-methyl-propan-1-one (110 mg, crude) as an oil.


Preparation of final products: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (46.20 mg, 173.75 μmol, 1.2 eq.) or 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (40.18 mg, 133.79 μmol, 1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (65.90 mg, 1.11 mmol, 95.79 μL, 10 eq.), CuI (21.23 mg, 111.49 μmol, 1 eq.), 2-iodo-N-(1-(R2-substituted)piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine 1-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-2-methyl-propan-1-one (55 mg, 111.49 μmol, 1 eq.), and Pd(PPh3)4 (25.77 mg, 22.30 μmol, 0.2 eq.)at 25° C. The mixture was stirred for 1 h under N2. LC-MS and TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (20 mL) at 25° C. and stirred for 2 h. The reaction mixture was partitioned by adding EtOAc (30 mL). The aqueous phase was extracted with EtOAc (30 mL×2)The organic phase was washed with brine (30 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give the crude product. The residue was purified by prep-TLC and prep-HPLC to give a solution of the desired product. The solution was lyophilized to give the desired product.


2-hydroxy-1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}ethan-1-one, (9.8 mg, 11.2% yield) MS (ES+, m/z): 539.0; 4-{[3-(4-{[1-(2-hydroxyacetyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, (11.2 mg, 13.4% yield) MS (ES+, m/z): 594.2; 2-methoxy-1-(4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-one, (13.4 mg, 14.5% yield) (MS (ES+, m/z): 607.2; 3-methoxy-4-((3-(4-((1-(2-methoxyacetyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzenesulfonamide, (17.1 mg, 19.8% yield) MS (ES+, m/z): 607.2; 2-(dimethylamino)-1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}ethan-1-one, (14.5 mg, 15.3% yield) (MS (ES+, m/z): 620.2; 4-((3-(4-((1-(dimethylglycyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, (11.3 mg, 13.7% yield) MS (ES+, m/z): 621.2; 2-hydroxy-1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-1-one, (9.6 mg, 8.8% yield) MS (ES+, m/z): 607.2; 4-{[3-(4-{[1-(2-hydroxypropanoyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, (10.7 mg, 10.8% yield) MS (ES+, m/z): 608.2; 3-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-oxopropanenitrile, (9.8 mg, 8.9% yield) MS (ES+, m/z): 602.2; 4-{[3-(4-{[1-(2-cyanoacetyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, (7.5 mg, 5.8% yield) MS (ES+, m/z): 603.2; 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-1-one, (15.3 mg, 21.7% yield) MS (ES+, m/z): 591.2; 3-methoxy-4-[(3-{4-[(1-propanoylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, (11.5 mg, 16.8% yield) MS (ES+, m/z): 592.1; 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-2-methylpropan-1-one, (10.3 mg, 14.3% yield) (MS (ES+, m/z): 605.2; 3-methoxy-4-{[3-(4-{[1-(2-methylpropanoyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, (13.1 mg, 19.3% yield) MS (ES+,606.2)


Example D94
Synthesis of Compounds 766A and 767A



embedded image


Preparation of tert-butyl (3S,4S)-3-hydroxy-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate and tert-butyl (3S,4S)-4-hydroxy-3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a mixture of tert-butyl 7-oxa-4-azabicyclo[4.1.0]heptane-4-carboxylate (878.81 mg, 4.41 mmol, 3 eq.) and 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (0.5 g, 1.47 mmol, 1 eq.) in CH3CN (5 mL) was added ZrCl4 (34.26 mg, 147.02 μmol, 12.24 μL, 0.1 eq.). The mixture was stirred at 25° C. for 2 h. TLC and LC-MS analysis showed that the reaction was complete. The reaction was filtered through a pad of diatomaceous earth and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=3:1) and by prep-HPLC to afford the desired products as yellow solids.


tert-butyl (3S,4S)-3-hydroxy-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.14 g, 233.62 μmol, 15.89% yield), MS (ES+, m/z): 540.2; and tert-butyl (3S,4S)-4-hydroxy-3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.24 g, 400.50 μmol, 27.24% yield).


Preparation of (3S,4S)-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-3-ol and (3S,4S)-3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-4-ol: To a solution of tert-butyl (3S,4S)-3-hydroxy-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.15 g, 250.31 μmol, 1 eq.) or tert-butyl (3S,4S)-4-hydroxy-3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.15 g, 250.31 μmol, 1 eq.) in DCM (3 mL) was added TFA (1.39 g, 12.16 mmol, 899.98 μL, 48.56 eq.). The mixture was stirred at 25° C. for 0.5˜1 h. TLC analysis showed that the reaction was complete. Saturated aqueous solution of Na2CO3 (10 mL) was added to the reaction mixture to adjust the pH of the mixture to 9. The mixture was then extracted with DCM (10 mL×3). The combined organic layers were washed with brine, dried over by anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was obtained as a yellow solid and used in the next step without purification.


Preparation of (3S,4S)-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-1-methylpiperidin-3-ol and (3S,4S)-3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-1-methylpiperidin-4-ol: To a mixture of formaldehyde (12.31 mg, 409.82 μmol, 11.29 μL, 2 eq.) and (3S,4S)-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-3-ol or (3S,4S)-3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-4-ol (0.09 g, 204.91 μmol, 1 eq.) in MeOH (3 mL) was added AcOH (12.30 mg, 204.91 μmol, 11.72 μL, 1 eq.). The mixture was stirred at 50° C. for 10 min, and NaBH3CN (64.38 mg, 1.02 mmol, 5 eq.) was added. The resulting reaction mixture was stirred further at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction was poured to saturated aqueous solution of Na2CO3 (10 mL) and extracted with DCM (10 mL×3). The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired products as yellow solids.


Preparation of final products: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (42.76 mg, 178.71 μmol, 1.5 eq.) in DMSO (2 mL) were added N-isopropylpropan-2-amine (120.56 mg, 1.19 mmol, 168.38 μL, 10 eq.), CuI (22.69 mg, 119.14 μmol, 1 eq.), then (3S,4S)-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-1-methylpiperidin-3-ol (0.06 g, 119.14 μmol, 1 eq.) or (3S,4S)-3-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-1-methylpiperidin-4-ol (70 mg, 154.44 μmol, 1 eq.), and Pd(PPh3)4 (71.39 mg, 61.78 μmol, 0.4 eq.). The mixture was stirred at 25° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction was diluted with EtOAc (20 mL), poured into saturated aqueous EDTA solution (20 mL) and stirred at 25° C. for 1 h. The resulting mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3) dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to afford the desired products as light yellow solids.


rac-(3R,4R)-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-1-methylpiperidin-3-ol, (41.6 mg, 61.1% yield) MS (ES+, m/z): 565.1; and rac-(3R,4S)-3-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]-1-methylpiperidin-4-ol, (43.3 mg, 49.4% yield) MS (ES+, m/z): 565.3.


Example D95
Synthesis of Compounds 523A, 524A, 525A, and 526A



embedded image


Preparation of 5-((tert-butoxycarbonyl)(3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxylic acid: To a solution of 5-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)thiophene-2-carboxylic acid (0.4 g, 1.42 mmol, 1 eq.) in DMSO (2 mL) were added i-Pr2NH (1.44 g, 14.22 mmol, 2.01 mL, 10 eq.), CuI (54.16 mg, 284.37 μmol, 0.2 eq.), 2-iodo-N-(1-methyl-4-piperidyl)-1-(2,2,2-trifluoroethyl)indol-4-amine (621.68 mg, 1.42 mmol, 1 eq.), and Pd(PPh3)4 (82.15 mg, 71.09 μmol, 0.05eq). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis (DCM:MeOH:TEA=10:1:1, Rf=0.2) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding saturated aqueous EDTA solution (20 mL) and stirring the mixture at 20° C. for 1 h. The mixture was then extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 0:1 to DCM:MeOH=10:1) to afford the desired product (0.71 g, 1.14 mmol, 80.32% yield) as a yellow solid.


Preparation of 5-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)4H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxylic acid: To a solution of 5-((tert-butoxycarbonyl)(3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxylic acid (0.06 g, 101.58 μmol, 1 eq.) in DCM (2 mL) were added 2,6-lutidine (326.54 mg,3.05 mmol, 354.94 μL, 30 eq.) and TMSI (609.78 mg, 3.05 mmol, 414.81 μL, 30 eq.). The mixture was stirred at 25° C. for 5 h. LC-MS analysis showed that the starting material was consumed completely, and the desired mass was detected. The reaction mixture was filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to obtain the desired product (0.015 g, 27.34 μmol, 26.91% yield) as a yellow solid. MS (ES+, m/z): 489.9.




embedded image


Preparation of tert-butyl (5-(methylcarbamoyl)thiophen-2-yl)(3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate and N,N-dimethyl-5-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxamide: To a solution of 5-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxylic acid (0.2 g, 338.61 μmol, 1 eq.) and methanamine hydrochloride (45.72 mg, 677.21 μmol, 2 eq.) or N-methylmethanamine hydrochloride (55.22 mg, 677.21 μmol, 2 eq.) in DCM (2 mL) and DMF (2 mL) were added TEA (171.32 mg, 1.69 mmol, 235.65 μL, 5 eq.), HOBt (68.63 mg, 507.91 μmol, 1.5 eq.), and EDCI (97.37 mg, 507.91 μmol, 1.5 eq.). The mixture was stirred at 25° C. for 20 h. HPLC analysis showed that the starting material remained. The reaction was quenched by adding water (30 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to afford the desired product as a yellow solid.


tert-butyl (5-(methylcarbamoyl)thiophen-2-yl)(3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate (0.08 g, 129.87 μmol, 38.35% yield), MS (ES+, m/z): 604.2; and N,N-dimethyl-5-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxamide (0.075 g, 118.99 μmol, 35.14% yield).


Preparation of N-methyl-5-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxamide and N,N-dimethyl-5-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxamide: A solution of tert-butyl (5-(methylcarbamoyl)thiophen-2-yl)(3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate (0.06 g, 97.40 μmol, 1 eq.)or N,N-dimethyl-5-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxamide (0.06 g, 97.13 μmol, 1 eq.) in 4N HCl/EtOAc (5 mL) was stirred at 25° C. for 1 h. LC-MS analysis showed the desired compound. The reaction mixture was filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to obtain the desired product as a yellow solid.


N-methyl-5-((3-(4-((l-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxamide (0.035 g, 65.12 μmol, 66.86% yield), MS (ES+, m/z): 504.2; and N,N-dimethyl-5-((3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)thiophene-2-carboxamide (0.036 g, 65.31 μmol, 67.24% yield).




embedded image


Preparation of N-(1-methylpiperidin-4-yl)-2-(3-((5-(methylsulfonyl)thiophen-2-yl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of tert-butyl (3-(4-((1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(5-(methylsulfonyl)thiophen-2-yl)carbamate (0.06 g, 96.04 μmol, 1 eq.) in 4N HCl/EtOAc (3 mL) was stirred at 25° C. for 1 h. HPLC analysis showed that 74.1% of desired compound had formed. The reaction mixture was quenched by adding a saturated solution of Na2CO3 (10 mL) to adjust the pH of the mixture to 8 and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL), filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to afford the desired product (0.017 g, 30.85 μmol, 32.12% yield) as a yellow solid. MS (ES+, m/z): 525.2.


Example D96
Synthesis of Compounds 839A and 840A



embedded image


Preparation of ethyl 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate and ethyl 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of ethyl 3-methoxy-4-(prop-2-yn-1-ylamino)benzoate (66.61 mg, 285.57 μmol, 1.3 eq.) in DMSO (3 mL) were added i-Pr2NH (222.28 mg, 2.20 mmol, 310.45 μL, 10 eq.), CuI (8.37 mg, 43.93 μmol, 0.2 eq.), N-((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 219.67 μmol, 1 eq.) or N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 219.67 μmol, 1 eq.), and Pd(PPh3)4 (25.38 mg, 21.97 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (100 mL) and EtOAc (50 mL) at 25° C. and extracting the mixture further with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired products as white solids.


Ethyl 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate, 36.1 mg, 29.3% yield, MS (ES+, m/z): 561.3; and ethyl 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate, 33.2 mg, 27.0% yield, MS (ES+, m/z): 561.3.


Example D97
Synthesis of Compounds 851A, 852A, 857A, and 858A



embedded image


embedded image


Preparation of tert-butyl 3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine hydrochloride (60 g, 26.56 mmol, 27.60 mL, 1 eq., HCl) in AcOH (1500 mL) and DCE (500 mL) were added tert-butyl 3-fluoro-4-oxo-piperidine-1-carboxylate (28.85 g, 132.79 mmol, 5 eq.) and NaBH(OAc)3 (14.07 g, 66.39 mmol, 2.5 eq.) at 20° C. The mixture was stirred at 40° C. for 2 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding ice water (2000 mL) at 0° C., adding aqueous 2N NaOH to adjust the pH of the mixture to 8 and extracting the mixture with EtOAc (1000 mL×4). The combined organic layers were washed with brine (1000 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 8:1) to obtain the desired product (100 g) as a yellow solid.


Preparation of tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate and tert-butyl (3R,4S)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: tert-Butyl 3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate was purified by prep-HPLC and SFC to obtain the desired products as white solids. tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate, 46.8% yield; and tert-butyl (3R,4S)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate, 46.4% yield.


Preparation of tert-butyl (3S,4R)-4-((2-(3-((4-(R-carbonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate and tert-butyl (3S,4R)-4-((2-(3-((4-(R-carbonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: To a solution of R-substituted alkyne (73.92 mg, 360.23 μmol, 1.3 eq.) in DMSO (4 mL) were added i-Pr2NH (280.40 mg, 2.77 mmol, 391.62 μL, 10 eq.), CuI (10.55 mg, 55.42 μmol, 0.2 eq.), tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate or tert-butyl (3R,4S)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.15 g, 277.10 μmol, 1 eq.), and Pd(PPh3)4 (32.02 mg, 27.71 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (100 mL) and EtOAc (50 mL) with stirring at 25° C. for 2 h. The mixture was further extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired products as yellow solids.


Preparation of final products: To a mixture of tert-butyl (3S,4R)-4-((2-(3-((4-(R-carbonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (100 mg, 161.65 μmol, 1 eq.) or tert-butyl (3S,4R)-4-((2-(3-((4-(R-carbonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (100 mg, 161.65 μmol, 1 eq.) in DCM (3 mL)was added TFA (1 mL). The mixture stirred at 25° C. for 1 h under N2. TLC showed that the reaction was completed. The reaction mixture was quenched by adding saturated aqueous sodium carbonate (100 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine solution (100 mL×2) in turn. Then dried over anhydrous sodium sulfate, filtered and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to obtain the desired products as white solids.


4-[3-[4-[[(3S,4R)-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzamide, 28.9 mg, 33.1% yield, MS (ES+, m/z): 518.2); 4-[3-[4-[[(3R,4S)-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzamide 39.9 mg, 59.52% yield, MS (ES+, m/z): 518.2) ; 4-{[3-(4-{[(3S,4R)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide, 27.4 mg, 38.0% yield, MS (ES+, m/z): 532.2; 4-{[3-(4-{[(3R,4S)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide, 30.5 mg, 36.1% yield, MS (ES+, m/z): 532.2; 4-{[3-(4-{[(3S,4R)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, 32.8 mg, 31% yield, MS (ES+, m/z): 519.2 and 4-{[3-(4-{[(3R,4S)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, 30.6 mg, 36.1% yield, MS (ES+, m/z): 519.2.


Example D98
Synthesis of Compounds 823A and 824A



embedded image


Preparation of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((3R,4S)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.3 g, 554.20 μmol, 1 eq.) or tert-butyl (3R,4S)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.3 g, 554.20 μmol, 1 eq.) in DCM (3 mL) was added TFA (1 mL). The reaction mixture was stirred at 25° C. for 1 h under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous solution of Na2CO3 and to adjust the pH of the mixture to 8 and extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The desired products were obtained as yellow solids.


N-((3S,4R)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 442.0; and N-((3R,4S)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 442.0.


Preparation of N-((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.24 g, 543.97 μmol, 1 eq) or N-((3R,4S)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (300 mg, 679.96 μmol, 1 eq.) in DMF (3 mL) were added iodoethane (127.26 mg, 815.95 μmol, 65.26 μL, 1.5 eq.) and K2CO3 (225.54 mg, 1.63 mmol, 3 eq.). The mixture was stirred at 50° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (80 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The desired products were obtained as yellow solids.


N-((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 470.0; and N-((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 470.0.


Preparation of final products: To a solution of ethyl 3-methoxy-4-(prop-2-yn-1-ylamino)benzoate (74.56 mg, 319.65 μmol, 1.5 eq.) in DMSO (3 mL) were added i-Pr2NH (215.64 mg, 2.13 mmol, 301.17 μL, 10 eq.), CuI (8.12 mg, 42.62 μmol 0.2 eq.), N-((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 213.10 μmol, 1 eq) or N-((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 213.10 μmol, 1 eq.), and Pd(PPh3)4 (24.63 mg, 21.31 μmol, 0.1 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (100 mL) and extracted with EtOAc (50 mL) at 25° C. The resulting mixture was further extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC and prep-HPLC to obtain the desired products as white solids.


ethyl 4-{[3-(4-{[(3S,4R)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, 33.4 mg, 27.1% yield, MS (ES+, m/z): 575.3; and ethyl 4-{[3-(4-{[(3R,4S)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, 27.9 mg, 22.8% yield, MS (ES+, m/z): 575.3.


Example D99
Synthesis of Compounds 796A and 797A



embedded image


Preparation of methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.3 g, 563.35 μmol, 1 eq.) in MeOH (3 mL) was added acetone (327.19 mg, 5.63 mmol, 414.16 μL, 10 eq.). The mixture was stirred at 25° C. for 1 h, and NaBH3CN (70.80 mg, 1.13 mmol, 2 eq.) was added to the reaction. The resulting reaction mixture was stirred at 25° C. for 1 h and was then stirred further at 50° C. for 12 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched with water (100 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (0.3 g, 522.09 μmol, 92.68% yield) as a yellow oil.


Preparation of 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid: To a solution of methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.25 g, 435.08 μmol, 1 eq.) in MeOH (3 mL) was added LiOH.H2O (365.12 mg, 8.70 mmol, 20 eq.). Then, water (3 mL) was added, and the mixture was stirred at 50° C. for 2 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (100 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to obtain the desired product (22.8 mg, 40.67 μmol, 45.60% yield) as a white solid. MS (ES+, m/z): 561.3.


Preparation of ethyl 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (60 mg, 107.03 μmol, 1 eq.) in DMF (3 mL) were added iodoethane (50.08 mg, 321.10 μmol, 25.68 μL, 3 eq.) and K2CO3 (44.38 mg, 321.10 μmol, 3 eq.). The mixture was stirred at 50° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (100 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to afford the desired product (25.0 mg, 42.47 μmol, 39.68% yield) as a white solid. MS (ES+, m/z): 589.3.


Example D100
Synthesis of Compounds 809A, 810A, 821A, and 825A



embedded image


Preparation of methyl 4-((3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate: To a solution of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxybenzoate (1.2 eq.) in DMSO (80 mL) were added i-Pr2NH (10 eq.), CuI (0.2 eq.), 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine hydrochloride (9 g, 1 eq.), and Pd(PPh3)4 (0.05 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. Saturated aqueous EDTA (300 mL) and EtOAc (100 mL) were added to the reaction mixture at 25° C. The resulting mixture was filtered and extracted with EtOAc (150 mL×2). The organic phase was washed with water (500 mL×2) and brine (500 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=20:1 to 2:1) to afford the desired product (13.5 g, 25.40 mmol) (86.4% yield) as a black brown oil.


Preparation of tert-butyl 4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: To a solution of methyl 4-((3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate (11 g, 1 eq.) in DMF (100 mL) were added tert-butyl 3-fluoro-4-oxopiperidine-1-carboxylate (5 eq.) and TMSCl (2.5 eq.). The mixture was stirred at 0° C. for 1 h, and BH3.THF (1 M, 3 eq.) was added to the mixture. The resulting reaction mixture was stirred at 0° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding ice water (250 mL), and the mixture was extracted with EtOAc (250 mL×2). The combined organic layers were washed with water (500 mL×2) and brine (500 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford the desired product (20 g, crude) as a black brown oil. MS (ES+, m/z): 755.3.


Preparation of tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: tert-Butyl 4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate was purified by prep-HPLC. The pH of the solution was adjusted to 8 by adding saturated Na2CO3. The solution was concentrated, and the mixture was extracted with EtOAc (250 mL×2). The combined organic layers were washed with brine (500 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to afford the desired product (10.5 g, 14.33 mmol, 58.33% yield) as a white solid.


Preparation of methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (2 g, 2.73 mmol, 1 eq.) in EtOAc (10 mL) was added HCl/EtOAc (4 M, 20 mL, 29.31 eq.). The mixture was stirred at 25° C. for 0.5 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (100 mL), and the pH of the solution was adjusted to 8 by adding saturated Na2CO3. The resulting mixture was extracted with EtOAc (100 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to obtain the desired product (1.6 g, crude) as a white solid.


Preparation of methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.45 g, 845.02 μmol, 1 eq.) in MeOH (5 mL) was added acetone (490.78 mg, 8.45 mmol, 621.24 μL, 10 eq.). The mixture was stirred at 50° C. for 1 h, and NaBH3CN (106.21 mg, 1.69 mmol, 2 eq.) was added to the reaction. The resulting mixture was stirred at 50° C. for 11 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (100 mL), and the mixture was extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to obtain the desired product (0.45 g, 783.14 μmol, 92.68% yield) as a yellow oil.


Preparation of 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid: To a solution of methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.4 g, 696.13 μmol, 1 eq.) in MeOH (3 mL) was added LiOH.H2O (584.19 mg, 13.92 mmol, 20 eq.). Then, water (3 mL) was added to the reaction, and the mixture was stirred at 50° C. for 2 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (100 mL), and the resulting mixture was extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to obtain the desired product (0.4 g, crude) as a yellow solid.


4-((3-(4-(((3R,4S)-3-Fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid was separated by SFC to obtain the desired products. 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(propan-2-yl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, MS (ES+, m/z): 561.2; and 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(propan-2-yl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, MS (ES+, m/z): 561.2.


Preparation of ethyl 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.15 g, 267.58 μmol, 1 eq.) in DMF (3 mL) were added iodoethane (41.73 mg, 267.58 μmol, 21.40 μL, 1 eq.) and K2CO3 (110.94 mg, 802.74 μmol, 3 eq.). The mixture was stirred at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (100 mL), and the resulting mixture was extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to obtain the desired product (0.14 g, crude) as a yellow solid.


Ethyl 4-((3-(4-(((3R,4S)-3-fluoro-1-isopropylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate was separated by SFC to obtain the desired products as white solids. Ethyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(propan-2-yl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, MS (ES+, m/z): 589.2; and ethyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(propan-2-yl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, MS (ES+, m/z): 589.2.


Example D101
Synthesis of Compounds 822A, 823A, 824A, 828A, 829A, and 958A



embedded image


Preparation of methyl 4-((3-(4-(((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.45 g, 845.02 μmol, 1 eq.) in DMF (5 mL) were added iodoethane (197.69 mg, 1.27 mmol, 101.38 μL, 1.5 eq.) and K2CO3 (350.37 mg, 2.54 mmol, 3 eq.). The mixture was stirred at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched with water (100 mL), and the mixture was extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (0.43 g, 767.06 μmol, 90.77% yield) as a yellow oil.


Preparation of 4-((3-(4-(((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid: To a solution of methyl 4-((3-(4-(((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.38 g, 677.87 1 eq.) in MeOH (3 mL) was added LiOH.H2O (568.92 mg, 13.56 mmol, 20 eq.). Then, water (3 mL) was added to the reaction, and the mixture was stirred at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (100 mL), and the resulting mixture was extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to afford the desired product (20.8 mg, 38.06 μmol) as a white solid. MS (ES+, m/z): 574.2.


Preparation of Compounds 828A and 829A: 4-((3-(4-(((3R,4S)-1-Ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid was separated by SFC to obtain the desired products as white solids. 4-{[3-(4-{[(3R,4S)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, MS (ES+, m/z): 547.3; 4-{[3-(4-{[(3S,4R)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, MS (ES+, m/z): 547.3.


Preparation of ethyl 4-((3-(4-(((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of 4-((3-(4-(((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.15 g, 274.45 μmol, 1 eq.) in DMF (3 mL) were added iodoethane (64.21 mg, 411.67 μmol, 32.93 μL, 1.5 eq.) and K2CO3 (113.79 mg, 823.34 μmol, 3 eq.). The mixture was stirred at 50° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding water (100 mL), and the mixture was extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to obtain the desired product (6.0 mg, 10.44 μmol) as a white solid. MS (ES+, m/z): 575.2.


Preparation of Compounds 823A and 824A: ethyl 4-((3-(4-(((3R,4S)-1-ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate was separated by SFC to obtain the desired products as white solids. ethyl 4-{[3-(4-{[(3R,4S)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, MS (ES+, m/z): 575.2; ethyl 4-{[3-(4-{[(3S,4R)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, MS (ES+, m/z): 575.2.


Example D102
Synthesis of Compounds 872A and 873A



embedded image


Preparation of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To the mixture of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 g, 2.94 mmol, 1 eq.) and 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (1.41 g, 5.88 mmol, 2 eq.) in DMSO (15 mL) were added into N-isopropylpropan-2-amine (2.98 g, 29.40 mmol, 4.16 mL, 10 eq.), Pd(dppf)Cl2 (215.16 mg, 294.05 μmol, 0.1 eq.), and CuI (560.01 mg, 2.94 mmol, 1 eq.) under N2. The mixture was stirred for 2 h at 45° C. LC-MS and TLC analysis (PE:EtOAc=1:1) showed that the reaction was complete. The reaction mixture was quenched by adding saturated aqueous EDTA (100 mL) at 25° C., and the resulting mixture was extracted with EtOAc (50 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by column chromatography (PE:EtOAc=2:1 to 1:1) to afford the desired product (0.8 g, 1.68 mmol, 57.25% yield) as a light yellow solid. MS (ES+, m/z): 452.0.


Preparation of tert-butyl 3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a mixture of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (360.89 mg, 1.66 mmol, 2.5 eq.) and 2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (300 mg, 664.51 μmol, 1 eq.) in DMF (6 mL) was added TMSCl (180.48 mg, 1.66 mmol, 210.84 μL, 2.5 eq.). The mixture was stirred at 0° C. for 2 h, and BH3.THF (1 M, 3.32 mL, 5 eq.) was added to the reaction under N2. The mixture was stirred at 20° C. for 2 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous Na2CO3 (30 mL) solution, diluted with water (10 mL), and extracted with EtOAc (20 mL×2). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-HPLC to give the desired product (160 mg, 245.14 μmol, 36.89% yield) as a yellow solid. MS (ES+, m/z): 653.2.


Preparation of N-(3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of tert-butyl 3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (80 mg, 122.57 μmol, 1 eq.) in HCl/EtOAc (4 M, 8 mL, 261.08 eq.) was stirred at 25° C. for 10 min. LC-MS analysis showed that the reaction was complete. The solution was dried in vacuo to give the crude product. The crude product was neutralized by adding saturated aqueous Na2CO3 (100 mL) and extracted with EtOAc (20 mL). The combined organic layers were washed with brine (100 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give the crude product (80 mg, crude) as a light yellow solid. MS (ES+, m/z): 553.1.


Preparation of final products: To a solution of N-(3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (60 mg, 108.58 μmol, 1 eq.) in EtOH (3 mL) was added 2-(methoxymethyl)oxirane (57.40 mg, 651.49 μmol, 57.98 μL, 6 eq.). The mixture was stirred at 90° C. for 2 h under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was concentrated in vacuo, and the crude residue was purified by prep-HPLC to give the desired products as yellow solids.


1-((3S,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, 25 mg, 35.0% yield, MS (ES+, m/z): 641.2; and 1-((3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, 25 mg, 35.0% yield, MS (ES+, m/z): 641.2.


Example D103
Synthesis of Compounds 733A and 734A



embedded image


embedded image


Preparation of tert-butyl (3S,4S)-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidine-1-carboxylate and tert-butyl (3R,4S)-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidine-1-carboxylate: To a mixture of 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (2.5 g, 7.35 mmol, 1 eq.) and tert-butyl 3-methyl-4-oxo-piperidine-1-carboxylate (4.70 g, 22.05 mmol, 3 eq.) in EtOH (25 mL) was added Ti(OEt)4 (8.38 g, 36.76 mmol, 7.62 mL, 5 eq.). The mixture was stirred at 50° C. for 12 h, and NaBH3CN (2.31 g, 36.76 mmol, 5 eq.) was added to the reaction mixture. The resulting reaction mixture was stirred at 50° C. for 1 h. LC-MS and TLC analysis showed that the reaction was complete. The reaction was poured saturated aqueous solution of Na2CO3 (8 mL) at 0° C., and the resulting mixture was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:0 to 10:1) and prep-HPLC to afford the desired products as grey solids.


Preparation of 2-iodo-N-((3S,4S)-3-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of tert-butyl (3S,4S)-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-methylpiperidine-1-carboxylate (490 mg, 911.87 μmol, 1 eq.) in DCM (6 mL) was added TFA (3.08 g, 27.01 mmol, 2 mL, 29.62 eq.). The mixture was stirred at 25° C. for 0.5 h. TLC analysis showed that the reaction was complete. Saturated aqueous Na2CO3 (20 mL) was added to the mixture to adjust the pH of the mixture to 9, and the resulting mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to obtain the desired product (0.36 g, crude) as a brown solid.


Preparation of N-((3S,4S)-1,3-dimethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-iodo-N-((3S,4S)-3-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.28 g, 640.38 μmol, 1 eq.) and formaldehyde (38.46 mg, 1.28 mmol, 35.28 μL, 2 eq.) in MeOH (6 mL) was added AcOH (38.46 ug, 0.64 μmol, 3.66e-2 μL, 0.001 eq.). The mixture was then stirred at 50° C. for 1 h, and NaBH3CN (201.21 mg, 3.20 mmol, 5 eq.) was added to the reaction. The reaction mixture was stirred further at 50° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was poured into to water (15 mL), and the resulting mixture was extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to afford the desired product (0.24 g, 531.84 μmol, 83.05% yield) as a yellow solid. MS (ES+, m/z): 452.1.


Preparation of N-((3S,4S)-1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (127.26 mg, 531.84 μmol, 1.2 eq.) in DMSO (2 mL) were added N-isopropylpropan-2-amine (448.47 mg, 4.43 mmol, 626.36 μL, 10 eq.), CuI (84.41 mg, 443.20 μmol, 1 eq.), N-((3S,4S)-1,3-dimethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.2 g, 443.20 μmol, 1 eq.), and Pd(PPh3)4 (204.86 mg, 177.28 μmol, 0.4 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction was diluted with EtOAc (15 mL), and the resulting mixture was poured into saturated aqueous EDTA (15 mL) and stirred at 25° C. for 1 h. The mixture was extracted with EtOAc (10 mL), and The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to obtain the desired product (0.1 g, 177.73 μmol, 40.10% yield) as a yellow solid.


Preparation of final products: N-((3S,4S)-1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine was purified by SFC to obtain the final products. N-((3S,4S)-1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.0224 g, 39.81 μmol), MS (ES+, m/z): 563.2; and N-((3R,4R)-1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.0222 g, 39.26 μmol), MS (ES+, m/z): 563.3.


Example D104
Synthesis of Compounds 736A and 737A



embedded image


embedded image


Preparation of 2-iodo-N-((3R,4S)-3-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of tert-butyl (3R,4S)-4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-3-methyl-piperidine-1-carboxylate (0.5 g, 930.48 μmol, 1 eq.) in DCM (3 mL) was added TFA (7.70 g, 67.53 mmol, 5 mL, 72.58 eq.). The mixture was stirred at 25° C. for 0.5 h. TLC analysis showed that the reaction was complete. Saturated aqueous Na2CO3 (20 mL) was added to the reaction to adjust the pH of the mixture to 9, and the mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product (0.4 g, crude) was obtained as a yellow solid and used in the next step without purification.


Preparation of N-((3R,4S)-1,3-dimethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-iodo-N-((3R,4S)-3-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.35 g, 800.47 μmol, 1 eq.) and formaldehyde (120.17 mg, 4 mmol, 110.25 μL, 5 eq.) in MeOH (3 mL) was added AcOH (48.07 ug, 0.8 μmol, 4.58e-2 μL, 0.001 eq.). The mixture was stirred at 50° C. for 1 h, and NaBH3CN (251.51 mg, 4 mmol, 5 eq.) was added to the reaction. The reaction mixture was stirred further at 50° C. for 1 h. TLC analysis showed that the reaction was complete. The reaction mixture was poured into water (10 mL) and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) to obtain the desired product (0.13 g, 288.08 μmol, 35.99% yield) as a yellow solid.


Preparation of N-((3R,4S)-1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (63.63 mg, 265.92 μmol, 1.2 eq.) in DMSO (2 mL) were added N-isopropylpropan-2-amine (224.24 mg, 2.22 mmol, 313.18 μL, 10 eq.) and CuI (42.20 mg, 221.60 μmol, 1 eq.), N-((3R,4S)-1,3-dimethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 221.60 μmol, 1 eq.), and Pd(PPh3)4 (102.43 mg, 88.64 μmol, 0.4 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis showed that the reaction was complete. The reaction mixture was diluted with EtOAc (15 mL), and the resulting mixture was poured into saturated aqueous EDTA solution (15 mL) and stirred further at 25° C. for 1 h. The mixture was extracted with EtOAc (10 mL×3), and The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to obtain the desired product (27.80 mg, 49.41 μmol, 22.30% yield) as a white solid.


Preparation of final products: N-((3R,4S)-1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine was purified by SFC to obtain the desired products as white solids. N-((3R,4S)-1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 563.2; and N-((3S,4R)-1,3-dimethylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 563.3.


Example D105
Synthesis of Compounds 780A and 781A



embedded image


A mixture of methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate, NaBH3CN (53.10 mg, 845.02 μmol, 3 eq.), AcOH (16.91 mg, 281.67 μmol, 16.11 μL, 1 eq.). and formaldehyde (84.59 mg, 2.82 mmol, 10 eq.) in MeOH (3 mL) was stirred at 20° C. for 16 h under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.65) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding water (10 mL) and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to afford methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.07 g, 121.67 μmol, 43.20% yield) as a yellow solid.


Methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate was separated by SFC to give the desired final products as yellow solids. 4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (0.03 g, 54.23 μmol, 42.34% yield), MS (ES+, m/z): 533.2; and 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (0.03 g, 54.67 μmol, 42.69% yield), MS (ES+, m/z): 533.2.


Example D106
Synthesis of Compounds 832A and 833A



embedded image


To a solution of methyl 4-((3-(4-((3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate(0.18 g, 329.34 μmol, 1 eq) in MeOH (20 mL) was added LiOH.H2O (20 mL, 10 μmol/L, 10 mL), and the reaction mixture was stirred at 50° C. for 16 h under N2. TLC analysis (EtOAc:TEA=10:1, Rf=0.01) indicated that the starting material remained, and one major new spot was detected. The reaction mixture was quenched by adding EtOAc (30 mL), and the resulting mixture was further extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by prep-HPLC to obtain the desired product as a yellow solid (0.1 g, 54.17% yield).


rac-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid, MS (ES+, m/z): 533.2; and rac-4-{[3-(4-{[(3R,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, MS (ES+, m/z): 533.1.


Example D107
Synthesis of Compounds 874A and 875A



embedded image


Preparation of methyl 4-((3-(4-((3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of methyl 4-((3-(4-((3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.5 g, 938.92 μmol, 1 eq.) and (2R)-2-(methoxymethyl)oxirane (413.62 mg, 4.69 mmol, 417.79 μL, 5 eq.) in DMF (5 mL) was added K2CO3 (389.29 mg, 2.82 mmol, 3 eq.). The mixture was stirred at 50° C. for 12 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.75) detected one major new spot. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the desired m/z or desired mass was detected. The reaction mixture was quenched by adding water (40 mL) and extracted with EtOAc (35 mL×3). The combined organic layers were washed with brine (25 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography to afford the desired product (0.35 g, 420.70 μmol, 44.81% yield) as a yellow solid. MS (ES+, m/z): 621.4.


Preparation of 4-((3-(4-((3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid: A mixture of methyl 4-((3-(4-((3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.1 g, 161.13 μmol, 1 eq.) and LiOH.H2O (67.61 mg, 1.61 mmol, 10 eq.) in water (0.5 mL) and MeOH (3 mL) was stirred at 50° C. for 12 h under N2 atmosphere. TLC analysis (EtOAc:TEA=10:1, Rf=0) indicated that the starting material was consumed completely. Several new peaks were shown on LC-MS, and the desired compound was detected. The reaction mixture was quenched by adding EtOAc (30 mL) and extracting the mixture further with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. LC-MS and HPLC analysis showed that the reaction was complete. The residue was purified by prep-HPLC to obtain the desired products as blue solids.


4-((3-(4-(((3R,4S)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid, (35 mg) MS (ES+, m/z): 607.2; and 4-((3-(4-(((3S,4S)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid, (35 mg) MS (ES+, m/z): 607.3.


Example D108
Synthesis of Compounds 876A and 877A



embedded image


Preparation of 4-((3-(4-(((3R,4S)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid: A solution of methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.2 g, 322.25 μmol, 1 eq) and LiOH.H2O (135.23 mg, 3.22 mmol, 10 eq.) in MeOH (15 mL) and water (3 mL) was stirred at 20° C. for 12 h under N2. TLC analysis (EtOAc: TEA=10:1, Rf=0) indicated that the starting material was consumed completely. The reaction mixture was quenched by adding EtOAc (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:THF=3:1) to obtain 4-((3-(4-(((3R,4S)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.11 g, 170.46 μmol, 52.90% yield) was obtained as a yellow oil.


Preparation of final products: 4-((3-(4-(((3R,4S)-3-Fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid was separated by SFC to obtain the desired products. 4-((3-(4-(((3R,4S)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid, MS (ES+, m/z): 607.3; and 4-((3-(4-(((3S,4R)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid, MS (ES+, m/z): 607.3.


Example D109
Synthesis of Compounds 940A, 942A, 943A, 945A, 946A, and 947A



embedded image


embedded image


Preparation of 4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl trifluoromethanesulfonate: To a solution of 4-bromo-1-(2,2,2-trifluoroethyl)indolin-2-one (10 g, 34.01 mmol, 1 eq.) and 2,6-lutidine (4.37 g, 40.81 mmol, 4.75 mL, 1.2 eq.) in DCM (100 mL) was added trifluoromethylsulfonyl trifluoromethanesulfonate (9.59 g, 34.01 mmol, 5.61 mL, 1 eq.) dropwise at 25° C., and the reaction mixture was stirred at 25° C. for 2 h. TLC analysis showed that the reaction was complete. The reaction mixture was poured into a saturated aqueous solution of NH4Cl (100 mL). The aqueous phase was extracted with DCM (60 mL×3) and washed with saturated aqueous NaHCO3 (100 mL). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered and concentrated on vacuum. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:0 to 100:1, Rf=0.5) to afford [4-bromo-1-(2,2,2-trifluoroethyl)indol-2-yl]trifluoromethanesulfonate (13.0 g, 27.46 mmol, 81% yield) as a yellow solid.


Preparation of methyl 4-((3-(4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate: To a solution of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxybenzoate (3.20 g, 10.03 mmol, 0.9 eq.) in DMSO (50 mL) were added i-Pr2NH (11.28 g, 111.47 mmol, 15.75 mL, 10 eq.), CuI (106.15 mg, 557.34 μmol, 0.05 eq.), and 4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl trifluoromethanesulfonate (5 g, 11.15 mmol, 1 eq.) at 20° C. Then, Pd(PPh3)4 (644.04 mg, 557.34 μmol, 0.05 eq.) was added to the reaction, and the mixture was purged with N2 three times. The mixture was then stirred at 25° C. for 1 h. TLC analysis (PE:EtOAc=5:1, Rf=0.3) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding saturated aqueous EDTA (500 mL), and the resulting mixture was extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (200 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=15:1 to 8:1) to obtain the desired product (6.2 g, 8.85 mmol, 79.40% yield) as a yellow solid.



1H NMR: (400 MHz, DMSO-d6) δ ppm 1.28-1.41 (m, 9H) 3.86 (s, 3H) 3.88 (s, 3H) 4.48-4.78 (m, 2H) 5.05 (q, J=8.63 Hz, 2H) 6.74-6.78 (m, 1H) 7.18-7.25 (m, 1H) 7.34-7.48 (m, 5H) 7.57-7.64 (m, 3H).


Preparation of methyl 4-((tert-butoxycarbonyl)(3-(4-1((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a mixture of methyl 4-((3-(4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate (5 g, 8.40 mmol, 1 eq.), (3S,4R)-3-fluoro-1-methylpiperidin-4-amine hydrochloride (1.89 g, 9.24 mmol, 1.1 eq., 2HCl), and Cs2CO3 (10.94 g, 33.59 mmol, 4 eq.) in dioxane (50 mL) were added RuPhos (548.62 mg, 1.18 mmol, 0.14 eq.) and BrettPhos (Pd, G4) (541.12 mg, 587.84 μmol, 0.07 eq.) at 20° C. The resulting mixture was purged with N2 three times and stirred at 95° C. for 38 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.3) indicated that 10% of the starting material remained, and one major new spot with polarity greater than that of the starting material was detected. The reaction mixture was quenched by adding saturated aqueous EDTA (500 mL). The mixture was extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine (100 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=8:1 to 0:1), and the crude product was triturated with MTBE:PE=10 mL:5 mL at 25° C. for 12 h to afford the desired product (3 g, 4.54 mmol, 54.03% yield) as a yellow solid.



1H NMR: (400 MHz, DMSO-d6) δ ppm 1.22-1.52 (m, 9H) 1.64-1.76 (m, 1H) 1.87-1.99 (m, 1H) 2.08 (br t, J=11.58 Hz, 1H) 2.14-2.30 (m, 4H) 2.77-2.86 (m, 1H) 2.96-3.06 (m, 1H) 3.47-3.66 (m, 1H) 3.83-3.90 (m, 6H) 4.52-4.72 (m, 2H) 4.75 (br s, 1H) 4.80-4.97 (m, 3H) 5.49-5.59 (m, 1H) 6.20-6.29 (m, 1H) 6.69-6.83 (m, 1H) 6.98-7.08 (m, 1H) 7.20 (d, J=2.21 Hz, 1H) 7.38-7.46 (m, 1H) 7.59 (br d, J=3.53 Hz, 2H).


Preparation of methyl 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: A solution of methyl 4-((tert-butoxycarbonyl)(3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (3 g, 4.50 mmol, 1 eq.) was prepared in HCl/EtOAc (4 M, 90 mL), and the mixture was stirred at 25° C. for 1 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.4) indicated that the starting material was consumed completely, and one major new spot with polarity greater than that of the starting material was detected. The mixture was filtered, and the filter cake was diluted with saturated aqueous Na2CO3 (200 mL) and extracted with EtOAc (80 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude product (2.5 g, crude) was obtained as a yellow solid and used in the next step without purification.


Preparation of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid: To a solution of methyl 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (2.5 g, 4.57 mmol, 1 eq.), LiOH.H2O (2.88 g, 68.61 mmol, 15 eq.), and NaOH (731.80 mg, 18.30 mmol, 4 eq.) in THF (20 mL), MeOH (20 mL), and water (20 mL) was stirred at 50° C. for 5 h. TLC analysis (EtOAc:MeOH=2:1, Rf=0.3) showed that the reaction was complete. The reaction mixture was concentrated to remove MeOH and THF. Water (100 mL) was added to the residue, and 0.5 M HCl was added to adjust the pH of the mixture to pH=5. The mixture with extracted with EtOAc (200 mL×12). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The crude product was triturated with ACN:MTBA=10 mL:80 mL at 25° C. for 60 min to obtain the desired product (1.9 g, 3.53 mmol, 77.14% yield) as a yellow solid.


1H NMR: (400 MHz, DMSO-d6) δ ppm 1.88-1.99 (m, 1H) 2.12-2.27 (m, 1H) 2.70-2.82 (m, 3H) 3.12-3.22 (m, 1H) 3.38-3.58 (m, 2H) 3.65-3.78 (m, 1H) 3.80-3.97 (m, 4H) 4.27-4.44 (m, 2H) 4.84-5.00 (m, 2H) 5.02-5.18 (m, 1H) 5.70-5.82 (m, 1H) 6.23-6.35 (m, 2H) 6.75-6.83 (m, 2H) 6.96-7.07 (m, 1H) 7.14-7.23 (m, 1H) 7.29-7.37 (m, 1H) 7.52 (d, J=8.19 Hz, 1H) 10.14-10.47 (m, 1H) 12.08-12.40 (m, 1H).


Preparation of final products: To a mixture of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.07 g, 131.45 μmol, 1 eq.), R-amine (11.85 mg, 262.90 μmol, 17.20 μL, 2 eq.), TEA (66.51 mg, 657.24 μmol, 91.48 μL, 5 eq.) in DCM (3 mL) DMF (3 mL) was added T3P (209.12 mg, 657.24 μmol, 195.44 μL, 5 eq.). The mixture was stirred at 20° C. for 1 h under N2 atmosphere. TLC analysis indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding water (5 mL) and extracted with EtOAc (5 mL×3). The combined organic layers were washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to afford the desired products as yellow solids.


N-ethyl-4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide, 28.0 mg, 37.7% yield, MS (ES+, m/z): 560.2; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N,N-dimethylbenzamide, 28.0 mg, 38.0% yield, MS (ES+, m/z): 560.3; N-ethyl-4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxy-N-methylbenzamide, 38.7% yield, MS (ES+, m/z): 588.3; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-(2-methoxyethyl)benzamide, 29.0 mg, 37% yield, MS (ES+, m/z): 590.2; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(2-hydroxyethyl)-3-methoxybenzamide, 30.0 mg,31.3% yield, MS (ES+, m/z): 576.3; and N-[2-(diethylamino)ethyl]-4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide, 24.0 mg, 28.7% yield, MS (ES+, m/z): 631.4.


Example D110
Synthesis of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(3-hydroxy-2-methoxypropyl)-3-methoxybenzamide (Compound 966A)



embedded image


Preparation of 2-(3-(benzyloxy)-2-hydroxypropyl)isoindoline-1,3-dione: To a solution of phthalimide (2 g, 13.59 mmol, 1 eq.) and 2-(benzyloxymethyl)oxirane (2.68 g, 116.31 mmol, 2.48 mL,1.2 eq.) in EtOH (20 mL) was added K2CO3 (150.30 mg, 1.09 mmol, 0.08 eq.). The mixture was stirred at 80° C. for 12 h. LC-MS and TLC analysis (PE:EtOAc=2:1, Rf=0.35) showed that the reaction was complete. The reaction mixture was concentrated in vacuo and purified by column chromatography (SiO2, PE:EtOAc=5:1 to 3:1, Rf=0.3) to obtain the desired product (3 g, 9.64 mmol, 70.89% yield) as a light yellow oil. 1H NMR (400 MHz, DMSO-d6) δ=7.87-7.82 (m, 4H), 7.31-7.24 (m, 5H), 5.15 (d, J=4.2 Hz, 1H), 4.47 (s, 2H), 4.01-3.99 (m, 2H), 3.63-3.61 (m, 2H), 3.46-3.41 (m, 2H)


Preparation of 2-(3-(benzyloxy)-2-methoxypropyl)isoindoline-1,3-dione: To a solution of 2-(3-(benzyloxy)-2-hydroxypropyl)isoindoline-1,3-dione (2.5 g, 8.03 mmol, 1 eq.) in DMF (30 mL) was added NaH (481.80 mg, 12.05 mmol, 1.5 eq.) at 0° C. under N2. The mixture was stirred for 0.5 h, and MeI (2.28 g, 16.06 mmol, 999.81 μL, 2 eq.) was added dropwise to the reaction. The resulting reaction mixture was stirred at 25° C. for 1 h. TLC analysis (PE:EtOAc=2:1, Rf=0.4) showed that the reaction was complete. The reaction mixture was poured into a saturated aqueous solution of NH4Cl (100 mL), and the aqueous phase was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (40 mL×1), dried over anhydrous Na2SO4, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=10:1 to 7:1, Rf=0.4) to afford the desired product (1 g, 3.07 mmol, 38.28% yield) as a light yellow oil.


Preparation of 3-(benzyloxy)-2-methoxypropan-1-amine: To a solution of 2-(3-(benzyloxy)-2-methoxypropyl)isoindoline-1,3-dione (1 g, 3.07 mmol, 1 eq.) in EtOH (20 mL) was added N2H4H2O (314 mg, 6.15 mmol, 304.86 μL, 2 eq.) at 50° C. under N2. The mixture was stirred at 80° C. for 2 h. LC-MS analysis showed that 20% of the starting material remained, and 65% of the desired product was detected. The reaction mixture was concentrated in vacuo and purified by prep-HPLC to obtain the desired product 0.2 g, 1.02 mmol, 33.33% yield as a light yellow oil.


Preparation of 3-amino-2-methoxypropan-1-ol: To a solution of 3-(benzyloxy)-2-methoxypropan-1-amine (0.1 g, 512.14 μmol, 1 eq.) in EtOH (2 mL) was added Pd/C (0.1 g, 93.97 μmol, 10% purity, 1.83e-1 eq.). The mixture was stirred at 40° C. for 8 h and filtered through a pad of silica. The crude residue was purified by prep-HPLC to give the desired product (50 mg) as a colorless oil.




embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.08 g, 150.23 μmol, 1 eq.) in DMF (5 mL) were added TEA (45.60 mg, 450.68 μmol, 62.73 μL, 3 eq.) and HATU (85.68 mg, 225.34 μmol, 1.5 eq.) at 25° C. The mixture was stirred for 0.5 h, and 3-amino-2-methoxy-propan-1-ol (17.37 mg, 165.25 μmol, 47.85 μL, 1.1 eq.) was added and the mixture. The resulting mixture was stirred at 50° C. for 1 h. LC-MS and HPLC analysis showed that the reaction was complete. The mixture was purified directly using prep-HPLC to obtain the desired product as a yellow solid. 31.0 mg, 28% yield, MS (ES+, m/z): 620.3.


Example D111
Synthesis of 1-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxyphenyl)formamido]-3-[(2-methylpropanoyl)oxy]propan-2-yl 2-methylpropanoate (Compound 967A)



embedded image


To a solution of N-(2,3-dihydroxypropyl)-4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzamide (80 mg, 132.10 μmol, 1 eq.) in DCM (3 mL) and CHCl3 (3 mL) were added TEA (40.10 mg, 396.29 μmol, 55.16 μL,3 eq.) and 2-methylpropanoyl 2-methylpropanoate (43.88 mg, 277.40 μmol, 46 μL, 2.1 eq.) at 25° C. The mixture was stirred at 60° C. for 16 h. LC-MS analysis detected the desired product. The mixture was concentrated, and the residue was purified by prep-HPLC to give the desired product as a yellow oil (28.0 mg, 28% yield). MS (ES+, m/z): 746.3.


Example D112
Synthesis of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-[(2-oxo-1,3-dioxolan-4-yl)methyl]benzamide (Compound 968A)



embedded image


To a solution of N-(2,3-dihydroxypropyl)-4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzamide (0.08 g, 132.10 μmol, 1 eq.) in toluene (5 mL) were added TEA (40.10 mg, 396.29 μmol, 55.16 μL, 3 eq.) and CDI (44.98 mg, 277.40 μmol, 2.1 eq.) at 25° C. The mixture was stirred at 50° C. for 12 h. LC-MS and HPLC analysis showed that the reaction was complete. The mixture was concentrated, and the residue was purified by prep-HPLC to give the desired product as a yellow solid (26.0 mg, 29.9% yield). MS (ES+, m/z): 632.2.


Example D113
Preparation of Compound 461A



embedded image


Synthesis of tert-butyl 4-((2-(3-((2-(cyanomethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a solution of 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetonitrile (prepared according to EXAMPLE A4) (101.01 mg, 305.73 μmol, 2 eq.) in DMSO (1 mL) were added i-Pr2NH (464.06 mg, 4.59 mmol, 648.13 μL, 30 eq.), CuI (58.23 mg, 305.73 μmol, 2 eq.), tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (80 mg, 152.87 μmol, 1 eq.), and Pd(PPh3)4 (44.16 mg, 38.22 μmol, 0.25 eq.). The mixture was stirred at 25° C. for 1 h under N2. TLC analysis (DCM:MeOH=20:1, Rf=0.5) indicated that the starting material was consumed completely. The mixture was poured into a saturated aqueous EDTA solution (20 mL), stirred at 25° C. for 1 h, and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (DCM:MeOH=20:1, Rf=0.5) to afford desired compound tert-butyl 4-((2-(3-((2-(cyanomethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (80 mg, 103.07 μmol, 67.43% yield) as a yellow solid.


Synthesis of final product: To a solution of compound tert-butyl 4-((2-(3-((2-(cyanomethoxy)-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (30 mg, 38.65 μmol, 1 eq.) in DCM (1 mL) was added formic acid (732 mg, 15.90 mmol, 600 μL, 411.46 eq.). The mixture was stirred at 25° C. for 1 h, after which time LC-MS analysis indicated that the Boc-protected piperidine was consumed completely. The mixture was concentrated under reduced pressure to give a residue that was purified by prep-HPLC to afford 2-{5-methanesulfonyl-2-[(3-{4-[(piperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]phenoxy}acetonitrile (13.2 mg, 20.38 μmol, 52.72% yield) as a yellow solid. MS (ES+, m/z): 560.2.


Example D114
Preparation of Compound 715A



embedded image


Synthesis of (S)-1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-yl propionate: To a solution of (S)-1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (prepared according to the first step of EXAMPLE D142 using (S)-glycidyl methyl ether in place of racemic glycidyl methyl ether) (1.5 g, 2.79 mmol, 1 eq.) in DCM (50 mL) was added propionic anhydride (435.23 mg, 3.34 mmol, 430.92 μL, 1.2 eq.). The mixture was stirred at 45° C. for 4 h. after which time TLC analysis (PE:EtOAc=1:1, Rf=0.5) indicated that the reaction was complete. The mixture was concentrated in vacuo, and the residue was purified by column chromatography (SiO2, PE:EtOAc=5:1 to 0:1, Rf=0.5) to afford of (S)-1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-yl propionate (2 g, 3.17 mmol, 56.92% yield) as a light yellow oil. MS (ES+, m/z): 568.1.


Synthesis of final product: To a solution of 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (830.67 mg, 3.43 mmol, 1.2 eq.) in DMSO (25 mL) was added diisopropylamine (2.89 g, 28.55 mmol, 4.04 mL, 10 eq.) and CuI (108.76 mg, 571.04 μmol, 0.2 eq.), followed by (S)-1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-yl propionate (1.8 g, 2.86 mmol, 1 eq.) and Pd(PPh3)4(164.97 mg, 142.76 μmol, 0.05 eq.) under N2. The mixture was stirred at 25° C. for 1 h, after which time TLC analysis (PE:EtOAc=0:1, Rf=0.3) indicated that the reaction was complete. The residue was poured into a saturated aqueous EDTA solution (200 mL) and stirred for 1 h, and extracted with EtOAc (100 mL×3). The combined organic layers were washed with brine (100 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:1 to 0:1, Rf=0.3), and then further purified by prep-HPLC to afford the desired product (3.78 g, 5.49 mmol, 93.08% yield) as a light yellow solid.


(2S)-1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-yl propanoate; 1H NMR (400 MHz, DMSO-d6) δ ppm 1.04 (t, J=7.52 Hz, 3H) 1.33-1.52 (m, 2H) 1.74-1.98 (m, 2H) 2.05-2.20 (m, 2H) 2.26-2.31 (m, 2H) 2.43 (br d, J=5.01 Hz, 3H) 2.59-2.73 (m, 1H) 2.77-2.99 (m, 2H) 3.09 (s, 4H) 3.25 (s, 3H) 3.30 (br s, 1H) 3.44 (d, J=4.65 Hz, 2H) 3.89 (s, 3H) 4.35 (br d, J=6.11 Hz, 2H) 4.92 (q, J=8.97 Hz, 2H) 5.00-5.12 (m, 1H) 5.47 (br d, J=7.95 Hz, 1H) 6.15 (d, J=7.83 Hz, 1H) 6.49 (t, J=6.30 Hz, 1H) 6.67 (br d, J=8.31 Hz, 1H) 6.89 (d, J=8.44 Hz, 1H) 6.94-7.04 (m, 1H) 7.07 (s, 1H) 7.25 (d, J=1.83 Hz, 1H) 7.38 (dd, J=8.31, 1.83 Hz, 1H) 7.35-7.43 (m, 1H). MS (ES+, m/z): 679.3.


Example D115
Preparation of Compound 638A



embedded image


Compound 638A was prepared via a procedure analogous to the synthesis of Compound 715A according to EXAMPLE D114, using isobutyric anhydride in place of propionic anhydride.


(2 S)-1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-yl 2-methylpropanoate ; 1H NMR (400 MHz, DMSO-d6) δ ppm 1.09 (dd, J=10.45, 6.91 Hz, 6H) 1.34-1.50 (m, 2H) 1.89 (br s, 2H) 2.01-2.22 (m, 2H) 2.33 (br s, 2H) 2.43 (br s, 2H) 2.76-2.94 (m, 2H) 3.09 (s, 3H) 3.25 (s, 3H) 3.30 (br s, 1H) 3.44 (br d, J=4.65 Hz, 2H) 3.89 (s, 3H) 4.35 (br d, J=5.99 Hz, 2H) 4.92 (q, J=8.56 Hz, 2H) 5.07 (br d, J=5.50 Hz, 1H) 5.47 (br d, J=7.83 Hz, 1H) 6.14 (br d, J=7.83 Hz, 1H) 6.49 (br t, J=6.24 Hz, 1H) 6.67 (br d, J=8.19 Hz, 1H) 6.89 (d, J=8.44 Hz, 1H) 6.99 (br t, J=7.95 Hz, 1H) 7.08 (s, 1H) 7.25 (d, J=1.59 Hz, 1H) 7.38 (br d, J=6.85 Hz, 1H). MS (ES+, m/z): 693.4.


Example D116
Preparation of Compound 482A



embedded image


Synthesis of 2-iodo-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 1-methylpiperidin-4-one (8.32 g, 73.51 mmol, 8.55 mL, 5 eq.) and 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (5 g, 14.70 mmol, 1 eq.) in toluene (100 mL) was added Ti(OEt)4 (6.71 g, 29.40 mmol, 6.10 mL, 2 eq.) under N2. The reaction mixture was stirred at 110° C. for 1 h. The reaction mixture was then concentrated, and the resulting residue was dissolved with MeOH (100 mL). Then, NaBH4 (1.11 g, 29.40 mmol, 2 eq.) was added and stirred at 40° C. for 16 h. TLC analysis (PE:EtOAc=0:1, Rf=0.0) showed that the starting material was consumed completely. The reaction mixture was filtered, and the filter cake was washed with DCM (200 mL×2). The combined organic layers were washed with brine (200 mL), dried over anhydrous sodium sulfate, filtered and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 0:1) to obtained product (6.5 g, 14.12 mmol, 48.03% yield) as light yellow solid.



1H NMR (400 MHz, DMSO-d6) δ ppm 1.17 (t, J=7.09 Hz, 1H) 1.40-1.55 (m, 2H) 1.91 (br d, J=11.13 Hz, 2H) 1.97 (br d, J=1.71 Hz, 1H) 1.99-2.05 (m, 2H) 2.17 (s, 3H) 2.76 (br d, J=11.74 Hz, 2H) 3.25 (br s, 1H) 4.03 (q, J=7.13 Hz, 1H) 4.98 (q, J=8.97 Hz, 2H) 5.40 (d, J=8.07 Hz, 1H) 6.15 (d, J=7.82 Hz, 1H) 6.77 (d, J=8.19 Hz, 1H) 6.90 (t, J=8.01 Hz, 1H) 7.16 (s, 1H).


Synthesis of final product: To a solution of 3-methoxy-N-methyl-4-(prop-2-ynylamino)benzamide (1.11 g, 5.10 mmol, 1.2 eq.) in DMSO (40 mL) was added diisopropylamine (4.30 g, 42.54 mmol, 6.01 mL, 10 eq.) and CuI (162.03 mg, 850.79 μmol, 0.2 eq.) under N2, followed by 2-iodo-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (2 g, 4.25 mmol, 1 eq.) and Pd(PPh3)4 (245.78 mg, 212.70 μmol, 0.05 eq.). The mixture was stirred at 45° C. for 1 h, after which time TLC analysis (DCM:MeOH=10:1, Rf=0.3) indicated that the reaction was complete. The residue was poured into a saturated aqueous EDTA solution (50 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (30 mL×3), and the combined organic layers were washed with brine (40 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=2:1 to DCM:MeOH=10:1, Rf=0.3) and then further purified by prep-HPLC. The concentrated eluate was then combined with saturated aqueous Na2CO3 (50 mL) to adjust the pH of the solution to 8, stirred for 1 h, and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (40 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to provide the desired product (3.04 g, 5.67 mmol, 88.16% yield) as a light yellow solid.


3-methoxy-N-methyl-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide: 1H NMR (400 MHz, DMSO-d6) δ ppm 1.41-1.56 (m, 2H) 1.92 (br d, J=11.37 Hz, 2H) 2.06 (br d, J=11.00 Hz, 2H) 2.20 (s, 3H) 2.72-2.84 (m, 5H) 3.23-3.29 (m, 1H) 3.84 (s, 3H) 4.31 (br d, J=6.24 Hz, 2H) 4.90 (q, J=9.05 Hz, 2H) 5.48 (d, J=7.95 Hz, 1H) 5.98 (t, J=6.36 Hz, 1H) 6.15 (d, J=7.70 Hz, 1H) 6.67 (d, J=8.07 Hz, 1H) 6.75 (d, J=8.31 Hz, 1H) 6.99 (t, J=7.95 Hz, 1H) 7.06 (s, 1H) 7.35 (d, J=1.59 Hz, 1H) 7.42 (dd, J=8.25, 1.53 Hz, 1H) 8.10 (br d, J=4.52 Hz, 1H). MS (ES+, m/z): 528.2.


Example D117
General Procedure for Preparation of Compounds 586A, 587A,588A, and 589A



embedded image


Step 1: To a mixture of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol (200 mg, 361.96 μmol, 1 eq.) in DCM (3 mL) was added propanoyl propanoate (117.76 mg, 904.90 μmol, 116.60 μL, 2.5 eq.). The mixture was stirred at ˜50° C. for ˜5 h. TLC and LC-MS analysis indicated that the starting material was consumed completely. The reaction was partitioned between water (100 mL) and EtOAc (10 mL) and then extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, and filtered. The filtrate was concentrated in vacuo to provide the desired compounds 120 mg as light brown oils. MS (ES+, m/z): 610.2. The same procedure was repeated to prepare the isobutyryl-protected analogue.


To a mixture of R2-substituted alkyne (31.41 mg, 118.15 μmol, 1.2 eq.) in DMSO (2 mL) were added i-Pr2NH (58.20 mg, 984.54 μmol, 10 eq.), CuI (18.75 mg, 98.45 μmol, 1 eq.), R1-substituted iodoindole (60 mg, 98.45 μmol, 1 eq.), and Pd(PPh3)4 (22.75 mg, 19.69 μmol, 0.2 eq.) at 25° C. The mixture was stirred at 25° C. for 2 h under N2, where after in each case LC-MS and TLC analysis indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (20 mL) and stirring the resulting mixture at 25° C. for 2 h. The reaction was partitioned between water (10 mL) and EtOAc (10 mL), and then extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL×3) dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC, and then further purified by prep-HPLC to give a solution of the desired product. The solution was lyophilized to give the desired compound as a light yellow solid.


1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-(propanoyloxy)propan-2-ylpropanoate, (21.5 mg) MS (ES+, m/z): 721.3; 1-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-(propanoyloxy)propan-2-ylpropanoate, (12.7 mg) MS (ES+, m/z): 722.2; 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-[(2-methylpropanoyl)oxy]propan-2-yl 2-methylpropanoate, (21.4 mg) MS (ES+, m/z): 749.3; and 1-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-[(2-methylpropanoyl)oxy]propan-2-yl 2-methylpropanoate, (23.8 mg) MS (ES+, m/z): 750.3.


Example D118
General Procedure for Preparation of Compounds 590A and 591A



embedded image


Step 1: To a mixture of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (2 g, 4.63 mmol, 1 eq.) in DMF (20 mL) was added 1-bromopropan-2-ol (9.20 g, 46.31 mmol, 10 eq.), and K2CO3 (3.20 g, 23.16 mmol 5 eq.). The mixture was stirred at 50° C. for 12 h, after which time TLC analysis indicated that the starting material was completely consumed. The reaction was partitioned between water (20 mL) and EtOAc (20 mL), and then extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, and filtered. The filtrate was concentrated in vacuo to provide the 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol as a black brown oil (3.8 g).


Step 2: To a mixture of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propan-2-ol (210 mg, 436.32 μmol, 1 eq.) in DCM (3 mL) was added propanoyl propanoate (62.46 mg, 479.96 μmol, 1.1 eq.). The mixture was stirred at 50° C. for 3 h. TLC and LC-MS analysis indicated that the starting material was consumed completely. The reaction was partitioned between water (15 mL) and EtOAc (10 mL), and then extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, and filtered. The filtrate was concentrated in vacuo. The crude product was purified by prep-TLC (PE:EtOAc=0:1, Rf=0.5) to give the product (140 mg, crude) as a light yellow oil. MS (ES+, m/z): 254.9.


Step-Synthesis of final products: To a solution of [2-[4-[[2-iodo-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-1-methyl-ethyl]propanoate (120 mg, 223.32 μmol, 1 eq.) in DMSO (3 mL) were added 3-methoxy-4-(prop-2-ynylamino)benzenesulfonamide (75.75 mg, 267.98 μmol, 1.2 eq.), i-PrNH2 (132 mg, 2.23 mmol, 191.86 μL, 10 eq.), CuI (42.53 mg, 223.32 μmol, 1 eq.) and Pd(PPh3)4 (51.61 mg, 44.66 μmol, 0.2 eq.). The mixture was flushed with N2 and stirred at 25° C. for 2 hrs. TLC analysis (PE:EtOAc=0:1, Rf=0.55) showed that the reaction was complete. The reaction mixture was quenched by adding saturated aqueous EDTA (20 mL) at 25° C. and stirring the resulting mixture for 2 hrs. The mixture was then extracted with EtOAc (10 mL×3).The organic phase was washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo to give the crude product. The residue was purified by prep-TLC (PE:EtOAc=0:1, Rf=0.45), then further purified by prep-HPLC to obtain the final product.


[2-[4-[[2-[3-(2-methoxy-4-sulfamoyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-1-methyl-ethyl]propanoate, 21.9 mg, 14.34% yield, MS (ES+, m/z): 650.2; [2-[4-[[2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-1-methyl-ethyl] propanoate, 6.3 mg, 6.98% yield, MS (ES+, m/z): 649.3; [2-[4-[[2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-1-methyl-ethyl] 2-methylpropanoate, 11.6 mg, 12.11% yield; [2-[4-[[2-[3-(2-methoxy-4-sulfamoyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]-1-piperidyl]-1-methyl-ethyl] 2-methylpropanoate (20 mg, 10.16% yield. MS (ES+, m/z): 663.3.


(rac)-1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-2-ylpropanoate, MS (ES+, m/z): 649.3; and (rac)-1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-2-yl 2-methylpropanoate, MS (ES+, m/z): 663.3.


Example D119
General Procedure for Preparation of Compounds 592A and 594A



embedded image


The desired products were prepared according to the procedure specified in EXAMPLE D117 except that 0.9 equivalents of anhydride O(R1)2 were used.


2-hydroxy-3-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propyl propanoate, MS (ES+, m/z): 665.3; and 2-hydroxy-3-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propyl 2-methylpropanoate, MS (ES+, m/z): 679.3.


Example D120
General Procedure for Preparation of Compounds 853A, 854A, 859A, 860A, 862A, and 863A



embedded image


Synthesis of tert-butyl (3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1.13 g, 3.33 mmol) in DMSO (15 mL) were added i-Pr2NH (2.80 g, 27.71 mmol, 10 eq.), CuI (105.55 mg, 554.20 μmol, 0.2 eq.), tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (1.5 g, 2.77 mmol), and Pd(PPh3)4 (160.10 mg, 138.55 μmol, 0.05 eq.). The mixture was stirred at 40° C. for 1 h under N2 atmosphere, after which time TLC (PE:EtOAc=2:1, Rf(sm)=0.6, Rf(pdt)=0.1) indicated that the starting material was completely consumed, and one new spot had formed. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (30 mL), stirring the mixture at 20° C. for 1 h, diluting the mixture with water (10 mL), and extracting the resulting mixture with EtOAc (20 mL×3). The combined organic layers were washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The resulting residue was purified by column chromatography (SiO2, PE:EtOAc=4:1 to 2:1) to provide tert-butyl (3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate as a yellow solid (1.8 g). 1H NMR (400 MHz, DMSO-d6) δ ppm 1.31-1.43 (18H, m) 1.65-1.74 (1H, m) 1.75-1.86(1H, m) 2.80-3.05 (1H, m) 3.09-3.28 (4H, m) 3.72-3.87 (1H, m) 3.92 (3H, s) 4.04-4.12 (1H, m) 4.16-4.36 (1H, m) 4.50-4.81 (2H, m) 4.82-4.98 (3H, m) 5.54-5.64 (1H, m) 6.25-6.33 (1H, m) 6.70-6.82 (1H, m) 7.00-7.07 (1H, m) 7.16-7.19 (1H, m) 7.51-7.54 (2H, m) 7.57 (1H, s).


The procedure was repeated using tert-butyl (3R,4S)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate in place of tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate to provide (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate.


Synthesis of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of tert-butyl (3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (1.8 g, 2.39 mmol, 1 eq.) in HCl/EtOAc (4 M, 36 mL, 60.23 eq.) was stirred at 20° C. for 1 h under N2 atmosphere. TLC analysis (EtOAc:TEA=10:1, Rf1=0.91, Rf2=0.1) indicated that the starting material was completely consumed, and one new spot was detected. The reaction mixture was quenched with saturated aqueous Na2CO3 (10 mL) and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine as a yellow solid (1.0 g). 1H NMR (400 MHz, DMSO-d6) δ ppm 1.61-1.69 (1H, m) 1.75 (1H, qd, J=12.07, 3.56 Hz) 2.56-2.69 (1H, m) 2.72-2.89 (1H, m) 2.95-3.03 (1H, m) 3.05-3.10 (3H, m) 3.12-3.20 (1H, m) 3.60-3.77 (1H, m) 3.87-3.91 (3H, m) 4.32-4.40 (2H, m) 4.65-4.81 (1H, m) 4.86-5.01 (2H, m) 5.48-5.56 (1H, m) 6.19-6.31 (1H, m) 6.45-6.54 (1H, m) 6.69-6.77 (1H, m) 6.84-6.92 (1H, m) 6.94-7.04 (1H, m) 7.17-7.22 (1H, m) 7.23-7.28 (1H, m) 7.37-7.41 (1H, m).


The procedure was repeated using tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate in place of tert-butyl (3S,4R)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate to provide N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine.


Synthesis of final products: To a solution of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.05 g, 90.48 1 eq.) and acetyl chloride (56.54 mg, 452.42 5 eq.), (RX=2-bromoethan-1-ol, or 1-bromo-2-methoxyethane) in DMF (3 mL) was added K2CO3 (37.52 mg, 271.45 3 eq. The mixture was stirred at 50° C. for 2 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.3) indicated that the starting material was consumed, and one major new spot was detected. The reaction mixture was quenched with water (10 mL), and then extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to provide the desired products.


1-[(3S,4R)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]ethan-1-one, 27 mg, 27% yield, MS (ES+, m/z): 595.2; 2-[(3S,4R)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]ethan-1-ol, 28 mg, 21% yield, MS (ES+, m/z): 597.2; and N-[(3S,4R)-3-fluoro-1-(2-methoxyethyl)piperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, 30 mg, 27% yield, MS (ES+, m/z): 611.2.


The procedure was repeated using N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine in place of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine.


1-[(3R,4S)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]ethan-1-one, (22 mg, 23% yield, MS (ES+, m/z): 595.2; 2-[(3R,4S)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]ethan-1-ol, (26 mg 24% yield, MS (ES+, m/z): 597.2; and N-[(3R,4S)-3-fluoro-1-(2-methoxyethyl)piperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine), (30 mg) 27% yield, MS (ES+, m/z): 611.2.


Example D121
Preparation of Compounds 871A and 894A



embedded image


A mixture of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 180.97 μmol 1 eq.) and propylene oxide (31.53 mg, 542.90 μmol, 3 eq.) in EtOH (3 mL) was stirred at 90° C. for 18 h. under N2 atmosphere. TLC analysis indicated that one major new spot had formed. The reaction mixture was quenched with water (10 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1) and further purified by prep-HPLC to provide 1-[(3S,4R)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]propan-2-ol, (24 mg, 21.7% yield) MS (ES+, m/z): 611.2.


The procedure was repeated using N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine in place of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine to provide 1-[(3R,4S)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]propan-2-ol, MS (ES+, m/z): 611.2.


Example D122
Preparation of Compounds 853A and 854A



embedded image


To a solution of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.05 g, 90.48 μmol and 2-(dimethylamino)acetic acid (18.66 mg, 180.97 μmol, 2 eq.) in DMF (3 mL) were added HATU (68.81 mg, 180.97 μmol, 2 eq.) and TEA (27.47 mg, 271.45 μmol, 37.78 μL, 3 eq.). The mixture was stirred at 50° C. for 2 h. TLC (EtOAc:TEA=10:1, Rf=0.35) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched with saturated aqueous solution of Na2CO3 (10 mL), diluted with water (10 mL), and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to provide 2-[(3S,4R)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]ethan-1-ol, 27 mg, 46.2% yield. MS (ES+, m/z): 638.3.


Example D123
Preparation of Compounds 892A and 893A



embedded image


Synthesis of tert-butyl (2-((3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-2-oxoethyl)carbamate and tert-butyl (2-((3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-2-oxoethyl)carbamate: To a solution of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 180.97 μmol, 1 eq.) and 2-(tert-butoxycarbonylamino)acetic acid (63.40 mg, 361.94 μmol, 2 eq.) in DMF (2 mL) was added TEA (91.56 mg, 904.84 μmol, 125.94 μL, 5 eq.) and HATU (206.43 mg, 542.90 μmol, 3 eq.). The mixture was stirred at 25° C. for 2 h under N2 atmosphere, after which time TLC analysis (EtOAc:TEA=10:1, Rf1=0.1, Rf2=0.55) indicated that the starting material was completely consumed, and one new spot had formed. The reaction mixture was quenched with water (15 mL) at 25° C. and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1) to provide tert-butyl (2-((3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-2-oxoethyl)carbamate (100 mg, 70% yield) as a yellow solid.


The procedure was repeated using N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine in place of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine to provide tert-butyl (2-((3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-2-oxoethyl)carbamate (68% yield) as a yellow solid.


Synthesis of final products: tert-Butyl (2-((3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-2-oxoethyl)carbamate (0.1 g, 140.89 μmol, 1 eq.) was added to HCl/EtOAc (4N, 5 mL). The resulting mixture was stirred at 25° C. for 0.5 h, after which time TLC analysis (EtOAc:TEA=10:1, Rf1=0.5, Rf1=0.25) indicated that the Boc-protected starting material was completely consumed, and one new spot had formed. The reaction mixture was quenched with saturated aqueous Na2CO3 (10 mL) and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL), filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to provide 2-amino-1-[(3S,4R)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]ethan-1-one (35 mg, 40.7% yield) as a yellow solid. MS (ES+, m/z): 610.2.


The procedure was repeated using tert-butyl (2-((3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-2-oxoethyl)carbamate in place of tert-butyl (2-((3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-2-oxoethyl)carbamate to provide 2-amino-1-[(3R,4S)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]ethan-1-one (30 mg, 36% yield) as a yellow solid. MS (ES+, m/z): 610.2.


Example D124
Preparation of Compounds 861A and 869A



embedded image


To a solution of (rac)-4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide (150 mg, 270.97 μmol, 1 eq.) in EtOH (2 mL) was added (R)-2-(methoxymethyl)oxirane (143.24 mg, 1.63 mmol, 144.69 μl, 6 eq.). The mixture was stirred at 90° C. for 2 h, after which time TLC analysis (DCM:MeOH=10:1) indicated that the secondary amine starting material was consumed, and one new spot had formed. The reaction mixture was concentrated under reduced pressure. The resulting residue was purified by prep-HPLC, to obtain a mixture of diastereomers (80 mg, 124.67 μmol, 46.01% yield), which was then resolved by chiral SFC to provide the separated diastereomers as light yellow solids.


4-{[3-(4-{[(3R,4S)-3-fluoro-1-[(2R)-2-hydroxy-3-methoxypropyl]piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 624.3; and 4-{[3-(4-{[(3S,4R)-3-fluoro-1-[(2R)-2-hydroxy-3-methoxypropyl]piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 624.3.


Example D125
Preparation of Compounds 882A and 883A



embedded image


To a solution of (rac)-4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide (300 mg, 541.94 μmol, 1 eq.) in EtOH (7 mL) was added (S)-oxiran-2-ylmethanol (200.73 mg, 2.71 mmol, 179.22 5 eq.). The mixture was stirred at 90° C. for 2 h, after which time TLC analysis (DCM:MeOH=10:1, Rf=0.43) indicated that the reaction was complete. The reaction mixture was concentrated under reduced pressure to remove solvent, and the residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1). The residue was then further purified by prep-HPLC to afford the diastereomeric mixture (100 mg, 159.32 μmol, 29.40% yield) as a light yellow solid. The byproduct (65 mg, 91.33 μmol), which was also obtained as a light yellow solid, was subjected to resolution by chiral SFC to provide the desired enantiopure products.


4-{[3-(4-{[(3R,4S)-1-[(2R)-2,3-dihydroxypropyl]-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 628.3; 4-{[3-(4-{[(3S,4R)-1-[(2R)-2,3-dihydroxypropyl]-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 628.3; and N-[(2R)-2,3-dihydroxypropyl]-4-{[3-(4-{[(3RS,4SR)-3-fluoro-1-[(2R)-2-hydroxy-3-methoxypropyl]piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 702.2 (M−Me)


Example D126
Preparation of Compounds 882A and 883A



embedded image


A solution of 4-((3-(4-(((3R,4S)-1-((R)-2,3-dihydroxypropyl)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide (300 mg, 406.28 μmol, 1 eq.) in acetic anhydride (8.34 g, 81.68 mmol, 7.65 mL, 201.04 eq.) was stirred at 20° C. for 1 h, after which time TLC analysis (DCM:MeOH=10:1, Rf=0.43) indicated that the reaction was complete. The reaction mixture was concentrated in vacuo, and the residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.43). Diastereomeric mixture (R)-3-((3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-sulfamoylphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl diacetate (100 mg, 136.15 μmol, 33.51% yield) was obtained as a light yellow solid, which was then further purified via chiral SFC to provide 4-{[3-(4-{[(3S,4R)-1-[(2R)-2,3-dihydroxypropyl]-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide (25.1 mg, 34.77 μmol) as a light yellow solid (MS (ES+, m/z): 628.3), and 4-{[3-(4-{[(3R,4S)-1-[(2R)-2,3-dihydroxypropyl]-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide (22.7 mg, 31.16 μmol) as a light yellow solid (MS (ES+, m/z): 628.3).


Example D127
Preparation of Compound 891A



embedded image


Synthesis of N1,N1-bis(pyridin-2-ylmethyl)ethane-1,2-diamine: To a solution of tert-butyl (2-(bis(pyridin-2-ylmethyl)amino)ethyl)carbamate (1.5 g, 4.38 mmol, 1 eq.) in DCM (5 mL) was added TFA (11.55 g, 101.30 mmol, 7.50 mL, 23.12 eq.). The resulting mixture was stirred at 25° C. for 0.5 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched with saturated solution of Na2CO3 (100 mL) at 25° C., and then extracted with EtOAc (100 mL×10). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide N1,N1-bis(pyridin-2-ylmethyl)ethane-1,2-diamine (1.1 g, crude) as a light yellow oil. MS (ES+, m/z): 243.1.


Synthesis of N-(2-(bis(pyridin-2-ylmethyl)amino)ethyl)-2-chloroacetamide: To a solution of N1,N1-bis(pyridin-2-ylmethyl)ethane-1,2-diamine (500 mg, 2.06 mmol, 1 eq.) in DCM (3 mL) was added chloroacetyl chloride (233.05 mg, 2.06 mmol, 164.12 μl, 1 eq.). The mixture was stirred at 25° C. for 5 min, after which time TLC analysis (DCM:MeOH=10:1, Rf=0.24) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated solution of Na2CO3 (40 mL) at 25° C. and extracted with DCM (25 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide N-(2-(bis(pyridin-2-ylmethyl)amino)ethyl)-2-chloroacetamide (550 mg, crude) as a light yellow oil.


Synthesis of final product: To a solution of (rac)-N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 180.97 μmol, 1 eq.) in MeCN (3 mL) was added K2CO3 (250.12 mg, 1.81 mmol, 10 eq.), followed by then N-(2-(bis(pyridin-2-ylmethyl)amino)ethyl)-2-chloroacetamide (144.23 mg, 361.94 μmol, 2 eq.). The mixture was stirred at 70° C. for 24 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was filtered and then concentrated under reduced pressure to remove solvent. The residue was purified by prep-HPLC to provide rac-N-(2-{bis[(pyridin-2-yl)methyl]amino}ethyl)-2-[(3R,4S)-3-fluoro-4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl) amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl]acetamide (25.8 mg, 30.78 μmol, 17.01% yield) as a light yellow solid.


Example D128
Preparation of Compounds 795A, 802A, 803A



embedded image


To a solution of (rac)-N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (200 mg, 361.9 μmol, 1 eq.) in DMF (4 mL) was added K2CO3 (150.1 mg, 1.1 mmol, 3 eq.), followed by 2-bromopropane (445.2 mg, 3.6 mmol, 339.8 μl, 10 eq.). The reaction mixture was stirred at 25° C. for 24 h, after which time TLC analysis indicated that the starting material was consumed completely. The reaction mixture was quenched with water (40 mL), and EtOAc (50 mL) was added. The mixture was extracted with EtOAc (20 mL×3), and the combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1), dissolved in DCM (5 mL), filtered, and concentrated under reduced pressure. The resulting residue was further purified by prep-HPLC to provide (rac)-N-[(3R,4S)-3-fluoro-1-(propan-2-yl)piperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine. The constituent enantiomers were then resolved via chiral SFC to provide N-[(3R,4S)-3-fluoro-1-(propan-2-yl)piperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (20.4 mg, 34.27 μmol) was obtained as a light yellow solid (MS (ES+, m/z): 595.3). N-[(3S,4R)-3-fluoro-1-(propan-2-yl)piperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (20.8 mg, 34.45 μmol) was obtained as a light yellow solid (MS (ES+, m/z): 595.3).


Example D129
Preparation of Compounds 780A and 792A



embedded image


Synthesis of 4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl trifluoromethanesulfonate: To a solution of 4-bromo-1-(2,2,2-trifluoroethyl)indolin-2-one (10 g, 34.01 mmol, 1 eq.) and 2,6-lutidine (4.37 g, 40.81 mmol, 4.75 mL, 1.2 eq.) in DCM (100 mL) was added trifluoromethylsulfonyl trifluoromethanesulfonate (9.59 g, 34.01 mmol, 5.61 mL, 1 eq.) dropwise at 25° C. The reaction mixture was stirred at 25° C. for 2 h, after which time TLC analysis (PE:EtOAc=3:1, Rf=0.5) indicated that the reaction was complete. The reaction mixture was poured into a saturated aqueous solution of NH4Cl (100 mL) and extracted with DCM (60 mL×3). The remaining aqueous phase added to saturated solution of NaHCO3 (100 mL) and again extracted with DCM (60 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:0 to 100:1, Rf=0.5) to provide [4-bromo-1-(2,2,2-trifluoroethyl)indol-2-yl]trifluoromethanesulfonate (13.0 g, 27.46 mmol, 80.74% yield) as a yellow solid.


Synthesis of methyl 4-((3-(4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate: To a solution of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxybenzoate (10.72 g, 33.56 mmol, 1.1 eq.) in DMSO (130 mL) was added i-Pr2NH (30.87 g, 305.07 mmol, 43.11 mL, 10 eq.), CuI (290.50 mg, 1.53 mmol, 0.05 eq.) and 4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl trifluoromethanesulfonate (13 g, 30.51 mmol, 1 eq.) at 20° C. Pd(PPh3)4 (1.76 g, 1.53 mmol, 0.05 eq.) was then added, and the mixture was purged with N2 three times. The mixture was stirred at 25° C. for 1 h, after which time TLC analysis (Rf=0.5, PE:EtOAc=3:1) indicated that the starting material was consumed. EtOAc (200 mL) and a saturated aqueous EDTA solution (300 mL) were added and stirred at 25° C. for 1 h. The mixture was extracted with EtOAc (200 mL×3), and The combined organic layers were washed with brine (50 mL×3) dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=15:1 to 8:1), and the solid concentrated eluate was washed with MTBE (45 mL) to provide methyl 4-((3-(4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate (14.1 g, 23.45 mmol, 76.87% yield) as a yellow solid.


Synthesis of methyl 4-((tert-butoxycarbonyl)(3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a mixture of methyl 4-((3-(4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate (12 g, 20.15 mmol, 1 eq.), (3S,4R)-3-fluoro-1-methylpiperidin-4-amine dihydrochloride (4.55 g, 22.17 mmol, 1.1 eq.), and Cs2CO3 (26.27 g, 80.62 mmol, 4 eq.) in dioxane (360 mL) was added RuPhos (1.32 g, 2.82 mmol, 0.14 eq.) and BrettPhos (Pd, G4) (1.30 g, 1.41 mmol, 0.07 eq.) at 20° C., then the mixture was purged with N2 three times. The mixture was stirred at 110° C. for 16 h, after which time HPLC indicated that the starting bromoindole was consumed. EtOAc (500 mL) and a saturated EDTA solution (800 mL) were added at 20° C. and stirred for 1 h. The mixture was then extracted with EtOAc (300 mL×3), and The combined organic layers were washed with brine (100 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=2:1 to 0:1), and the solid concentrated eluate was washed with MTBE (20 mL) to provide methyl 4-((tert-butoxycarbonyl)(3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (10.1 g, 15.13 mmol, 75.09% yield) as a yellow solid.


Synthesis of methyl 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: A mixture of methyl 4-((tert-butoxycarbonyl)(3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (10.1 g, 15.13 mmol, 1 eq.) in 4N HCl/EtOAc (300 mL) was stirred at 20° C. for 1 h. TLC analysis (Rf=0.45, EtOAc:TEA=10:1) indicated that the starting material was completely consumed. The mixture was filtered, and the filtrate was washed with saturated aqueous NaHCO3 (200 mL) and extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated to provide methyl 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (8.0 g, 13.91 mmol, 91.88% yield), as a yellow solid. The residue was used directly in the next step.


Synthesis of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid: A mixture of compound methyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate (7 g, 12.17 mmol, 1 eq.), LiOH.H2O (10.21 g, 243.34 mmol, 20 eq.) and NaOH (1.95 g, 48.67 mmol, 4 eq.) in THF (70 mL), MeOH (70 mL), and water (70 mL) was stirred at 50° C. for 5 h under N2 atmosphere, after which time TLC analysis (Rf=0.3, EtOAc:MeOH=2:1) indicated complete consumption of starting material. The organic solvents were removed in vacuo, and the concentrate was diluted with water (200 mL) and adjusted to pH=5 with 4 N HCl. The resulting precipitate was filtered, and the retentate was washed with water (20 mL×2) and lyophilized to provide a first batch of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (4.8 g, 98.083% purity) as a yellow solid. The filtrate was extracted with EtOAc (250 mL×3) and the combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was triturated with MTBE (50 mL) to provide a second batch of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (2 g) as a yellow solid.


4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid: 1H NMR (400 MHz, DMSO-d6) δ=12.21 (br s, 1H), 7.52 (d, J=8.5 Hz, 1H), 7.34 (d, J=1.5 Hz, 1H), 7.18 (s, 1H), 7.02 (t, J=8.0 Hz, 1H), 6.79 (br d, J=8.3 Hz, 1H), 6.76 (br d, J=8.3 Hz, 1H), 6.32-6.22 (m, 2H), 5.61 (br d, J=8.4 Hz, 1H), 5.04-4.84 (m, 3H), 4.34 (br d, J=6.1 Hz, 2H), 3.84 (s, 3H), 3.75-3.60 (m, 1H), 3.42-3.37 (m, 1H), 3.15-2.98 (m, 1H), 2.84-2.53 (m, 2H), 2.47-2.39 (m, 3H), 2.20-1.93 (m, 1H), 1.81 (br d, J=11.9 Hz, 1H). MS (ES+, m/z): 533.2.


Example D130
Preparation of Compounds 783A, 804A, and 805A



embedded image


Synthesis of 4-bromo-1-(2,2,2-trifluoroethyl)indoline-2,3-dione: To a mixture of tert-butyl (2-methoxy-4-(methylcarbamoyl)phenyl)(prop-2-yn-1-yl)carbamate (10.68 g, 33.56 mmol, 1.1 eq.) in DMSO (130 mL) was added i-Pr2NH (30.87 g, 305.07 mmol, 43.11 mL, 10 eq.), CuI (581.01 mg, 3.05 mmol, 0.1 eq.), 4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl trifluoromethanesulfonate (13 g, 30.51 mmol, 1 eq.) and Pd(PPh3)4 (2.12 g, 1.83 mmol, 0.06 eq.) at 20° C. The mixture was then purged with N2 three times. The reaction mixture was stirred at 40° C. for 1 h, after which time TLC analysis (Rf=0.5, PE:EtOAc=1:1) indicated that the reaction was complete. EtOAc (500 mL) and saturated aqueous EDTA (500 mL), was then added, mixture was stirred at 20° C. for a further 1 h. The mixture was extracted with EtOAc (500 mL×3), and the combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 1:2) to provide 4-bromo-1-(2,2,2-trifluoroethyl)indoline-2,3-dione (13 g, 65% yield) as a yellow solid.


Synthesis of (rac)-tert-butyl (3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylcarbamoyl)phenyl)carbamate: To a mixture of 4-bromo-1-(2,2,2-trifluoroethyl)indoline-2,3-dione (10 g, 16.82 mmol, 1 eq.), (rac)-(3R,4S)-3-fluoro-1-methyl-piperidin-4-amine (3.80 g, 18.51 mmol, 1.1 eq., dihydrochloride salt) in dioxane (300 mL) were added Cs2CO3 (16.44 g, 50.47 mmol, 3 eq.), RuPhos (1.02 g, 2.19 mmol, 0.13 eq), and BrettPhos (Pd, G4) (929.16 mg, 1.01 mmol, 0.06 eq.). The mixture was degassed and purged with N2 three times and then stirred at 110° C. for 6 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.35) indicated that the starting material was consumed completely. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (400 mL), and was stirred at 25° C. for 2 h. The mixture was extracted with EtOAc (100 mL×4) and the extracts were treated with 2M HCl solution to adjust the pH of the mixture to 3. Saturated aqueous Na2CO3 was then added to adjust the pH of the mixture to 8, and the mixture was filtered and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:1 to EtOAc:TEA:MeOH=10:1:0.2) to afford (rac)-tert-butyl (3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylcarbamoyl)phenyl)carbamate (9.5 g, 13.24 mmol, 78.71% yield) as a yellow solid.


Synthesis of rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide and chiral resolution of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide and 4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide: A mixture of (rac)-tert-butyl (3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylcarbamoyl)phenyl)carbamate (6.3 g, 9.76 mmol, 1 eq.), in 4N HCl/EtOAc (300 mL) was stirred at 25° C. for 1 h under N2 atmosphere. TLC analysis (EtOAc:TEA=10:1, Rf=0.30) indicated that the starting material was consumed completely, and one new spot was observed. The mixture was then treated with saturated aqueous Na2CO3 to adjust the pH of the mixture to 8 and extracted with EtOAc (100 mL×4). The combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was stirred in EtOH (10 mL) at 25° C. for 10 h and then filtered to afford (rac)-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide (4.9 g, 8.53 mmol, 87.45% yield) as a yellow solid.


(Rac)-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide (7.2 g, 13.20 mmol, 1 eq.) was resolved into respective enantiomers via chiral SFC to afford 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide (3.34 g, 6.04 mmol, 45.74% yield) as a yellow solid and 4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide (2.34 g, 4.16 mmol, 31.56% yield) as a yellow solid.


4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide: 1H NMR (400 MHz, DMSO-d6) δ ppm 1.65-1.72 (m, 1H) 1.87-1.98 (m, 1H) 2.04-2.12 (m, 1H) 2.14-2.29 (m, 4H) 2.72-2.84 (m, 4H) 3.02 (br t, J=10.76 Hz, 1H) 3.47-3.62 (m, 1H) 3.80-3.89 (m, 3H) 4.31 (d, J=6.24 Hz, 2H) 4.72-4.87 (m, 1H) 4.92 (q, J=9.05 Hz, 2H) 5.42-5.55 (m, 1H) 5.94-6.03 (m, 1H) 6.19-6.29 (m, 1H) 6.70-6.79 (m, 2H) 7.00 (t, J=7.95 Hz, 1H) 7.17 (s, 1H) 7.35 (s, 1H) 7.39-7.46 (m, 1H) 8.08-8.13 (m, 1H). MS (ES+, m/z): 546.3; 4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide, MS (ES+, m/z): 546.3.


Example D131
General Procedure for Preparation of Compounds 772 and 773A



embedded image


To a solution of (rac)-N-((3R,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (30 g, 53.48 mmol, 1 eq.) in MeOH (300 mL) were added AcOH (9.31 g, 155 mmol, 8.87 mL, 2.90 eq.), paraformaldehyde (8.03 g), and NaBH3CN (16.80 g, 267.38 mmol, 5 eq.). The reaction mixture was stirred at 50° C. for 1 h 40 min under N2, after which time TLC analysis (EtOAc:TEA=10:1, Rf=0.4) indicated that starting material remained, and one major new spot with polarity lower than that of the starting material was detected. Further portions of AcOH (6.21 g, 103.34 mmol, 5.91 mL, 1.93 eq.), paraformaldehyde (1.61 g) and NaBH3CN (3.36 g, 53.48 mmol, 1 eq.) were then added, and the mixture was stirred at 50° C. for a further 0.5 h. TLC analysis (EtOAc:TEA=10:1, Rf=0.4) indicated that starting material remained. A final portion of paraformaldehyde (802.83 mg) and NaBH3CN (3.36 g, 53.48 mmol, 1 eq.) were added, and the mixture was stirred at 50° C. for an additional 10 min. TLC analysis (EtOAc:TEA=10:1, Rf=0.4) showed that the starting material was consumed completely. The reaction mixture was poured into a saturated aqueous solution of Na2CO3 (4 L) and extracted with EtOAc (1 L×3). The combined organic layers were washed with a saturated aqueous solution of Na2CO3 (1 L) and brine (1 L×2), dried over anhydrous sodium sulfate, filtered, and concentrated to ˜500 mL. The concentrate was filtered to afford the crude product as the retentate. The retentate was purified by column chromatography (SiO2, EtOAc) and the enantiomers were separated by chiral SFC to afford the desired pure enantiomers as light yellow solids.


N-[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: 1H NMR (400 MHz, DMSO-d6) δ ppm 7.39 (dd, J=8.38, 1.77 Hz, 1H) 7.25 (d, J=1.83 Hz, 1H) 7.18 (s, 1H) 7.01 (t, J=8.01 Hz, 1H) 6.89 (d, J=8.44 Hz, 1H) 6.73 (d, J=8.19 Hz, 1H) 6.48 (t, J=6.17 Hz, 1H) 6.24 (d, J=7.82 Hz, 1H) 5.49 (d, J=8.56 Hz, 1H) 4.93 (q, J=9.17 Hz, 2H) 4.70-4.87 (m, 1H) 4.36 (d, J=6.11 Hz, 2H) 3.89 (s, 3H) 3.47-3.64 (m, 1H) 3.09 (s, 3H) 3.02 (br t, J=10.51 Hz, 1H) 2.79 (br d, J=11.00 Hz, 1H) 2.14-2.30 (m, 4H) 2.02-2.13 (m, 1H) 1.92 (qd, J=12.17, 3.48 Hz, 1H) 1.69 (br d, J=9.78 Hz, 1H). MS (ES+, m/z): 567.2; N-[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 567.2.


Example D132
Preparation of Compound 459A



embedded image


Synthesis of tert-butyl 4-((2-(3-((2-methoxy-4-(morpholinosulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a mixture 2-methoxy-4-morpholinosulfonyl-N-prop-2-ynyl-aniline (89.05 mg, 283.76 μmol, 1.5 eq.) and tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.1 g, 189.17 μmol, 1 eq.) (99%) in DMSO (2 mL) were added CuI (36.03 mg, 189.17 μmol, 1 eq.), Pd(PPh3)4 (21.86 mg, 18.92 μmol, 0.10 eq.), and diisopropylamine (19.14 mg, 189.17 μmol, 26.74 μL, 1 eq.). The reaction mixture was stirred at 30° C. for 1 h under N2, after which time LC-MS analysis indicated that the reaction was complete. The reaction was poured into a saturated aqueous EDTA solution (50 mL) and extracted with EtOAc (20 mL×3), and The combined organic layers were washed with saturated aqueous EDTA solution (20 mL) and stirred for 1 h. The organic layer was then washed with brine (50 mL), dried over anhydrous sodium sulfate, and concentrated in vacuo. The crude residue was purified by prep-TLC (PE:EtOAc=1:1, Rf=0.32) to provide tert-butyl 4-((2-(3-((2-methoxy-4-(morpholinosulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.08 g, 90.68 μmol, 47.93% yield) as a yellow solid.


Preparation of final product: To a mixture tert-butyl 4-((2-(3-((2-methoxy-4-(morpholinosulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.07 g, 79.34 μmol, 1 eq.) was added HCl/EtOAc (4 M, 34.26 mL, 1726.94 eq.). The mixture was stirred at 25° C. for 1 h under N2, after which time LC-MS analysis indicated that the reaction was complete. The mixture was directly concentrated to afford a crude residue that was purified by prep-HPLC to afford 2-(3-{[2-methoxy-4-(morpholine-4-sulfonyl)phenyl]amino}prop-1-yn-1-yl)-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.0166 g, 26.89 μmol, 33.89% yield) as a white solid. MS (ES+, m/z): 606.2.


Example D133
General Procedure for Preparation of Compounds 482A and 1003A



embedded image


3-Methoxy-N-methyl-4-(prop-2-yn-1-ylamino)benzamide was coupled to the R1-substituted iodoindoles specified above according to the general procedure specified in EXAMPLE D120. In each case, the reactions were deemed complete after stirring for 1 h at 30° C., and the crude compounds were first purified by prep-TLC and further purified by prep-HPLC.


3-methoxy-N-methyl-4-[(3-{4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide, MS (ES+, m/z): 515.2; and 3-methoxy-N-methyl-4-[(3-{4-[(1-methylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzamide, MS (ES+, m/z): 528.2.


Example D134
Preparation of methyl 4-((3-(4-(((3S,4R)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate



embedded image


Synthesis of tert-butyl (3S,4R)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate and tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: To a solution of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxybenzoate (3.54 g, 11.08 mmol, 1.2 eq.) in DMSO (50 mL) were added i-Pr2NH (9.35 g, 92.37 mmol, 13.05 mL, 10 eq.), and CuI (351.83 mg, 1.85 mmol, 0.2 eq.). The mixture was degassed and purged with N2, and tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (5 g, 9.24 mmol, 1 eq.) and Pd(PPh3)4 (1.07 g, 923.67 μmol, 0.1 eq.) were added. The mixture was stirred at 20° C. for 1 h under N2 atmosphere, after which time TLC analysis (PE:EtOAc=2:1, Rf=0.47) indicated that the starting material was completely consumed. The reaction mixture was quenched with a saturated aqueous EDTA solution (250 mL), and extracted with EtOAc (150 mL×3). The combined organic layers were washed with brine (50 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=7:1 to 0:1) provide tert-butyl (3S,4R)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate as a yellow solid (76% yield). MS (ES+, m/z): 733.3.


The procedure was repeated using tert-butyl (3R,4S)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate in place of tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate to provide tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate.


Synthesis of methyl 4-((3-(4-(((3S,4R)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: A solution of tert-butyl (3S,4R)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (6 g, 7.07 mmol, 1 eq.) dissolved in 4N HCl/EtOAc (30 mL). The mixture was stirred at 25° C. for 1 h, after which time HPLC analysis indicated that the starting material was completely consumed. The reaction mixture was quenched by adding saturated aqueous Na2CO3 (150 mL) until the pH of the mixture was -9. The mixture was extracted with EtOAc (100 mL×3), and The combined organic layers were washed with brine (30 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide crude methyl 4-((3-(4-(((3S,4R)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (78% yield) as a yellow solid.



1H NMR: (400 MHz, DMSO-d6) δ ppm 1.59-1.66 (m, 1H) 1.68-1.78 (m, 1H) 2.55-2.61 (m, 1H) 2.69-2.82 (m, 1H) 2.92-3.00 (m, 1H) 3.06-3.14 (m, 1H) 3.31 (br s, 1H) 3.59-3.72 (m, 1H) 3.78 (s, 3H) 3.85 (s, 3H) 4.32-4.37 (m, 2H) 4.62-4.78 (m, 1H) 4.88-4.97 (m, 2H) 5.47-5.55 (m, 1H) 6.22-6.28 (m, 1H) 6.37-6.43 (m, 1H) 6.70-6.75 (m, 1H) 6.79-6.85 (m, 1H) 6.97-7.02 (m, 1H) 7.17-7.21 (m, 1H) 7.32-7.35 (m, 1H) 7.53-7.56 (m, 1H).


The procedure was repeated using tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate in place of tert-butyl (3S,4R)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate to provide methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate.


Example D135
Preparation of Compounds 899A, 903A, 908A, and 912A



embedded image


Synthesis of methyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate: To a solution of methyl 4-((3-(4-(((3S,4R)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (prepared according to EXAMPLE D134) (300 mg, 450.68 μmol, 1 eq.) in DMF (3 mL) were added K2CO3 (311.43 mg, 2.25 mmol, 5 eq.) and 2-bromoethanol (225.28 mg, 1.80 mmol, 128 μL, 4 eq.). The mixture was stirred at 50° C. for 6 h, after which time TLC (DCM:MeOH=10:1, Rf=0.38) indicated that the starting material was completely consumed, and one new spot had formed. The reaction mixture was quenched with water (20 mL) and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 0:1) to provide methyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate (49% yield) as a yellow solid. MS (ES+, m/z): 577.3.


Synthesis of methyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate: To a solution of methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (1 eq.) in DMF (3 mL) were added K2CO3 (5 eq.) and 2-bromoethanol (4 eq.). The mixture was stirred at 50° C. for 12 h, after which time TLC analysis indicated that the starting material was completely consumed, and one new spot had formed. The reaction mixture was quenched with water (5 mL) and extracted with EtOAc (5 mL×3). The combined organic layers were washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=1:1 to 0:1), and further purified by prep-HPLC to afford methyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate (38% yield) as a yellow solid. MS (ES+, m/z): 577.2.


Synthesis of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid and 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid: To a solution of methyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate (0.1 g, 155.57 μmol, 1 eq.) in THF (1 mL), water (1 mL) and MeOH (1 mL) were added NaOH (31.11 mg, 777.86 μmol, 5 eq.) and LiOH.H2O (32.64 mg, 777.86 μmol, 5 eq.). The mixture was stirred at 40° C. for 18 h, after which time TLC analysis (DCM:MeOH=10:1, Rf=0.2) indicated that the starting material was completely consumed, and one new spot had formed. 2N HCl (20 mL) was then added to adjust the pH of the mixture to 3, and the mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to provide 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (45% yield) as a yellow solid. MS (ES+, m/z): 563.2.


The procedure was repeated using methyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate in place of methyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate to provide 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (27% yield) as a yellow solid. MS (ES+, m/z): 563.2.


Example D136
Preparation of Compounds 897A, 898A, 902A, and 904A



embedded image


Compounds 897A, 898A, 902A, and 904A were prepared via a procedure analogous to Example D135, using 1-bromo-2-methoxy-ethane in place of 2-bromoethanol.


methyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-methoxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop -2-yn-1-yl]amino}-3-methoxybenzoate, MS (ES+, m/z): 591.3; methyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-methoxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate , MS (ES+, m/z): 591.3; 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-methoxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, MS (ES+, m/z): 577.2; and 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-methoxyethyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, MS (ES+, m/z): 577.3.


Example D137
Preparation of Compounds 900A, 905A, 911A, and 921A



embedded image


Synthesis of Compounds methyl 4-{[3-(4-{[(35,4R)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate and methyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate: A mixture of methyl 4-((3-(4-(((3S,4R)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.2 g, 375.57 μmol, 1 eq.) and 2-methyloxirane (109.06 mg, 1.88 mmol, 131.72 μL, 5 eq.) in EtOH (3 mL)was stirred at 90° C. for 4 h, after which time TLC analysis (DCM:MeOH=10:1, Rf=0.32) indicated that the starting material was completely consumed, and one new spot had formed. The reaction mixture was concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and further purified by prep-HPLC to provide methyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate (180 mg, 43% yield) as a yellow solid. MS (ES+, m/z): 591.2.


The procedure was repeated using methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate in place of methyl 4-((3-(4-(((3S,4R)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate to afford methyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate. MS (ES+, m/z): 591.2.


Synthesis of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid and 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid. To a solution of methyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate (0.1 g, 151.71 μmol, 1 eq.) in THF (1 mL), MeOH (1 mL) and water (1 mL) were added NaOH (30.34 mg, 758.54 μmol, 5 eq.) and LiOH.H2O (31.83 mg, 758.54 μmol, 5 eq.). The mixture was stirred at 50° C. for 18 h under N2 atmosphere, after which time TLC analysis (DCM:MeOH=10:1, Rf=0.12) indicated that the ester starting material was consumed completely and two new spots had formed. The reaction mixture was quenched by adding 2N HCl (15 mL) to adjust the pH of the mixture to 3 and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to provide 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (45% yield) as a yellow solid. MS (ES+, m/z): 577.3.


The procedure was repeated using methyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate in place of methyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate to afford 4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2-hydroxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid. MS (ES+, m/z): 577.3.


Example D138
Preparation of Compounds 901A, 915A, 925A, and 926A



embedded image


Synthesis of methyl 4-{[3-(4-{[(3S,4R)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate and methyl 4-{[3-(4-{[(3R,4S)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate: To a solution of methyl 4-((3-(4-(((3S,4R)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.2 g, 375.57 μmol, 1 eq.) in DMF (2 mL) were added 2-bromoacetamide (155.44 mg, 1.13 mmol, 3 eq.) and K2CO3 (259.53 mg, 1.88 mmol, 5 eq.). The mixture was stirred at 50° C. for 1 h under N2 atmosphere, after which time TLC analysis (DCM:MeOH=10:1, Rf=0.46) indicated that the starting material was completely consumed, and one new spot had formed. The reaction mixture was quenched with water (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=20:1) to provide methyl 4-{[3-(4-{[(3S,4R)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate (42% yield) as a yellow oil. MS (ES+, m/z): 590.2.


The procedure was repeated using 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate in place of methyl 4-((3-(4-(((3S,4R)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate to afford methyl 4-{[3-(4-{[(3R,4S)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate. MS (ES+, m/z): 590.2.


Synthesis of 4-{[3-(4-{[(3S,4R)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid and 4-{[3-(4-{[(3R,4S)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid: A mixture of methyl 4-{[3-(4-{[(3S,4R)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate (1 eq.), NaOH (5 eq.), and LiOH (5 eq.) in THF (1 mL), MeOH (1 mL), and water (1 mL) was degassed and purged with N2. The mixture was stirred at 50° C. for 12 h under N2 atmosphere, after which time LC-MS analysis indicated that some starting material remained, and the desired compound was present. The reaction mixture was quenched with water (5 mL) and then extracted with EtOAc (5 mL×3). The combined organic layers were washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC. 4-{[3-(4-{[(3S,4R)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (12% yield) was obtained as a yellow solid. MS (ES+, m/z): 576.2.


The procedure was repeated using methyl 4-{[3-(4-{[(3R,4S)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate in place of methyl 4-{[3-(4-{[(3S,4R)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate to provide 4-{[3-(4-{[(3R,4S)-1-(carbamoylmethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid. MS (ES+, m/z): 576.2.


Example D139
Preparation of Compounds 913A, 914A, 920A, 927A, and 934A



embedded image


Compounds 913A, 914A, 920A, and 927A were prepared via a procedure analogous to the synthesis of the compounds described in EXAMPLE D138, using 2-bromo-N,N-dimethyl-acetamide in place of 2-bromoacetamide. Compound 934A was obtained as a side-product of the last step. Compounds 913A and 914A were purified via prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC (column: C18 100×30 mm 5 μm; mobile phase: [water(0.2% FA)-ACN]; B %: 25%-55%, 10 min). Compounds 920A, 914A, and 934A were purified via prep-HPLC (column: C18 100×30 mm 5 μm; mobile phase: [water (0.2% FA)-ACN]; B %: 15%-45%, 10 min).


methyl 4-{[3-(4-{[(3S,4R)-1-[(dimethylcarbamoyl)methyl]-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, MS (ES+, m/z): 618.3; methyl 4-{[3-(4-{[(3R,4S)-1-[(dimethylcarbamoyl)methyl]-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoate, MS (ES+, m/z): 618.3; 4-{[3-(4-{[(3S,4R)-1-[(dimethylcarbamoyl)methyl]-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid), MS (ES+, m/z): 604.3; 4-{[3-(4-{[(3R,4S)-1-[(dimethylcarbamoyl)methyl]-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, MS (ES+, m/z): 604.2; and 4-{[3-(4-{[(3S,4R)-1-(carboxymethyl)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid, MS (ES+, m/z): 577.2.


Example D140
Preparation of Compound 487A



embedded image


Synthesis of 2-iodo-6-methoxy-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A mixture of 1-methylpiperidin-4-one (30.57 mg, 270.19 μmol, 31.42 μL, 2 eq.), 2-iodo-6-methoxy-1-(2,2,2-trifluoroethyl)indol-4-amine (0.05 g, 135.10 μmol, 1 eq.), and TMSCl (36.69 mg, 337.74 μmol, 42.86 μL, 2.5 eq.) in DMF (2 mL) was degassed and purged with N2, and then BH3.THF (1 M, 337.74 μL, 2.5 eq.) was added. The mixture was stirred at 0° C. for 1 h under N2 atmosphere, after which time TLC analysis (EtOAc:MeOH=20:1, Rf=0.24) indicated that the reaction was complete. The reaction mixture was quenched with water (100 mL) at 0° C. and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, EtOAc:MeOH=20:1, Rf=0.24) to provide 2-iodo-6-methoxy-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.04 g, 68.48 μmol, 50.69% yield) as a yellow solid.


Synthesis of 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-6-methoxy-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (23.41 mg, 89.03 μmol, 1.3 eq.) and 2-iodo-6-methoxy-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.04 g, 68.48 μmol, 1 eq.) in DMSO (2 mL) were added CuI (13.04 mg, 68.48 μmol, 1 eq.), followed by Pd(PPh3)4 (7.91 mg, 6.85 μmol, 0.10 eq.) and diisopropylamine (6.93 mg, 68.48 μmol, 9.68 μL, 1 eq.). The mixture was stirred at 30° C. for 1 h under N2, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched with a saturated aqueous solution of EDTA (30 mL) and stirred with EtOAc (10 mL) at 25° C. for 1 h. The resulting mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=0:1, Rf=0.24) and further purified by prep-HPLC to provide 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-6-methoxy-N-(1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.0072 g, 11.12 μmol, 16.24% yield) as a yellow solid. MS (ES+, m/z): 579.2.


Example D141
Preparation of Compound 643A



embedded image


Synthesis of tert-butyl 4-((2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a mixture of tert-butyl 4-oxopiperidine-1-carboxylate (116.28 mg, 583.61 μmol, 26.80 μL, 3 eq.) and 2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.08 g, 194.54 μmol, 1 eq.) in DMF (2 mL) was added TMSCl (52.84 mg, 486.34 μmol, 61.72 μL, 2.5 eq.). The mixture was then cooled to 0° C., and BH3.THF (1 M, 486.34 μL, 2.5 eq.) was added under N2. The mixture was stirred at 0° C. for 1 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched with water (100 mL) at 0° C., and then extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL), dried over Na2SO4, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1, Rf=0.43) to provide tert-butyl 4-((2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.08 g, 115.66 μmol, 59.45% yield) as a yellow oil. MS (ES+, m/z): 554.0.


Synthesis of 2-iodo-5-methoxy-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of tert-butyl 4-((2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (0.07 g, 101.20 μmol, 1 eq.) in DCM (0.5 mL) was added TFA (5.39 g, 47.27 mmol, 3.50 mL, 467.10 eq.). The mixture was stirred at 25° C. for 1 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched with saturated solution of NaHCO3 (100 mL) at 0° C., diluted with EtOAc (20 mL), and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL), dried over Na2SO4, filtered, and concentrated under reduced pressure to provide 2-iodo-5-methoxy-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.050 g, 88.25 μmol, 87.21% yield) as a yellow solid, which was directly used in next step. MS (ES+, m/z): 453.8.


Synthesis of 1-(4-((2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol: A mixture of 2-iodo-5-methoxy-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.04 g, 70.60 μmol, 1 eq.), glycidyl methyl ether (31.10 mg, 353.01 μmol, 31.42 μL, 5 eq.), and K2CO3 (29.27 mg, 211.81 μmol, 3 eq.) in DMF (1 mL) was stirred at 50° C. for 10 h, after which time LC-MS analysis indicated that a product with the desired mass was present. The reaction mixture was quenched with water (100 mL) at 0° C. and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL), dried over Na2SO4, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1, Rf=0.43) to provide 1-(4-((2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (0.04 g, 59.11 μmol, 83.72% yield) as yellow solid. MS (ES+, m/z): 542.0.


Synthesis of final product: To a of mixture 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (17.87 mg, 70.93 μmol, 1.2 eq.) and 1-(4-42-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (0.04 g, 59.11 μmol, 1 eq.) in DMSO (2 mL) was added CuI (11.26 mg, 59.11 μmol, 1 eq.), followed by Pd(PPh3)4 (6.83 mg, 5.91 μmol, 0.10 eq.) and diisopropylamine (5.98 mg, 59.11 μmol, 8.35 μL, 1 eq.). The mixture was stirred at 30° C. for 1 h under N2, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched with a saturated aqueous solution of EDTA and EtOAc (˜10 mL), stirred at 25° C. for 1 h, and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.24) to provide 1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol (0.0157 g, 23.57 μmol, 39.88% yield) as light yellow solid. MS (ES+, m/z): 653.4.


Example D142
Preparation of Compounds 976A, 977A, 978A, and 979A



embedded image


Synthesis of 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To the mixture of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 g, 2.94 mmol, 1 eq.) and 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (1.41 g, 5.88 mmol, 2 eq.) in DMSO (15 mL) was added diisopropylamine (2.98 g, 29.40 mmol, 4.16 mL, 10 eq.) and Pd(dppf)Cl2 (215.16 mg, 294.05 μmol, 0.1 eq.), followed by CuI (560.01 mg, 2.94 mmol, 1 eq.) under N2. The reaction mixture was stirred for 2 h at 45° C., after which time LC-MS and TLC (PE:EtOAc=1:1) indicated that the reaction was complete. The reaction mixture was quenched by addition of a saturated aqueous solution of EDTA (100 mL) at 25° C., and then extracted with EtOAc (50 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The resulting residue was purified by column chromatography (PE:EtOAc=2:1 to 1:1) to afford 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.8 g, 1.68 mmol, 57.25% yield) as a light yellow solid.


Synthesis of (rac)-tert-butyl (3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate and (rac)-tert-butyl (3S,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate: To a solution of tert-butyl 3-fluoro-4-oxopiperidine-1-carboxylate (360.89 mg, 1.66 mmol, 2.5 eq.) and 2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (300 mg, 664.51 μmol, 1 eq.) in DMF (6 mL) was added TMSCl (180.48 mg, 1.66 mmol, 210.84 μL, 2.5 eq.), and the resulting mixture was stirred at 0° C. for 2 h. BH3.THF (1 M, 3.32 mL, 5 eq.) was then added under N2, and the mixture was stirred for a further 2 h at 20° C., after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched by adding saturated aqueous Na2CO3 (30 mL), diluted with water (10 mL), and extracted with EtOAc (20 mL×2). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude residue was purified by prep-HPLC to provide (rac)-tert-butyl (3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (80 mg, 37% yield) and (rac)-tert-butyl (3S,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (80 mg, 37% yield) as yellow solids.


General procedure for synthesis of (rac)-N-((3S,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and (rac)-N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl) amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of (rac)-tert-butyl (3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (80 mg, 122.57 μmol, 1 eq.) or (rac)-tert-butyl (3S,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (80 mg, 122.57 μmol, 1 eq.) in HCl/EtOAc (4 M, 8 mL, 261.08 eq.) was stirred at 25° C. for 10 min, after which time LC-MS analysis indicated that reaction was complete. The solution was concentrated in vacuo. The crude residue was neutralized by adding saturated aqueous Na2CO3 (100 mL), and the resulting mixture was extracted with EtOAc (200 mL). The combined organic layers were washed with brine (100 mL×3), dried over anhydrous sodium sulfate, and filtered to provide crude (rac)-N-((3S,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or (rac)-N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine as a light yellow solid.


Synthesis of final products: To a solution of (rac)-N-((3S,4S)-3-fluoropiperidin-4-yl)-2-(3-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or (rac)-N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (180.97 μmol, 1 eq.) in EtOH (3 mL) was added (S)-glycidyl methyl ether (95.67 mg, 1.09 mmol, 96.63 μL, 6 eq.). The mixture was stirred at 90° C. for 2 h under N2 atmosphere, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was concentrated in vacuo and was purified by prep-HPLC to provide the epimeric product as a white solid (55 mg, 85.85 μmol, 47.44% yield), which was then resolved via chiral SFC to provide the desired pure enantiomers.


(S)-1-((3R,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.2; (S)-1-((3S,4S)-3-fluoro-4-((2-(3-((2-methoxy -4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.2; (S)-1-((3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.3; and (S)-1-((3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.3.


Example D143
Preparation of Compounds 980A and 981A

Compounds 980A and 981A were prepared via a procedure analogous to the synthesis shown in Example D142, using racemic glycidyl methyl ether in place of (S)-glycidyl methyl ether.


(rac)-1-((3S,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.3; and (rac)-1-((3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.3.


Example D144
General Procedure for Preparation of Compounds 982A, 983A, 984A, and 985A



embedded image


Compounds 982A, 983A, 984A, and 985A were prepared via a procedure analogous to the synthesis shown in EXAMPLE D142, using (R)-glycidyl methyl ether in place of (S)-glycidyl methyl ether.


The epimeric mixture was resolved via chiral SFC to provide the desired pure enantiomers. (R)-1-((3S,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.2; (R)-1-((3R,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.2; (R)-1-((3R,4S)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.3; and (R)-1-((3S,4R)-3-fluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol, MS (ES+, m/z): 641.3.


Example D145
Preparation of Compound 987A



embedded image


Synthesis of tert-butyl (3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate: To a mixture of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine hydrochloride (5 g, 13.28 mmol, 1 eq.) and tert-butyl N-(2-methoxy-4-methylsulfonyl-phenyl)-N-prop-2-ynyl-carbamate (8.11 g, 23.90 mmol, 1.8 eq.) in DMSO (50 mL) were added diisopropylamine (13.44 g, 132.79 mmol, 18.77 mL, 10 eq.) and Pd(dppf)Cl2 (485.81 mg, 663.93 μmol, 0.05 eq.), followed by CuI (1.26 g, 6.64 mmol, 0.5 eq.) under N2 atmosphere. The mixture was stirred for 2 h at 45° C., after which time LC-MS and TLC analysis (PE:EtOAc=1:1) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous solution of EDTA (150 mL) at 25° C. and extracted with EtOAc (150 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 1:1) to provide tert-butyl (3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (4.5 g, 8.16 mmol, 61.44% yield) as a red gum.


Synthesis of tert-butyl 4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3,3-difluoropiperidine-1-carboxylate: To a solution of intermediate tert-butyl 3,3-difluoro-4,4-dihydroxypiperidine-1-carboxylate (2.48 g, 9.80 mmol, 4 eq.) and tert-butyl (3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(2-methoxy-4-(methylsulfonyl)phenyl)carbamate (1.5 g, 2.45 mmol, 1 eq.) in DMF (15 mL) was added TMSCl (798.50 mg, 7.35 mmol, 932.83 μL, 3 eq.). The mixture was stirred at 0° C. for 2 h, then BH3.THF (1 M, 12.25 mL, 5 eq.) was added under N2 atmosphere. The mixture was stirred at 25° C. for a further 3 h, after which time TLC analysis indicated a 2:1 ratio of starting primary amine to product. The reaction mixture was quenched by addition of saturated aqueous Na2CO3 (300 mL), diluted with water (10 mL), and extracted with EtOAc (150 mL×2). The combined organic layers were then washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (PE:EtOAc=3:1 to 2:1) to provide tert-butyl 4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3,3-difluoropiperidine-1-carboxylate (1.5 g, 1.65 mmol, 67.51% yield) as a yellow solid.


Synthesis of N-(3,3-difluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: A solution of tert-butyl 4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3,3-difluoropiperidine-1-carboxylate (250 mg, 275.69 μmol, 1 eq.) in HCl/EtOAc (4 M, 5 mL, 72.55 eq.) was stirred at 25° C. for 30 min, after which time LC-MS analysis indicated that the reaction was complete. The solution was dried in vacuo to provide a crude residue that was neutralized by the addition of saturated aqueous Na2CO3 (100 mL). The mixture was extracted with EtOAc (200 mL), washed with brine (100 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated to provide crude N-(3,3-difluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (130 mg) as a yellow solid.


Synthesis of final product: To a solution of N-(3,3-difluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 175.26 μmol, 1 eq.) in EtOH (3 mL) was added glycidyl methyl ether (92.65 mg, 1.05 mmol, 93.58 μL, 6 eq.). The mixture was stirred at 90° C. for 2 h under N2 atmosphere, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was concentrated in vacuo and purified by prep-HPLC to provide 1-(3,3-difluoro-4-((2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (21.7 mg, 32.85 μmol, 18.74% yield) as a yellow solid. MS (ES+, m/z): 659.2.


Example D146
General Procedure for Preparation of Compounds 769A, 770A, 771A, 772A, 773A, and 774A



embedded image


To a solution of (rac)-N-((3S,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or (rac)-N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (200 mg, 289.55 1 eq.) and (CH2O)n (43.47 mg, 1.45 mmol, 39.88 μL, 5 eq.) in MeOH (3 mL) was added acetic acid (17.39 ug, 0.29 μmol, 0.001 eq.) and NaBH3CN (90.98 mg, 1.45 mmol, 5 eq.). The mixture was stirred at 50° C. for 4 h, then TLC analysis (DCM:MeOH=10:1, Rf=0.43) indicated that the reaction was complete. The reaction was quenched by addition of saturated aqueous NaHCO3 (60 mL) and then extracted with EtOAc (20 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide a residue. The residue was purified by prep-HPLC to provide the desired racemic compounds as light yellow solids. The enantiomers were separated by chiral SFC to obtain the desired products.


(rac)-N-((3R,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-(3-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 567.2; (rac)-N-((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 567.2; N-((3R,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 567.2; N-((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 567.2; N-((3S,4S)-3-fluoro-1-methylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine), MS (ES+, m/z): 567.2; and N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine), MS (ES+, m/z): 567.2.


Example D147
General Procedure for Preparation of Compounds 775A, 776A. 790A. and 791A



embedded image


Compounds 775A, 776A, 790A, and 791A were prepared via a procedure analogous to the synthesis of (rac)-N-((3S,4S)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and (rac)-N-((3S,4R)-3-fluoropiperidin-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine according to EXAMPLE D141 using 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline and EXAMPLE D146.


(rac)-4-((3-(4-(((3R,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 568.1; (rac)-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 568.2; 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 568.3; and 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 568.3.


Example D148
General Procedure for Preparation of Compound 986A



embedded image


4-((3-(4-(((3R,4S)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide was prepared via a procedure analogous to EXAMPLE D142, using (R)-glycidyl methyl ether in place of (S)-glycidyl methyl ether and 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide in place of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline. 4-((3-(4-(((3R,4S)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide was purified by prep-HPLC and obtained as a white solid.


4-((3-(4-(((3RS,4SR)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzenesulfonamide, MS (ES+, m/z): 642.3.


Example D149
Preparation of Compounds 549A and 550A



embedded image


Synthesis of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.3 g, 708.86 μmol, 1 eq.) in DMF (3 mL) were added R-glycidol (262.56 mg, 3.54 mmol, 234.43 μL, 5 eq.) and K2CO3 (293.92 mg, 2.13 mmol, 3 eq.). The reaction mixture was stirred at 50° C. for 10 h, quenched with water (10 mL), and extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (5 mL), dried over anhydrous sodium sulfate and concentrated to provide crude 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol (0.3 g) as a yellow oil. The crude product was used to the next step without further purification.


Synthesis of final products: To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (116 mg, 1.3 eq.) in DMSO (10 mL) was added CuI (71 mg, 1 eq.) and diisopropylamine (217 mg, 10 eq.). The reaction was degassed with N2, 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol (183 mg, 1 eq.) and Pd(PPh3)4 (85 mg, 0.2 eq.) were added, and the reaction mixture was again degassed with N2. The reaction mixture was stirred at 25° C. for 2 h, after which time LC-MS analysis indicated that the reaction was complete. EtOAc (20 mL) was then added to the reaction mixture, and the mixture was poured into a saturated aqueous solution of EDTA (50 mL) and stirred at 25° C. for 2 h. The aqueous phase was extracted with EtOAc (30 mL×3), and the combined organic layers were washed with brine (40 mL×1), dried over anhydrous sodium sulfate, treated with activated carbon, filtered, and concentrated in vacuo to provide the crude product. The residue was purified by prep-TLC or chromatography on silica-gel (DCM:MeOH=10:1, Rf=0.4), then further purified by prep-HPLC provide (rac)-4-({3-[4-({1-[2,3-dihydroxypropyl]piperidin-4-yl}amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl]prop-2-yn-1-yl}amino)-3-methoxybenzene-1-sulfonamide as a yellow solid. MS (ES+, m/z): 610.2. The same procedure was used starting from S-glycidol to obtain the other enantiomer.


Example D150
General Procedure for Preparation of Compounds 580A and 581A



embedded image


Synthesis of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol: To a mixture of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1.5 g, 3.40 mmol, 1 eq.) and glycidyl methyl ether (1.58 g, 17.01 mmol, 1.59 mL, 5 eq., 95% purity) in DMF (30 mL) was added K2CO3 (1.41 g, 10.21 mmol, 3 eq.) in one portion at 25° C. under N2. The mixture was then stirred at 50° C. for 12 h, after which time TLC analysis (EtOAc:MeOH=5:1, Rf=0.40) indicated that the reaction was complete. The mixture was cooled to 25° C., poured into water (150 mL), and stirred for 1 min. The aqueous phase was extracted with EtOAc (50 mL×3), and the combined organic layers were washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by silica gel chromatography (SiO2, EtOAc/MeOH=1/0, 5/1) to afford 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (1.6 g, 2.82 mmol, 82.77% yield) as red oil.


Synthesis of N-(1-(2,3-dimethoxypropyl)piperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (200 mg, 352.03 μmol, 1 eq.) in THF (3 mL) was added NaH (56.32 mg, 1.41 mmol, 60% in mineral oil, 4 eq.) in one portion at 0° C. under N2. The mixture was stirred at 0° C. for 30 min, and dimethylsulfate (44.40 mg, 352.03 μmol, 33.39 μL, 1 eq.) was then added in one portion at 0° C. under N2. The reaction mixture was warmed to 25° C. and stirred for 1 h, after which time TLC analysis (EtOAc:MeOH=5:1, Rf=0.72) and LC-MS analysis indicated that the reaction was complete. The mixture was poured into a saturated aqueous NH4Cl solution (20 mL), stirred for 2 min, and the aqueous phase was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (EtOAc: MeOH=5:1, Rf=0.72) to afford N-(1-(2,3-dimethoxypropyl)piperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (135 mg, 154.18 μmol, 43.80% yield) as yellow solid.


Synthesis of final products: Compounds 580A and 581A were prepared via a procedure analogous to EXAMPLE C69, using N-(1-(2,3-dimethoxypropyl)piperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine in place of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol.


N-[1-(2,3-dimethoxypropyl)piperidin-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 637.3; and 4-{[3-(4-{[1-(2,3-dimethoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 638.2.


Example D151
General Procedure for Preparation of Compounds 569A and 574A



embedded image


Compounds 569A and 574A were prepared via a procedure analogous to EXAMPLE C69, using 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol in place of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol.


1-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}-3-methoxypropan-2-ol, MS (ES+, m/z): 623.3; and 4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 624.2.


Example D152
General Procedure for Preparation of Compounds 573 and 579A



embedded image


Synthesis of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl diacetate: To a solution of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol (100 mg, 1 eq.) in DCM (2 mL)was added acetic anhydride (37 mg, 2 eq.), then the mixture was stirred at 25° C. for 4 h, after which time TLC and LC-MS analysis indicated that the starting diol was completely consumed. The solvent was removed by sparging with a stream of N2. The resulting residue was purified by prep-TLC (DCM:MeOH=5:1, Rf=0.80) to afford 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl diacetate as light brown oil.


Synthesis of final products: Compounds 573 and 579A were prepared via a procedure analogous to EXAMPLE C69, using 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl diacetate in place of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol.


1-(acetyloxy)-3-{4-[(2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-2-yl acetate, MS (ES+, m/z): 693.2; and 1-(acetyloxy)-3-{4-[(2-{3-[(2-methoxy-4-sulfamoylphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino]piperidin-1-yl}propan-2-yl acetate, MS (ES+, m/z): 694.2.


Example D153
General Procedure for the Preparation of Compounds 566A and 568A



embedded image


Synthesis of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diyl diacetate: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (300 mg, 1 eq.) and (R)-2,2-dimethyl-1,3-dioxolane-4-carbaldehyde (354 mg, 4 eq.) in 1,2-dichloroethane (20 mL) was added NaBH(OAc)3 (577 mg, 4 eq.). The mixture was stirred at 22° C. for 1 h, after which time LC-MS and TLC analysis indicated that the reaction was complete. The reaction mixture washed with water (300 mL), and the organic phase was dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (PE:EtOAc=5:1, Rf=0.5) to give (R)—N-(1-((2,2-dimethyl-1,3-dioxolan-4-yl)methyl)piperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine as a yellow oil. (187 mg, 40.9% yield)


Synthesis of final products: Compounds 566A and 568A were prepared via a procedure analogous to EXAMPLE C69 using (R)—N-(1-((2,2-dimethyl-1,3-dioxolan-4-yl)methyl)piperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine in place of 3-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)propane-1,2-diol.


N-(1-{[(4R)-2,2-dimethyl-1,3-dioxolan-4-yl]methyl}piperidin-4-yl)-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 649.3; and 4-[(3-{4-[(1-{[(4R)-2,2-dimethyl-1,3-dioxolan-4-yl]methyl}piperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 650.3.


Example D154
Preparation of Compounds 782A and 783A



embedded image


embedded image


embedded image


Synthesis of methyl 4-((3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate: To a solution of methyl 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxybenzoate (6.9 g, 21.39 mmol, 1.2 eq.) in DMSO (50 mL) were added CuI (1.02g, 5.35 mmol, 0.3 eq.), diisopropylamine (18.04 g, 178.25 mmol, 25.19 mL, 10 eq.), Pd(PPh3)4 (1.03 g, 891.26 μmol, 0.05 eq.), and 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine hydrochloride (6.06 g, 17.83 mmol, 1 eq.) under N2. The reaction mixture was stirred for 1 h at 20° C., after which time TLC analysis (PE:EtOAc=2:1, Rf=0.24) indicated that the reaction was complete. The reaction mixture was quenched with a saturated aqueous solution of EDTA (500 mL) at 25° C., stirred for 1 h, and then extracted with EtOAc (200 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by column chromatography (SiO2, PE:EtOAc=3:1 to 1:2, PE:EtOAc=1:1, Rf=0.24) to provide methyl 4-((3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate (10 g, 13.73 mmol, 77.05% yield) as a brown oil.


Synthesis of (rac)-tert-butyl (3R,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate and (rac)-tert-butyl (3S,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate: To a solution of tert-butyl 3-fluoro-4-oxopiperidine-1-carboxylate (16 g, 73.65 mmol, 4 eq.) and methyl 4-((3-(4-amino-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)(tert-butoxycarbonyl)amino)-3-methoxybenzoate (9.79 g, 18.41 mmol, 1 eq.) in DMF (20 mL) was added TMSCl (6 g, 55.24 mmol, 7.01 mL, 3 eq.). The mixture was stirred at 0° C. for 0.5 h, where after BH3.THF (1 M, 184.13 mL, 10 eq.) was added under N2. The mixture was stirred at 0° C. for an additional 0.5 h, after which time LC-MS analysis indicated that the starting primary amine was completely consumed. The reaction mixture was adjusted to pH˜8 with saturated aqueous Na2CO3, diluted with water (50 mL), and extracted with EtOAc 600 mL (150 mL×4). The combined organic layers were washed with brine (100 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to provide (rac)-tert-butyl (3S,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (5.7 g, 7.78 mmol, 42.25% yield) as a yellow solid. The trans diastereomer was also isolated in 35% yield (4.7 g).


Synthesis of (rac)-methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of (rac)-tert-butyl (3S,4S)-4-((2-(3-((tert-butoxycarbonyl)(2-methoxy-4-(methoxycarbonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (5 g, 6.82 mmol, 1 eq.) was added 4N HCl/EtOAc (34.12 mmol, 20 mL, 5 eq.). The mixture was stirred at 20° C. for 1 h, after which time TLC analysis (DCM:MeOH=10:1) indicated that the protected starting material was completely consumed, and one new spot had appeared. The reaction mixture was adjusted to pH˜8 with saturated aqueous Na2CO3, diluted with water (50 mL), and extracted with EtOAc (50 mL×4). The combined organic layers were washed with NaCl (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide crude (rac)-methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (4.1 g, crude) as a yellow solid.


Synthesis of (rac)-methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: A mixture of (rac)-methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.6 g, 1.13 mmol, 1 eq.), paraformaldehyde (338.30 mg, 11.27 mmol, 310.37 μL, 10 eq.), NaBH3CN (212.41 mg, 3.38 mmol, 3 eq.), and AcOH (67.66 mg, 1.13 mmol, 64.44 μL, 1 eq.) in MeOH (20 mL) was degassed and purged with N2. The mixture was stirred at 20° C. for 2 h under N2 atmosphere, after which time TLC analysis (EtOAc:TEA=10:1, Rf=0.65) indicated that one new spot had appeared. The reaction mixture was quenched with saturated aqueous NaHCO3 (30 mL), and then extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (25 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=20:1) to provide (rac)-methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.4 g, 658.67 μmol, 58.46% yield) as a yellow solid.


Synthesis of (rac)-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid: A mixture of (rac)-methyl 4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (0.4 g, 731.86 μmol, 1 eq.) in LiOH.H2O (10 mL, 10M) and MeOH (10 mL) was degassed and purged with N2. The mixture was stirred at 40° C. for 12 h under N2 atmosphere, after which time TLC analysis (EtOAc:TEA=10:1, Rf=0) indicated that one new spot had appeared. The reaction mixture was extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1) to provide (rac)-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.2 g, 338.01 μmol, 46.19% yield) as a yellow solid.


Synthesis of (rac)-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide: A mixture of (rac)-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.12 g, 225.34 μmol, 1 eq.), NH4Cl (24.11 mg, 450.68 μmol, 2 eq.), HOBt (45.67 mg, 338.01 μmol, 1.5 eq.), EDCI (64.80 mg, 338.01 μmol, 1.5 eq.), and TEA (91.21 mg, 901.36 μmol, 125.46 μL, 4 eq.) in DCM (5 mL) was degassed and purged with N2. The mixture was stirred at 20° C. for 16 h under N2 atmosphere, after which time TLC analysis (EtOAc:TEA=10:1, Rf=0.1) indicated that one new major new spot had appeared. The reaction mixture was diluted with EtOAc (15 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-HPLC to provide (rac)-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide as a yellow solid (24.5 mg, 20.5% yield). MS (ES+, m/z): 532.2.


Synthesis of rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide: A mixture of (rac)-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.12 g, 225.34 μmol, 1 eq.), methylamine hydrochloride (30.43 mg, 450.68 μmol, 2 eq.), HOBt (45.67 mg, 338.01 μmol, 1.5 eq.), EDCI (64.80 mg, 338.01 μmol, 1.5 eq.), and TEA (91.21 mg, 901.36 μmol, 125.46 μL, 4 eq.) in DCM (5 mL) was degassed and purged with N2. The mixture was stirred at 20° C. for 16 h under N2 atmosphere, after which time TLC analysis (EtOAc:TEA=10:1, Rf=0.2) indicated that one new major spot had formed. The reaction mixture was diluted with EtOAc (15 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, EtOAc:TEA=10:1), and further purified by prep-HPLC to provide (rac)-4-{[3-(4-{[(3R,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide as a yellow solid(22.1 mg, 18.0% yield) MS (ES+, m/z): 546.3.


Example D155
Preparation of Compounds 788A and 789A



embedded image


4-{[3-(4-{[(3R,4R)-3-Fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid was prepared via an procedure analogous to the synthesis of (rac)-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid according to steps 3-5 of EXAMPLE D154, using (rac)-methyl 4-((3-(4-(((3S,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate in place of (rac)-methyl 4-((3-(4-(((3R,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate. The racemate product was resolved into its constituent enantiomers via chiral SFC.


4-{[3-(4-{[(3R,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (32 mg, 60.09 μmol, 41.05% yield) was obtained as white solid (MS (ES+, m/z): 533.1). 4-{[3-(4-{[(3S,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (26 mg, 48.82 μmol, 33.36% yield) was obtained as a white solid (MS (ES+, m/z): 533.1).


Example D156
Synthesis of Compounds 885A, 886A, and 887A



embedded image


Synthesis of Compound methyl 4-((3-(4-(((3SR,4SR)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate: To a solution of (rac)-methyl 4-((3-(4-(((3S,4S)-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (500 mg, 938.92 μmol, 1 eq.) and (R)-glycidyl methyl ether (413.62 mg, 4.69 mmol, 417.80 μL, 5 eq.) in DMF (10 mL) was added K2CO3 (389.29 mg, 2.82 mmol, 3 eq.). The mixture was stirred at 50° C. for 12 h, after which time TLC analysis (PE:EtOAc=0:1) indicated that the reaction was complete. The reaction mixture was quenched with water (60 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=0:1) to provide methyl 4-((3-(4-(((3SR,4SR)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (240 mg, 386.70 μmol, 41.19% yield) as a yellow solid.


Synthesis of final products: To a solution of methyl 4-((3-(4-(((3SR,4SR)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoate (200 mg, 322.25 μmol, 1 eq.) in THF (2 mL), water (1 mL), and MeOH (1 mL) was added LiOH-water (135.23 mg, 3.22 mmol, 10 eq.). The mixture was stirred at 50° C. for 12 h, after which time TLC (DCM:MeOH=10:1, Rf=0.19) indicated that the reaction was complete. The reaction mixture was quenched with water (60 mL) at 25° C., and then extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1, Rf=0.19), and further purified by prep-HPLC to provide diastereomeric mixture 4-((3-(4-(((3SR,4SR)-3-fluoro-14(R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (160 mg, 255.85 μmol, 79.39% yield) as a white solid. MS (ES+, m/z): 607.3.


The diastereomers were then separated via prep-HPLC to provide 4-((3-(4-(((3S,4S)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid and 4-((3-(4-(((3R,4R)-3-fluoro-1-((R)-2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid.


Example D157
Preparation of Compounds 786A and 793A



embedded image


Preparation of rac-4-{[3-(4-{[(3R,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide: rac-4-{[3-(4-{[(3R,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide was prepared via a procedure analogous to EXAMPLE D154, using 4-{[3-(4-{[(3S,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (0.08 g, 150.23 μmol, 1 eq.) in place of (rac)-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid. The crude residue was purified by prep-HPLC (column: C18 100×30 5 μm; mobile phase: [water (0.225% FA)-ACN]; B %: 1%-30%, 15 min) to provide (rac)-4-{[3-(4-{[(3R,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide as a white solid (0.03 g, 56.44 μmol, 37.57% yield). MS (ES+, m/z): 532.2.


Synthesis of (rac)-4-{[3-(4-{[(3R,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide: (rac)-4-{[3-(4-{[(3R,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide was prepared via procedure analogous to EXAMPLE D154, using 4-{[3-(4-{[(3S,4S)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzoic acid (80 mg, 150.23 μmol, 1 eq.) in place of (rac)-4-((3-(4-(((3R,4S)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid. The crude residue was purified by prep-HPLC (column: C18 100×30 5 μm; mobile phase: [water (0.225% FA)-ACN]; B %: 1%-30%, 15 min) to provide (rac)-4-{[3-(4-{[(3R,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide as a white solid (0.03 g, 54.99 μmol, 36.60% yield). MS (ES+, m/z): 546.2.


Example D158
Preparation of Compound 1054A



embedded image


Synthesis of 3-((3-methoxy-4-nitrophenyl)sulfonyl)-6-oxa-3-azabicyclo[3.1.1]heptane: To a solution of 6-oxa-3-azabicyclo[3.1.1]heptane (486.28 mg, 1.79 mmol, 1.1 eq.) in DCM (10 mL) was added TEA (329.73 mg, 3.26 mmol, 453.56 μL, 2 eq.) and 3-methoxy-4-nitrobenzenesulfonyl chloride (410 mg, 1.63 mmol, 1 eq.). The resulting mixture was stirred at 25° C. for 2 h, after which time TLC (PE:EtOAc=3:1, Rf=0.19) indicated that the starting sulfonyl chloride was completely consumed, and one new spot was observed. The reaction mixture was poured into water (50 mL) and filtered with diatomite. The aqueous phase was extracted with EtOAc (10 mL×3), and the combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The resulting residue was purified by column chromatography (SiO2, PE:EtOAc=4:1 to 1:1) to afford 3-((3-methoxy-4-nitrophenyl)sulfonyl)-6-oxa-3-azabicyclo[3.1.1]heptane (320 mg, 1.02 mmol, 62.49% yield) as a light yellow solid.


Synthesis of 4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyaniline: To a solution of 3-((3-methoxy-4-nitrophenyl)sulfonyl)-6-oxa-3-azabicyclo[3.1.1]heptane (310 mg, 986.28 μmol, 1 eq.) in EtOH (10 mL) and water (2 mL) was added a saturated aqueous NH4Cl solution (263.79 mg, 4.93 mmol, 172.41 μL, 5 eq.) at 25° C. Fe (275.39 mg, 4.93 mmol, 5 eq.) was then added, and the mixture was stirred at 70° C. for 2 h. TLC analysis (PE:EtOAc=1:1, Rf=0.20) indicated that the starting nitro compound was completely consumed, and one new spot was detected. The mixture was concentrated, the resulting residue was extracted with EtOAc (60 mL), and the EtOAc solution was concentrated to afford 4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyaniline (260 mg, 914.43 μmol, 92.72% yield) as a black brown solid.


Synthesis of tert-butyl (4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyphenyl)carbamate: To a solution of 4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyaniline (210 mg, 738.58 μmol, 1 eq.) in DCM (10 mL) were added DMAP (90.23 mg, 738.58 μmol, 1 eq.) and Boc2O (322.38 mg, 1.48 mmol, 339.35 μL, 2 eq.). The mixture was stirred at 25° C. for 12 h, after which time TLC analysis (PE:EtOAc=0.20, Rf=0.20) indicated that the starting primary amine was consumed completely, and one main peak with the desired product mass was detected via LC-MS. The reaction mixture was then poured into water (40 mL) and filtered with diatomite. The aqueous phase was extracted with EtOAc (6 mL×3), and the combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (PE:EtOAc=5:1, Rf=0.20) to afford tert-butyl (4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyphenyl)carbamate (130 mg, 338.15 μmol, 45.78% yield) as a yellow oil.


Synthesis of tert-butyl (4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyphenyl)(prop-2-yn-1-yl)carbamate: To a solution of tert-butyl (4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyphenyl)carbamate (130 mg, 338.15 μmol, 1 eq.) in DMF (4 mL) was added NaH (27.05 mg, 676.30 μmol, 60% w/w, 2 eq.). The mixture was stirred at 0° C. for 30 min, and propargyl bromide was then added (48.27 mg, 405.78 μmol, 34.98 μL, 1.2 eq.). The mixture was stirred at 25° C. for 1.5 h, after which time TLC analysis (PE:EtOAc=5:1, Rf=0.26) indicated that the starting secondary amine was consumed completely, and one main peak with the desired product mass was detected via LC-MS. The reaction mixture was poured into water (30 mL) and filtered with diatomite. The aqueous phase was extracted with EtOAc (6 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (PE:EtOAc=5:1, Rf=0.26) to afford tert-butyl (4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyphenyl)(prop-2-yn-1-yl)carbamate (100 mg, 236.69 μmol, 70% yield) as a yellow oil.


Synthesis of 4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline: To a solution of tert-butyl (4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyphenyl)(prop-2-yn-1-yl)carbamate (100 mg, 236.69 μmol, 1 eq.) in DCM (6 mL) was added TFA (2 mL), then the mixture was stirred at 25° C. for 1 h. TLC analysis (PE:EtOAc=1:1, Rf=0.22) indicated that the starting Boc-amine was consumed completely. The residue was poured into a saturated aqueous solution of NaHCO3 (30 mL) and filtered with diatomite. The aqueous phase was extracted with EtOAc (6 mL×3), and the combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The black-brown solid residue containing crude 4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline (50 mg) was used in next step directly.


Synthesis of final product: To a solution of 4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline (31.52 mg, 97.79 μmol, 1 eq.) in DMSO (4 mL) were added diisopropylamine (98.95 mg, 977.86 μmol, 138.20 μL, 10 eq.) and CuI (18.62 mg, 97.79 μmol, 1 eq.). The mixture was then degassed with N2, and 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (50 mg, 97.79 μmol, 1 eq.) and Pd(PPh3)4 (22.60 mg, 19.56 μmol, 0.2 eq.) were added. The mixture was stirred at 25° C. for 2 h, after which time TLC analysis (PE:EtOAc=1:1, Rf=0.21) indicated that 10% of the iodoindole remained, and one main peak with the desired product mass was detected via LC-MS. The reaction mixture was diluted with EtOAc (5 mL), poured into a saturated EDTA solution (30 mL), and stirred for 1 h. The mixture was then extracted with EtOAc (15 mL×2), and The combined organic layers were washed with brine (10 mL) and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (PE:EtOAc=1:1, Rf=0.21) to afford 1-(4-((2-(3-((4-((6-oxa-3-azabicyclo[3.1.1]heptan-3-yl)sulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (4.5 mg, 6.22 μmol, 6.36% yield) as a yellow solid. MS (ES+, m/z): 706.3.


Example D159
Synthesis of 4-{[3-(4-{[1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzene-1-sulfonamide (Compound 574A)



embedded image


To a mixture 3-hydroxy-4-(prop-2-ynylamino)benzenesulfonamide (41.48 mg, 146.68 μmol, 1.5 eq.) and 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (0.05 g, 97.79 μmol, 1 eq.) in DMSO (2 mL) were added CuI (18.62 mg, 97.79 μmol, 1 eq.), Pd(PPh3)4 (11.30 mg, 9.78 μmol, 0.10 eq.), and N-isopropylpropan-2-amine (9.89 mg, 97.79 μmol, 13.82 μL, 1 eq.). The mixture was stirred at 30° C. for 1 h under N2. TLC analysis (PE:EtOAc=0:1, Rf=0.23) showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous solution of EDTA (30 mL) and EtOAc (10 mL) and stirring the mixture at 25° C. for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, PE:EtOAc=0:1, Rf=0.24) to afford the desired product. MS (ES+, m/z): 624.2.


Example D160
Synthesis of N-(3-(4-((1-(2-hydroxy-3-methoxypropyl)piperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-N-(2-hydroxy-4-(N-propionylsulfamoyl)phenyl)propionamide (Compound 636A)



embedded image


To a mixture N-(2-hydroxy-4-(N-propionylsulfamoyl)phenyl)-N-(prop-2-yn-1-yl)propionamide (57.86 mg, 117.34 1.2 eq.) and 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)-3-methoxypropan-2-ol (0.05 g, 97.79 μmol, 1 eq.) in DMSO (2 mL) were added CuI (18.62 mg, 97.79 μmol, 1 eq.), Pd(PPh3)4(11.30 mg, 9.78 μmol, 0.10 eq.), and N-isopropylpropan-2-amine (9.89 mg, 97.79 μmol, 13.82 μL, 1 eq.). The mixture was stirred at 30° C. for 1 h under N2. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous EDTA solution (30 mL) and EtOAc (10 mL) and stirring the mixture at 25° C. for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-TLC (SiO2, PE:EtOAc=0:1, Rf=0.24) and prep-HPLC to afford the desired product (12.6 mg, 15.71 μmol, 16.07% yield) as a yellow solid. MS (ES+, m/z): 722.3.


Example D161
General Procedure for Preparation of Compounds 536A, 540A, and 729A



embedded image


Synthesis of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of tert-butyl 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (6 g, 10.89 mmol, 1 eq.) in DCM (50 mL) was added TFA (50 mL). The mixture was stirred at 0° C. for 1 h, after which time LC-MS and TLC analysis (PE:EtOAc=5:1, Rf=0.1) indicated that reaction was complete. The reaction mixture was concentrated in vacuo, and the residue was poured into water (300 mL) and neutralized by adding saturated aqueous Na2CO3 (100 mL). The aqueous phase was extracted with EtOAc (200 mL×3). The combined organic layers were washed with brine (100 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was stirred in PE (20 mL) at 25° C. for 1 h and filtered to afford 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (15 g, 31.90 mmol, 97.62% yield) as light yellow solid.


Synthesis of N-(1-ethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and 2-iodo-N-(1-isopropylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 212.66 μmol, 1 eq.) in DMF (2 mL) were added isopropyl bromide or ethyl bromide (45 eq.) and K2CO3 (146.95 mg, 1.06 mmol, 5 eq.). The resulting mixture was stirred at 50° C. for 2˜5 h under N2. The mixture was poured into water (30 mL) and then extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue that was purified by prep-TLC to afford desired compounds N-(1-ethylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or 2-iodo-N-(1-isopropylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine as yellow solids.


Synthesis of 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-one: To a solution of 2-iodo-N-(piperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.2 g, 425.32 μmol, 1 eq.) and TEA (129.11 mg, 1.28 mmol, 177.60 μL, 3 eq.) in DCM (2 mL) was added acetic anhydride (52.10 mg, 510.38 μmol, 47.80 μL, 1.2 eq.). The resulting mixture was stirred 0° C. for 2 h and then poured into water (10 mL). The mixture was extracted with DCM (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was washed with PE (10 mL×3) to afford desired compound 1-(4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidin-1-yl)ethan-1-one (0.15 g, 290.17 μmol, 68.22% yield) as a yellow solid.


Synthesis of final products: To a mixture of 2-(5-(methylsulfonyl)-2-(prop-2-yn-1-ylamino)phenoxy)acetonitrile (prepared according to EXAMPLE A4) (1˜2 eq.) in DMSO (2 mL) was added i-Pr2NH (1030 eq.). CuI (1˜2 eq.), R3-substituted iodoindole (1 eq.), and Pd(PPh3)4 (0.20˜0.50 eq.) were then added to the mixture. The mixture was stirred at 20-40° C. for 1-3 h under N2, and the progress of the reaction was monitored by LC-MS or TLC. The mixture was poured into a saturated EDTA solution (15 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3), and the combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by preparative TLC, preparative HPLC, or preparative TLC followed by preparative HPLC to afford the desired compounds.


2-(5-methanesulfonyl-2-{[3-(4-{[1-(propan-2-yl)piperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}phenoxy)acetonitrile, MS (ES+, m/z): 602.3; 2-{2-[(3-{4-[(1-ethylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-5-methanesulfonylphenoxy}acetonitrile, MS (ES+, m/z): 588.2; and 2-{2-[(3-{4-[(1-acetylpiperidin-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-5-methanesulfonylphenoxy}acetonitrile, MS (ES+, m/z): 602.2.


Example D162
Preparation of 1-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxyphenyl)-formamido]-3-methoxypropan-2-yl 2-methylpropanoate



embedded image


Synthesis of tert-butyl N-[4-[(2-hydroxy-3-methoxy-propyl)carbamoyl]-2-methoxy-phenyl]-N-prop-2-ynyl-carbamate. To a solution of 4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-methoxy-benzoic acid (200 mg, 655.04 1 eq) in DMF (2 mL) were added 1-amino-3-methoxy-propan-2-ol (103.3 mg, 982.56 1.5 eq), HATU (498.1 mg, 1.31 mmol, 2 eq), and TEA (331.4 mg, 3.28 mmol, 456 μL, 5 eq). The mixture was degassed, purged with N2 3 times, and stirred at 50° C. for 2 h under N2 atmosphere. TLC analysis (PE:EtOAc=1:1, Rf=0.4) indicated that the benzoic acid starting material was consumed. The reaction mixture was diluted with water (30 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a crude residue. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) to give the desired product (170 mg, 66% yield).


Synthesis of [1-[[[4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-methoxy-benzoyl]amino]methyl]-2-methoxy-ethyl] 2-methylpropanoate. To a solution of tert-butyl N-[4-[(2-hydroxy-3-methoxy-propyl)carbamoyl]-2-methoxy-phenyl]-N-prop-2-ynyl-carbamate (170 mg, 433.18 μmol, 1 eq) in DCM (2 mL) were added TEA (306.8 mg, 3.03 mmol, 422 μL, 7 eq) and 2-methylpropanoyl 2-methylpropanoate (342.6 mg, 2.17 mmol, 359 μL, 5 eq). The mixture was stirred at 25° C. for 4 h under N2 atmosphere. The reaction progress was monitored by TLC analysis (PE:EtOAc=1:1, Rf=0.45). Upon completion of the reaction, the reaction mixture was quenched by addition of water (20 mL) and extracted with DCM (15 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the crude [1-[[[4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-methoxy-benzoyl] amino]methyl]-2-methoxy-ethyl]2-methylpropanoate (160 mg), which was used directly in the next reaction without further purification.


Synthesis of [1-(methoxymethyl)-2-[[3-methoxy-4-(prop-2-ynylamino)benzoyl]-amino] ethyl]2-methylpropanoate. A solution of [1-[[[4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-methoxy-benzoyl]amino]methyl]-2-methoxy-ethyl] 2-methylpropanoate (160 mg, 345.92 μmol, 1 eq) in TFA (1.5 mL) and DCM (3 mL) was stirred at 25° C. for 15 min. TLC analysis (PE:EtOAc=1:1, Rf=0.25) indicated that 95% of the starting material was consumed, and one major new spot was detected. The reaction mixture was quenched by adding a saturated solution of Na2CO3 to adjust the pH of the solution to 8. The mixture was extracted with DCM (30 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated to dryness under reduced pressure. The crude residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) to give the desired product (85 mg, 68% yield).


Synthesis of [1-[[[4-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoyl]amino]methyl]-2-methoxy-ethyl] 2-methylpropanoate. To a solution of [1-(methoxymethyl)-2-[[3-methoxy-4-(prop-2-ynylamino)benzoyl] amino]ethyl] 2-methylpropanoate (79.6 mg, 219.67 μmol, 1 eq) in DMSO (2 mL) were added i-Pr2NH (222.3 mg, 2.20 mmol, 310.45 μL, 10 eq), N-[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (100 mg, 219.67 μmol, 1 eq), CuI (8.4 mg, 43.93 μmol, 0.2 eq), and Pd(PPh3)4 (12.7 mg, 10.98 μmol, 0.05 eq). The reaction mixture was degassed, purged with N2 3 times, and stirred at 50° C. for 2 h. TLC analysis (DCM:MeOH=10:1, Rf=0.38) indicated that the starting material was consumed completely and one new spot was observed. The reaction mixture was quenched by adding a saturated solution of EDTA (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) and was purified by preparative HPLC (Phenomenex Luna C18: 200×40 mm, 10 um; Mobile phase: [water (0.2% FA)/ACN]; B %: 20%-60%, 10 min) to give the product (30 mg, 43% yield). LC-MS (ES+, m/z). 660.1 [(M+H)+].


Example D163
Preparation of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(1-hydroxypropan-2-yl)-3-methoxybenzamide



embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (100 mg, 187.78 μmol, 1 eq) and 2-aminopropan-1-ol (16 mg, 206.56 μmol, 16.45 μL, 1.1 eq) in DMF (2 mL) were added HATU (107.1 mg, 281.67 μmol, 1.5 eq) and TEA (57.01 mg, 563.35 μmol, 78.41 μL, 3 eq). The mixture was degassed, purged with N2 3 times, and stirred at 25° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely. Several new peaks were observed on LC-MS, and 34% of the desired compound was detected. The residue was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The crude product was purified by reversed-phase HPLC (column: Phenomenex Luna C18 200×40 mm, 10 um; mobile phase: [water (0.2% FA)-ACN]; B %: 20%-50%, 10 min) to give the desired amide product as a yellow solid (18.6 mg, 17% yield). LC-MS (ES+, m/z): 590.1 [(M+H)+]


Example D164
Preparation of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-N-(2-hydroxypropyl)-3-methoxybenzamide



embedded image


To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (100 mg, 187.78 μmol, 1 eq) and 1-aminopropan-2-ol (15.5 mg, 206.56 μmol, 16.18 μL, 1.1 eq) in DMF (2 mL) were added HATU (107.1 mg, 281.67 μmol, 1.5 eq) and TEA (57.01 mg, 563.34 μmol, 78.41 μL, 3 eq). The mixture was degassed, purged with N2 3 times, and stirred at 25° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely. Several new peaks were shown on LC-MS, and 35% of the desired compound was detected. The residue was diluted with water (30 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The crude product was purified by reversed-phase HPLC (column: Phenomenex Luna C18 200×40 mm, 10 um; mobile phase: [water (0.2% FA)-ACN]; B %: 20%-50%, 10 min) to give the desired amide product as a yellow solid (30.8 mg, 27% yield). LC-MS (ES+, m/z). 590.1 [(M+H)+]


Example D165
Preparation of 4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-hydroxy-N-methylbenzamide



embedded image


Synthesis of 3-hydroxy-N-methyl-4-(prop-2-ynylamino)benzamide. To a mixture of 3-methoxy-N-methyl-4-(prop-2-ynylamino)benzamide (500 mg, 2.29 mmol, 1 eq) in DCM (10 mL) was added BBr3 (1.43 g, 5.73 mmol, 551.85 μL, 2.5 eq) at −10° C. The mixture was stirred at 0° for 1 h. LC-MS analysis showed that 27% of the starting material still remained. Several new peaks were observed on LC-MS, and 57% of the desired compound was detected. The reaction mixture was quenched by addition saturated solution of Na2CO3 (80 mL) to adjust the pH to 7˜The mixture was then extracted with DCM:MeOH (100:1, 50 mL×3), filtered and concentrated to dryness under reduced pressure. The crude residue was purified by preparative TLC (SiO2, PE:EtOAc=1:1) to give the product (80 mg, 15% yield). LC-MS (ES+, m/z): 205.0 [(M+H)+].


Synthesis of 4-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-hydroxy-N-methyl-benzamide. To a solution of 3-hydroxy-N-methyl-4-(prop-2-ynylamino)benzamide (27.4 mg, 120.82 μmol, 1.1 eq) in DMSO (1 mL) were added i-Pr2NH (111.1 mg, 1.10 mmol, 155 μL, 10 eq), CuI (2.1 mg, 10.98 μmol, 0.1 eq), and N-[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (50 mg, 109.83 μmol, 1 eq), Pd(PPh3)4 (6.4 mg, 5.49 μmol, 0.05 eq). The mixture was degassed, purged with N2 3 times, and stirred at 40° C. for 1 h under N2 atmosphere. LC-MS analysis showed that the starting material was consumed completely, and the desired mass was detected. The reaction mixture was quenched by adding a saturated EDTA solution (20 mL) and stirring the mixture for 0.5 h. The mixture was then extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×1), dried over anhydrous Na2SO4, filtered, and concentrated to dryness under reduced pressure. The crude residue was purified by preparative HPLC (Phenomenex Luna C18 100×30 mm, 5 um; Mobile phase: [water (0.2% FA)-ACN]; B %: 10%-30%, 12 min) to give the desired product (11.8 mg, 20% yield). LC-MS (ES+, m/z): 532.2 [(M+H)+]


Example D166
Preparation of 3-ethoxy-4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide



embedded image


Synthesis of methyl 4-amino-3-ethoxy-benzoate. To a mixture of methyl 4-amino-3-hydroxy-benzoate (200 mg, 1.20 mmol, 1 eq), K2CO3 (330.7 mg, 2.39 mmol, 2 eq) in DMF (4 mL) was added iodoethane (223.92 mg, 1.44 mmol, 114.83 μL, 1.2 eq). The mixture was stirred at 20° C. for 16 h under N2 atmosphere. TLC analysis (PE:EtOAc=3:1, Rf=0.35) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was quenched by adding water (60 mL) and extracted with EtOAc (35 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated to dryness under reduced pressure. The crude residue was purified by preparative TLC (SiO2, PE:EtOAc=3:1) to give the desired product (140 mg, 60% yield).


Synthesis of methyl 4-(tert-butoxycarbonylamino)-3-ethoxy-benzoate. A mixture of methyl 4-amino-3-ethoxy-benzoate (140 mg, 717.16 μmol, 1 eq) in Boc2O (782.6 mg, 3.59 mmol, 823.79 μL, 5 eq) was degassed, purged with N2 3 times, and stirred at 110° C. for 2 h under N2 atmosphere. TLC analysis (PE:EtOAc=3:1, Rf=0.39) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was quenched by adding water (20 mL) and extracted with EtOAc (15 mL×2). The combined organic layers were washed with brine (8 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness under reduced pressure. The crude residue was purified by preparative TLC (SiO2, PE:EtOAc=3:1) to give the desired product (120 mg, 45% yield). LC-MS (ES+, m/z): 240.0 [(M−tBu)+]


Synthesis of methyl 4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-ethoxy-benzoate. A mixture of methyl 4-(tert-butoxycarbonylamino)-3-ethoxy-benzoate (100 mg, 338.60 μmol, 1 eq), Cs2CO3 (220.7 mg, 677.21 μmol, 2 eq), 3-bromoprop-1-yne (75.5 mg, 507.91 μmol, 54.73 μL, 1.5 eq) in DMF (2 mL) was degassed and purged with N2 3 times. The mixture was stirred at 25° C. for 3 h under N2 atmosphere. LC-MS analysis showed that the starting material was consumed completely, and the desired mass was detected. The reaction mixture was quenched by adding water (40 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness under reduced pressure to give the crude product (100 mg). The crude product was used in the next step without further purification. LC-MS (ES+, m/z): 278.0 [(M−tBu)+]


Synthesis 4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-ethoxy-benzoic acid. A mixture of methyl 4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-ethoxy -benzoate (100 mg, 299.96 μmol, 1 eq) and LiOH.H2O (62.9 mg, 1.50 mmol, 5 eq) in MeOH (1.5 mL) and water (0.5 mL) was degassed and purged with N2 3 times. The mixture was stirred at 25° C. for 2 h under N2 atmosphere. TLC analysis (PE:EtOAc=3:1, Rf=0.3) indicated that the ester starting material was consumed completely, and one new spot was observed. The reaction mixture was concentrated under reduced pressure to remove MeOH and was quenched by adding 1N HCl to adjust the pH of the solution to 3˜4, and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous Na2SO4, filtered, and concentrated to dryness under reduced pressure to give crude 4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-ethoxy-benzoic acid (80% yield). The crude product was used in the next reaction without further purification.


Synthesis of tert-butyl N-(4-carbamoyl-2-ethoxy-phenyl)-N-prop-2-ynyl-carbamate. A mixture of 4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-ethoxy-benzoic acid (80 mg, 250.51 μmol, 1 eq), ammonia.hydrochloride (40.20 mg, 751.52 μmol, 3 eq), HOBt (67.7 mg, 501.02 μmol, 2 eq), EDCI (96.0 mg, 501.02 μmol, 2 eq) and TEA (253.49 mg, 2.51 mmol, 349 μL, 10 eq) in DMF (2 mL) was degassed, purged with N2 3 times, and stirred at 25° C. for 4 h under N2 atmosphere. LC-MS analysis showed the mass of the desired product. The reaction mixture was quenched by adding water (30 mL) and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by preparative TLC (SiO2, PE:EtOAc=1:1) to give the desired product (60 mg, 68% yield). LC-MS (ES+, m/z): 263.0 [(M−tBu)+].


Synthesis of tert-butyl N-(4-carbamoyl-2-ethoxy-phenyl)-N-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]carbamate. To a solution of tert-butyl N-(4-carbamoyl-2-ethoxy-phenyl)-N-prop-2-ynyl-carbamate (51.3 mg, 144.98 μmol, 1.1 eq) in DMSO (2 mL) were added i-Pr2NH (134 mg, 1.32 mmol, 186 μL, 10 eq), CuI (2.5 mg, 13.18 μmol, 0.1 eq), N-[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (60 mg, 131.80 μmol, 1 eq), and Pd(PPh3)4 (7.62 mg, 6.59 μmol, 0.05 eq). The reaction mixture was degassed, purged with N2 3 times, and stirred at 40° C. for 1 h under N2 atmosphere. TLC analysis (EtOAc: MeOH=5:1, Rf=0.30) indicated that the starting material was consumed completely, and one new spot was observed. The reaction was quenched by adding a saturated solution of EDTA (30 mL), stirring the mixture for 0.5 h, and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by preparative TLC (SiO2, EtOAc: MeOH=5:1) to give the desired product (75 mg, 82% yield).


Synthesis of 3-ethoxy-4-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]benzamide. A mixture of tert-butyl N-(4-carbamoyl-2-ethoxy-phenyl)-N-[3-[4-[[(3S,4R) -3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]carbamate (75 mg, 116.16 μmol, 1 eq), in HCl/EtOAc (3 mL) was stirred at 25° C. for 1 h under N2 atmosphere. TLC analysis (EtOAc: MeOH=5:1, Rf=0.38) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was concentrated under reduced pressure to remove EtOAc and was quenched by adding a saturated solution of Na2CO3 to adjust the pH to 9. The mixture was then extracted with EtOAc (20 mL×2). The combined organic layers were washed with brine (20 mL), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by preparative TLC (SiO2, EtOAc: MeOH=5:1). The residue was purified by preparative HPLC (FA condition; column: Welch Xtimate C18 150×2 5 mm, 5 um; Mobile phase: [water (0.2% FA)-ACN]; B %: 20%-40%, 10 min) to give the desired product (25 mg, 39.5% yield). LC-MS (ES+, m/z): 546.2 [(M+H)+]


Example D167
Preparation of N-ethyl-4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-hydroxybenzamide



embedded image


Synthesis of tert-butyl N-[4-(ethylcarbamoyl)-2-methoxy-phenyl]-N-prop-2-ynyl-carbamate. To a solution of 4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-methoxy-benzoic acid (1 g, 3.28 mmol, 1 eq) in DMF (10 mL) were added TEA (3.31 g, 32.75 mmol, 4.56 mL, 10 eq), HOBt (885.1 mg, 6.55 mmol, 2 eq), EDCI (1.26 g, 6.55 mmol, 2 eq), and ethanamine (267.1 mg, 3.28 mmol, 387.63 μL, 1 eq, HCl). The reaction mixture was degassed, purged with N2 3 times, and stirred at 30° C. for 2 h under N2 atmosphere. TLC analysis (PE:EtOAc=2:1, Rf=0.41) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was quenched by adding water (100 mL) and extracted with EtOAc (50 mL×2). The combined organic layers were washed with brine (50 mL), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by column chromatography (SiO2, PE/EtOAc=0:1 to 3:1) to give the desired product (800 mg, 74% yield).


Synthesis of N-ethyl-3-methoxy-4-(prop-2-ynylamino)benzamide. A mixture of tert-butyl N-[4-(ethylcarbamoyl)-2-methoxy-phenyl]-N-prop-2-ynyl-carbamate (800 mg, 2.41 mmol, 1 eq), in DCM (8 mL) and TFA (4 mL) was degassed and purged with N2 3 times, and the mixture was stirred at 25° C. for 0.5 h under N2 atmosphere. TLC analysis (PE:EtOAc=1:1, Rf=0.4) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was quenched by adding a saturated solution of Na2CO3, adjusting the pH of the solution to 7˜8, and extracting the mixture with DCM (100 mL×3). The combined organic layers were washed with brine (50 mL), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by column chromatography (SiO2, PE:EtOAc=0:1 to 1:1) to give the desired product (470 mg, 84% yield).


Synthesis of N-ethyl-3-hydroxy-4-(prop-2-ynylamino)benzamide. To a mixture of N-ethyl-3-methoxy-4-(prop-2-ynylamino)benzamide (400 mg, 1.45 mmol, 1 eq) in DCM (10 mL) was added BBr3 (1.09 g, 4.34 mmol, 418.49 μL, 3 eq) at 0° C. The mixture was stirred at 0° C. for 1.5 h. LC-MS analysis showed that 3.5% of the starting material remained. Several new peaks were shown on LC-MS, and 84% of the desired compound was detected. The reaction mixture was quenched by adding a saturated solution of Na2CO3, and 1N HCl was added to the mixture to adjust the pH of the solution to 6. The mixture was then extracted with DCM:MeOH=200:1 (100 mL×2), filtered, and concentrated under reduced pressure to give a residue. The crude product was precipitated using DCM (15 mL), filtered, and concentrated under reduced pressure to give the desired product (180 mg, 53% yield). LC-MS (ES+, m/z): 219.1 [(M+H)+].


Synthesis of N-ethyl-4-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-hydroxy-benzamide. To a solution of N-ethyl-3-hydroxy-4-(prop-2-ynylamino)benzamide (41.0 mg, 169.14 μmol, 1.1 eq) in DMSO (1 mL) were added i-Pr2NH (155.6 mg, 1.54 mmol, 217.32 μL, 10 eq), CuI (2.9 mg, 15.38 μmol, 0.1 eq), N-[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (70 mg, 153.77 μmol, 1 eq), and Pd(PPh3)4 (8.9 mg, 7.69 μmol, 0.05 eq). The reaction mixture was degassed and purged with N2 3 times, then stirred at 40° C. for 1 h under N2 atmosphere. TLC analysis (EtOAc: MeOH=4:1, Rf=0.26) indicated that the starting material was consumed completely, and one new spot was observed. The mixture was quenched by adding a saturated solution of EDTA (40 mL), stirring the resulting mixture for 0.5 h, and extracting the mixture with EtOAc (25 mL×2). The combined organic layers were washed with brine (10 mL), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative HPLC (Phenomenex Luna C18 200×40 mm, 10 um; mobile phase: [water (0.2% FA)-ACN]; B %: 1%-30%, 8 min) to give the desired product (26 mg, 31% yield). LC-MS (ES+, m/z): 546.3 [(M+H)+].


Example D168
Preparation of 3-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxyphenyl)-formamido]-2-methoxypropyl 2-methylpropanoate



embedded image


Synthesis of 2-(3-(Benzyloxy)-2-hydroxypropyl)isoindoline-1,3-dione. To a solution of 2-((benzyloxy)methyl)oxirane (2.68 g, 1.2 eq), isoindoline-1,3-dione (2 g, 1 eq) in EtOH (20 mL) was added K2CO3 (150.29 mg, 0.08 eq). The mixture was stirred at 80° C. for 12 h. LCMS analysis showed that the starting material was consumed completely, and one main peak with desired mass was observed. The reaction mixture was concentrated under reduced pressure to dryness. The crude residue was purified by column chromatography (SiO2, PE:EtOAc=20:1 to 2:1). 2-(3-(Benzyloxy)-2-hydroxypropyl)isoindoline-1,3-dione was obtained as a white solid (3.1 g).


Synthesis of 2-(3-(benzyloxy)-2-methoxypropyl)isoindoline-1,3-dione. To a solution of 2-(3-(benzyloxy)-2-hydroxypropyl)-isoindoline-1,3-dione (2 g, 1 eq) and MeI (1.37 g, 1.5 eq) in THF (20 mL) was added NaH (385.40 mg, 60% purity, 1.5 eq) at 0° C., then the mixture was stirred at 25° C. for 16 h. TLC analysis (PE:EtOAc=2:1, Rf=0.6) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was poured into NH4Cl (150 mL). The aqueous phase was extracted with EtOAc (60 mL×3). The combined organic phase was washed with brine (40 mL), dried with anhydrous Na2SO4, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=20:1 to 15:1) to give the desired product as a light yellow oil (1.2 g).


Synthesis of 3-(benzyloxy)-2-methoxypropan-1-amine. To a solution of 2-(3-(benzyloxy)-2-methoxypropyl)isoindoline-1,3-dione (1.2 g, 1 eq) in EtOH (12 mL), was added N2H4water (376.80 mg, 98% purity, 2 eq) at 50° C. under N2, then the mixture was stirred at 80° C. for 2 h. LCMS analysis showed that the starting material was consumed completely, and one main peak with the desired m/z was observed. The reaction mixture was concentrated under reduced pressure to remove the solvent. The crude product was purified by reversed-phase HPLC (column: Xtimate C18 10 u 250 mm*80 mm; mobile phase: [water(10 mM NH4HCO3)-ACN]; B %: 1%-20%, 27 min). 3-(Benzyloxy)-2-methoxypropan-1-amine was obtained as a clear oil (0.19 g). LCMS (ES+, m/z): 391.2 [(M+H)+]


Synthesis of 3-amino-2-methoxypropan-1-ol. To a solution of 3-(benzyloxy)-2-methoxypropan-1-amine (204.71 mg, 1.05 mmol, 1 eq) in MeOH (2 mL) was added Pd/C (10%, 0.15 g) under N2 atmosphere. The suspension was degassed and purged with H2 for 3 times. The mixture was stirred under H2 (50 psi or atm) at 25° C. for 16 h. TLC analysis (DCM:MeOH=10:1, Rf=0.2) indicated that the starting material was consumed completely. The reaction mixture was filtered and concentrated under reduced pressure to give a residue. The crude product was used directly in the next step. 3-Amino-2-methoxypropan-1-ol was obtained as a white oil (90 mg, crude). 1H NMR (400 MHz, Chloroform-d) δ=2.89-2.95 (m, 1H), 2.97-3.05 (m, 1H), 3.28 (br d, J=2.63 Hz, 1H), 3.43-3.46 (m, 3H), 3.69-3.76 (m, 1H), 3.79-3.86 (m, 1H), 7.30 (br s, 1H).


Synthesis of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-N-(3-hydroxy-2-methoxypropyl)-3-methoxybenzamide. To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (150 mg, 1 eq) in DMF (2 mL) were added HATU (160.65 mg, 1.5 eq) and TEA (85.51 mg, 3 eq). The mixture was degassed and purged with N2 for 3 times, and then 3-amino-2-methoxypropan-1-ol (32.58 mg, 1.1 eq) was added dropwise, The mixture was stirred at 25° C. for 1 h. LCMS analysis showed that the starting material was consumed completely, and three main peaks with the desired m/z were observed. The residue was diluted with water (50 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) to give 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-N-(3-hydroxy-2-methoxypropyl)-3-methoxybenzamide as a yellow solid (100 mg). LCMS (ES+, m/z): 620.3 [(M+1)+]


Synthesis of 3-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxyphenyl)-formamido]-2-methoxypropyl 2-methylpropanoate. To a solution of 4-((3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)-N-(3-hydroxy-2-methoxypropyl)-3-methoxybenzamide (90 mg, 1 eq) in DCM (5 mL) were added 2-methylpropanoyl 2-methylpropanoate (25.3 mg, 1.1 eq) and TEA (44.09 mg, 3 eq) , The mixture was stirred at 45° C. for 16 h. TLC analysis (DCM:MeOH=10:1, Rf=0.5) indicated that the starting material was consumed completely, and one new spot was observed. The mixture was filtered and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1). The residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) to give the desired product as a yellow solid (24.2 mg). LCMS (ES+, m/z): 690.2 [M+1)+].


Example D169
Preparation of N-ethyl-4-{[3-(4-{[(3S,4R)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide



embedded image


Synthesis of tert-butyl (4-(ethylcarbamoyl)-2-methoxyphenyl)(prop-2-yn-1-yl)carbamate. A mixture of 4-((tert-butoxycarbonyl)(prop-2-yn-1-yl)amino)-3-methoxybenzoic acid (0.4 g, 1.31 mmol, 1 eq) and ethanamine (106.83 mg, 1.31 mmol, 155.05 μL, 1 eq, HCl) in DMF (2 mL) were added HOBt (354.04 mg, 2.62 mmol, 2 eq) , EDCI (502.28 mg, 2.62 mmol, 2 eq) , and TEA (397.70 mg, 3.93 mmol, 547.04 μL, 3 eq). The mixture was degassed and purged with N2 3 times, and then the mixture was stirred at 25° C. for 2 h under N2 atmosphere. TLC analysis (PE:EtOAc=2:1, Rf=0.4) indicated that the starting material was consumed completely, and one new spot was observed. The residue was diluted with water (50 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, PE:EtOAc=2:1) to give tert-butyl (4-(ethylcarbamoyl)-2-methoxyphenyl)(prop-2-yn-1-yl)carbamate as clear oil (400 mg, 83% yield). 1H NMR (400 MHz, DMSO-d6) δ=1.10-1.17 (m, 3H), 1.20-1.42 (m, 9H), 3.06-3.14 (m, 1H), 3.31 (br s, 2H), 3.81-3.89 (m, 3H), 3.99-4.63 (m, 2H), 7.20-7.31 (m, 1H), 7.37-7.44 (m, 1H), 7.47-7.53 (m, 1H), 8.44-8.56 (m, 1H).


Synthesis of tert-butyl (3S,4R)-4-((2-(3-((tert-butoxycarbonyl)(4-(ethylcarbamoyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate. To a solution of tert-butyl (4-(ethylcarbamoyl)-2-methoxyphenyl)(prop-2-yn-1-yl)carbamate (55.26 mg, 166.26 μmol, 0.9 eq) in DMSO (2 mL) were added i-PrNH2 (109.20 mg, 1.85 mmol, 158.72 μL, 10 eq) and CuI (1.76 mg, 9.24 μmol, 0.05 eq). Then, tert-butyl (3S,4R)-3-fluoro-4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)piperidine-1-carboxylate (100 mg, 184.73 μmol, 1 eq) and Pd(PPh3)4 (10.67 mg, 9.24 μmol, 0.05 eq) were added, and the resulting mixture was purged with N2 3 times. The mixture was stirred at 25° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.45) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was quenched by adding a saturated solution of EDTA (100 mL) and extracted with EtOAc (90 mL×3).The combined organic layers were washed with brine (30 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) to give the desired product as a yellow solid (70 mg, 50% yield). LC-MS (ES+, m/z): 797.5 [(M+1)+]


Synthesis of N-ethyl-4-{[3-(4-{[(3S,4R)-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide. A solution of tert-butyl (3S,4R)-4-((2-(3-((tert-butoxycarbonyl)(4-(ethylcarbamoyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)-3-fluoropiperidine-1-carboxylate (70 mg, 93.86 μmol, 1 eq) in HCl/EtOAc (4 M, 2 mL) was stirred at 25° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.5) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was diluted with a saturated solution of Na2CO3 (50 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) and then by reversed-phase HPLC (column: Welch Xtimate C18 150×25 mm, 5 um; mobile phase: [water (0.2% FA)-ACN]; B %: 25%-50%, 10 min) to give the desired product as a yellow solid (20.6 mg, 40% yield).


Example D170
Preparation of 4-{[3-(4-{[(3S,4R)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide



embedded image


Synthesis of N-(((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine. To a solution of N-((3S,4R)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.15 g, 339.98 μmol, 1 eq) in DMF (2 mL) were added EtI (79.5 mg, 509.97 μmol, 41 μL, 1.5 eq) and K2CO3 (234.9 mg, 1.70 mmol, 5 eq).The mixture was stirred at 25° C. for 2 h under N2 atmosphere. TLC analysis (PE:EtOAc=2:1, Rf=0.4) indicated that the starting material was consumed completely, and one new spot was observed. The residue was diluted with water (20 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, PE:EtOAc=2:1). N-((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine was obtained as a yellow solid (120 mg, 68% yield). 1H NMR (400 MHz, DMSO-d6) δ=1.00 (t, J=7.09 Hz, 3H) 1.66-1.77 (m, 1H) 1.85-1.96 (m, 1H) 2.05-2.14 (m, 1H) 2.16-2.31 (m, 1H) 2.37 (br d, J=7.09 Hz, 2H) 2.90-2.94 (m, 1H) 3.07-3.17 (m, 1H) 3.51-3.70 (m, 1H) 4.72-4.92 (m, 1H) 4.96-5.05 (m, 2H) 5.35-5.44 (m, 1H) 6.19-6.28 (m, 1H) 6.79-6.86 (m, 1H) 6.88-6.97 (m, 1H) 7.22-7.30 (m, 1H).


Synthesis of tert-butyl (4-carbamoyl-2-methoxyphenyl)(3-(4-(((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate. To a solution of tert-butyl (4-carbamoyl-2-methoxyphenyl)(prop-2-yn-1-yl)carbamate (58.4 mg, 191.79 μmol, 0.9 eq) in DMSO (2 mL) were added i-PrNH2 (126 mg, 2.13 mmol, 183 μL, 10 eq) , CuI (2.03 mg, 10.66 μmol, 0.05 eq) , N-((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (100 mg, 213.10 μmol, 1 eq) , and Pd(PPh3)4 (12.31 mg, 10.66 μmol, 0.05 eq). The mixture was purged with N2 3 times then stirred at 25° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.5) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was quenched by addition a saturated solution of EDTA (100 mL) and extracted with EtOAc (90 mL×3).The combined organic layers were washed with brine (30 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) to give tert-butyl (4-carbamoyl-2-methoxyphenyl)(3-(4-(((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate as a yellow solid (100 mg, 69% yield). LC-MS (ES+, m/z): 678.8 [(M+1)+].


Synthesis of 4-{[3-(4-{[(3S,4R)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide. A solution of tert-butyl (4-carbamoyl-2-methoxyphenyl)(3-(4-(((3S,4R)-1-ethyl-3-fluoropiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate (100 mg, 154.87 μmol, 1 eq) in HCl/EtOAc (4 M, 2 mL) was stirred at 25° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.4) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was diluted with a saturated solution of Na2CO3 (50 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give a residue. The crude residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) then again by preparative TLC (SiO2, EtOAc:MeOH:TEA=20:1:1) to give 4-{[3-(4-{[(3S,4R)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxybenzamide as a yellow solid (25.2 mg, 30% yield). LC-MS (ES+, m/z): 546.2 [(M+1)+].


Example D171
Preparation of 5-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-4-methoxy-N,N-dimethylpyridine-2-carboxamide



embedded image


Synthesis of 5-bromo-4-methoxy-pyridine-2-carboxylic acid. A mixture of methyl 5-bromo-4-methoxy-pyridine-2-carboxylate (1 g, 4.06 mmol, 1 eq), LiOH.H2O (852.7 mg, 20.32 mmol, 5 eq) in THF (8 mL) and water (8 mL) was degassed and purged with N2 3 times, then stirred at 25° C. for 1 h under N2 atmosphere. TLC analysis (PE:EtOAc=2:1, Rf=0.02) indicated that the starting material was consumed completely, and one new spot was observed. The reaction mixture was quenched by adding 1N HCl to adjust the solution to pH=4 and extracted with EtOAc (30 mL×15). The combined organic layers were washed with brine (20 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give the crude 5-bromo-4-methoxy-pyridine-2-carboxylic acid (750 mg). LC-MS (ES+, m/z): 231.9 [(M−H)+]. The crude product was used in the next step without further purification.


Synthesis of 5-bromo-4-methoxy-N,N-dimethyl-pyridine-2-carboxamide. A mixture of 5-bromo-4-methoxy-pyridine-2-carboxylic acid (700 mg, 3.02 mmol, 1 eq), N-methylmethanamine (2 M, 1.96 mL, 1.3 eq), HATU (1.38 g, 3.62 mmol, 1.2 eq), and TEA (1.53 g, 15.08 mmol, 2.10 mL, 5 eq) in DMF (10 mL) was degassed and purged with N2 3 times, and the mixture was stirred at 25° C. for 15 h under N2 atmosphere. TLC analysis (PE:EtOAc=2:1, Rf=0.13) indicated that 10% of the starting material remained, and one major new spot was detected. The reaction mixture was quenched by adding water (100 mL) and extracted with EtOAc (50 mL×5). The combined organic layers were washed with brine (20 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, PE:EtOAc=2:1) to give 5-bromo-4-methoxy-N,N-dimethyl-pyridine-2-carboxamide (500 mg, 64% yield).


Synthesis of tert-butyl N-[6-(dimethylcarbamoyl)-4-methoxy-3-pyridyl]carbamate. To a solution of 5-bromo-4-methoxy-N,N-dimethyl-pyridine-2-carboxamide (300 mg, 1.16 mmol, 1 eq) in dioxane (10 mL) were added NH2Boc (271 mg, 2.32 mmol, 2 eq), Cs2CO3 (1.13 g, 3.47 mmol, 3 eq), XPhos (331 mg, 694.71 μmol, 0.6 eq), and Pd(OAc)2 (169 mg, 752.61 μmol, 0.65 eq). The mixture was degassed and purged with N2 3 times, then stirred at 120° C. for 2 h. TLC analysis (PE:EtOAc=1:1, Rf=20) indicated that the starting material was consumed completely, and new spots were detected. The reaction mixture was quenched by adding water (300 mL) and extracted with EtOAc (50 mL×5). The combined organic layers were washed with brine (30 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, PE:EtOAc=1:1) to give the desired product (200 mg, 59% yield). LC-MS (ES+, m/z): 296.1 [(M+H)+].


Synthesis of tert-butyl N-[6-(dimethylcarbamoyl)-4-methoxy-3-pyridyl]-N-prop-2-ynyl-carbamate. To a solution of tert-butyl N[6-(dimethylcarbamoyl)-4-methoxy-3-pyridyl]carbamate (150 mg, 507.90 μmol, 1 eq) in DMF (3 mL) were added Cs2CO3 (331 mg, 1.02 mmol, 2 eq) and 3-bromoprop-1-yne (98.18 mg, 660.27 μmol, 71.15 μL, 1.3 eq). The mixture was stirred at 25° C. for 10 h under N2 atmosphere. TLC analysis (PE:EtOAc=0:1, Rf=0.40) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding water (80 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The crude residue was purified by preparative TLC (SiO2, PE:EtOAc=0:1) to give tert-butyl N-[6-(dimethylcarbamoyl)-4-methoxy-3-pyridyl]-N-prop-2-ynyl-carbamate (115 mg, 68% yield). LC-MS (ES+, m/z): 334.1 [(M+H)+]


Synthesis of tert-butyl N-[6-(dimethylcarbamoyl)-4-methoxy-3-pyridyl]-N-[3-[4-[[(3S,4R) -3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]carbamate. To a solution of N-[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (130 mg, 285.57 μmol, 1 eq) in DMSO (2 mL) were added i-Pr2NH (288.97 mg, 2.86 mmol, 403.59 μL, 10 eq), tert-butyl N-[6-(dimethylcarbamoyl) -4-methoxy-3-pyridyl]-N-prop-2-ynyl-carbamate (104.72 mg, 314.13 μmol, 1.1 eq), CuI (10.88 mg, 57.11 μmol, 0.2 eq), and Pd(PPh3)4(16.50 mg, 14.28 μmol, 0.05 eq). The mixture was degassed and purged with N2 3 times then stirred at 50° C. for 1 h under N2 atmosphere. TLC analysis (DCM:MeOH=10:1, Rf=0.50) indicated that the starting material was consumed completely, and new spots were detected. The reaction mixture was quenched by adding a saturated solution of EDTA (150 mL) and stirred for 30 min then extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (20 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness. The crude residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) to give tert-butyl N-[6-(dimethylcarbamoyl)-4-methoxy-3-pyridyl]-N-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]carbamate (100 mg, 53% yield). LC-MS (ES+, m/z): 661.3 [(M+H)+].


Synthesis of 5-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-4-methoxy-N,N-dimethyl-pyridine-2-carboxamide. A mixture of tert-butyl N-[6-(dimethylcarbamoyl)-4-methoxy-3-pyridyl]-N-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]carbamate (100 mg, 151.35 μmol, 1 eq) in EtOAc (10 mL) and 4 M HCl/EtOAc (3 mL) was degassed and purged with N2 3 times, then stirred at 25° C. for 0.5 h under N2 atmosphere. LC-MS analysis showed that the starting material was consumed completely, and desired mass was detected. The reaction mixture was quenched by adding a saturated solution of Na2CO3 to adjust the solution to pH 9 and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness. The crude residue was purified by preparative HPLC (Column: Phenomenex Luna C18 200×40 mm, 10 um; Mobile phase: [water (10 mM NH4HCO3)-ACN]; B %: 20%-50%, 10 min) to give 5-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-4-methoxy-N,N-dimethyl-pyridine-2-carboxamide (27.5 mg, 32% yield). LC-MS (ES+, m/z): 561.1 [(M+H)+].


Example D172
Preparation of 5-{[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-4-methoxy-N-methylpyridine-2-carboxamide



embedded image


Synthesis of methyl 5-(tert-butoxycarbonylamino)-4-methoxy-pyridine-2-carboxylate. To a solution of methyl 5-bromo-4-methoxy-pyridine-2-carboxylate (300 mg, 1.22 mmol, 1 eq) in dioxane (10 mL) were added NH2Boc (285.65 mg, 2.44 mmol, 2 eq), Cs2CO3 (1.19 g, 3.66 mmol, 3 eq), XPhos (348.74 mg, 731.53 μmol, 0.6 eq), and Pd(OAc)2 (177.92 mg, 792.50 μmol, 0.65 eq). The mixture was degassed and purged with N2 3 times, then stirred at 120° C. for 2 h under N2 atmosphere. TLC analysis (PE:EtOAc=1:1, Rf=0.16) indicated that the starting material was consumed completely, and new spots were detected. The reaction mixture was quenched by adding water (300 mL) and extracted with EtOAc (50 mL×5). The combined organic layers were washed with brine (30 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by preparative TLC (SiO2, PE:EtOAc=1:1) to give methyl 5-(tert-butoxycarbonylamino)-4-methoxy-pyridine-2-carboxylate (160 mg, 47% yield).


Synthesis of methyl 5-[tert-butoxycarbonyl(prop-2-ynyl)amino]-4-methoxy-pyridine-2-carboxylate. A mixture of methyl 5-(tert-butoxycarbonylamino)-4-methoxy-pyridine-2-carboxylate (133.8 mg, 474.04 μmol, 1 eq), Cs2CO3 (386.1 mg, 1.19 mmol, 2.5 eq), and 3-bromoprop-1-yne (105.7 mg, 711.06 μmol, 76.62 μL, 1.5 eq) in DMF (2 mL) was degassed and purged with N2 3 times, then stirred at 25° C. for 2 h under N2 atmosphere. TLC analysis (PE:EtOAc=0:1, Rf=0.37) indicated that the starting material was consumed completely, and a new spot was detected. The reaction mixture was quenched by adding water (80 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness. The residue was purified by preparative TLC (SiO2, PE:EtOAc=0:1) to give methyl 5-[tert-butoxycarbonyl(prop-2-ynyl)amino]-4-methoxy-pyridine-2-carboxylate (125 mg, 82.3% yield).


Synthesis of tert-butyl N-[4-methoxy-6-(methylcarbamoyl)-3-pyridyl]-N-prop-2-ynyl-carbamate. A mixture of methyl 5-[tert-butoxycarbonyl(prop-2-ynyl)amino]-4-methoxy-pyridine -2-carboxylate (105 mg, 327.78 μmol, 1 eq), methanamine (10.2 mg, 327.78 μmol, 1 mL, 1 eq), in THF (1 mL) was degassed and purged with N2 3 times, then stirred at 25° C. for 5 h under N2 atmosphere. TLC analysis [(PE:EtOAc=1:1) (DCM:MeOH=10:1), Rf=0.45] indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding water (50 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness. The crude product tert-butyl N-[4-methoxy-6-(methylcarbamoyl)-3-pyridyl]-N-prop-2-ynyl-carbamate (95 mg, 91% yield) was used in the next step without further purification. LC-MS (ES+, m/z): 320.1 [(M+H)+].


Synthesis of tert-butyl N-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]-N-[4-methoxy-6-(methylcarbamoyl)-3-pyridyl]carbamate. To a solution of N-[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (120 mg, 263.60 μmol, 1 eq) in DMSO (2 mL) were added i-Pr2NH (266.74 mg, 2.64 mmol, 372.54 μL, 10 eq), tert-butyl N-[4-methoxy-6-(methylcarbamoyl)-3-pyridyl]-N-prop-2-ynyl-carbamate (92.60 mg, 289.96 μmol, 1.1 eq), CuI (10.04 mg, 52.72 μmol, 0.2 eq), and Pd(PPh3)4 (15.23 mg, 13.18 μmol, 0.05 eq). The mixture was degassed and purged with N2 3 times, then stirred at 40° C. for 1 h under N2 atmosphere. TLC analysis (DCM:MeOH=10:1, Rf=0.38) indicated that the starting material was consumed completely, and new spots were detected. The reaction mixture was quenched by adding a saturated solution of EDTA (100 mL) and stirring the mixture for 30 min, and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness. The crude residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) to give tert-butyl N-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]-N-[4-methoxy-6-(methylcarbamoyl)-3-pyridyl]carbamate (100 mg, 59% yield).


Synthesis of 5-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-4-methoxy-N-methyl-pyridine-2-carboxamide. A mixture of tert-butyl N-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]-N-[4-methoxy-6-(methylcarbamoyl)-3-pyridyl]carbamate (100 mg, 154.64 μmol, 1 eq) in EtOAc (10 mL) and 4M HCl/EtOAc (3 mL) was degassed and purged with N2 3 times, then stirred at 25° C. for 1.5 h under N2 atmosphere. LC-MS analysis showed that the desired mass was detected. The reaction mixture was quenched by adding a saturated solution of Na2CO3 to adjust the solution to pH=9 and extracted with EtOAc (20 mL×4). The combined organic layers were washed with brine (10 mL×2), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness. The crude residue was purified by preparative HPLC (neutral condition; column: Waters Xbridge Prep OBD C18 150×40 mm, 10 um; mobile phase: [water(10 mM NH4HCO3)-ACN]; B %: 25%-55%, 8 min) to give 5-[3-[4-[[(3S,4R)-3-fluoro-1-methyl-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-4-methoxy-N-methyl-pyridine-2-carboxamide (30 mg, 36% yield). LC-MS (ES+, m/z): 547.1 [(M+H)+].


Example D173
1-tert-butyl-N-[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]-1H-pyrazole-4-carboxamide



embedded image


Synthesis of tert-butyl (3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate. To a solution of tert-butyl prop-2-yn-1-ylcarbamate (61.36 mg, 395.40 μmol, 0.9 eq) in DMSO (2 mL) were added i-Pr2NH (444.57 mg, 4.39 mmol, 620.90 μL, 10 eq), CuI (4.18 mg, 21.97 μmol, 0.05 eq), and N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (200 mg, 439.34 μmol, 1 eq) at 20° C., then Pd(PPh3)4 (25.38 mg, 21.97 μmol, 0.05 eq) was added. The mixture was purged with N2 3 times and stirred at 25° C. for 1 h. TLC analysis (DCM:MeOH=10:1, Rf=0.4) indicated that the starting material was consumed completely, and one new spot was detected. The reaction mixture was quenched by adding a saturated solution of EDTA (50 mL) and extracted with EtOAc (40 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to dryness. The crude residue was purified by preparative TLC (SiO2, DCM:MeOH=10:1) to give tert-butyl (3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate was obtained as a yellow solid (100 mg, 46% yield). 1H NMR (400 MHz, DMSO-d6) δ=1.41 (s, 9H), 1.65-1.76 (m, 1H), 1.86-2.01 (m, 1H), 2.04-2.15 (m, 1H), 2.17-2.31 (m, 4H), 2.75-2.88 (m, 1H), 3.04 (br t, J=10.58 Hz, 1H), 3.47-3.73 (m, 1H), 4.03 (d, J=5.62 Hz, 2H), 4.89 (br s, 1H), 4.95-5.12 (m, 2H) 5.48-5.59 (m, 1H) 6.19-6.34 (m, 1H) 6.72-6.84 (m, 1H) 7.03 (t, J=8.01 Hz, 1H) 7.17-7.26 (m, 1H) 7.41 (br s, 1H).


Synthesis of 2-(3-aminoprop-1-yn-1-yl)-N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine. To a solution of tert-butyl (3-(4-(((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)carbamate (100 mg, 207.25 μmol, 1 eq) in DCM (2.64 g, 31.08 mmol, 2 mL, 149.98 eq) was added TFA (1.54 g, 13.51 mmol, 1 mL, 65.17 eq), and the resulting mixture was stirred at 25° C. for 1 h. TLC analysis (PE:EtOAc=0:1, Rf=0.2) indicated that the starting material was consumed completely, and one new spot formed. The reaction mixture was concentrated under nitrogen to remove the solvent. Water (50 mL) was then added, and a saturated solution of Na2CO3 was added to adjust the solution to pH=10. The product was extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness. The crude residue was purified by reversed-phase HPLC (column: Phenomenex Luna C18 200×40 mm, 10 um; mobile phase: [water (0.2% FA)-ACN]; B %: 1%-40%, 10 min) to give 2-(3-aminoprop-1-yn-1-yl)-N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine as a yellow solid (21.6 mg, 27% yield). 1H NMR (400 MHz, DMSO-d6) δ=1.67-1.75 (m, 1H), 1.88-2.02 (m, 1H), 2.06-2.14 (m, 1H), 2.16-2.31 (m, 4H), 2.82 (br d, J=11.37 Hz, 1H), 2.99-3.09 (m, 1H), 3.53-3.63 (m, 1H), 3.76 (s, 2H), 4.76-4.90 (m, 1H), 5.02-5.12 (m, 2H), 5.40-5.64 (m, 1H), 6.23-6.31 (m, 1H), 6.74-6.82 (m, 1H), 6.99-7.07 (m, 1H), 7.18-7.25 (m, 1H), 8.24-8.27 (m, 1H).


Synthesis of 1-tert-butyl-N-[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]-1H-pyrazole-4-carboxamide. To a solution of 1-(tert-butyl)-1H-pyrazole-4-carboxylic acid (48.4 mg, 287.66 μmol, 1.1 eq) in DMF (2 mL) were added HOBt (70.67 mg, 523.02 μmol, 2 eq) , EDCI (100.26 mg, 523.02 μmol, 2 eq) , TEA (79.39 mg, 784.52 μmol, 109.20 μL, 3 eq) , and 2-(3-aminoprop-1-yn-1-yl)-N-((3S,4R)-3-fluoro-1-methylpiperidin-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.1 g, 261.51 μmol, 1 eq). The resulting mixture was stirred at 25° C. for 1 h under N2 atmosphere. TLC analysis (EtOAc:TEA=20:1, Rf=0.6) indicated that the starting material was consumed completely, and one new spot was detected. The residue was diluted with water (60 mL) and extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give a residue. The crude product was purified by reversed-phase HPLC (column: Phenomenex Luna C18 200×40 mm, 10 um; mobile phase: [water (0.2% FA)-ACN]; B %: 20%-60%, 10 min). 1-tert-butyl-N-[3-(4-{[(3S,4R)-3-fluoro-1-methylpiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]-1H-pyrazole-4-carboxamide was obtained as a yellow solid (30.1 mg, 22% yield). LCMS (ES+, m/z): 533.1 [(M+H)+].


Example D174
Preparation of rac-N-[(3R,4S)-4-fluoro-1-methylpiperidin-3-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine



embedded image


Synthesis of N-[3-[4-bromo-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]-2-methoxy-4-methylsulfonyl-aniline. A mixture of tert-butyl N-[3-[4-bromo-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]-N-(2-methoxy-4-methylsulfonyl-phenyl)carbamate (300 mg, 487.44 μmol, 1.1 eq) and HCl/EtOAc (4 M, 5 mL, 45.1 eq) was stirred at 25° C. for 2 h. TLC showed that the reaction was complete. The residue was filtered and concentrated in vacuo to afford the product (200 mg, crude) as a yellow oil, which was used in the next step without purification.


Synthesis of tert-butyl (3R,4S)-4-fluoro-3-[[2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]piperidine-1-carboxylate. To a mixture of N-[3-[4-bromo-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynyl]-2-methoxy-4-methylsulfonyl-aniline (200 mg, 388.09 μmol, 1.1 eq) and tert-butyl (3R,4S)-3-amino-4-fluoro-piperidine-1-carboxylate (80 mg, 366.52 μmol, 1.0 eq) in THF (7 mL) were added XPhos-Pd-G4 (33.7 mg, 36.65 μmol, 0.1 eq), dicyclohexyl-[2-(2,6-diisopropoxyphenyl)phenyl]phosphane (34.2 mg, 73.30 μmol, 0.2 eq), and Cs2CO3 (358.3 mg, 1100.00 μmol, 3.0 eq) in one portion at 20° C. under N2. The reaction mixture was then heated to 90° C. and stirred for 2 hours. TLC and LCMS analysis showed that the reaction was completed. The residue was poured into a saturated solution of EDTA (20 mL) and stirred for 120 min. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic phases were washed with brine (20 mL×3), dried with anhydrous Na2SO4, filtered, and concentrated to dryness under reduced pressure to give tert-butyl (3R,4S)-4-fluoro-3-[[2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]piperidine-1-carboxylate as yellow solid (150 mg, crude). It was used in the next reaction without further purification. LC-MS (ES+, m/z): 653.3 [(M+H)+]. 1H NMR (400 MHz, DMSO-d6) δ=7.38 (dd, J=8.40, 2.00 Hz, 1H), 7.25 (d, J=2.00 Hz, 1H), 7.17 (s, 1H), 7.03 (t, J=8.00 Hz, 1H), 6.89 (d, J=8.44 Hz, 1H), 6.79 (d, J=8.20 Hz, 1H), 6.48 (t, J=6.30 Hz, 1H), 6.31 (d, J=7.82 Hz, 1H), 5.53 (d, J=8.44 Hz, 1H), 5.13-4.86 (m, 3H), 4.36 (d, J=6.24 Hz, 2H), 3.89 (s, 3H), 3.76-3.62 (m, 1H), 3.96-3.59 (m, 1H), 3.09 (s, 3H), 2.05-1.96 (m, 1H), 2.17-1.68 (m, 2H), 1.35 (s, 9H).


Synthesis of N-[(3R,4S)-4-fluoro-3-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine. To a mixture of tert-butyl (3R,4S)-4-fluoro-3-[[2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-yl]amino]piperidine-1-carboxylate (150 mg, 229.81 μmol, 1.0 eq) was added HCl/EtOAc (4 M, 2.31 mL, 40.2 eq) in one portion at 20° C., and the mixture was stirred for 1 h. TLC and LCMS analysis showed that the reaction was complete. The residue was poured into NaHCO3 (sat.) (10 mL), and the aqueous phase was extracted with EtOAc (20 mL×3). The combined organic phase was washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness to give the crude product as white solid (70 mg). The crude product was used in the next step without further purification. LC-MS (ES+, m/z): 553.2 [(M+H)+]. 1H NMR (400 MHz, DMSO-d6) δ=7.39 (dd, J=8.38, 1.76 Hz, 1H), 7.25 (d, J=1.76 Hz, 1H), 7.16 (s, 1H), 7.01 (t, J=8.04 Hz, 1H), 6.89 (d, J=8.38 Hz, 1H), 6.75 (d, J=8.16 Hz, 1H), 6.49 (t, J=6.16 Hz, 1H), 6.26 (d, J=7.72 Hz, 1H), 5.44 (d, J=8.82 Hz, 1H), 5.07-4.86 (m, 3H), 4.36 (d, J=6.16 Hz, 2H), 3.89 (s, 3H), 3.78-3.59 (m, 1H), 3.09 (s, 3H), 2.96-2.64 (m, 4H), 1.99-1.67 (m, 2H).


Synthesis of N-[(3R,4S)-4-fluoro-1-methyl-3-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine. To a mixture of N-[(3R,4S)-4-fluoro-3-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (70 mg, 126.68 μmol, 1.0 eq) and formaldehyde (38 mg, 1270.00 μmol, 0.034 mL, 10.0 eq) in MeOH (3 mL) were added sodium cyanoborohydride (23.88 mg, 380.03 μmol, 3.0 eq) and AcOH (0.76 mg, 12.67 μmol, 0.1 eq) in one portion at 20° C. under N2. The mixture was heated to 50° C. and stirred for 1.5 h. LCMS analysis showed the reaction was completed. The residue was poured into a saturated solution of EDTA (20 mL) and stirred for 120 min. The aqueous phase was extracted with EtOAc (30 mL×3). The combined organic phases were washed with brine (30 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated in vacuo. The crude product was purified by preparative HPLC (column: Waters Xbridge BEH C18 100×25 mm, 5 um; mobile phase: [water (10 mM NH4HCO3)-ACN]; B %: 40%-70%, 10 min) to give N-[(3R,4S)-4-fluoro-1-methyl-3-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine as white solid (23.1 mg, 32% yield). LC-MS (ES+, m/z): 567.3 [(M+H)+].


Example D175
N-[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine and N-[(3R,4S)-1-tert-butyl-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine



embedded image


Synthesis of rac-N-(1-tert-butyl-3-fluoro-4-piperidyl)-2-iodo-1-(2,2,2-trifluoroethyl)-indol-4-amine. To a mixture of 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (140 mg, 371.80 1.0 eq, HCl) and 1-tert-butyl-3-fluoro-piperidin-4-one (193.22 mg, 1.12 mmol, 3.0 eq) in EtOH (3 mL) was added Ti(OEt)4 (848.1 mg, 3.72 mmol, 771.01 μL, 10.0 eq) in one portion at 50° C. under N2. The reaction mixture was stirred for 14 h, then NaBH3CN (233.7 mg, 3.72 mmol, 10.0 eq) was added, and the reaction was then heated to 50° C. and stirred for 2 h. TLC and LCMS analysis showed the desired mass. The aqueous phase was extracted with EtOAc (20 mL×3) and water (30 mL). The combined organic phases were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The crude was purified by preparative TLC (SiO2, DCM/MEOH=10:1) to give rac-N-((3S,4R)-1-(tert-butyl)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (90 mg, 49% yield) as yellow oil and rac-N-((3R,4R)-1-(tert-butyl)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (45 mg, 24% yield) as yellow oil. LC-MS (ES+, m/z): 498.2 [(M+H)+].


Synthesis of N-[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine and N-[(3R,4S)-1-tert-butyl-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine. To a mixture of rac-N-((3S,4R)-1-(tert-butyl)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (90.0 mg, 162.88 μmol, 1.0 eq) and 2-methoxy-4-methylsulfonyl-N-prop-2-ynyl-aniline (77.95 mg, 325.75 μmol, 2.0 eq) in DMSO (2 mL) were added CuI (310.2 ug, 1.63 μmol, 0.1 eq), N-isopropylpropan-2-amine (164.8 mg, 1.63 mmol, 230 μL, 10.0 eq), and Pd(PPh3)4 (9.4 mg, 8.14 μmol, 0.1 eq) in one portion at 25° C. under N2, then the reaction was stirred for 1 h. LCMS analysis showed the desired product. The residue was poured into a saturated solution of EDTA (20 mL), and the biphasic mixture was stirred for 120 min. The layers were separated, and the aqueous phase was extracted with EtOAc (20 mL×3). The combined organic phase was washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness. The crude residue was purified by preparative HPLC (Waters Xbridge Prep OBD C18 150×40 mm, 10 um; mobile phase: [water (10 mM NH4HCO3)-ACN]; B %: 60%-80%, 8 min) to give rac-N-[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine as white solid (40 mg, 36% yield). LC-MS (ES+, m/z): 609.2 [(M+H)+].


The enantiomers of rac-N-[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine were then separated by chiral SFC (WHELK-01, 0.1% NH3H2O, EtOH) to give: N-[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (pre peak): 13.4 mg, 37% yield. LC-MS (ES+, m/z): 609.3 [(M+H)+]; N-[(3R,4S)-1-tert-butyl-3-fluoro-4-piperidyl]-2-[3-(2-methoxy-4-methylsulfonyl-anilino)prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (post peak): 15.2 mg, 42% yield. LC-MS (ES+, m/z): 609.3 [(M+H)+].


Example D176
Preparation of 4-[3-[4-[[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoic acid and 4-[3-[4-[[(3R,4S)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoic acid



embedded image


Synthesis of 3-methoxy-4-(prop-2-ynylamino)benzoate. To a mixture of methyl 4-[tert-butoxycarbonyl(prop-2-ynyl)amino]-3-methoxy-benzoate (400 mg, 1.25 mmol, 1.0 eq) in DCM (5 mL) was added TFA (1.54 g, 13.51 mmol, 1 mL, 10.9 eq) in one portion at 25° C. The mixture was stirred for 2 h. LCMS analysis showed that the reaction was completed. A saturated solution of NaHCO3 was added to adjust the solution to pH=8. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic phases were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to give the desired product as yellow oil (270 mg, crude). LC-MS (ES+, m/z): 220.1 [(M+H)+]


Synthesis of 3-methoxy-4-(prop-2-ynylamino)benzoic acid. To a mixture of crude methyl 3-methoxy-4-(prop-2-ynylamino)benzoate (270 mg, 1.23 mmol, 1.0 eq) in MeOH (2 mL) and water (0.5 mL) was added NaOH (147.8 mg, 3.69 mmol, 3.0 eq) in one portion at 40° C., and the mixture was stirred for 2 h. TLC analysis showed that the reaction was complete. 2M HCl was added to adjust the solution to pH=6. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic phases were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The crude product was triturated with EtOAc at 20° C. for 10 min to give 3-methoxy-4-(prop-2-ynylamino)benzoic acid as white solid (200 mg, 974.61 μmol, 79.14% yield).


Synthesis of 4-[3-[4-[[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoic acid and 4-[3-[4-[[(3R,4S)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoic acid. To a mixture of rac-N-((3S,4R)-1-(tert-butyl)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (80 mg, 144.78 μmol, 1.0 eq) and 3-methoxy-4-(prop-2-ynylamino)benzoic acid (44.6 mg, 217.17 μmol, 1.5 eq) in DMSO (3 mL) were added CuI (2.76 mg, 14.48 μmol, 0.1 eq), N-isopropylpropan-2-amine (146.5 mg, 1.45 mmol, 204.61 μL, 10.0 eq), and Pd(PPh3)4 (8.4 mg, 7.24 μmol, 0.1 eq) in one portion at 25° C. under N2. The mixture was then stirred for 3 h, and LCMS analysis showed that the reaction was complete. The residue was poured into a saturated solution of EDTA (20 mL) and stirred for 120 min. The layers were separated, and the aqueous phase was extracted with EtOAc (20 mL×3). The combined organic phase was washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The crude racemic product was first purified by preparative HPLC (Waters Xbridge Prep OBD C18 150×40 mm, 10 um; mobile phase: [water (10 mM NH4HCO3)-ACN]; B %: 60%-80%, 8 min), then the enantiomers were separated by chiral SFC (CHIRALCEL® OJ, MeOH_IPAm) to give: 4-[3-[4-[[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoic acid (pre peak): 12.9 mg, 16% yield. LC-MS (ES+, m/z): 588.3 [(M+H)+]; and 4-[3-[4-[[(3R,4S)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-benzoic acid (post peak): 16.8 mg, 20% yield. LC-MS (ES+, m/z): 588.3 [(M+H)+]


Example D177
Preparation of 4-[3-[4-[[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]-prop-2-ynylamino]-3-methoxy-N-methyl-benzamide and 4-[3-[4-[[(3R,4S)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-N-methyl-benzamide



embedded image


To a mixture of rac-N-((3S,4R)-1-(tert-butyl)-3-fluoropiperidin-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (160 mg, 289.56 μmol, 1.0 eq) and 3-methoxy-N-methyl-4-(prop-2-ynylamino)benzamide (126.39 mg, 579.12 μmol, 2.0 eq) in DMSO (4 mL) were added CuI (551.5 ug, 2.90 μmol, 0.1 eq), N-isopropylpropan-2-amine (293.0 mg, 2.90 mmol, 409.22 μL, 10.0 eq), and Pd(PPh3)4 (16.7 mg, 14.48 μmol, 0.1 eq) in one portion at 25° C. under N2. The reaction mixture was then stirred for 3 h. LCMS analysis showed the desired product. A saturated solution of EDTA (20 mL) was added, and the mixture was stirred for 2 h. The phases were separated, and the aqueous phase was extracted with EtOAc (20 mL×3). The combined organic phases were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure to dryness. The crude racemic product was first purified by preparative HPLC (Waters Xbridge Prep OBD C18 150×40 mm, 10 um; mobile phase: 10 mM NH4HCO3-MeCN; B %: 60%-80%, 8 min), then the enantiomers were separated by chiral SFC (ChiralPak AD, Isopropyl alcohol_IPAm) to give: 4-[3-[4-[[(3S,4R)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]-prop-2-ynylamino]-3-methoxy-N-methyl-benzamide (pre peak): 52.6 mg, 31% yield. LC-MS (ES+, m/z): 588.3 [(M+H)+]; 4-[3-[4-[[(3R,4S)-1-tert-butyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-N-methyl-benzamide (post peak):33.7 mg, 19.6% yield. LC-MS (ES+, m/z): 588.3 [(M+H)+].


Example D178
Preparation of 4-{[3-(4-{[(3S,4R)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide and 4-{[3-(4-{[(3R,4S)-1-ethyl-3-fluoropiperidin-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}-3-methoxy-N-methylbenzamide



embedded image


Synthesis of N-[(3S,4R)-1-ethyl-3-fluoro-4-piperidyl]-2-iodo -1-(2,2,2-trifluoroethyl)indol-4-amine. To a solution of N-[(3S,4R)-3-fluoro-4-piperidyl]-2-iodo-1-(2,2,2-trifluoroethyl) indol-4-amine (200 mg, 453.30 μmol, 1.0 eq) in DMF (4 ml) were added K2CO3 (125.3 mg, 906.61 μmol, 2.0 eq) and iodoethane (106.1 mg, 679.96 μmol, 54.38 μL, 1.5 eq). The reaction mixture was stirred at 20° C. for 2 h. LCMS and TLC analysis (SiO2, DCM/MEOH=10:1) showed that the reaction was completed. The reaction was quenched by adding water (20 mL) and extracting the mixture with EtOAc (20 mL×3). The combined organic phases were washed with brine (20 mL×3), dried over anhydrous Na2SO4, filtered, and concentrated in vacuum. The crude was purified by preparative TLC (SiO2, DCM/MEOH=10:1) to give N-[(3S,4R)-1-ethyl-3-fluoro-4-piperidyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine as yellow oil (190 mg, 89% yield). LC-MS (ES+, m/z): 470.1 [(M+H)+].


Synthesis of 4-[3-[4-[[(3S,4R)-1-ethyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl) indol-2-yl]prop-2-ynylamino]-3-methoxy-N-methyl-benzamide and 4-[3-[4-[[(3R,4S)-1-ethyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-N-methyl-benzamide. To a mixture of N-[(3S,4R)-1-ethyl-3-fluoro-4-piperidyl]-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (200 mg, 426.21 μmol, 1.0 eq) and 3-methoxy-N-methyl-4-(prop-2-ynylamino)benzamide (102.32 mg, 468.83 μmol, 1.1 eq) in DMSO (5 ml) were added CuI (8.12 mg, 42.62 μmol, 0.1 eq) , Pd(PPh3)4 (24.63 mg, 21.31 μmol, 0.05 eq), and N-isopropylpropan-2-amine (431.28 mg, 4.26 mmol, 602.34 μL, 10.0 eq) at 20° C., and the reaction was stirred for 1 h. LCMS analysis showed that the reaction was completed. The residue was poured into a saturated solution of EDTA (20 ml) and stirred for 120 min. The aqueous phase was extracted with EtOAc (30 mL×3). The combined organic phase was washed with brine (30 mL×3), dried over anhydrous Na2SO4, filtered and concentrated in vacuo. The crude residue was purified by prep-HPLC (Phenomenex Luna C18 75×30 mm, 3 um; mobile phase: [water(0.2% FA)-ACN]; B %: 20%-40%,10 min) to give the racemic product. The enantiomers were then separated by chiral SFC (DAICEL CHIRALCEL OJ 250×30 mm, 10 um); mobile phase: [0.1% NH3H2O in EtOH]; B %: 45%-45%, 10 min) to give: 4-[3-[4-[[(3S,4R)-1-ethyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl)indol-2-yl]prop-2-ynylamino]-3-methoxy-N-methyl-benzamide (38.6 mg, 16% yield). LC-MS (ES+, m/z): 560.1 [(M+H)+]; and 4-[3-[4-[[(3R,4S)-1-ethyl-3-fluoro-4-piperidyl]amino]-1-(2,2,2-trifluoroethyl) indol-2-yl]prop-2-ynylamino]-3-methoxy-N-methyl-benzamide (27 mg, 11% yield). LC-MS (ES+, m/z): 560.1 [(M+H)+].


TABLE 4 shows compounds with a 2-ethynyl-N-(heterocyclyl)-1H-indole-4-amine core.















Com-


LC-MS


pound


(ES+,


No.
Structure
IUPAC
m/z)







455A


embedded image


1-{3-[(2-{3-{(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]pyrrolidin-1-yl}-3- methoxypropan-2-ol
608.9





456A


embedded image


N-[3-(4-{[1-(2-hydroxy-3- methoxypropyl)pyrrolidin-3- yljamino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]benzamide
528.9





457A


embedded image


l-{3-[(2-{3-[(4- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino]pyrrolidin-1- yl}-3-methoxypropan-2-ol
578.9





458A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[1-(oxan-4-yl)pyrrolidin-3- yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
604.9





459A


embedded image


2-(3-{[2-methoxy-4-(morpholine-4- sulfonyl)phenyl]amino}prop-1-yn- 1-yl)-N-(piperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
606.2





460A


embedded image


3-methoxy-N,N-dimethyl-4-[(3-{4- [(piperidin-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino]benzene-1- sulfonamide
564.3





461A


embedded image


2-{5-methanesulfonyl-2-[(3-{4- [(piperidin-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1- yl)amino]phenoxy}acetonitrile
560.2





462A


embedded image


3-methoxy-4-((3-(4-(piperidin-4- ylamino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)benzamide
500.3





463A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[(3R)-piperidin-3-yl]-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
534.9





464A


embedded image


3-methoxy-4-{[3-(4-{[(2S,4S)-2- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}benzene- 1-sulfonamide
550.1





465A


embedded image


3-methoxy-4-((3-(4-((1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1- yl)amino)benzenesulfonamide
550.2





466A


embedded image


2-(3-{[4-methanesulfonyl-2- (trifluoromethoxy)phenyl]amino} prop-1-yn-1-yl)-N-(1-methyl- piperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
603.1





467A


embedded image


N-(1-methylpiperidin-4-yl)-2-(3-((4- (methylsulfonyl)-2-(2,2,2- trifluoroethoxy)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
617.2





468A


embedded image


2-{4-methoxy-5-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]pyridin-2- yl}-2-methylpropanenitrile
539.3





469A


embedded image


3-methoxy-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]-N-(1,2- oxazol-3-yl)benzene-1-sulfonamide
617.2





470A


embedded image


3-methoxy-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]-N-(oxan- 4-yl)benzene-1-sulfonamide
634.2





471A


embedded image


3 -methoxy-N-(5-methyl-1,2-oxazol- 3-yl)-4-[(3-{4-[(1-methylpiperidin- 4-yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]benzene-1-sulfonamide
631.2





472A


embedded image


N-(2-hydroxyethyl)-3-methoxy-N- methyl-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzene- 1-sulfonamide
608.2





473A


embedded image


3-methoxy-N,N-dimethyl-4-[(3-{4- [(1-methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzene- 1-sulfonamide
578.2





474A


embedded image


4-[(3-{6-fluoro-4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]-3- methoxybenzene-1-sulfonamide
568.2





475A


embedded image


6-fluoro-2-{3-[(4-methanesulfonyl- 2-methoxyphenyl)amino]prop-1-yn- 1-yl}-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
567.2





476A


embedded image


2-(3-((4-methoxy-6- (methylsulfonyl)pyridin-3- yl)amino)prop-1-yn-1-yl)-N-(1- methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
550.1





477A


embedded image


3-methoxy-N-(2-methoxyethyl)-N- methyl-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzene- 1-sulfonamide
622.2





478A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)(methyl)amino]prop- 1-yn-1-yl}-N-(1-methylpiperidin-4- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
563.2





479A


embedded image


1-(4-{3-methoxy-4-[(3-{4-[(1- methylpiperidin-4-yl)aminol-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1- yl)amino]benzenesulfonyl}piperazin- 1-yl)ethan-1-one
661.3





480A


embedded image


2-(3-{[2-methoxy-4-(morpholine-4- sulfonyl)phenyl]amino}prop-1-yn- 1-yl)-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
620.2





481A


embedded image


3-methoxy-4-((3-(4-((1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)benzoic acid
515.1





482A


embedded image


3-methoxy-N-methyl-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzamide
528.2





483A


embedded image


N,N-bis(2-hydroxyethyl)-3- methoxy-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzene- 1-sulfonamide
638.2





484A


embedded image


3-methoxy-N-methyl-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzene- 1-sulfonamide
564.2





485A


embedded image


2-[3-({2-methoxy-4-[(4- methylpiperazin-1- yl)sulfonyl]phenyl}amino)prop-1- yn-1-yl]-N-(1-methylpiperidin-4- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
633.3





486A


embedded image


5-methanesulfonyl-2-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]phenol
535.2





487A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-6-methoxy-N-(1- methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
579.2





488A


embedded image


2-{3-[2-(dimethylamino)-4- methanesulfonylphenoxy]prop-1-yn- 1-yl}-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
563.2





489A


embedded image


2-{5-methanesulfonyl-2-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1- yl)amino]phenoxy}acetonitrile
574.3





490A


embedded image


2-(3-{[2-(fluoromethoxy)-4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-N-(1-methylpiperidin-4- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
567.2





491A


embedded image


2-(3-{[2-methoxy-4-(morpholine-4- carbonyl)phenyl]amino}prop-1-yn- 1-yl)-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
584.3





492A


embedded image


1-{3-methoxy-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1- yl)amino]benzoyl}piperidin-4-ol
598.3





493A


embedded image


3-(3-(4-((1-methylpiperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1-yl)-6- (methylsulfonyl)benzo[d]oxazol- 2(3H)-one
561.2





494A


embedded image


2-(3-{[2-methoxy-4-(5- methoxypyridin-3- yl)phenyl]amino}prop-1-yn-1-yl)- N-(1-methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
578.3





495A


embedded image


2-{3-[(5-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
549.3





496A


embedded image


N-(2-hydroxyethyl)-3-methoxy-4- [(3-{4-[(1-methylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]benzamide
558.2





497A


embedded image


3-methoxy-N-(2-methoxyethyl)-4- [(3-{4-[(1-methylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]benzamide
572.2





498A


embedded image


3-methoxy-N-(1-methylpiperidin-4- yl)-4-[(3-{4-[(1-methylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]benzamide
611.3





499A


embedded image


2-[3-({4-[4- (dimethylamino)piperidine-1- carbonyl]-2- methoxyphenyl}amino)prop-1-yn-1- yl] -N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
625.3





500A


embedded image


3-methoxy-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]-N-(oxan- 4-yl)benzamide
598.3





501A


embedded image


2-(3-{[2-methoxy-4-(4- methylpiperazine-1- carbonyl)phenyl]amino}prop-1-yn- 1-yl)-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
597.3





502A


embedded image


2-{3-[(2-methoxy-4-{2-oxa-6- azaspiro[3.3]heptane-6- carbonyl}phenyl)amino]prop-1-yn- 1-yl}-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
596.3





503A


embedded image


2-(3-{[2-methoxy-4-(pyridin-3- yl)phenyl]amino}prop-1-yn-1-yl)- N-(1-methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
548.3





504A


embedded image


2-(3-{[2-methoxy-4-(pyridin-4- yl)phenyl]amino}prop-1-yn-1-yl)- N-(1-methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
548.3





505A


embedded image


N-(3-{4-[(1-methylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)pyridine-3-carboxamide
470.2





506A


embedded image


2-(3-{[2-methoxy-4-(1,3-oxazol-2- yl)phenyl]amino}prop-1-yn-1-yl)- N-(1-methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
538.3





507A


embedded image


2-{3-[(3- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-N-(1-methylpiperidin-4- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
519.2





508A


embedded image


N-(1-methylpiperidin-4-yl)-2-[3- ({4-[(morpholin-4- yl)methyl]phenyl}amino)prop-1-yn- 1-yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
540.3





509A


embedded image


2-(3-{[2-methoxy-4-(1,3-thiazol-2- yl)phenyl]amino}prop-1-yn-1-yl)- N-(1-methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
554.2





510A


embedded image


2-[3-({2-methoxy-4-[1-(2- methoxyethyl)-1H-pyrazol-4- yl]phenyl}amino)prop-1-yn-1-yl]- N-(1-methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
595.4





511A


embedded image


2-{3-[(2-methoxy-4-{7-oxa-2- azaspiro[3.5]nonane-2- carbonyl}phenyl)amino]prop-1-yn- 1-yl}-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
624.3





512A


embedded image


2-{3-[(4-chloro-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
505.1





513A


embedded image


2-(3-(((3S,4R)-3- methoxytetrahydro-2H-pyran-4- yl)amino)prop-1-yn-1-yl)-N-(1- methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
479.2





514A


embedded image


2-fluoro-5-methoxy-4-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzamide
532.2





515A


embedded image


2-(3-{[2-methoxy-4- (trifluoromethyl)phenyl]amino}prop- 1-yn-1-yl)-N-(1-methylpiperidin-4- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
539.2





516A


embedded image


2-fluoro-5-methoxy-N-methyl-4-[(3- {4-[(1-methylpiperidin-4-yl)amino]- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzamide
546.2





517A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-(1-methylpiperidin-4-yl)-1- [(oxiran-2-yl)methyl]-1H-indol-4- amine
523.2





518A


embedded image


2-(3-((2-ethoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-N-(1-methylpiperidin-4- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
563.2





519A


embedded image


2-{3-[(2-fluoro-4-methanesulfonyl- 6-methoxyphenyl)amino]prop-1-yn- 1-yl}-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
567.2





520A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)arnino]prop-1-yn-1- yl}-3-methyl-N-(1-methylpiperidin- 4-yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
563.3





521A


embedded image


2-(3-(((3R,4R)-3- methoxytetrahydro-2H-pyran-4- yl)amino)prop-1-yn-1-yl)-N-(1- methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
497.2





522A


embedded image


2-{3-[(5-fluoro-4-methanesulfonyl- 2-methoxyphenyl)amino]prop-1-yn- 1-yl}-N-(1-methylpiperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
567.2





523A


embedded image


2-{3-[(5-methanesulfonylthiophen- 2-yl)amino]prop-1-yn-1-yl}-N-(1- methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
525.2





524A


embedded image


N-methyl-5-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]thiophene- 2-carboxamide
504.2





525A


embedded image


N,N-dimethyl-5-[(3-{4-[(1- methylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]thiophene- 2-carboxamide
518.2





526A


embedded image


5-[(3-{4-[(1-methylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]thiophene-2-carboxylic acid
489.0





527A


embedded image


2-(3-((4-methoxypyridin-3- yl)amino)prop-1-yn-1-yl)-N-(1- methylpiperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
472.2





528A


embedded image


2-(2-((3-(4-((1-methylpiperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-5- (methylsulfonyl)phenoxy)acetamide
592.2





529A


embedded image


N-(2-hydroxyethyl)-3-mcthoxy-4- ((3-(4-((1-methylpiperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)benzenesulfonamide
594.2





530A


embedded image


4-((2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)-1- methylpiperidin-2-one
563.2





531A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[(3R,4S)-3-methoxy-1- methylpiperidin-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
578.9





532A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[(3S,4R)-3-methoxy-1- methylpiperidin-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
578.9





533A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[(3S,4R)-3-methoxy-1- methylpiperidin-4-yl]-N-methyl-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
636.9





534A


embedded image


N-(1-ethylpiperidin-4-yl)-2-(3-{[2- (fluoromethoxy)-4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
581.3





535A


embedded image


4-[(3-{4-[(1-ethylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxy-N- methylbenzamide
542.3





536A


embedded image


2-{2-[(3-{4-[(1-ethylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-5- methanesulfonylphenoxy} acetonitrile
588.2





537A


embedded image


N-(1-ethylpiperidin-4-yl)-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)aminolprop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-aniine
563.2





538A


embedded image


4-[(3-{4-[(1-ethylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxybenzene-1- sulfonamide
564.2





539A


embedded image


3-methoxy-N-methyl-4-{[3-(4-{[1- (propan-2-yl)piperidin-4-yl]amino}- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}benzamide
556.4





540A


embedded image


2-(5-methanesulfonyl-2-{[3-(4-{[1- (propan-2-yl)piperidin-4-yl]amino}- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}phenoxy)acetonitrile
602.3





541A


embedded image


2-(3-{[2-(fluoromethoxy)-4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-N-[1-(propan-2- yl)piperidin-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-amine
595.2





542A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl)-N-[1-(propan-2-yl)piperidin-4- yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
577.3





543A


embedded image


3-methoxy-4-{[3-(4-{[1-(propan-2- yl)piperidin-4-yl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl] amino}benzene-1- sulfonamide
578.2





544A


embedded image


2-[2-(2-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}ethoxy)ethoxy]ethan-1-ol
667.2





545A


embedded image


4-({4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)aminoJpiperidin-1- yl}methyl)-1,3-dioxolan-2-one
635.2





546A


embedded image


3-methoxy-4-({3-[4-({1-[(2-oxo- 1,3-dioxolan-4-yl)methyl]piperidin- 4-yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl]prop-2-yn-1- yl}amino)benzene-1-sulfonamide
636.2





547A


embedded image


4-{[3-(4-{[1-(2,3- dihydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N-(1,2- oxazol-3-yl)benzene-1-sulfonamide
677.2





548A


embedded image


4-((3-(4-((1-(2,3- dihydroxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3- methoxybenzenesulfonamide






549A


embedded image


4-({3-[4-({1-[(2S)-2,3- dihydroxypropyl]piperidin-4- yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl]prop-2-yn-1- yl}amino)-3-methoxybenzene-1- sulfonamide
610.1





550A


embedded image


4-({3-[4-({1-[(2R)-2,3- dihydroxypropyl]piperidin-4- yl)amind)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl]prop-2-yn-1- yl}amino)-3-methoxybenzene-1- sulfonamide
610.2





551A


embedded image


4-{[3-(4-{[1-(2,3- dihydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N-(5 -methyl - 1,2-oxazol-3 -yl)benzene-1- sulfonamide
391.2





552A


embedded image


4-{[3-(4-{[1-(2,3- dihydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N-(oxan-4- yl)benzene-1-sulfonamide 4
694.3





553A


embedded image


4-{[3-(4-{[1-(2,3- dihydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-N-(2-hydroxyethyl)-3- methoxy-N-methylbenzene-1- sulfonamide
668.2





554A


embedded image


2-(5-{[3-(4-{[1-(2,3- dihydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-4-methoxypyridin-2-yl)- 2-methylpropanenitrile
599.3





555A


embedded image


N-(2-hydroxyethyl)-3-methoxy-N- methyl-4-{[3-(4-{[1-(oxan-4- yl)piperidin-4-yl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino}benzene-1- sulfonamide
678.3





556A


embedded image


3-(4-((2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)propane-1,2-diol
609.3





557A


embedded image


(2R)-3-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propane-1,2-diol
609.2





558A


embedded image


(2S)-3-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propane-1,2-diol
609.2





559A


embedded image


3-[4-({2-[3-({2-methoxy-4-[(4- methylpiperazin-1- yl)sulfonyl]phenyl}amino)prop-1- yn-1-yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl}amino)piperidin-1- yl]propane-1,2-diol
693.3





560A


embedded image


4-((3-(4-((1-(2,3- dihydroxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoic acid
575.2





561A


embedded image


methyl 4-((3-(4-((1-(2,3- dihydroxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoate
589.2





562A


embedded image


3-methoxy-4-[(3-{4-[(1-{[(4R)-2- oxo-1,3-dioxolan-4- yl]methyl}piperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzene- 1-sulfonamide
636.2





563A


embedded image


(4R)-4-({4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}methyl)-1,3-dioxolan-2-one
635.3





564A


embedded image


4-{[3-(4-{[1-(2,3- dihydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N,N- dimethylbenzene-1-sulfonamide
638.3





565A


embedded image


2-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}EtOAc
621.3





566A

text missing or illegible when filed

N-(1-{[(4R)-2,2-dimethyl-1,3- dioxolan-4-yl]methyl}piperidin-4- yl)-2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
649.3





567A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl acetate
635.2





568A


embedded image


4-[(3-{4-[(1-{[(4R)-2,2-dimethyl- 1,3-dioxolan-4-yl]methyl}piperidin- 4-yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxybenzene-1- sulfonamide
650.3





569A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
623.3





570A


embedded image


1-(4-((2-(3-((4-(ethylsulfonyl)-2- methoxyphenyl)amino)prop-1-yn-1- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino)piperidin-1-yl)-3- methoxypropan-2-ol
637.2





571A


embedded image


1-ethoxy-3-(4-((2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)propan-2-ol
637.3





572A


embedded image


4-{[3-(4-{[1-(2,3- dihydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N-(2- methoxyethyl)-N-methylbenzene-1- sulfonamide
682.2





573A


embedded image


1-(acetyloxy)-3-{4-[(2-{3-[(2- methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl acetate
694.2





574A


embedded image


4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
624.2





575A


embedded image


3-methoxy-4- [3-(4-{[1-(2- methoxyacetyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}benzene-1-sulfonamide
608.2





576A


embedded image


1-(4-(N-(2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)acetamido)piperidin- 1-yl)propan-2-yl acetate






577A


embedded image


1-[4-(4-{[3-(4-{[1-(2,3- dihydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3- methoxybenzenesulfonyl)piperazin- 1-yl]ethan-1-one
721.3





578A


embedded image


(4S)-4-({4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]pipendin-1- yl}methyl)-1,3-dioxolan-2-one
635.2





579A


embedded image


1-(acetyloxy)-3-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]pipendin-1- yl}propan-2-yl acetate
693.2





580A


embedded image


N-[1-(2,3- dimethoxypropyl)piperidin-4-yl]-2- {3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
637.3





581A


embedded image


4-{[3-(4-{[1-(2,3- dimethoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
638.2





582A


embedded image


3-(4-{[2-(3-{[2-methoxy-4- (morpholine-4- sulfonyl)phenyl]amino}prop-1-yn- 1-yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl]amino}piperidin-1- yl)propane-1,2-diol
680.2





583A


embedded image


4-({3-[4-({1-[(2R)-2,3- dihydroxypropyl]piperidin-4- yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl]prop-2-yn-1- yl}amino)-3-methoxybenzamide
574.2





584A


embedded image


2-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}ethyl 2-methylpropanoate
649.3





585A


embedded image


2-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}ethyl propanoate
635.3





586A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- (propanoyloxy)propan-2-yl propanoate
721.3





587A


embedded image


1-{4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- (propanoyloxy)propan-2-yl propanoate
722.2





588A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- [(2-methylpropanoyl)oxy]propan-2- yl 2-methylpropanoatc
749.3





589A


embedded image


1-{4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- [(2-methylpropanoyl)oxy]propan-2- yl 2-methylpropanoate
750.3





590A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino] prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl propanoate
649.3





591A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl 2-methylpropanoate
663.3





592A


embedded image


2-hydroxy-3-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propyl 2-methylpropanoate
679.3





593A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-yl acetate
665.3





594A


embedded image


2-hydroxy-3-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propyl propanoate
665.3





595A


embedded image


N,N-bis(2-hydroxyethyl)-4-{[3-(4- {[1-(2-hydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
682.2





596A


embedded image


4-{[3-(4-{[1-(2- hydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N- methylbenzamide
572.3





597A


embedded image


(S)-4-((3-(4-((1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxy-N- methylbenzamide
602.3





598A


embedded image


1-{4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl 2-methylpropanoate
664.4





599A


embedded image


1-{4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl acetate
636.3





600A


embedded image


2-{4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}ethyl 2-methylpropanoate
650.3





601A


embedded image


4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N- methylbenzamide
602.4





602A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-yl propanoate
679.3





603A

text missing or illegible when filed

1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-yl 2- methylpropanoate
693.3





604A


embedded image


1-methoxy-3-{4-[(2-{3-[(2- methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl 2-methylpropanoate
694.3





605A


embedded image


1-{4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)aminoJprop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl propanoate
650.2





606A


embedded image


N-(4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)pipcridin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3- methoxybenzenesulfonyl)acetamide
666.2





607A


embedded image


N-(4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3- methoxybenzenesulfonyl) propanamide
680.3





608A


embedded image


2-{4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]ethyl propanoate
636.2





609A


embedded image


4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N- methyl benzene-1-sulfonamide
638.2





610A


embedded image


1-methoxy-3-{4-[(2-{3-[(2- methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl propanoate
680.3





611A


embedded image


(2R)-1-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
623.3





612A


embedded image


(2S)-1-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
623.4





613A


embedded image


3-methoxy-4-{[3-(4-{[(1S,4S)-4- (dimethylamino)cyclohexyl]amino}- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}benzamide
542.2





614A


embedded image


3-methoxy-4-((3-(4-((1-(2- methoxyethyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)benzenesulfonamidc






615A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl) -N-(1-(2- methoxyethyl)piperidin-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
593.2





616A


embedded image


3-methoxy-4-{[3-(4-{[1-(2- methoxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-N-methylbenzamide
572.3





617A


embedded image


3-methoxy-4-{[3-(4-{[1-(2- methoxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-N-methylbenzene-1- sulfonamide
608





618A


embedded image


2-{4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}EtOAc
622.3





619A


embedded image


1-methoxy-3-{4-[(2-{3-[(2- methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-yl acetate
666.2





620A


embedded image


4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzamide
588.3





621A


embedded image


2-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-5-methanesulfonylphenol
609.2





622A


embedded image


4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N,N- dimethylbenzene-1-sulfonamide
652.4





623A


embedded image


4-({3-[4-({1-[(2R)-3-hydroxy-2- methoxypropyl]piperidin-4- yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl] prop-2 -yn-1- yl}amino)-3-methoxybenzene-1- sulfonamide
624.1





624A


embedded image


N-(4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3- methoxybenzenesulfonyl)-N- methylpropanamide
694.3





625A

text missing or illegible when filed

1-(4-{[2-(3-{[2-(2-fluoroethoxy)-4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)-3-methoxypropan-2-ol
655.3





626A


embedded image


1-(4-((2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)tetradecan-1-one






627A


embedded image


1-methoxy-3-(4-{[2-(3-{[2- methoxy-4- (propanamidosulfonyl)phenyl] amino}prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl]amino}piperidin-1-yl)propan-2-yl propanoate
736.3





628A


embedded image


1-(4-{[2-(3-{[2-methoxy-4- (propanamidosulfonyl)phenyl] amino}prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl]amino}piperidin-1-yl)-3- (propanoyloxy)propan-2-yl propanoate
778.1





629A


embedded image


(2R)-3-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-2- methoxypropan-1-ol
623.3





630A


embedded image


(2S)-3-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-2- methoxypropan-1-ol
623.4





631A


embedded image


1-{4-[(2-{3-[(2-ethoxy-4- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino]piperidin-1- yl}-3-methoxypropan-2-ol
637.2





632A


embedded image


4-({3-[4-({l-[(2S)-3-hydroxy-2- methoxypropyl]piperidin-4- yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl]prop-2-yn-1- yl}amino)-3-methoxybenzene-1- sulfonamide
624.3





633A


embedded image


4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N-(propan-2- yl)benzamide
630.2





634A


embedded image


3-hydroxy-4-{[3-(4-{[1-(2-hydroxy- 3-methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}benzene-1-sulfonamide
610.1





635A


embedded image


(2R)-1-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-yl 2- methylpropanoate
693.1





636A


embedded image


N-(3-(4-((1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1-yl)-N-(2- hydroxy-4-(N- propionylsulfamoyl)phenyl)propion amide
722.3





637A


embedded image


1-(4-{[2-(3-{[4-methanesulfonyl-2- (2- methoxyethoxy)phenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)-3-methoxypropan-2-ol
667.1





638A


embedded image


(2S)-1-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-yl 2- methylpropanoate
693.4





639A


embedded image


N-(3-(4-((1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1-yl)-N-(2- hydroxy-4- (methylsulfonyl)phenyl)acetamide






640A


embedded image


N-(3-(4-((1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1-yl)-N-(2- hydroxy-4- (methylsulfonyl)phenyl)propion- amide
665.3





641A


embedded image


N-(3-(4-((1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1-yl)-N-(2- hydroxy-4- (methylsulfonyl)phenyl)isobutyr- amide
679.3





642A


embedded image


2-(2-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-5- methanesulfonylphenoxy) acetonitrile
648.3





643A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-5-methoxy-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
653.4





644A


embedded image


1-(4-{[2-(3-{[2-(2-hydroxyethoxy)- 4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)-3-methoxypropan-2-ol
653.3





645A


embedded image


1-(4-{[2-(3-{[4-methanesulfonyl-2- (2,2,2- trifluoroethoxy)phenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)-3-methoxypropan-2-ol
691.3





646A


embedded image


1-[4-((2-[3-(2-amino-4- methanesulfonylphenoxy)prop-1-yn- 1-yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl}amino)piperidin-1-yl]-3- methoxypropan-2-ol
609.1





647A


embedded image


4-({3-[4-({1-[(2R)-2-hydroxy-3- methoxypropyl]piperidin-4- yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl]prop-2-yn-1- yl}amino)-3-methoxy-N- methylbenzamide
602.3





648A


embedded image


4-({3-[4-({1-[(2S)-2-hydroxy-3- methoxypropyl]piperidin-4- yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl] prop-2-yn-1- yl}amino)-3-methoxy-N- methylbenzamide
602.3





649A


embedded image


4-({3-[4-({1-[(2R)-3-hydroxy-2- methoxypropyl]piperidin-4- yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl]prop-2-yn-1- yl}amino)-3-methoxy-N- methylbenzamide
602.3





650A


embedded image


4-({3-[4-({1-[(2S)-3-hydroxy-2- methoxypropyl]piperidin-4- yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl]prop-2-yn-1- yl}amino)-3-methoxy-N - methylbenzamide
602.3





651A


embedded image


l-{4-[(2-{3-[4-methane sulfonyl-2- (methylamino)phenoxyjprop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
623.4





652A


embedded image


3 -(2-fluoroethoxy)-4-{[3-(4-{[1-(2- hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-N-methylbenzamide
634..3





653A


embedded image


4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-(2-methoxyethoxy)-N- methylbenzamide
646.3





654A


embedded image


3-(cyanomethoxy)-4-{[3-(4-{[1-(2- hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-N-methylbenzamide
627.2





655A


embedded image


N-ethyl-4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzamide
616.3





656A


embedded image


1-(4-{[2-(3-{[2-methoxy-4- (methylcarbamoyl)phenyl]amino} prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl]amino}piperidin-1-yl)-3- (propanoyloxy)propan-2-yl propanoate
700.3





657A


embedded image


1-methoxy-3-(4-{[2-(3-{[2- methoxy-4- (methylcarbamoyl)phenyl]amino} prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1lH-indol-4- yl]amino}piperidin-1-yl)propan-2-yl propanoate
658.3





658A


embedded image


4-{[3-(4-{[1-(2,3- dihydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N- methylbenzamide
588.3





659A


embedded image


3-(2-cyanoethoxy)-4-{[3-(4-{[1-(2- hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-N-methylbenzamide
641.4





660A


embedded image


1-ethoxy-3-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-2-ol
637.3





661A


embedded image


2-(2-{[3-(4-{[1-(2- hydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-5- methanesulfonylphenoxy)acetonitrile
618.12





662A


embedded image


1-(4-{[2-(3-{[4-(ethanesulfonyl)-2- methoxyphenyl]amino}prop-1-yn-1- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl]amino}piperidin-1-yl)-3- methoxypropan-2-ol
637.2





663A


embedded image


3-(fluoromethoxy)-4-{[3-(4-{[1-(2- hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-N-methylbenzamide
620.2





664A


embedded image


1-(4-{[2-(3-{[2-(fluoromethoxy)-4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)-3-methoxypropan-2-ol
641.6





665A


embedded image


2-(4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxyphenyl)-2- methylpropanenitrile
612.3





666A


embedded image


(2S)-1-(4-{[2-(3-{[2- (fluoromethoxy)-4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)-3-methoxypropan-2-ol
641.2





667A


embedded image


(2R)-1-(4-{[2-(3-{[2- (fluoromethoxy)-4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)-3-methoxypropan-2-ol
641.2





668A


embedded image


1-(4-{[2-(3-{[2-(difluoromethoxy)- 4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)-3-methoxypropan-2-ol
659.2





669A


embedded image


3-(2-hydroxy-3-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propoxy)propane-1,2-diol
683.2





670A


embedded image


1-{4-[(2-{3-[(5-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
623.3





671A


embedded image


3-(3-(4-((1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1-yl)-6- (methylsulfonyl)benzo[d]oxazol- 2(3H)-one
635.3





672A


embedded image


1-{4-[(2-{3-[(4- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino]piperidin-1- yl}-3 -methoxypropan-2 -ol
593.2





673A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- (2,2,2-trifluoroethoxy)propan-2-ol
691.2





674A


embedded image


4-hydroxy-9-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]-2-oxa-6λ5- azaspiro[5.5]undecan-6-ylium
622.2





675A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[1-(3- methoxypropyl)piperidin-4-yl]-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
607.2





676A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-3-methyl-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
637.2





677A


embedded image


1-{4-[(2-{3-[(5-fluoro-4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
641.2





678A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[1-(oxetan-3-yl)piperidin-4- yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
591.2





679A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-N-(1-(tetrahydrofuran-3- yl)piperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
605.3





680A


embedded image


(R)-2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-N-(1-(tetrahydrofuran-3- yl)piperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
605.3





681A


embedded image


(S)-2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-N-(1-(tetrahydrofuran-3- yl)piperidin-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-aminc
605.3





682A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-N-(1-((tetrahydrofuran-2- yl)methyl)piperidin-4-yl)-l-(2,2,2- trifluoroethyl)-1H-indol-4-amine
619.2





683A


embedded image


2-fluoro-4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol -2-yl)prop-2-yn-1- yljamino}-5-methoxybenzamide
606.2





684A


embedded image


1-methoxy-3-(4-((2-(3-(((3S,4R)-3- methoxytetrahydro-2H-pyran-4- yl)amino)prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino)piperidin-1-yl)propan-2-ol
553.2





685A


embedded image


1-(4-{[2-(3-{[4- (cyclopropanesulfonyl)-2- methoxyphenyl]amino}prop-1-yn-1- yl)-1l-(2,2,2-trifluoroethyl)-1H- indol-4-yl]amino}piperidin-1-yl)-3- methoxypropan-2-ol
649.3





686A


embedded image


3-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propanenitrile
588.2





687A


embedded image


4-(4-((2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)butanenitrile
602.2





688A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-{1-[(oxolan-2- yl)methyl]piperidin-4-yl}-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
619.2





689A


embedded image


1-methoxy-3-(4-{[2-(3-{[2- methoxy-4- (trifluoromethyl)phenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)propan-2-ol
613.2





690A


embedded image


2-fluoro-4-{[3-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-5-methoxy-N- methylbenzamide
620.3





691A


embedded image


1-(4-{[2-(3-{[4-(benzenesulfonyl)- 2-methoxyphenyl]amino}prop-1-yn- 1-yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl]amino}piperidin-1-yl)-3- methoxypropan-2-ol
685.3





692A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[1-(2-methoxy-2- methylpropyl)piperidin-4-yl]-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
621.2





693A


embedded image


2-(4-((2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)ethan-l-ol
579.2





694A


embedded image


1-methoxy-3-(4-{[2-(3-{[2- methoxy-4-(propane-2- sulfonyl)phenyl]amino}prop-1-yn- 1-yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl]amino}piperidin-1- yl)propan-2-ol
651.3





695A


embedded image


1-{3-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
622.9





696A


embedded image


1-methoxy-3-(4-((2-(3-(((3R,4R)-3- methoxytetrahydro-2H-pyran-4- yl)amino)prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino)piperidin-1-yl)propan-2-ol
553.2





697A


embedded image


l-{4-[(2-{3 -[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-propyl-1H-indol-4- yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
583.3





698A


embedded image


1-(4-{[1-(2-fluoroethyl)-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1H-indol-4-yl]amino}piperidin- 1-yl)-3-methoxypropan-2-ol
587.2





699A


embedded image


2-(4-{[1-(2-hydroxy-3- methoxypropyl)piperidin-4- yl]amino}-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1H-indol-1-yl)acetonitrile
580.3





700A


embedded image


1-(4-{[1-(2-chloroethyl)-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1H-indol-4-yl]amino}piperidin- 1-yl)-3-methoxypropan-2-ol
603.2





701A


embedded image


rac-1-[(3R.4S)-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]-3- methylpiperidin-1-yl]-3- methoxypropan-2-ol
637.3





702A


embedded image


rac-1-[(3R,4R)-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]-3- methylpiperidin-1-yl]-3- methoxypropan-2-ol
637.3





703A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methylphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
607.3





704A


embedded image


1-[4-({1-[(2,2- difluorocyclopropyl)methyl]-2-{3- [(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1H-indol-4-yl}amino)piperidin- 1-yl]-3-methoxypropan-2-ol
630.9





705A


embedded image


4-{[3-(4-{[1-(2-hydroxy-3 - methoxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoic acid
589.3





706A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[1-(3- methanesulfonylpropyl)piperidin-4- yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
655.2





707A


embedded image


4-{[3-(4-{[1-(3- methanesulfonylpropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoic acid
621.3





708A


embedded image


1-(4-{[2-(3-{[4-methanesulfonyl-2- (trifluoromethyl)phenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl]amino}piperidin-1- yl)-3-methoxypropan-2-ol
661.3





709A


embedded image


1-(4-{[1-(2,2-difluoroethyl)-2-{3- [(4-methane sulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1H-indol-4-yl]amino}piperidin- 1-yl)-3-methoxypropan-2-ol
605.2





710A


embedded image


1-(4-{[2-(3-{[4-methanesulfonyl-2- (trifluoromethoxy)phenyl]amino} prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl]amino}piperidin-1-yl)-3- methoxypropan-2-ol
677.1





711A


embedded image


l-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(3,3,3-trifluoropropyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
637.3





712A


embedded image


1-(4-{[ 1 -(2,2-difluoropropyl)-2-{3- [(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1 H-indol-4-yl]amino}piperidin- 1-yl)-3-methoxypropan-2-ol
619.3





713A


embedded image


1-{4-[(2-{3-[(2-chloro-4- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino]piperidin-1- yl}-3-methoxypropan-2-ol
627.4





714A


embedded image


1-{4-[(2-{3-[(2-fluoro-4- methanesulfonyl-6- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
641.2





1054A


embedded image


1-(4-((2-(3-((4-((6-oxa-3- azabicyclo[3.1.1]heptan-3- yl)sulfonyl)-2- methoxyphenyl)amino)prop-1- yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol






715A


embedded image


(2S)-1-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-yl propanoate
679.3





716A


embedded image


1-{4-[(2-{3-[(4-chloro-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- methoxypropan-2-ol
579.2





717A


embedded image


2-(2-(4-((2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)ethoxy)ethan-1-ol
623.2





718A


embedded image


4-((3-(4-((1-(2,3- dihydroxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-N-(2-hydroxyethyl)-3- methoxybenzenesulfonamide






719A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-[1-(4-methyl-1,3-thiazol-2- yl)piperidin-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
632.2





720A


embedded image


N-(1-cyclopropylpiperidin-4-yl)-2- {3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
575.2





721A


embedded image


4-[(3-{4-[(1-cyclopropylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxybenzoic acid
541.2





722A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-{1-[(3R)-oxolan-3- yl]piperidin-4-yl}-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
605.2





723A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-{1-[(3S)-oxolan-3- yl]piperidin-4-yl}-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
605.3





724A


embedded image


3-methoxy-4-{[3-(4-{[1-(oxan-4- yl)piperidin-4-yl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino}benzoic acid
585.3





725A


embedded image


3-methoxy-4-((3-(4-((1-(tetrahydro- 2H-pyran-4-yl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)benzamide
584.3





726A


embedded image


N-(2-hydroxyethyl)-3-methoxy-4- ((3-(4-((1-(tetrahydro-2H-pyran-4- yl)piperidin-4-yl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-l- yl)amino)benzenesulfonamide
664.3





727A


embedded image


3-methoxy-4-((3-(4-((1′-methyl- [1,4′-bipiperidin]-4-yl)amino)-1- (2,2.2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)benzamide
597.3





728A


embedded image


3-methoxy-4-((3-(4-((1-(2-(4- methylpiperazin-1-yl)-2- oxoethyl)piperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)benzamide
640.3





729A


embedded image


2-{2-[(3-{4-[(1-acetylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-5- methanesulfonylphenoxy}acetonitrile
602.2





730A


embedded image


4-{[3-(4-{[1-(2- hydroxyacetyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxy-N,N- dimethylbenzene-1-sulfonamide
622.4





731A


embedded image


2-hydroxy-1-{4-[(2-{3-[(2-hydroxy- 4- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino]piperidin-1- yl}ethan-1-one
579.2





732A


embedded image


2-hydroxy-1-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}ethan-1-one
539.0





733A


embedded image


N-((3S,4S)-1,3-dimethylpiperidin-4- yl)-2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
563.2





734A


embedded image


N-((3R,4R)-1,3-dimethylpiperidin- 4-yl)-2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
563.3





735A


embedded image


N-((3 R,4R)-1,3-dimethylpiperidin- 4-yl)-2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
563.3





736A


embedded image


N-((3R,4S)-1,3-dimethylpiperidin-4- yl)-2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
563.2





737A


embedded image


N-((3S,4R)-1,3-dimethylpiperidin-4- yl)-2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
563.2





738A


embedded image


1-(4-((2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)-2- methylpiperidin-1-yl)ethan-1-one
591.2





739A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]-2- methylpiperidin-1-yl}ethan-1-one
591.2





740A


embedded image


4-{[3-(4-{[(2S,4S)-1-acetyl-2- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzene-1-sulfonamide
592.2





741A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-2- methoxyethan-1-one
607.2





742A


embedded image


2-hydroxy-1-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino] prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-1-one
607.2





743A


embedded image


2-methoxy-1-(4-((2-(3-((2-methoxy- 4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)ethan-1-one
607.2





744A


embedded image


3-methoxy-4-((3-(4-((1-(2- methoxyacetyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)benzenesulfonamide
607.2





745A


embedded image


4-{[3-(4-{[1-(2- hydroxypropanoyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
608.2





746A


embedded image


3-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-3- oxopropanenitrile
602.2





747A


embedded image


4-{[3-(4-{[1-(2- cyanoacetyl)piperidin-4-yl]amino}- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzene-1-sulfonamide
603.2





748A


embedded image


4-{[3-(4-{[1-(2- hydroxyacetyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
594.2





749A


embedded image


4-[(3-{4-[(1-acetylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxybenzene-1- sulfonamide
578.1





750A


embedded image


2-(dimethylamino)-1-{4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}ethan-1-one
620.2





751A


embedded image


4-((3-(4-((1- (dimethylglycyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3- methoxybenzenesulfonamide
621.2





752A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl}-2- methylpropan-1-one
605.2





753A


embedded image


3-methoxy-4-{[3-(4-{[1-(2- methylpropanoyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}benzene-1-sulfonamide
606.2





754A


embedded image


4-((2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)-N,N- dimethylpiperidine-1-carboxamide
606.2





755A


embedded image


4-[(3-{4-[(1-acetylpiperidin-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxy-N,N- dimethylbenzene-1-sulfonamide
606.2





756A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl}propan-1-one
591.2





757A


embedded image


3-methoxy-4-[(3-{4-[(1- propanoylpiperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzene- 1-sulfonamide
592.1





758A


embedded image


1-(4-{[2-(3-{[2-methoxy-4- (morpholine-4- sulfonyl)phenyl]amino}prop-1-yn- 1-yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl]amino}piperidin-1- yl)ethan-1-one
648.2





759A


embedded image


3-methoxy-4-[(3-{4-[(1-{[(4S)-2- oxo-1,3-dioxolan-4- yl]methyl}piperidin-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]benzene- 1-sulfonamide
636.2





760A


embedded image


N-((3-methoxy-4-((3-(4-((1-((2-oxo- 1,3-dioxolan-4-yl)methyl)piperidin- 4-yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)phenyl)sulfonyl)propion- amide






761A


embedded image


N-[3-methoxy-4-({3-[4-({1-[(2-oxo- 1,3-dioxolan-4-yl)methyl]piperidin- 4-yl}amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl]prop-2-yn-1- yl}amino)benzenesulfonyl]acetamide
678.2





762A


embedded image


3-methoxy-N-methyl-4-({3-[4-({1- [(2-oxo-1,3-dioxolan-4- yl)methyljpiperidin-4-yl}amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl]prop-2-yn-1-yl}amino)benzamide
614.3





763A


embedded image


2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-N-(octahydroindolizin-7- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
575.2





764A


embedded image


N-[(7R,8aS)-octahydroindolizin-7- yl]-2-{3-[(4-methanesulfonyl-2- methoxyphfenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
575.2





765A


embedded image


N-[(7R,8aR)-octahydroindolizin-7- yl]-2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
575.2





766A


embedded image


rac-(3R,4S)-3-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]-1- methylpiperidin-4-ol
565.3





767A


embedded image


rac-(3R,4R)-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]-1- methylpiperidin-3-ol
565.1





768A


embedded image


3-methoxy-4-((3-(4-((1-(tetrahydro- 2H-pyran-4-yl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)benzenesulfonamide
620.2





769A


embedded image


rac-N-[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
567.2





770A


embedded image


N-((3S,4S)-3-fluoro-1- methylpiperidin-4-yl)-2-(3-((2- methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
567.2





771A


embedded image


N-[(3S,4S)-3-fluoro-1- methylpiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
567.2





772A


embedded image


N-[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
567.2





773A


embedded image


N-[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
567.2





774A


embedded image


N-[(3R,4R)-3-fluoro-1- methylpiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
567.2





775A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzene-1-sulfonamide
568.2





776A


embedded image


rac-4-{[3-(4-{[(3R,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzene-1-sulfonamide
568.1





777A


embedded image


rac-methyl 4-{[3-(4-{[(3R,4R)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoate
547.3





778A


embedded image


rac-methyl 4-{[3-(4-{[(3R,4S)-3- fluoro-1-methylpiperidin-4- yljamino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoate
547.2





779A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
533.2





780A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
533.2





781A


embedded image


4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
533.2





782A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
532.1





783A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl] amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methylbenzamide
546.2





784A


embedded image


4-((3-(4-(((3S.4R)-3-fluoro-1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-3- methoxy-N-methylbenzamide
546.2





785A


embedded image


rac-4-{[3-(4-{[(3R,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methylbenzamide
546.2





786A


embedded image


2-fluoro-4-((3-(4-(((3R.4S)-3- fluoro-1-methylpiperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-5-methoxy-N- methylbenzamide
564.3





787A


embedded image


2-fluoro-4-((3-(4-(((3S.4R)-3- fluoro-1-methylpiperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-5-methoxy-N- methylbenzamide
564.3





788A


embedded image


4-{[3-(4-{[(3R,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
533.1





789A


embedded image


4-{[3-(4-{[(3S,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
533.1





790A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzene-1-sulfonamide
568.3





791A


embedded image


4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzene-1-sulfonamide
568.3





792A


embedded image


methyl 4-{[3-(4-{[(3S,4R)-3-fluoro- 1-methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
547.2





793A


embedded image


rac-4-{[3-(4-{[(3R,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
532.2





794A


embedded image


methyl 4-{[3-(4-{[(3R,4S)-3-fluoro- 1-methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
547.2





795A


embedded image


rac-N-[(3R,4S)-3-fluoro-1-(propan- 2-yl)piperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
595.3





796A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- (propan-2-yl)piperidin-4-yl]amino}- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
561.3





797A


embedded image


rac-ethyl 4-{[3-(4-{[(3R,4S)-3- fluoro-1-(propan-2-yl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoate
589.3





798A


embedded image


rac-ethyl 4-{[3-(4-{[(3R,4S)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoate
561.3





799A


embedded image


(2R)-1-(acetyloxy)-3-[(3RS,4SR)-3- fluoro-4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]propan-2-yl acetate
712.2





800A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
532.2





801A


embedded image


4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
532.2





802A


embedded image


N-[(3S,4R)-3-fluoro-1-(propan-2- yl)piperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2.2-trifluoroethyl)-1H- indol-4-amine
595.3





803A


embedded image


N-[(3R,4S)-3-fluoro-1-(propan-2- yl)piperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
595.3





804A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methylbenzamide
546.3





805A


embedded image


4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methylbenzamide
546.3





806A


embedded image


rac-2-hydroxypropyl 4-{[3-(4- {[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
591.3





807A


embedded image


4-((3-(4-(((3R,4S)-3-fluoro-1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-N- isopropyl-3-methoxybenzamide
574.3





808A


embedded image


4-{[3-(4-{[(3 S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-(propan-2-yl)benzamide
574.3





809A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- (propan-2-yl)piperidin-4-yl]amino}- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
561.2





810A


embedded image


4-{[3-(4-{[(3R,4S)-3-fluoro-1- (propan-2-yl)piperidin-4-yl]amino}- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
561.2





811A


embedded image


rac-2-[(3R,4S)-3-fluoro-4-[(2-{3- [(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]acetamide
610.2





812A


embedded image


N-[(3S,4R)-1-ethyl-3- fluoropiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
581.3





813A


embedded image


N-[(3R,4S)-1-ethyl-3- fluoropiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
581.3





814A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-(2- methoxyethyl)benzamide
590.4





815A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2yn-1-yl]amino}-3- methoxy-N,N-dimethylbenzamide
560.3





816A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yljamino}-N-(2- hydroxy-3-methoxypropyl)-3- methoxybenzamide
620.2





817A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-(propan-2-yl)benzamide
574.3





818A


embedded image


rac-4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-(oxan-4-yl)benzamide
616.3





819A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-(oxan-4-yl)benzamide
616.3





820A


embedded image


rac-N-[(3R,4S)-1-ethyl-3- fluoropiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
581.3





821A


embedded image


ethyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1- (propan-2-yl)piperidin-4-yl]amino}- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
589.2





822A


embedded image


ethyl 4-((3-(4-(((3R,4S)-1-ethyl-3- fluoropiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-3- methoxybenzoate
575.2





823A


embedded image


ethyl 4-{[3-(4-{[(3S,4R)-1-ethyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
575.2





824A


embedded image


ethyl 4-{[3-(4-{[(3R,4S)-1-ethyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl] amino}-3- methoxybenzoate
575.2





825A


embedded image


ethyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1- (propan-2-yl)piperidin-4-yl]amino}- 1-(2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
589.2





826A


embedded image


2-fluoro-4-{[3-(4-{[(3S,4R)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-5-methoxy-N- methylbenzamide
564.3





827A


embedded image


2-fluoro-4-{[3-(4-{[(3R,4S)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-5-methoxy-N- methylbenzamide
564.3





828A


embedded image


4-{[3-(4-{[(3R,4S)-1-ethyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl] amino}-3- methoxybenzoic acid
547.3





829A


embedded image


4-{[3-(4-{[(3S,4R)-1-ethyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
547.3





830A


embedded image


rac-N-(2-{bis[(pyridin-2- yl)methyl]amino}ethyl)-4-{[3-(4- {[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yljamino}-3- methoxybenzamide
557.3





831A


embedded image


rac-N-[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-methyl-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
581.2





832A


embedded image


rac-4-((3-(4-(((3R,4S)-3-fluoro-1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-3- methoxybenzoic acid
533.2





833A


embedded image


rac-4-{[3-(4-{[(3R,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
533.1





834A


embedded image


2-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-5- methanesulfonylphenol
553.2





835A


embedded image


2-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-H-indol-2- yl)prop-2-yn-1-yl]amino}-5- methanesulfonylphenol
553.2





836A


embedded image


rac-6-fluoro-N-[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
584.8





837A


embedded image


N-(4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-}4]amino}-3- methoxybenzenesulfonyl)acetamide
610.2





838A


embedded image


N-(4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzenesulfonyl)acetamide
610.2





839A


embedded image


ethyl 4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl] amino}-3- methoxybenzoate
561.3





840A


embedded image


ethyl 4-{[3-(4-{[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
561.3





841A


embedded image


N-[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]-2-(3-{[2- (fluoromethoxy)-4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
585.3





842A


embedded image


N-[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]-2-(3-{[2- (fluoromethoxy)-4- methanesulfonylphenyl]amino}prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
585.3





843A


embedded image


2-{3-[(2-ethoxy-4- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-N-[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
581.1





844A


embedded image


2-{3-[(2-ethoxy-4- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-N-[(3R,4S)-3-fluoro-1- methylpiperidin-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
581.1





845A


embedded image


4-{[3-(4-{[(3S,4R)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzene-1-sulfonamide
554.2





846A


embedded image


4-{[3-(4-{[(3R,4S)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-l-yl]amino}-3- methoxybenzene-1-sulfonamide
554.2





847A


embedded image


N-((3S,4R)-3-fluoropiperidin-4-yl)- 2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
553.2





848A


embedded image


N-((3R,4S)-3-fluoropiperidin-4-yl)- 2-(3-((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
553.2





849A


embedded image


4-{[3-(4-{[(3S,4R)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
518.2





850A


embedded image


4-((3-(4-(((3R,4S)-3- fluoropiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-3- methoxybenzamide
518.2





851A


embedded image


4-{[3-(4-{[(3R,4S)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yljamino}-3- methoxy-N-methylbenzamide
532.2





852A


embedded image


4-{[3-(4-{[(3R,4S)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
519.2





853A


embedded image


2-[(3S,4R)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]ethan-1-ol
597.2





854A


embedded image


2-[(3R,4S)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]ethan-1-ol
597.2





855A


embedded image


2-(dimethylamino)-1-[(3S,4R)-3- fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]ethan-1-one
638.3





856A


embedded image


2-(dimethylamino)-1-[(3R,4S)-3- fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]ethan-1-one
638.3





857A


embedded image


4-{[3-(4-{[(3S,4R)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methylbenzamide
532.2





858A


embedded image


4-{[3-(4-{[(3S,4R)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
519.2





859A


embedded image


N-[(3S,4R)-3-fluoro-1-(2- methoxyethyl)piperidin-4-yl]-2-{3- [(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
611.2





860A


embedded image


N-[(3R,4S)-3-fluoro-1-(2- methoxyethyl)piperidin-4-yl]-2-{3- [(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
611.2





861A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- [(2R)-2-hydroxy-3 - methoxypropyl]piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
624.3





862A


embedded image


1-[(3S,4R)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]ethan-1-one
595.2





863A


embedded image


1-[(3R,4S)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]ethan-1-one
595.2





864A


embedded image


1-[(3S,4R)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]propan-1-one
609.3





865A


embedded image


1-[(3R,4S)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]propan-1-one
609.3





866A


embedded image


1-[(3S,4R)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl]-2- methoxyethan-1-one
625.3





867A


embedded image


1-[(3R,4S)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1-yl]-2- methoxyethan-1-one
625.3





868A


embedded image


4-{[3-(4-{[(3R,4S)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
518.3





869A


embedded image


4-{[3-(4-{[(3R,4S)-3-fluoro-1- [(2R)-2-hydroxy-3- methoxypropyl]piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
642.3





870A


embedded image


N-[(7S,8R)-7-fluoro-1,4- dioxaspiro[4.5]decan-8-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
610.2





871A


embedded image


1-[(3S,4R)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]propan-2-ol
611.2





872A


embedded image


1-((3S,4S)-3-fluoro-4-((2-(3-((2- methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.2





873A


embedded image


1-((3R,4S)-3-fluoro-4-((2-(3-((2- methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.2





874A


embedded image


4-((3-(4-(((3S,4S)-3-fluoro-1-((R)- 2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoic acid
607.3





875A


embedded image


4-((3-(4-(((3R,4S)-3-fluoro-1-((R)- 2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoic acid
607.2





876A


embedded image


4-((3-(4-(((3R,4S)-3-fluoro-1-((R)- 2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoic acid
607.3





877A


embedded image


4-((3-(4-(((3S.4R)-3-fluoro-1-((R)- 2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoic acid
607.3





878A


embedded image


methyl 4-((3-(4-(((3S.4R)-3-fluoro- 1-((R)-2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoate
621.3.





879A


embedded image


methyl 4-((3-(4-(((3R,4S)-3-fluoro- 1-((R)-2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoate
621.4





880A


embedded image


(R)-1-((3R,4S)-3-fluoro-4-((2-(3- ((2-fluoro-6-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-propyl-1H-indol-4- yl)amino)piperidin-1-yl)-3- methoxypropan-2-ol
619.3





881A


embedded image


(R)-1-((3R,4S)-4-((1-allyl-2-(3-((2- fluoro-6-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1H-indol-4-yl)amino)-3- fluoropiperidin-1-yl)-3- methoxypropan-2-ol
599.3





882A


embedded image


4-{[3-(4-{[(3S,4R)-1-[(2R)-2,3- dihydroxypropyl]-3-fluoropiperidin- 4-yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
628..3





883A


embedded image


4-{[3-(4-{[(3R,4S)-1-[(2R)-2,3- dihydroxypropyl]-3-fluoropiperidin- 4-yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
628.3





884A


embedded image


(2R)-1-[(3RS,4SR)-3-fluoro-4-[(2- {3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-propyl-1H-indol-4- yl)amino]piperidin-1-yl]-3- methoxypropan-2-ol
601.2





885A


embedded image


4-((3-(4-(((3S,4S)-3-fluoro-1-((R)- 2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoic acid






886A


embedded image


4-((3-(4-(((3S,4S)-3-fluoro-1-((R)- 2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoic acid
607.2





887A


embedded image


4-((3-(4-(((3R,4R)-3-fluoro-1-((R)- 2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzoic acid
607.2





888A


embedded image


(2R)-1-(acetyloxy)-3-[(3R,4S)-3- fluoro-4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-l-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]propan-2-yl acetate
712.2





889A


embedded image


N-[(2R)-2,3-dihydroxypropyl]-4- {[3-(4-{[(3RS,4SR)-3-fluoro-1- [(2R)-2-hydroxy-3- methoxypropyl]piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzene-1- sulfonamide
702.2 M-Me





890A


embedded image


(2R)-1-(acetyloxy)-3-[(3S,4R)-3- fluoro-4-[(2-{3-[(2-methoxy-4- sulfamoylphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]propan-2-yl acetate
712.3





891A


embedded image


rac-N-(2-{bis[(pyridin-2- yl)methyl]amino}ethyl)-2-[(3R,4S)- 3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2-methoxyphenyl) amino] prop-1-yn-1-yl}-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino]piperidin-1-yl]acetamide
835.2





892A


embedded image


2-amino-1-[(3R,4S)-3-fluoro-4-[(2- {3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]ethan-1-one
610.2





893A


embedded image


2-amino-1-[(3S,4R)-3-fluoro-4-[(2- {3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]ethan-1-one
610.2





894A


embedded image


1-[(3R,4S)-3-fluoro-4-[(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]piperidin-1- yl]propan-2-ol
611.2





895A


embedded image


3-(4-(((3S,4R)-3-fluoro-1- methylpiperidin-4-vl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-ol
384.1





896A


embedded image


(4-((3-(4-(((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-3- methoxybenzoyl)glycine
590.2





897A


embedded image


methyl 4-{[3-(4-{[(3S,4R)-3-fluoro- 1-(2-methoxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoate
591.2





898A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1-(2- methoxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoic acid
577.2





899A


embedded image


methyl 4-{[3-(4-{[(3S,4R)-3-fluoro- 1-(2-hydroxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl] amino}-3-methoxybenzoate
577.3





900A


embedded image


methyl 4-{[3-(4-{[(3S,4R)-3-fluoro- 1-(2-hydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoate
591.2





901A


embedded image


methyl 4-{[3-(4-{[(3S,4R)-1- (carbamoylmethyl)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
590.2





902A


embedded image


methyl 4-{[3-(4-{[(3R,4S)-3-fluoro- 1-(2-methoxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoate
591.3





903A


embedded image


methyl 4-{[3-(4-{[(3R,4S)-3-fluoro- 1-(2-hydroxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoate
577.2





904A


embedded image


4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2- methoxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoic acid
577.3





905A


embedded image


methyl 4-{[3-(4-{[(3R,4S)-3-fluoro- 1-(2-hydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoate
591.3





906A


embedded image


N-[(3S,4R)-3 -fluoro-1- methylpiperidin-4-yl]-2-{3-[(2- methoxy-4-{2-oxa-6- azaspiro[3.3]heptane-6- carbonyl}phenyl)aminolprop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
614.3





907A


embedded image


N-[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]-2-{3-[(2- methoxy-4-{7-oxa-2 - azaspiro[3.5]nonane-2- carbonyl}phenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
642.3





908A


embedded image


4-{[3-(4-{[(3 S,4R)-3-fluoro-1-(2- hydroxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoic acid
563.2





909A


embedded image


N-[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]-2-(3-{[2- methoxy-4-(morpholine-4- carbonyl)phenyl]amino}prop-1-yn- 1-yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
602.3





910A


embedded image


N-[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]-2-(3-{[2- methoxy-4-(4-methylpiperazine-1- carbonyl)phenyl]amino}prop-1-yn 1-yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
615.4





911A


embedded image


4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2- hydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoic acid
577.3





912A


embedded image


4-{[3-(4-{[(3R,4S)-3-fluoro-1-(2- hydroxyethyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoic acid
563.2





913A


embedded image


methyl 4-{[3-(4-{[(3S,4R)-1- [(dimethylcarbamoyl)methyl]-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
618.3





914A


embedded image


methyl 4-{[3-(4-{[(3R,4S)-1- [(dimethylcarbamoyl)methyl]-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
618.3





915A


embedded image


methyl 4-{[3-(4-{[(3R,4S)-1- (carbamoylmethyl)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoate
590.2





916A


embedded image


2-((3R,4S)-3-fluoro-4-((2-(3-((2- methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)acetamide
610.2





917A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-(1,3-thiazol-2- yl)benzamide
615.2





918A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-(1-methylpiperidin-4- yl)benzamide
629.3





919A


embedded image


1-(4-{[3-(4-{[(3 S,4R)-3 -fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoyl)piperidin-4-ol
616.3





920A


embedded image


4-{[3-(4-{[(3S,4R)-1- [(dimethylcarbamoyl)methyl]-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
604.3





921A


embedded image


4-{[3-(4-{ [(3S,4R)-3-fluoro-1-(2- hydroxypropyl)piperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoic acid
577.3





922A


embedded image


tert-butyl (3S,4R)-4-{[2-(3-{[4- (ethanesulfonyl)-2- methoxyphenyl]amino}prop-1-yn-1- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl]amino}-3- fluoropiperidine-1-carboxylate
667.3





923A


embedded image


2-(3-((4-(ethylsulfonyl)-2- methoxyphenyl)amino)prop-1-yn-1- yl)-N-((3S,4R)-3-fluoropiperidin-4- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
567.2





924A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-[2-(morpholin-4- yl)ethyl]benzamide
645.4





925A


embedded image


4-{[3-(4-{[(3R,4S)-1- (carbamoylmethyl)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
576.3





926A


embedded image


4-{[3-(4-{[(3S,4R)-1- (carbamoylmethyl)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
576.2





927A


embedded image


4-{[3-(4-{[(3R,4S)-1- [(dimethylcarbamoyl)methyl]-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
604.2





928A


embedded image


tert-butyl (3S,4R)-4-[(2-{3-[(2- ethoxy-4- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino]-3- fluoropiperidine-1-carboxylate
611.2 (M- tert- But)





929A


embedded image


(2S)-2-[(4-{[3-(4-{[(3S,4R)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3- methoxyphenyl)formamido]pentane dioic acid
662.3





930A


embedded image


(2S)-4-carbamoyl-2-[(4-{[3-(4- {[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxyphenyl)formamido]butanoic acid
661.3





931A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzene-1-sulfonic acid
569.2





932A


embedded image


1,5-dimethyl (2S)-2-[(4-{[3-(4- {[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxyphenyl)formamido]pentane dioate
690.3





933A


embedded image


2-[3-({4-[4- (dimethylamino)piperidine-1- carbonyl]-2- methoxyphenyl}amino)prop-1-yn-1- yl]-N-[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
643.3





934A


embedded image


4-{[3-(4-{[(3S,4R)-1- (carboxymethyl)-3-fluoropiperidin- 4-yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzoic acid
577.2





935A


embedded image


2-(3-{[4-(ethanesulfonyl)-2- methoxyphenyl]amino}prop-1-yn-1- yl)-N-[(3S,4R)-3-fluoropiperidin-4- yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
567.2





936A


embedded image


(1R,2R,4S)-2-fluoro-N1-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)cyclohexane-1,4-diamine
567.2





937A


embedded image


(1R,2R,4S)-2-fluoro-N1-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)-N4-methylcyclohexane- 1,4-diamine
581.2





938A


embedded image


(1S,3R,4R)-3-fluoro-N4-(2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)-N1,N1- dimethylcyclohexane-1,4-diamine
595.2





939A


embedded image


2-(4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzenesulfonyl)ethan-1-ol
597.2





940A


embedded image


N-ethyl-4-{[3-(4-{[(3S,4R)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-methoxybenzamide
560.2





941A


embedded image


2-{3-[(2-ethoxy-4- methanesulfonylphenyl)amino]prop- 1-yn-1-yl}-N-[(3S,4R)-3- fluoropiperidin-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
567.3





942A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N,N-dimethylbenzamide
560.3





943A


embedded image


N-ethyl-4-((3-(4-(((3S,4R)-3-fluoro- 1-methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-3- methoxy-N-methylbenzamide
588.3





944A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methyl-N-(propan-2- yl)benzamide
588.3





945A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-(2- methoxyethyl)benzamide
590.2





946A


embedded image


N-[2-(diethylamino)ethyl]-4-{[3-(4- {[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
631.4





947A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-N-(2- hydroxyethyl)-3-methoxybenzamide
576.3





948A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-[(2R,3R,4R,5S,6R)- 2,4,5-trihydroxy-6- (hydroxymethyl)oxan-3- yl]benzamide
694.3





949A


embedded image


4-((3-(4-(((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-N-(1- hydroxypropan-2-yl)-3- methoxybenzamide
590.3





950A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-N-[(2R)- 1-hydroxypropan-2-yl]-3- methoxybenzamide
590.3





951A


embedded image


N-[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1- yl]cyclopropanecarboxamide
451.2





952A


embedded image


(1R,2R)-N-[3-(4-{[(3S,4R)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1-yl]-2- phenylcyclopropane-1-carboxamide
527.3





953A


embedded image


N-[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]-1-methyl-1H- pyrrole-3-carboxamide
490.2





954A


embedded image


1-ethyl-N-[3-(4-{[(3S,4R)-3-fluoro- 1-methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]-1H-pyrrole-3- carboxamide
504.2





955A


embedded image


1-tert-butyl-N-[3-(4-{[(3S,4R)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1-yl]-1H- pyrrole-3-carboxamide
532.3





956A


embedded image


methyl (2S)-4-carbamoyl-2-[(4-{[3- (4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxyphenyl)formamido] butanoate
675.3





957A


embedded image


4-((3-(4-(((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-N-((R)-2- hydroxypropyl)-3- methoxybenzamide
590.2





958A


embedded image


rac-4-{[3-(4-{[(3R,4S)-1-ethyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
547.2





959A


embedded image


4-((3-(4-(((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-N-((S)-2- hydroxypropyl)-3- methoxybenzamide
590.2





960A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-N-(2- hydroxy-3-methoxypropyl)-3- methoxybenzamide
620.3





961A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-N-[(2S)- 2-hydroxypropyl]-3- methoxybenzamide
590.3





962A


embedded image


N-(2,3-dihydroxypropyl)-4-{[3-(4- {[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
606.3





963A


embedded image


N-[(2R)-2,3-dihydroxypropyl]-4- {[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
606.2





964A


embedded image


N-[(2S)-2,3-dihydroxypropyl]-4- {[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
606.2





965A


embedded image


N-(1,5-dihydroxypentan-3-yl)-4- {[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
634.3





966A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-N-(3- hydroxy-2-methoxypropyl)-3- methoxybenzamide
620.3





967A


embedded image


1-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxyphenyl)formamido]-3-[(2- methylpropanoyl)oxy]propan-2-yl 2-methylpropanoate
746.3





968A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-[(2-oxo-1,3-dioxolan-4- yl)methyl]benzamide
632.2





969A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-N-(2- methanesulfonylethyl)-3- methoxybenzamide
638.1





970A


embedded image


1-(acetyloxy)-3-[(4-{[3-(4- {[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxyphenyl)formamido]propan- 2-yl acetate
690.2





971A


embedded image


1-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxyphenyl)formamido]-3- (propanoyloxy)propan-2-yl propanoate
718.2





972A


embedded image


2-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxyphenyl)formamido]propyl 2-methylpropanoate
660.1





973A


embedded image


(S)-5-ethoxy-2-(4-((3-(4-(((3S,4R)- 3-fluoro-1-methylpiperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3-methoxybenzamido)-5- oxopentanoic acid
649.3





974A


embedded image


(4-((3-(4-(((3S,4R)-3-fluoro-1- methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-3- methoxybenzoyl)-L-glutamine
661.3





975A


embedded image


(S)-2-(4-((3-(4-(((3S,4R)-3-fluoro- 1-methylpiperidin-4-yl)amino)-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl)amino)-3- methoxybenzamido)-5-methoxy-5- oxopentanoic acid
694.3





976A


embedded image


(S)-1-((3S,4S)-3-fluoro-4-((2-(3-((2- methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.2





977A


embedded image


(S)-1-((3R,4R)-3-fluoro-4-((2-(3- ((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.2





978A


embedded image


(S)-1-((3R,4S)-3-fluoro-4-((2-(3- ((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-l-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.3





979A


embedded image


(S)-1-((3S,4R)-3-fluoro-4-((2-(3- ((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-l-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.3





980A


embedded image


1-((3S,4S)-3-fluoro-4-((2-(3-((2- methoxy-4- (methylsulfonyl)phenyl)ainino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.3





981A


embedded image


1-((3R,4S)-3-fluoro-4-((2-(3-((2- methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.3





982A


embedded image


(R)-1-((3S,4S)-3-fluoro-4-((2-(3- ((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.2





983A


embedded image


(R)-1-((3R,4R)-3-fluoro-4-((2-(3- ((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.2





984A


embedded image


(R)-1-((3R,4S)-3-fluoro-4-((2-(3- ((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.3





985A


embedded image


(R)-1-((3S,4R)-3-fluoro-4-((2-(3- ((2-methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
641.3





986A


embedded image


4-((3-(4-(((3R,4S)-3-fluoro-1-((R)- 2-hydroxy-3- methoxypropyl)piperidin-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)-3- methoxybenzenesulfonamide
642.3





987A


embedded image


1-(3,3 -difluoro-4-((2-(3-((2- methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)piperidin-1- yl)-3-methoxypropan-2-ol
659.2





988A


embedded image


2-{3-[(4-methanesulfonyl-2 - methoxyphenyl)amino]prop-1-yn-1- yl}-N-(1-methylazepan-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
563.2





989A


embedded image


1-{4-[(2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]azepan-1-yl}-3- methoxypropan-2-ol
637.2





990A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-N-{8-methyl-8- azabicyclo[3.2.1]octan-3-yl}-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
575.2





1055A


embedded image


1-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxyphenyl)formamido]-3- methoxypropan-2-yl 2- methylpropanoate
690.2





1056A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-N-(1- hydroxypropan-2-yl)-3- methoxybenzamide
590.1





1057A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-N-(2- hydroxypropyl)-3- methoxybenzamide
590.1





1058A


embedded image


4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- hydroxy-N-methylbenzamide
532.2





1059A


embedded image


3-ethoxy-4-{[3-(4-{[(3S,4R)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}benzamide
546.2





1060A


embedded image


N-ethyl-4-{[3-(4-{[(3S,4R)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl]amino}-3-hydroxybenzamide
546.3





1061A


embedded image


3-[(4-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxyphenyl)formamido]-2- methoxypropyl 2-methylpropanoate
690.2





1062A


embedded image


N-ethyl-4-{[3-(4-{[(3S,4R)-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
546.2





1063A


embedded image


4-{[3-(4-{[(3S,4R)-1-ethyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzamide
546.2





1064A


embedded image


5-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1 - (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-4- methoxy-N,N-dimethylpyridine-2- carboxamide
561.1





1065A


embedded image


5-{[3-(4-{[(3S,4R)-3-fluoro-1- methylpiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-4- methoxy-N-methylpyridine-2- carboxamide
547.1





1066A


embedded image


1-tert-butyl-N-[3-(4-{[(3S,4R)-3- fluoro-1-methylpiperidin-4- yl]amino}-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1-yl]-1H- pyrazole-4-carboxamide
533.1





1067A


embedded image


rac-N-[(3R,4S)-4-fluoro-1- methylpiperidin-3-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1 H- indol-4-amine
567.2





1068A


embedded image


N-((3S,4R)-1-(tert-butyl)-3- fluoropiperidin-4-yl)-2-(3 -((2- methoxy-4- (methylsulfonyl)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-amine
609.2





1069A


embedded image


N-[(3R,4S)-1-tert-butyl-3- fluoropiperidin-4-yl]-2-{3-[(4- methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn-1- yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
609.3





1070A


embedded image


4-{[3-(4-{[(3S,4R)-1-tert-butyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
575.3





1071A


embedded image


4-{[3-(4-{[(3R,4S)-1-tert-butyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxybenzoic acid
575.3





1072A


embedded image


4-{[3-(4-{[(3S,4R)-1-tert-butyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methylbenzamide
588.3





1073A


embedded image


4-{[3-(4-{[(3R,4S)-1-tert-butyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methylbenzamide
588.3





1074A


embedded image


4-{[3-(4-{[(3S,4R)-1-ethyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methylbenzamide
560.1





1075A


embedded image


4-{[3-(4-{[(3R,4S)-1-ethyl-3- fluoropiperidin-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}-3- methoxy-N-methvlbenzamide
560.1






text missing or illegible when filed indicates data missing or illegible when filed







E. Compounds with 2-ethynyl-N-(tetrahydropyran-4-yl)-1H-indole-4-amine Core
Example E1
Synthesis of Compounds 1023A and 1024A



embedded image


Preparation of 2-iodo-N-((3R,4S)-3-methoxytetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and 2-iodo-N-((3S,4S)-3-methoxytetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a solution of 2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (0.5 g, 1.47 mmol, 1 eq.) and 3-methoxytetrahydropyran-4-one (765.35 mg, 5.88 mmol, 4 eq.) in DMF (5 mL) was added TMSCl (399.32 mg, 3.68 mmol, 466.50 μL, 2.5 eq.) at 0° C. The reaction mixture was stirred at 0° C. for 2 h, then BH3.THF (1M, 7.35 mL, 5 eq.) was added to the mixture under N2 at 0° C. The resulting mixture was stirred at 25° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction was poured into a saturated aqueous solution of NH4Cl (15 mL) and extracted with EtOAc (15 mL×3). The combined organic layers were washed with brine (15 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=2:1) and prep-HPLC to afford the desired racemic products as light-yellow solids. 2-Iodo-N-[(3R,4R)-3-methoxytetrahydropyran-4-yl]-1-(2,2,2-trifluoroethyl)indol-4-amine (0.04 g, 79.26 μmol, 5.39% yield), MS (ES+, m/z): 455.1; 2-iodo-N-[(3S,4R)-3-methoxytetrahydropyran-4-yl]-1-(2,2,2-trifluoroethyl)indol-4-amine (0.03 g, 59.44 μmol, 4.04% yield), MS (ES+, m/z): 455.1.


Preparation of final products: To a solution of 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline (1.2 eq., HCl) in DMSO were added N-isopropylpropan-2-amine (10 eq.), CuI (1 eq.), 2-iodo-N-[(3R,4R)-3-methoxytetrahydropyran-4-yl]-1-(2,2,2-trifluoroethyl)indol-4-amine or 2-iodo-N-[(3S,4R)-3-methoxytetrahydropyran-4-yl]-1-(2,2,2-trifluoroethyl)indol-4-amine (1 eq.), and Pd(PPh3)4 (0.4 eq.). The reaction mixture was stirred at 25° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction was diluted with EtOAc (15 mL), and the resulting mixture was poured into saturated aqueous EDTA (15 mL) and stirred at 25° C. for 1 h. The mixture was extracted with EtOAc (10 mL×3). The combined organic layers were washed with brine (10 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, DCM:MeOH=10:1) and prep-HPLC to afford the desired products as light-yellow solids.


2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-((3R,4S)-3-methoxytetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 566.2; and 2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-N-((3S,4S)-3-methoxytetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 566.2.


Example E2
Synthesis of Compounds 1025A and 1026A



embedded image


Preparation of N-((3S,4S)-3-fluorotetrahydro-2H-pyran-4-yl)-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of N-(3-(4-bromo-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)-2-methoxy-4-(methylsulfonyl)aniline (50 mg, 97.02 μmol, 1 eq.) and (3S,4S)-3-fluorotetrahydropyran-4-amine (30.19 mg, 194.05 μmol, 2 eq., HCl) in dioxane (6.25 mL) were added NaOtBu (35.43 mg, 368.69 μmol, 3.8 eq.) and RuPhos (14.49 mg, 31.05 μmol, 0.32 eq.). The reaction mixture was stirred at 80° C. for 40 mins. TLC analysis showed no reaction. NaOtBu (35.43 mg, 368.69 μmol, 3.8 eq.) and BrettphosPdG4 (89.31 mg, 97.02 μmol, 1 eq.) were added to the reaction, and the mixture was stirred at 80° C. for another 40 mins. TLC analysis showed that very little starting material remained, and one new major spot for the desired product was detected. EtOAc (20 mL) was poured into the mixture, and the resulting mixture was then poured into a saturated solution of EDTA (30 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL×3), dried over anhydrous sodium sulfate, treated with activated carbon to remove color, filtered, and concentrated in vacuo. The crude residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1) and prep-HPLC to obtain the desired product (105 mg, 189.68 μmol, 32.58% yield) as a yellow solid. MS (ES+, m/z): 554.2.


Preparation of N-[(3S,4S)-3-fluorooxan-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-[(3R,4R)-3-fluorooxan-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: The residue from the previous step was purified by prep-SFC to obtain the desired products as white solids.


N-[(3S,4S)-3-fluorooxan-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (15.4 mg, 27.76 μmol, 14.64% yield), MS (ES+, m/z): 554.2; and N-[(3R,4R)-3-fluorooxan-4-yl]-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (21.2 mg, 38.30 μmol, 20.19% yield), MS (ES+, m/z): 554.2.


Example E3
Synthesis of 3-methoxy-4-((3-(4-((tetrahydro-2H-pyran-4-yl)amino)-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl)amino)benzamide (Compound 1006A)



embedded image


To a solution of 3-methoxy-4-(prop-2-yn-1-ylamino)benzamide (1.1 g, 4.85 mmol, 1.44 eq.) in DMSO (15 mL) were added i-Pr2NH (3.40 g, 33.59 mmol, 4.75 mL, 10 eq.), CuI (639.77 mg, 3.36 mmol, 1 eq.), 2-iodo-N-(tetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1.5 g, 3.36 mmol, 1 eq.), and Pd(PPh3)4 (776.37 mg, 671.85 μmol, 0.2 eq.) in one portion at 25° C. under N2. The mixture was stirred at 25° C. for 1 h. TLC analysis (PE:EtOAc=0:1, Rf=0.36) showed that the reaction was complete. EtOAc (30 mL) was poured into the mixture, and the resulting mixture was poured into a saturated aqueous solution of EDTA (100 mL) and stirred for 15 min. The aqueous phase was extracted with EtOAc (50 mL×2). The organic layer was poured into a saturated aqueous EDTA solution (100 mL) and stirred for 1 h. The aqueous phase was extracted with EtOAc (50 mL×3). The combined organic layers were washed with brine (50 mL×3), dried over anhydrous sodium sulfate, treated with activated carbon, filtered, and concentrated in vacuo. The crude residue was purified by silica gel chromatography (SiO2, PE:EtOAc=1:0 to 0:1) and prep-HPLC to afford the desired product as a yellow solid. MS (ES+, m/z): 501.1.


Example E4
Synthesis of Compounds 997A and 998A



embedded image


embedded image


embedded image


Preparation of 4-bromo-6-fluoro-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indole: To a mixture of NaH (2.80 g, 70.08 mmol, 60% in mineral oil, 3 eq.) in THF (5 mL) at 0° C. was added a solution of 2-(chloromethoxy)ethyl-trimethyl-silane (5.84 g, 35.04 mmol, 6.20 mL, 1.5 eq.) in THF (5 mL). The mixture was stirred at 0° C. for 1 h, and 4-bromo-6-fluoro-1H-indole (5 g, 23.36 mmol, 1 eq.) was added to the reaction. The resulting reaction mixture was stirred at 0° C. for 1 h. TLC analysis (PE:EtOAc=5:1, Rf=0.43) showed that the reaction was complete. The reaction mixture was quenched by adding saturated aqueous NH4Cl (50 mL) and extracting the mixture with EtOAc (200 mL×3). The organic layer was washed with brine (500 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was purified using column chromatography (SiO2, PE:EtOAc=5:1, Rf=0.43) to give the desired product (14 g, 32.12 mmol, 68.76% yield) as a yellow oil. MS (ES+, m/z): 346.0.


Preparation of 6-fluoro-N-(tetrahydro-2H-pyran-4-yl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indol-4-amine: To a solution of tetrahydro-2H-pyran-4-amine (4.87 g, 48.19 mmol, 3 eq.) in toluene (10 mL) were added 4-bromo-6-fluoro-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indole (7 g, 16.06 mmol, 1 eq.), Pd2(dba)3 (2.94 g, 3.21 mmol, 0.20 eq.), NaOtBu (2.01 g, 20.88 mmol, 1.30 eq.), and ditert-butyl-(2-phenylphenyl)phosphine (958.57 mg, 3.21 mmol, 0.20 eq.) at 20° C. The mixture was stirred at 85° C. for 12 h in a sealed tube. LC-MS analysis showed that the starting material was converted to one main product. The reaction mixture was poured into a saturated aqueous solution of EDTA (150 mL) and extracted with EtOAc (200 mL×3). The combined organic layers were stirred with saturated EDTA solution (200 mL) for 1 h. The organic layer was washed with brine (100 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was purified by column chromatography (SiO2, PE:EtOAc=5:1, Rf=0.43) to give the desired product (5.5 g, 9.51 mmol, 59.18% yield) as a yellow oil. MS (ES+, m/z): 365.0.


Preparation of tert-butyl (6-fluoro-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate: To a solution of 6-fluoro-N-(tetrahydro-2H-pyran-4-yl)-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indol-4-amine (5.5 g, 9.51 mmol, 1 eq.) in t-BuOH (30 mL) was added Boc2O (20.75 g, 95.05 mmol, 21.84 mL, 10 eq.) at 20° C. The mixture was stirred at 100° C. for 20 h. LC-MS and HPLC analysis showed that 50% of the product had formed. The reaction mixture was added to water (500 mL) and extracted with EtOAc (200 mL×3). The organic layer was washed with brine (500 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude product was purified by column chromatography (SiO2, PE:EtOAc=5:1, Rf=0.43) to afford the desired product (0.8 g, 1.21 mmol, 12.68% yield) as a yellow oil. MS (ES+, m/z): 469.5.


Preparation of tert-butyl (6-fluoro-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate: To a solution of tert-butyl (6-fluoro-1-((2-(trimethylsilyl)ethoxy)methyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate (1.5 g, 2.10 mmol, 1 eq.) in THF (5 mL) was added TBAF (1 M, 20.98 mL, 10 eq.) at 20° C. The mixture was stirred at 100° C. for 4 h. HPLC analysis showed that the reaction was complete. The reaction mixture was quenched with saturated aqueous solution of NaHCO3 (50 mL) and extracted with EtOAc (100 mL×3). The organic layer was washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was purified by column chromatography (SiO2, PE:EtOAc=4:1) to afford the desired product (0.42 g, 879.23 μmol, 41.90% yield) as a yellow solid.


Preparation of tert-butyl (6-fluoro-1-(phenylsulfonyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate: To a mixture of NaH (100.48 mg, 2.51 mmol, 60% in mineral oil, 3 eq.) in THF (2 mL) at 0° C. was added a solution of tert-butyl (6-fluoro-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate (0.4 g, 837.36 μmol, 1 eq.) in THF (2 mL). The mixture was stirred at 0° C. for 1 h, and benzenesulfonyl chloride (221.84 mg, 1.26 mmol, 160.76 μL, 1.5 eq.) was added to the reaction. The mixture was stirred further at 0° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction was quenched with saturated aqueous solution of NH4Cl (50 mL) and extracted with EtOAc (10 mL×3). The organic layer was washed with brine (5 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was purified by column chromatography (SiO2, PE:EtOAc=2:1) to give the desired product (0.3 g, 606.90 μmol, 72.48% yield) as a yellow solid.


Preparation of tert-butyl (6-fluoro-2-iodo-1-(phenylsulfonyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate: To a solution of tert-butyl (6-fluoro-1-(phenylsulfonyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate (0.11 g, 213.26 μmol, 1 eq.) in THF (3 mL) at −78° C. was added LDA (2 M, 373.20 μL, 3.5 eq.). The mixture was stirred at −78° C. for 1 h, and a solution of I2 (216.51 mg, 853.03 μmol, 171.83 μL, 4 eq.) in THF (2 mL) was added to the reaction. The mixture was stirred further at −78° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding saturated aqueous NH4Cl and extracted the mixture with EtOAc (20 mL×3). The organic layer was washed with brine (5 mL), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The crude product was purified by prep-TLC (PE:EtOAc=1:1) to give the desired product (0.25 g, 416.36 μmol, 65.08% yield) as a yellow solid.


Preparation of tert-butyl (6-fluoro-2-iodo-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate: To a solution of tert-butyl (6-fluoro-2-iodo-1-(phenylsulfonyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate (0.12 g, 199.85 1 eq.) in MeOH (3 mL) was added K2CO3 (110.49 mg, 799.41 μmol, 4 eq.). The mixture was stirred at 60° C. for 2 h. HPLC analysis showed that the reaction was complete. The reaction mixture was added to water (50 mL) and extracted with EtOAc (20 mL×3). The organic layer was washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated to give the crude product (0.16 g, crude) as a yellow solid.


Preparation of tert-butyl (6-fluoro-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate: To a mixture of NaH (28.68 mg, 716.95 60% in mineral oil, 3 eq.) in THF (2 mL) at 0° C. was added a solution of tert-butyl (6-fluoro-2-iodo-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate (0.11 g, 238.98 μmol, 1 eq.) in THF (1 mL). The mixture was stirred at 0° C. for 1 h, and 2,2,2-trifluoroethyl trifluoromethanesulfonate (277.34 mg, 1.19 mmol, 5 eq.) was added to the reaction. The resulting reaction mixture was stirred further at 0° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was quenched by adding saturated aqueous NH4Cl (15 mL) and extracting the mixture with EtOAc (20 mL×3). The organic layer was washed with brine (5 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to afford the crude product (0.11 g, crude) as a yellow solid.


Preparation of tert-butyl (6-fluoro-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate and tert-butyl (6-fluoro-2-(3-((2-methoxy-4-sulfamoylphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate: To a mixture 2-methoxy-4-(methylsulfonyl)-N-(prop-2-yn-1-yl)aniline or 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (2 eq.) and tert-butyl (6-fluoro-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate (0.07 g, 129.08 μmol, 1 eq.) in DMSO (5 mL) were added CuI (1 eq.), Pd(PPh3)4 (0.10 eq.), and N-isopropylpropan-2-amine (1 eq.). The mixture was stirred at 25° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction mixture was poured into water (50 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with saturated aqueous EDTA (20 mL) by stirring the mixture for 1 h. The organic layer was washed with brine (50 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude product was purified by prep-TLC to give the desired products as yellow solids.


Preparation of 6-fluoro-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(oxan-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and 4-[(3-{6-fluoro-4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide: A mixture of tert-butyl (6-fluoro-2-(3-((2-methoxy-4-(methylsulfonyl)phenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate or tert-butyl (6-fluoro-2-(3-((2-methoxy-4-sulfamoylphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)(tetrahydro-2H-pyran-4-yl)carbamate (50 mg, 1 eq.) in 4N HCl/EtOAc (4 mL, 254 eq.) was stirred at 25° C. for 1 h. LC-MS analysis showed that the reaction was complete. The reaction was concentrated to give the crude products.


6-fluoro-2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-(oxan-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 554.1; and 4-[(3-{6-fluoro-4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]-3-methoxybenzene-1-sulfonamide, MS (ES+, m/z): 555.1.


Example E5
Synthesis of Compounds 1016A, 1017A, 1018A, 1019A, 1020A, 1021A, 1027A, 1028A, 1029A, 1030A, 1031A, and 1032A



embedded image


Preparation of 2-iodo-N-(2-methyltetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine and N-((2R,6S)-2,6-dimethyltetrahydro-2H-pyran-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (500 mg, 1 eq.) and 2-methyltetrahydro-4H-pyran-4-one (500 mg, 1 eq.) or (2R,6S)-2,6-dimethyltetrahydro-4H-pyran-4-one (376 mg,2 eq.) in DMF (10 mL) was added TMSCl (399 mg, 2.5 eq.). The mixture was stirred at 0° C. for 1 h, and BH3.THF (379 mg, 3 eq., 1 M) was added to the reaction under N2. The mixture was stirred at 0° C. for 12 h. TLC (PE:EtOAc=5:1, Rf=0.50) indicated the reaction was completed. The reaction mixture was poured into water (150 mL), then extracted with EtOAc (80 mL×3). The combined organic layers was washed with saturated brine (80 mL), filtered and concentrated under reduced pressure to afford the desired compound.


Preparation of final products: To a solution of alkyne (1.2 eq.) in DMSO (5 mL) were added CuI (1 eq.) and i-Pr2NH (10 eq.). The solution was degassed with N2 three times, and 2-iodo-N-(2-methyltetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine or N-((2R,6S)-2,6-dimethyltetrahydro-2H-pyran-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (1 eq.) and Pd(PPh3)4 (0.2 eq.) were added to the solution. The reaction mixture was stirred at 25° C. for 2 h. TLC analysis showed that the starting material was consumed completely, and one main peak with the desired mass was detected. The reaction mixture was diluted with EtOAc (5 mL), and the resulting mixture was poured into saturated aqueous EDTA (30 mL) and stirred for 1 h. The mixture was then extracted with EtOAc (15 mL×2). The combined organic layers were washed with brine (10 mL) and concentrated under reduced pressure. The crude residue was purified by prep-TLC to afford the desired products.


3-methoxy-4-{[3-(4-{[(2S,4R)-2-methyloxan-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 515.2; 3-methoxy-4-{[3-(4-{[(2S,4S)-2-methyloxan-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 515.2; 3-methoxy-4-{[3-(4-{[(2S,4R)-2-methyloxan-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 551.2; 3-methoxy-4-{[3-(4-{[(2S,4S)-2-methyloxan-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 551.2; 3-methoxy-4-{[3-(4-{[(2R,4S,6S)-2,6-dimethyloxan-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 529.2; 3-methoxy-4-{[3-(4-{[(2R,4R,6S)-2,6-dimethyloxan-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzamide, MS (ES+, m/z): 529.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(2R,4S,6S)-2,6-dimethyloxan-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 564.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(2R,4R,6S)-2,6-dimethyloxan-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 564.2; 3-methoxy-4-{[3-(4-{[(2R,4S,6S)-2,6-dimethyloxan-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 565.2; and 3-methoxy-4-{[3-(4-{[(2R,4R,6S)-2,6-dimethyloxan-4-yl]amino}-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl)prop-2-yn-1-yl]amino}benzene-1-sulfonamide, MS (ES+, m/z): 565.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(2S,4S)-2-methyloxan-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 550.2; 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-N-[(2S,4R)-2-methyloxan-4-yl]-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 550.2.


Example E6
General Procedure for Preparation of Compounds 1010A and 1012A



embedded image


Synthesis of 5-methoxy-4-nitro-1-(phenylsulfonyl)-1H-indole: In each of two separate, identical batches, a solution of 5-methoxy-4-nitro-1H-indole (2 g, 10.41 mmol, 1 eq.) in THF (1 mL) was added to a mixture of NaH (1.25 g, 31.22 mmol, 60% in mineral oil, 3 eq.) and THF (3 mL) at 0° C. The mixture was stirred for 1 h at 0° C., and then added benzenesulfonyl chloride (2.76 g, 15.61 mmol, 2 mL, 1.5 eq.) was added. The mixture was stirred for an additional 1 h at 0° C., after which time TLC (PE:EtOAc=4:1, Rf=0.43) indicated that the reaction was complete. The batches were combined, and the resulting mixture was quenched by addition of saturated aqueous NH4Cl (20 mL) at 0° C., and then diluted with EtOAc (20 mL) and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was washed with PE (20 mL) to provide 5-methoxy-4-nitro-1-(phenylsulfonyl)-1H-indole (7 g, 16.85 mmol, 80.96% yield) as a yellow solid, which was used directly in the next step without further purification.


Synthesis of 2-iodo-5-methoxy-4-nitro-1-(phenylsulfonyl)-1H-indole: To each of two separate, identical batches containing a mixture of 5-methoxy-4-nitro-1-(phenylsulfonyl)-1H-indole (0.5 g, 1.20 mmol, 1 eq.) in THF (30 mL) at −78° C. was added lithium diisopropylamide (2 M, 2.41 mL, 4 eq.). The mixture was stirred 1 h at −78° C. under N2. I2 (1.22 g, 4.81 mmol, 969.81 μL, 4 eq.) in THF (13 mL) was then added, and the mixture was stirred for an additional 1 h at −78° C. under N2. The batches were then combined, and the resulting mixture was poured into saturated aqueous NH4Cl solution (25 mL) and stirred for 5 min, and then extracted with EtOAc (25 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by prep-TLC (SiO2, PE:EtOAc=4:1) to provide 2-iodo-5-methoxy-4-nitro-1-(phenylsulfonyl)-1H-indole (0.7 g, 763.81 μmol, 31.73% yield) as a yellow solid.


Synthesis of 2-iodo-5-methoxy-4-nitro-1H-indole: A mixture of 2-iodo-5-methoxy-4-nitro-1-(phenylsulfonyl)-1H-indole (0.7 g, 763.81 μmol, 1 eq.) and K2CO3 (316.69 mg, 2.29 mmol, 3 eq.) in MeOH (5 mL) was stirred at 70° C. for 2 h, after which time LC-MS analysis indicated that the reaction was complete. The residue was poured into water (25 mL), stirred for 5 min, and then extracted with EtOAc (25 mL×3). The combined organic layers were washed with brine (20 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated in vacuo. The residue was purified by column chromatography (SiO2, PE:EtOAc=4:1, Rf=0.31) to provide 2-iodo-5-methoxy-4-nitro-1H-indole (0.1 g, 251.52 μmol, 32.93% yield) as a yellow solid.


Synthesis of 2-iodo-5-methoxy-4-nitro-1-(2,2,2-trifluoroethyl)-1H-indole: To a mixture of NaH (30.18 mg, 754.56 μmol, 60% in mineral oil, 3 eq.) in THF (2 mL) at 0° C. was added 2-iodo-5-methoxy-4-nitro-1H-indole (0.1 g, 251.52 μmol, 1 eq.) in THF (2 mL). The mixture was stirred for 1 h at 0° C., and 2,2,2-trifluoroethyl trifluoromethanesulfonate (291.89 mg, 1.26 mmol, 5 eq.) was added. The mixture was stirred at 0° C. for an additional 1 h, after which time TLC analysis (PE:EtOAc=1:1, Rf=0.43) indicated that the reaction was complete. The reaction mixture was then quenched by adding saturated aqueous NH4Cl (20 mL) at 0° C., diluted with EtOAc (20 mL), and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to provide 2-iodo-5-methoxy-4-nitro-1-(2,2,2-trifluoroethyl)-1H-indole (0.1 g, crude) as a yellow solid. The crude residue was used directly in the next step.


Synthesis of 2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of 2-iodo-5-methoxy-4-nitro-1-(2,2,2-trifluoroethyl)-1H-indole (0.1 g, 249.94 μmol, 1 eq.) in EtOH (5 mL) and water (1 mL) was added saturated aqueous NH4Cl (66.85 mg, 1.25 mmol, 43.69 μL, 5 eq.). The mixture was heated to 70° C., and Fe (69.79 mg, 1.25 mmol, 5 eq.) was added. The mixture stirred at 70° C. for 1 h, after which time LC-MS analysis indicated that the reaction was complete. water (20 mL) was added, and then the mixture was extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (20 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1 Rf=0.43) to provide 2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.035 g, 80.38 μmol, 32.16% yield) as a yellow solid.




embedded image


Synthesis of 2-iodo-5-methoxy-N-(tetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of tetrahydropyran-4-one (24.14 mg, 241.15 μmol, 22.15 μL, 3 eq.) and 2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.035 g, 80.38 μmol, 1 eq.) in DMF (2 mL) was added TMSCl (21.83 mg, 200.95 μmol, 25.50 μL, 2.5 eq.). The mixture was cooled to 0° C., and BH3.THF (1 M, 200.95 μL, 2.5 eq.) was then added under N2. The mixture was stirred at 0° C. for 1 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched by adding water (100 mL) at 0° C. and then extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1, Rf=0.28) to provide 2-iodo-5-methoxy-N-(tetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.03 g, 56.14 μmol, 69.84% yield) as a yellow solid.


Preparation of final products: 2-iodo-5-methoxy-N-(tetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine was coupled to the R-substituted alkynes specified above according to the general procedure specified in EXAMPLE C51. In each case, the reactions were deemed complete after stirring for 1 h at 30° C., and the crude compounds were first purified by prep-TLC and further purified by prep-HPLC.


3-methoxy-4-[(3-{5-methoxy-4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide, MS (ES+, m/z): 567.3; and 2-{3-[(4-methanesulfonyl-2-methoxyphenyl)amino]prop-1-yn-1-yl}-5-methoxy-N-(oxan-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine, MS (ES+, m/z): 566.2.


Example E7
Preparation of Compound 1013A



embedded image


2-iodo-6-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine was prepared via an analogous procedure to the synthesis of 2-iodo-5-methoxy-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine according to Example E6, using 6-methoxy-4-nitro-1H-indole in place of 5-methoxy-4-nitro-1H-indole.




embedded image


Synthesis of 2-iodo-6-methoxy-N-(tetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine: To a mixture of tetrahydropyran-4-one (27.59 mg, 275.59 μmol, 25.31 μL, 3 eq.) and 2-iodo-6-methoxy-1-(2,2,2-trifluoroethyl)indol-4-amine (0.04 g, 91.86 μmol, 1 eq.) in DMF (2 mL) was added TMSCl (24.95 mg, 229.66 μmol, 29.15 μL, 2.5 eq.). The mixture was cooled to 0° C., and BH3.THF (1 M, 229.66 μL, 2.5 eq.) was then added under N2. The mixture was stirred at 0° C. for 1 h, after which time LC-MS analysis indicated that the reaction was complete. The reaction mixture was quenched by adding water (100 mL) at 0° C., and then extracted with EtOAc (30 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=4:1, Rf=0.44) to provide 2-iodo-6-methoxy-N-(tetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.035 g, 61.64 μmol, 67.10% yield) as a yellow solid.


Preparation of final product: To a mixture of 3-methoxy-4-(prop-2-yn-1-ylamino)benzenesulfonamide (24.45 mg, 91.58 μmol, 1.3 eq.) and 2-iodo-6-methoxy-N-(tetrahydro-2H-pyran-4-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-amine (0.04 g, 70.45 μmol, 1 eq.) in DMSO (2 mL) was added CuI (13.42 mg, 70.45 μmol, 1 eq.), followed by Pd(PPh3)4 (8.14 mg, 7.04 μmol, 0.10 eq.) and diisopropylamine (7.13 mg, 70.45 μmol, 9.96 μL, 1 eq.). The mixture was stirred at 30° C. for 1 h under N2, after which time TLC analysis (PE:EtOAc=1:1, Rf=0.23) indicated that the reaction was complete. The reaction mixture was quenched by adding a saturated aqueous solution of EDTA (30 mL) and EtOAc (10 mL), stirred at 25° C. for 1 h, and extracted with EtOAc (20 mL×3). The combined organic layers were washed with brine (30 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The residue was purified by prep-TLC (SiO2, PE:EtOAc=0:1, Rf=0.24), then further purified by prep-HPLC to provide 3-methoxy-4-[(3-{6-methoxy-4-[(oxan-4-yl)amino]-1-(2,2,2-trifluoroethyl)-1H-indol-2-yl}prop-2-yn-1-yl)amino]benzene-1-sulfonamide (0.0155 g, 26.59 μmol, 37.74% yield) as white solid. MS (ES+, m/z): 567.0.


TABLE 5 shows compounds with a 2-ethynyl-N-(tetrahydropyran-4-yl)-1H-indole-4-amine core.












TABLE 5





Com-


LC-MS


pound


(ES+,


No.
Structure
IUPAC
m/z)







 991A


embedded image


2-(3-{[4-methanesulfonyl-2- (trifluoromethoxy)phenyl]amino} prop-1-yn-1-yl)-N-(oxan-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
590.3





 992A


embedded image


3-methoxy-4-[(3-{4-[(oxan-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-N-(1,2-oxazol-3- yl)benzene-1-sulfonamide
604.2





 993A


embedded image


3-methoxy-N-(oxan-4-yl)-4-[(3-{4- [(oxan-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino]benzene-1- sulfonamide
621.3





 994A


embedded image


3-methoxy-N-(5-methyl-1,2- oxazol-3-yl)-4-[(3-{4-[(oxan-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]benzene-1-sulfonamide
618.2





 995A


embedded image


2-{4-methoxy-5-[(3-{4-[(oxan-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]pyridin-2-yl}-2- methylpropanenitrile
526.2





 996A


embedded image


N-(2-hydroxyethyl)-3-methoxy-N- methyl-4-[(3-{4-[(oxan-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]benzene-1-sulfonamide
595.2





 997A


embedded image


6-fluoro-2-{3-[(4-methanesulfonyl- 2-methoxyphenyl)amino]prop-1- yn-1-yl}-N-(oxan-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
554.1





 998A


embedded image


4-[(3-{6-fluoro-4-[(oxan-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxybenzene-1- sulfonamide
555.1





 999A


embedded image


3-methoxy-N,N-dimethyl-4-[(3-{4- [(oxan-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino]benzene-1- sulfonamide
565.2





1000A


embedded image


3-methoxy-N-(2-methoxyethyl)-N- methyl-4-[(3-{4-[(oxan-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]benzene-1-sulfonamide
609.2





1001A


embedded image


1-(4-{3-methoxy-4-[(3-{4-[(oxan- 4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino] benzenesulfonyl}piperazin- 1-yl)ethan-1-one
648.2





1002A


embedded image


2-(3-{[2-methoxy-4-(morpholine- 4-sulfonyl)phenyl]amino}prop-1- yn-1-yl)-N-(oxan-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
607.2





1003A


embedded image


3-methoxy-N-methyl-4-[(3-{4- [(oxan-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino]benzamide
515.2





1004A


embedded image


3-methoxy-4-((3-(4-((tetrahydro- 2H-pyran-4-yl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl)amino)benzoic acid
502.2





1005A


embedded image


methyl 3-methoxy-4-((3-(4- ((tetrahydro-2H-pyran-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)benzoate
516.2





1006A


embedded image


3-methoxy-4-((3-(4-((tetrahydro- 2H-pyran-4-yl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl)amino)benzamide
501.1





1007A


embedded image


N,N-bis(2-hydroxyethyl)-3- methoxy-4-[(3-{4-[(oxan-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]benzene-1-sulfonamide
625.2





1008A


embedded image


3-methoxy-N-methyl-4-[(3-{4- [(oxan-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino]benzene-1- sulfonamide
551.2





1009A


embedded image


5-methanesulfonyl-2-[(3-{4- [(oxan-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino]phenol
522.1





1010A


embedded image


3-methoxy-4-[(3-{5-methoxy-4- [(oxan-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino]benzene-1- sulfonamide
567.3





1011A


embedded image


2-[3-({2-methoxy-4-[(4- methylpiperazin-1- yl)sulfonyl]phenyl}amino)prop-1- yn-1-yl]-N-(oxan-4-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
620.4





1012A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn- 1-yl}-5-methoxy-N-(oxan-4-yl)-1- (2,2,2-trifluoroethyl)-1H-indol-4- amine
566.2





1013A


embedded image


3-methoxy-4-[(3-{6-methoxy-4- [(oxan-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino]benzene-1- sulfonamide
567.0





1014A


embedded image


5-methanesulfonyl-2-[(3-{4- [(oxan-4-yl)amino]-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl}prop- 2-yn-1-yl)amino]phenyl propanoate
578.2





1015A


embedded image


N-(2-hydroxyethyl)-3-methoxy-4- ((3-(4-((tetrahydro-2H-pyran-4- yl)amino)-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl)prop-2-yn-1- yl)amino)benzenesulfonamide
581.2





1016A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn- 1-yl}-N-[(2S,4R)-2-methyloxan-4- yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
550.2





1017A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn- 1-yl}-N-[(2S,4S)-2-methyloxan-4- yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
550.2





1018A


embedded image


3-methoxy-4-{[3-(4-{[(2S,4R)-2- methyloxan-4-yl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino}benzene-1- sulfonamide
551.2





1019A


embedded image


3-methoxy-4-{[3-(4-{[(2S,4S)-2- methyloxan-4-yl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino}benzene-1- sulfonamide
551.2





1020A


embedded image


3-methoxy-4-{[3-(4-{[(2S,4R)-2- methyloxan-4-yl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino}benzamide
515.2





1021A


embedded image


3-methoxy-4-{[3-(4-{[(2S,4S)-2- methyloxan-4-yl]amino}-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl]amino}benzamide
515.2





1022A


embedded image


rac-N-[(3R,4R)-3-fluorooxan-4-yl]- 2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
553.9





1023A


embedded image


2-(3-((2-methoxy-4-(methyl- sulfonyl)phenyl)amino)prop- 1-yn-1-yl)-N-((3R,4S)-3- methoxytetrahydro-2H-pyran-4- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
566.2





1024A


embedded image


2-(3-((2-methoxy-4-(methyl- sulfonyl)phenyl)amino)prop- 1-yn-1-yl)-N-((3S,4S)-3- methoxytetrahydro-2H-pyran-4- yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
566.2





1025A


embedded image


N-[(3S,4S)-3-fluorooxan-4-yl]-2- {3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
554.2





1026A


embedded image


N-[(3R,4R)-3-fluorooxan-4-yl]-2- {3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-amine
554.2





1027A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn- 1-yl}-N-[(2R,4R,6S)-2,6- dimethyloxan-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
564.2





1028A


embedded image


2-{3-[(4-methanesulfonyl-2- methoxyphenyl)amino]prop-1-yn- 1-yl}-N-[(2R,4S,6S)-2,6- dimethyloxan-4-yl]-1-(2,2,2- trifluoroethyl)-1H-indol-4-amine
564.2





1029A


embedded image


3-methoxy-4-{[3-(4-{[(2R,4R,6S)- 2,6-dimethyloxan-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
529.2





1030A


embedded image


3-methoxy-4-{[3-(4-{[(2R,4S,6S)- 2,6-dimethyloxan-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1- yl]amino}benzamide
529.2





1031A


embedded image


3-methoxy-4-{[3-(4-{[(2R,4S,6S)- 2,6-dimethyloxan-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}benzene- 1-sulfonamide
565.2





1032A


embedded image


3-methoxy-4-{[3-(4-{[(2R,4R,6S)- 2,6-dimethyloxan-4-yl]amino}-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl)prop-2-yn-1-yl]amino}benzene- 1-sulfonamide
565.2







text missing or illegible when filed








F. Compounds with 4-((2-ethynyl-1H-indol-4-yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide Core
Example F1
Synthesis of 4-((2-(3-((4-methoxypyridin-3-yl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide (Compound 1033A)



embedded image


4-Methoxy-N-prop-2-ynyl-pyridin-3-amine was prepared using the method described in EXAMPLE D1.


To a solution of N-(1,1-dioxothian-4-yl)-2-iodo-1-(2,2,2-trifluoroethyl)indol-4-amine (70 mg, 148.22 μmol, 1 eq.) in DMSO (3 mL) were added 4-methoxy-N-prop-2-ynyl-pyridin-3-amine (36.06 mg, 222.34 μmol, 1.50 eq.), CuI (28.23 mg, 148.22 μmol, 1 eq.), Pd(PPh3)4 (17.13 mg, 14.82 μmol, 0.10 eq.), and N-isopropylpropan-2-amine (89.99 mg, 889.34 μmol, 124.99 μL, 6 eq.). The mixture was stirred at 40° C. for 2 h. The reaction mixture was quenched with saturated aqueous EDTA (20 mL) and stirred for 2 h. Then, EtOAc (20 mL) was added to the mixture. The organic phase was separated, washed with water (10 mL), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The crude residue was purified by prep-HPLC to afford N-(1,1-dioxothian-4-yl)-2-[3-[(4-methoxy-3-pyridyl)amino]prop-1-ynyl]-1-(2,2,2-trifluoroethyl)indol-4-amine (5 mg, 9.87 μmol, 6.66% yield) as a white solid. MS (ES+, m/z): 507.1.


Example F2
Synthesis of 4-((2-(3-((4-methoxy-6-(methylsulfonyl)pyridin-3-yl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide (Compound 1050A)



embedded image


4-Methoxy-6-(methylsulfonyl)-N-(prop-2-yn-1-yl)pyridin-3-amine was prepared using the method described in EXAMPLE D47.


A solution of 4-methoxy-6-(methylsulfonyl)-N-(prop-2-yn-1-yl)pyridin-3-amine (35.16 mg, 127.05 μmol, 1.2 eq., HCl) in DMSO (2 mL) was flushed with N2. CuI (20.16 mg, 105.87 μmol, 1 eq.) and N-isopropyl amine (32.14 mg, 317.62 μmol, 44.89 μL, 3 eq.) were added to the mixture. 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide (50 mg, 105.87 μmol, 1 eq.) and Pd(PPh3)4 (9.79 mg, 8.47 μmol, 0.08 eq.) were added, and the resulting mixture was flushed again with N2. The resulting reaction mixture was stirred at 45° C. for 2 h. LC-MS analysis showed that the starting material was consumed completely, and one main peak with the desired mass was detected. Saturated aqueous EDTA (20 mL) was added, and the mixture was stirred at 15° C. for 1 h. The reaction mixture was partitioned by adding saturated aqueous EDTA (20 mL) and EtOAc (20 mL). The organic phase was separated, washed with brine (5 mL×3), dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure to give a residue. The residue was purified by prep-HPLC to afford the desired product (7.8 mg, 13.34 μmol, 12.60% yield) as a white solid. MS (ES+, m/z): 585.0.


Example F3
Procedure for Preparation of Compound 1047A



embedded image


Synthesis of 6-((3-methoxy-4-nitrophenyl)sulfonyl)-2-oxa-6-azaspiro[3.3]heptane: To a solution of 2-oxa-6-azaspiro[3.3]heptane (451.03 mg, 2.38 mmol, 1.2 eq.) in DCM (5 mL) was TEA (402.12 mg, 3.97 mmol, 553.12 μL, 2 eq.), followed by 3-methoxy-4-nitrobenzenesulfonyl chloride (500 mg, 1.99 mmol, 1 eq.) at 0° C. The temperature was slowly increased to 25° C. and stirred for 16 h, after which time TLC analysis (PE:EtOAc=2:1, Rf=0.43) indicated that the starting sulfonyl chloride was consumed. The reaction mixture was quenched by adding water (40 mL) at 25° C., and then extracted with EtOAc (40 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by column chromatography (SiO2, PE:EtOAc=5:1 to 1:1) to afford 6-((3-methoxy-4-nitrophenyl)sulfonyl)-2-oxa-6-azaspiro[3.3]heptane (550 mg, 1.57 mmol, 39.63% yield) as a yellow solid.


Synthesis of 4-((2-oxa-6-azaspiro[3.3]heptan-6-yl)sulfonyl)-2-methoxyaniline: A solution of 6-((3-methoxy-4-nitrophenyl)sulfonyl)-2-oxa-6-azaspiro[3.3]heptane (550 mg, 1.57 mmol, 1 eq.) and NH4Cl (421.21 mg, 7.87 mmol, 275.30 μL, 5 eq.) in EtOH (10 mL) and water (2 mL) was added into Fe (879.48 mg, 15.75 mmol, 10 eq.) at 70° C. and stirred for 2 h, after which time LC-MS analysis indicated that the starting nitro compound was consumed, and one main peak with the desired product mass was detected. The mixture was filtered, diluted with water (100 mL), and extracted with EtOAc (30 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The brown solid residue containing 4-((2-oxa-6-azaspiro[3.3]heptan-6-yl)sulfonyl)-2-methoxyaniline (450 mg, 1.35 mmol, 85.42% yield) was used into the next step without further purification.


Synthesis of 4-((2-oxa-6-azaspiro[3.3]heptan-6-yl)sulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline: To a solution of propargyl bromide (355.63 mg, 2.99 mmol, 257.70 μL, 20 eq.) in DMF (2 mL) was added 4-((2-oxa-6-azaspiro[3.3]heptan-6-yl)sulfonyl)-2-methoxyaniline (50 mg, 149.47 μmol, 1 eq.) and K2CO3 (41.32 mg, 298.95 μmol, 2 eq.). The mixture was stirred at 70° C. for 12 h. LC-MS analysis indicated that 80% of the starting primary amine was consumed, and one main peak with the desired product mass was detected. The reaction mixture was quenched by adding water (40 mL) at 25° C., and then extracted with EtOAc (10 mL×3). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (SiO2, PE:EtOAc=1:1, Rf=0.32) to provide 4-((2-oxa-6-azaspiro[3.3]heptan-6-yl)sulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline (40 mg, 111.67 μmol, 74.71% yield) as a light yellow solid.


Preparation of final product: To a solution of 4-((2-iodo-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide (50 mg, 105.87 μmol, 1 eq.) and 4-((2-oxa-6-azaspiro[3.3]heptan-6-yl)sulfonyl)-2-methoxy-N-(prop-2-yn-1-yl)aniline (40 mg, 111.67 μmol, 1.05 eq.) in DMSO (3 mL) was added CuI (20.16 mg, 105.87 μmol, 1 eq.) and diisopropylamine (10.71 mg, 105.87 μmol, 14.96 μL, 1 eq.), followed by Pd(PPh3)4 (2.45 mg, 2.12 μmol, 0.02 eq.) under N2. The reaction mixture was then stirred for 1 h at 25° C., after which time LC-MS analysis indicated that the starting iodoindole was completely consumed, and one main peak with the desired product mass was detected. The reaction mixture was quenched by adding saturated aqueous EDTA (60 mL), stirring the mixture at 25° C. for 1 h, and then extracting the mixture with EtOAc (20 mL×4). The combined organic layers were dried over anhydrous sodium sulfate, filtered, and concentrated under reduced pressure. The resulting residue was purified by prep-TLC (SiO2, EtOAc:MeOH=2:1, Rf=0.30), and further purified by prep-HPLC to afford 4-((2-(3-((4-42-oxa-6-azaspiro[3.3]heptan-6-yl)sulfonyl)-2-methoxyphenyl)amino)prop-1-yn-1-yl)-1-(2,2,2-trifluoroethyl)-1H-indol-4-yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide (8.8 mg, 13.20 μmol, 12.47% yield) as a light yellow solid. MS (ES+, m/z): 667.1.


TABLE 6 shows compounds with a 4-((2-ethynyl-1H-indol-4-yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide core.












TABLE 6





Com-


LC-MS


pound


(ES+,


No.
Structure
IUPAC
m/z)







1033A


embedded image


4-((2-(3-((4-methoxypyridin-3- yl)amino)prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide
507.1





1034A


embedded image


2-{5-[(3-{4-[(1,1-dioxo-1λ6-thian-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-4-methoxypyridin-2-yl}- 2-methylpropanenitrile
574.2





1035A


embedded image


4-{[2-(3-{[4-methanesulfonyl-2- (trifluoromethoxy)phenyl]amino} prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl]amino}-1λ6-thiane-1,1-dione
638.1





1036A


embedded image


4-{[2-(3-{[2-methoxy-4- (morpholine-4- sulfonyl)phenyl]amino}prop-1-yn- 1-yl)-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl]amino}-1λ6-thiane-1,1- dione
655.3





1037A


embedded image


4-({2-[3-({2-[2- (dimethylamino)ethoxy]-4- methanesulfonylphenyl}amino) prop-1-yn-1-yl]-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl}amino)-1λ6-thiane- 1,1-dione
641.2





1038A


embedded image


4-[(3-{4-[(1,1-dioxo-1λ6-thian-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-N-(2-hydroxyethyl)-3- methoxy-N-methylbenzene-1- sulfonamide
643.1





1039A


embedded image


4-[(3-{4-[(1,1-dioxo-1λ6-thian-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxy-N-(1,2- oxazol-3-yl)benzene-1-sulfonamide
652.1





1040A


embedded image


4-[(3-{4-[(1,1-dioxo-1λ6-thian-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxy-N-(5-methyl- 1,2-oxazol-3-yl)benzene-1- sulfonamide
666.2





1041A


embedded image


4-[(3-{4-[(1,1-dioxo-1λ6-thian-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxy-N-(oxan-4- yl)benzene-1-sulfonamide
669.1





1042A


embedded image


N-(2,3-dihydroxypropyl)-4-[(3-{4- [(1,1-dioxo-1λ6-thian-4-yl)amino]-1- (2,2,2-trifluoroethyl)-1H-indol-2- yl}prop-2-yn-1-yl)amino]-3- methoxybenzene-1-sulfonamide
659.1





1043A


embedded image


N-[2-(dimethylamino)ethyl]-4-[(3- {4-[(1,1-dioxo-1λ6-thian-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxy-N- methylbenzene-1-sulfonamide
670.2





1044A


embedded image


4-[(3-{4-[(1,1-dioxo-1λ6-thian-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxy-N,N- dimethylbenzene-1-sulfonamide
613.1





1045A


embedded image


4-({2-[3-({4-[(4-acetylpiperazin-1- yl)sulfonyl]-2- methoxyphenyl}amino)prop-1-yn-1- yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl}amino)-1λ6-thiane-1,1- dione
696.2





1046A


embedded image


4-[(3-{4-[(1,1-dioxo-1λ6-thian-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxy-N-(2- methoxyethyl)-N-methylbenzene-1- sulfonamide
657.2





1047A


embedded image


4-[(2-{3-[(2-methoxy-4-{2-oxa-6- azaspiro[3.3]heptane-6- sulfonyl}phenyl)amino]prop-1-yn- 1-yl}-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl)amino]-1λ6-thiane-1,1- dione
667.1





1048A


embedded image


4-({2-[3-({2-methoxy-4-[(4- methylpiperazin-1- yl)sulfonyl]phenyl}amino)prop-1- yn-1-yl]-1-(2,2,2-trifluoroethyl)-1H- indol-4-yl}amino)-1λ6-thiane-1,1- dione
668.2





1049A


embedded image


4-[(3-{4-[(1,1-dioxo-1λ6-thian-4- yl)amino]-1-(2,2,2-trifluoroethyl)- 1H-indol-2-yl}prop-2-yn-1- yl)amino]-3-methoxy-N- methylbenzamide
563.2





1050A


embedded image


4-((2-(3-((4-methoxy-6- (methylsulfonyl)pyridin-3- yl)amino)prop-1-yn-1-yl)-1-(2,2,2- trifluoroethyl)-1H-indol-4- yl)amino)tetrahydro-2H-thiopyran 1,1-dioxide






1051A


embedded image


4-((2-(3-((4-(methylsulfonyl)-2- (2,2,2- trifluoroethoxy)phenyl)amino)prop- 1-yn-1-yl)-1-(2,2,2-trifluoroethyl)- 1H-indol-4-yl)amino)tetrahydro-2H- thiopyran 1,1-dioxide
652.1





1052A


embedded image


2-(2-((3-(4-((1,1-dioxidotetrahydro- 2H-thiopyran-4-yl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl)amino)-5- (methylsulfonyl)phenoxy)acetamide
627.2





1053A


embedded image


2-(2-((3-(4-((1,1-dioxidotetrahydro- 2H-thiopyran-4-yl)amino)-1-(2,2,2- trifluoroethyl)-1H-indol-2-yl)prop- 2-yn-1-yl)amino)-5- (methylsulfonyl)phenoxy)acetamide
629.2









Example G
In Vitro DNA Binding Activity Assay

The ability of a compound of the invention to stabilize p53 Y220C and increase the DNA binding activity of p53 Y220C was measured by a homogeneous time-resolved fluorescence (HTRF) assay. Recombinant His-tagged p53 Y220C used in the HTRF assay was expressed in the bacterium E. coli. The recombinant protein was a truncation mutant containing only amino acids 94-312 of p53, which encompassed the DNA binding domain (DBD) of p53 (SEQ ID NO.: 1). The His tagged p53 Y220C was tested for DNA binding ability with a consensus sequence of DNA (DNA duplex with a sequence of 5′-ATTAGGCATGTCTAGGCATGTCTAGG-3′; SEQ ID NO.: 2). SEQ ID NO.: 2 was then conjugated with a biotin label and used in the activity assay.


The binding of the recombinant His-tagged p53 Y220C protein and the biotin-labeled consensus DNA was measured using fluorescence resonance energy transfer (FRET). For the FRET assay, the binding between the p53 mutant and the DNA sequence was measured by detecting the fluorescence of the interaction between an anti-His antibody conjugated to allophycocyanin (APC) and streptavidin conjugated to europium to detect the biotin-labeled DNA.


The test compounds were prepared as 4.5 mM stock solutions in dimethylsulfoxide (DMSO). The compounds of the disclosure were used to test the stabilization of p53 Y220C and increase in DNA binding activity of p53 Y220C. The stock solutions were then serially diluted 3-fold in DMSO, and 1.2 μL of the diluted solutions was added to each well of a 384-well polypropylene black plate. 30 μL of a 181 nM solution of the recombinant His-tagged p53 Y220C protein and 12.1 nM of APC conjugated anti-His tag antibody in ice-cold Assay Buffer 1 (50 mM Tris-HCl, pH 7.4; 75 mM KCl; 0.75 mM DTT; and 0.2 mg/mL bovine serum albumin (BSA) was added to each well containing the test compounds.


As a background control, 30 μL of Assay Buffer 1 containing 12.1 nM of APC anti-His antibody was also added into a second set of serially-diluted compound plates. The test and control samples were spun at 1200 rpm for 1 minute and incubated at room temperature for 15 minutes. The samples were then further incubated at either 27° C. or 29° C. for 60 min. Five microliters of 311 nM biotin labeled consensus DNA (SEQ ID NO.: 2) and 13.03 nM europium-conjugated streptavidin in Assay Buffer 2 (50 mM Tris-HCl, pH 7.4; 75 mM KCl; and 0.2 mg/mL BSA) were added to each well for both the test and control plates. The plates were spun at 1200 rpm for 1 minute and incubated at room temperature for 20 minutes. The assay signals were monitored by reading excitation at 340 nm, and emission fluorescence at 615 nm and 665 nm on a plate reader.


Normalized time-resolved fluorescence resonance energy transfer (TR-FRET) assay signal (Rn) was calculated by the formula:






R
n=[(A−Ba−CD)/(D−Bd)](Dc−Bd)

  • where A was the fluorescence intensity of the sample at 665 nm;
  • D was the fluorescence intensity of the sample at 615 nm;
  • Ba and Bd were plate background readings at 665 nm and 615 nm, respectively; and
  • Dc was the fluorescence intensity of 1.8 nM Eu-SA in the assay buffer at 615 nm.


The cross talk factor (C) was determined by the following formula:






C=(Ac−Ba)/(Dc−Bd)


where Ac was the fluorescence intensity of 1.8 nM Eu-labeled anti-FLAG antibody in the assay buffer at 665 nm.


The percentage of activation of protein DNA binding in the presence of a compound of the invention compared to the absence of the compound was denoted by a SC150 value, which indicated the concentration of the compound required to increase the DNA binding activity by 50%. The SC150 values were calculated using either Prism™ or ActivityBase™.









TABLE 7





Compound Number/SC150 (μM)


















 1A
+++



 2A
++



 3A
++++



 4A
+



 5A
++++



 6A
++++



 7A
++++



 8A
++++



 9A
++++



 10A
++++



 11A
++++



 12A
+



 13A
++++



 14A
++++



 15A
++++



 16A
++++



 17A
++++



 18A
+



 19A
+



 20A
+



 21A
+



 22A
+



 23A
+



 24A
+



 25A
+



 26A
+



 27A
+



 28A
++



 29A
+



 30A
+



 31A
+



 32A
+



 33A
+



 34A
+



 35A
+



 36A
+++



 37A
+



 39A
+



 41A
+



 43A
+



 44A
+



 45A
+



 48A
+



 49A
+



 50A
+



 51A
+



 54A
+



 55A
+



 56A
+



 57A
+



 58A
+



 61A
+



 62A
+



 63A
+



 64A
+



 65A
+



 66A
+



 67A
+



 68A
+



 69A
+



 70A
+



 71A
+



 72A
+



 73A
+



 74A
+



 75A
++



 76A
+



 77A
++++



 78A
+++



 79A
+



 80A
+



 81A
+



 82A
+



 83A
+



 84A
++



 85A
+



 86A
+



 87A
+



 88A
+



 89A
+



 92A
+



 93A
+



 94A
+++



 95A
+



 96A
++



 97A
+



 98A
+



 99A
+



100A
+



101A
+



102A
+



103A
+



104A
+



105A
+



106A
+



107A
+



108A
++



109A
+



110A
+



111A
++++



112A
+++



113A
+



114A
+



115A
++



117A
+



119A
+



120A
+



121A
+



123A
+



125A
++++



127A
+



130A
+



132A
+



134A
+



136A
+



138A
+++



139A
+



140A
+



142A
+



144A
+



146A
+



148A
+



149A
+



150A
+



151A
+



152A
+



153A
+



155A
+



157A
+



160A
+



162A
+



164A
+



165A
+



166A
+



168A
+



170A
+



171A
+



172A
+



173A
+



174A
+



175A
++



176A
+



177A
+



178A
+



179A
++



180A
+



183A
+



185A
+



186A
+



187A
+



188A
+



190A
+



192A
+



194A
+



196A
+



198A
+



202A
+



203A
+



204A
+



205A
+



206A
+



207A
+



208A
+



209A
+



210A
+



212A
+



213A
+



214A
+



215A
+



218A
++++



220A
+



221A
+



222A
+



223A
+



224A
+



225A
+



226A
+



228A
+



229A
+



230A
+



231A
+



232A
+



233A
++



234A
+



235A
+



236A
+



237A
+



238A
+



239A
+



240A
+



241A
+



242A
+



243A
+



244A
++



245A
+



248A
+



249A
+



250A
+



251A
+



253A
+



255A
+



257A
+



259A
+



261A
+



263A
+



265A
+



267A
+



269A
+



273A
+



275A
+



277A
++



279A
+



281A
+



283A
+



285A
+



287A
+



289A
+



293A
+



294A
+



295A
+



296A
+



297A
+



298A
+



299A
+



300A
+



301A
+



303A
+



304A
+



305A
+



307A
+



309A
+



311A
++



313A
+



314A
+



315A
+



316A
+



318A
+



320A
+



322A
+



324A
+



327A
+



329A
+



331A
+



333A
+



335A
+



340A
+



342A
+



344A
+



346A
+



348A
+



350A
+



352A
+



354A
+



356A
+



358A
+



362A
+



364A
+



369A
+



370A
+



372A
+



374A
+



375A
+



376A
+



377A
+



379A
+



381A
+



383A
+



385A
+



387A
+



389A
+



390A
+



391A
+



393A
+



395A
+



398A
+



399A
+



400A
+



401A
++



402A
+



403A
++



404A
+



405A
+



406A
+



407A
+



409A
+



410A
+



411A
+



414A
+



416A
+



418A
+



420A
+



422A
+



424A
+



426A
+



427A
+



428A
+



430A
+



432A
+



434A
+



436A
+



438A
+



440A
+



442A
+



444A
+



446A
+



448A
++



455A
+



456A
++++



457A
++



458A
+



459A
+



460A
+



461A
+



463A
+



464A
+



466A
+



468A
+



469A
+



470A
+



471A
+



472A
+



473A
+



474A
+



475A
+++



477A
+



478A
++++



479A
+



480A
+



482A
+



483A
+



484A
+



485A
+



486A
+



487A
++



488A
+++



489A
+



490A
+



491A
+



492A
+



494A
+



495A
+++



496A
+



497A
+



498A
+



499A
+



500A
+



501A
+



502A
+



503A
++



504A
+



505A
+++



506A
+



507A
++



508A
+



509A
+



510A
+



511A
+



512A
++



514A
+



515A
++



516A
+



517A
+++



519A
++++



520A
+++



522A
+



523A
+



524A
+



525A
+



526A
++



531A
++



532A
++



533A
++



534A
+



535A
+



536A
+



537A
+



538A
+



539A
+



540A
+



541A
+



542A
+



543A
+



544A
+



545A
+



546A
+



547A
+



549A
+



550A
+



551A
+



552A
+



553A
+



554A
+



555A
+



557A
+



558A
+



559A
+



562A
+



563A
+



564A
+



565A
+



566A
+



567A
+



568A
+



569A
+



572A
+



573A
+



574A
+



575A
+



577A
+



578A
+



579A
+



580A
+



581A
+



582A
+



583A
+



584A
+



585A
+



586A
+



587A
+



588A
+++



589A
++



590A
+



591A
+



592A
+



593A
+



594A
+



595A
+



596A
+



598A
+



599A
+



600A
+



601A
+



602A
+



603A
+



604A
+



605A
+



606A
+



607A
+



608A
+



609A
+



610A
+



611A
+



612A
+



613A
+



616A
+



617A
+



618A
+



619A
+



620A
+



621A
+



622A
+



623A
+



624A
+



625A
+



627A
+



628A
+



629A
+



630A
+



631A
+



632A
+



633A
+



634A
+



635A
+



637A
+



638A
+



642A
+



643A
+++



644A
+



645A
+



646A
+



647A
+



648A
+



649A
+



650A
+



651A
+



652A
+



653A
+



654A
+



655A
+



656A
+



657A
+



658A
+



659A
+



660A
+



661A
+



662A
+



663A
+



664A
+



665A
+



666A
+



667A
+



668A
+



669A
+



670A
++++



672A
+



673A
+



674A
+



675A
+



676A
+++



677A
+



678A
+



683A
+



685A
+



686A
+



688A
+



689A
+++



690A
+



691A
+



692A
+



694A
+



695A
+



697A
+



698A
+



699A
+



700A
+



701A
+



702A
+



703a 
+



704a 
++



705A
+



706A
+



707A
+



708A
++



709A
+



710A
+



711A
++



712A
++



713A
+



714A
++++



715A
+



716A
++



719A
+++



720A
+



721A
+



722A
+



723A
+



724A
+



729A
+



730A
+



731A
+



732A
+



739A
+



740A
+



741A
+



742A
+



745A
+



746A
+



747A
+



748A
+



749A
+



750A
+



751A
+



752A
+



753A
+



755A
+



756A
+



757A
+



758A
+



759A
+



761A
+



762A
+



764A
+



765A
+



766A
+



767A
+



769A
+



771A
+



772A
+



773A
+



774A
+



775A
+



776A
+



777A
+



778A
+



779A
+



780A
+



781A
+



782A
+



783A
+



785A
+



788A
+



789A
++



790A
+



791A
+



792A
+



793A
+



794A
+



795A
+



796A
+



797A
+



798A
+



799A
+



800A
+



801A
+



802A
+



803A
+



804A
+



805A
+



806A
+



808A
+



809A
+



810A
+



811A
+



812A
+



813A
+



814A
+



815A
+



816A
+



817A
+



818A
+



819A
+



820A
+



821A
+



823A
+



824A
+



825A
+



826A
+



827A
+



828A
+



829A
+



830A
+



831A
+



833A
++



834A
+



835A
+



836A
+



837A
+



838A
+



839A
+



840A
+



841A
+



842A
+



843A
+



844A
+



845A
+



846A
+



848A
+



849A
+



851A
+



852A
+



853A
+



854A
+



855A
+



856A
+



857A
+



858A
+



859A
+



860A
+



862A
+



863A
+



864A
+



865A
+



866A
+



867A
+



868A
+



869A
+



870A
+



871A
+



878A
+



879A
+



880A
++++



882A
+



883A
+



884A
+



888A
+



889A
+



890A
+



891A
+



892A
+



893A
+



894A
+



895A
+++



896A
+



897A
+



898A
+



899A
+



900A
+



901A
+



902A
+



903A
+



904A
+



905A
+



906A
+



907A
+



908A
+



909A
+



910A
+



911A
+



912A
+



913A
+



914A
+



915A
+



917A
+



918A
+



919A
+



920A
+



921A
+



922A
++



924A
+



925A
+



926A
+



927A
+



928A
++++



929A
+



930A
+



931A
+



932A
+



933A
+



934A
+



935A
+



936A
+



937A
+



938A
+



939A
+



940A
+



941A
+



942A
+



944A
+



945A
+



946A
+



947A
+



948A
+



950A
+



951A
+



952A
+



953A
+



954A
+



955A
+



956A
+



957A
+



958A
+



960A
+



961A
+



962A
+



963A
+



964A
+



965A
+



966A
+



967A
+



968A
+



969A
+



970A
+



971A
+



972A
+



988A
+



989A
+



990A
+



991A
+



992A
+



993A
+



994A
+



995A
+



996A
+



997A
+



998A
+



999A
+



1000A 
+



1001A 
+



1002A 
+



1003A 
+



1007A 
+



1008A 
+



1009A 
+



1010A 
++++



1011A 
+



1012A 
++++



1013A 
+++



1014A 
+



1016A 
+



1017A 
+



1018A 
+



1019A 
+



1020A 
+



1021A 
+



1022A 
+



1023A 
++



1024A 
+



1025A 
+



1026A 
+



1027A 
++



1028A 
+++



1029A 
+++



1030A 
++



1031A 
+



1032A 
++



1034A 
+



1035A 
+



1036A 
+



1037A 
++



1038A 
+



1039A 
+



1040A 
+



1041A 
+



1042A 
+



1043A 
+



1044A 
+



1045A 
+



1046A 
+



1047A 
+



1048A 
+



1049A 
+



1055A 
+



1056A 
+



1057A 
+



1058A 
+



1059A 
+



1060A 
+



1061A 
+



1062A 
+



1063A 
+



1064A 
+



1065A 
+



1066A 
+



1067A 
+



1068A 
+



1069A 
+



1070A 
+



1071A 
+



1072A 
+



1073A 
+



1074A 
+



1075A 
+







+ = 0 μM ≤ SC150 < 0.05 μM



++ = 0.05 μM ≤ SC150 < 0.1 μM



+++ = 0.1 μM ≤ SC150 < 0.2 μM



++++ = 0.2 μM ≤ SC150 < 1 μM






Embodiments

The following non-limiting embodiments provide illustrative examples of the invention, but do not limit the scope of the invention.


Embodiment 1. A compound of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the Y atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof, wherein the compound is not a compound of Table 1.


Embodiment 2. A compound of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent, wherein at least one of R3 and R4 is alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


Embodiment 3. The compound of embodiment 1 or 2, wherein X1 is a carbon atom connected to Q1.


Embodiment 4. The compound of embodiment 1 or 2, wherein X2 is a carbon atom connected to Q1.


Embodiment 5. The compound of any one of embodiments 1-4, wherein Q1 is a bond.


Embodiment 6. The compound of any one of embodiments 1-5, wherein Y is N or O.


Embodiment 7. The compound of any one of embodiments 1-6, wherein Y is N.


Embodiment 8. The compound of any one of embodiments 1-7, wherein m is 1.


Embodiment 9. The compound of any one of embodiments 1-7, wherein m is 2.


Embodiment 10. The compound of any one of embodiments 1-3 and 5-8, wherein the compound is of the formula:




embedded image


Embodiment 11. The compound of any one of embodiments 1-3, 5-8, and 10, wherein the compound has the formula:




embedded image


Embodiment 12. The compound of any one of embodiments 1, 2, and 4-8, wherein the compound is of the formula:




embedded image


Embodiment 13. The compound of any one of embodiments 1, 2, 4-8, and 12, wherein the compound has the formula:




embedded image


Embodiment 14. The compound of any one of embodiments 1-13, wherein R1 is alkyl, alkenyl, —C(O)R16, —C(O)OR16, or —C(O)NR16R17.


Embodiment 15. The compound of any one of embodiments 1-14, wherein R1 is substituted alkyl.


Embodiment 16. The compound of any one of embodiments 1-15, wherein R1 is alkyl substituted with NR16R17.


Embodiment 17. The compound of any one of embodiments 1-8, 10, 11, and 14-16, wherein the compound is of the formula:




embedded image


Embodiment 18. The compound of any one of embodiments 1-8, 10, 11, and 14-17, wherein the compound has the formula:




embedded image


Embodiment 19. The compound of any one of embodiments 1-8 and 12-16, wherein the compound is of the formula:




embedded image


Embodiment 20. The compound of any one of embodiments 1-8, 12-16, and 19, wherein the compound has the formula:




embedded image


Embodiment 21. The compound of any one of embodiments 1-20, wherein each R16 and R17 is independently alkyl, alkenyl, aryl, heteroaryl, heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen.


Embodiment 22. The compound of any one of embodiments 1-21, wherein R16 is hydrogen or alkyl.


Embodiment 23. The compound of any one of embodiments 1-22, wherein R17 is aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted.


Embodiment 24. The compound of any one of embodiments 1-23, wherein R17 is substituted aryl.


Embodiment 25. The compound of any one of embodiments 1-24, wherein R17 is substituted phenyl.


Embodiment 26. The compound of any one of embodiments 1-25, wherein R17 is phenyl substituted with a sulfoxide group, carboxyl group, amide group, amino group, alkyl, alkoxy, hydroxy, halo, cyano, or heterocyclyl, each of which is independently substituted or unsubstituted.


Embodiment 27. The compound of any one of embodiments 1-26, wherein R17 is phenyl substituted with methoxy.


Embodiment 28. The compound of any one of embodiments 1-26, wherein R17 is phenyl substituted with a substituted sulfoxide group.


Embodiment 29. The compound of any one of embodiments 1-26, wherein R17 is phenyl substituted with a carboxyl group.


Embodiment 30. The compound of any one of embodiments 1-26, wherein R17 is phenyl substituted with a substituted amide group.


Embodiment 31. The compound of any one of embodiments 1-30, wherein R2 is hydrogen or substituted or unsubstituted alkyl.


Embodiment 32. The compound of any one of embodiments 1-31, wherein R2 is substituted C1-C5-alkyl.


Embodiment 33. The compound of any one of embodiments 1-32, wherein R2 is trifluoroethyl.


Embodiment 34. The compound of any one of embodiments 1-32, wherein R2 is cycloalkyl.


Embodiment 35. The compound of any one of embodiments 1-34, wherein R13 is alkyl, alkenyl, hydrogen, or halogen.


Embodiment 36. The compound of any one of embodiments 1-35, wherein R13 is hydrogen.


Embodiment 37. The compound of any one of embodiments 1-3, 4-8, 10, 11, 14-18, 21-33, 35, and 36, wherein the compound has the formula:




embedded image


Embodiment 38. The compound of any one of embodiments 1, 2, 4-8, 12-16, 19-33, 35, and 36, wherein the compound has the formula:




embedded image


Embodiment 39. The compound of any one of embodiments 1-38, wherein at least one of R3 and R4 is aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-.


Embodiment 40. The compound of any one of embodiments 1-39, wherein R3 is H, and R4 is aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-.


Embodiment 41. The compound of any one of embodiments 1-40, wherein R3 is H, and R4 is aryl substituted at least with fluoro-.


Embodiment 42. The compound of any one of embodiments 1-40, wherein R3 is H, and R4 is heteroaryl substituted at least with fluoro-.


Embodiment 43. The compound of any one of embodiments 1-42, wherein R3 is H, and R4 is heterocyclyl substituted at least with fluoro-.


Embodiment 44. The compound of any one of embodiments 1-43, wherein at least one of R3 and R4 is aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with chloro-.


Embodiment 45. The compound of any one of embodiments 1-44, wherein R3 is H, and R4 is heterocyclyl substituted at least with chloro-.


Embodiment 46. The compound of any one of embodiments 1-45, wherein R4 is substituted piperidinyl.


Embodiment 47. The compound of any one of embodiments 1-47, wherein R4 is piperidinyl substituted at least with alkyl, carboxy, heterocyclyl, or an amide group, each of which is substituted or unsubstituted.


Embodiment 48. The compound of any one of embodiments 1-47, wherein R4 is unsubstituted or substituted methyl piperidinyl.


Embodiment 49. The compound of any one of embodiments 1-48, wherein R4 is 3-fluoro-1-methylpiperidinyl.


Embodiment 50. The compound of any one of embodiments 1-47, wherein R4 is piperidinyl substituted with a substituted or unsubstituted methoxypropanol.


Embodiment 51. The compound of any one of embodiments 1-47 and 50, wherein R4 is 3-fluoro-1-(2-hydroxy-3-methoxypropyl)piperidinyl.


Embodiment 52. The compound of any one of embodiments 1-45, wherein R4 is unsubstituted or substituted tetrahydropyranyl.


Embodiment 53. The compound of any one of embodiments 1-45 and 52, wherein R4 is unsubstituted tetrahydropyranyl.


Embodiment 54. The compound of any one of embodiments 1-45 and 52, wherein R4 is tetrahydropyranyl substituted with alkyl.


Embodiment 55. The compound of any one of embodiments 1-45, 52, and 54, wherein R4 is tetrahydrothiopyran-1,1-dioxide.


Embodiment 56. The compound of any one of embodiments 1-3, 5-8, 10, 11, 14-18, 21-28, 31-33, and 35-37, wherein the compound is:




embedded image


Embodiment 57. The compound of any one of embodiments 1-3, 5-8, 10, 11, 14-18, 21-28, 31-33, and 35-37, wherein the compound is:




embedded image


Embodiment 58. The compound of any one of embodiments 1-3, 5-8, 10, 11, 14-18, 21-28, 31-33, and 35-37, wherein the compound is:




embedded image


Embodiment 59. The compound of any one of embodiments 1-3, 5-8, 10, 11, 14-18, 21-28, 31-33, 35-37, and 39-49, wherein the compound is:




embedded image


Embodiment 60. The compound of any one of embodiments 1-3, 5-8, 10, 11, 14-18, 21-28, 31-33, 35-37, and 39-49, wherein the compound is:




embedded image


Embodiment 61. The compound of any one of embodiments 1-3, 5-8, 10, 11, 14-18, 21-28, 31-33, and 35-37, wherein the compound is:




embedded image


Embodiment 62. The compound of any one of embodiments 1-3, 5-8, 10, 11, 14-18, 21-28, 31-33, and 35-37, wherein the compound is:




embedded image


Embodiment 63. The compound of any one of embodiments 1-3, 5-8, 10, 11, 14-18, 21-28, 31-33, and 35-37, wherein the compound is:




embedded image


Embodiment 64. The compound of any one of embodiments 1-3, 5-8, 10, 11, 14-18, 21-28, 31-33, 35-37, and 39-49, wherein the compound is:




embedded image


Embodiment 65. A compound comprising: a heterocyclyl group comprising a halogen substituent, wherein the compound binds a mutant p53 protein and increases wild-type p53 activity of the mutant p53 protein.


Embodiment 66. The compound of embodiment 65, wherein the compound further comprises an indole group attached to the heterocyclyl group.


Embodiment 67. The compound of embodiment 66, wherein the indole group has a 1,1,1-trifluoroethyl substituent at a 1-position of the indole group.


Embodiment 68. The compound of any one of embodiments 65-67, wherein the indole group has a propargyl substituent at a 2-position of the indole group.


Embodiment 69. The compound of embodiment 68, wherein the propargyl substituent is attached to the indole group via an sp carbon atom of the propargyl substituent.


Embodiment 70. The compound of embodiment 68 or 69, wherein the propargyl substituent is attached to a nitrogen atom of an aniline group via a methylene group of the propargyl substituent.


Embodiment 71. The compound of any one of embodiments66-70, wherein the indole group comprises an amino substituent at a 4-position of the indole group.


Embodiment 72. The compound of embodiment 71, wherein the amino substituent is attached to the heterocyclyl group.


Embodiment 73. The compound of any one of embodiments 65-72, wherein the heterocyclyl group is a piperidine group.


Embodiment 74. The compound of any one of embodiments 65-73, wherein the halogenated substituent comprises a fluoro group.


Embodiment 75. The compound of any one of embodiments 65-73, wherein the halogenated substituent comprises a chloro group.


Embodiment 76. The compound of any one of embodiments 65-75, wherein the heterocyclyl group further comprises at least one substituent group.


Embodiment 77. The compound of any one of embodiments 65-76, wherein the heterocyclyl group comprises an alkyl group.


Embodiment 78. The compound of any one of embodiments 65-77, wherein the heterocyclyl group comprises a methyl group.


Embodiment 79. The compound of any one of embodiments 65-78, wherein the heterocyclyl group is a methylpiperidine group.


Embodiment 80. The compound of any one of embodiments 65-79, wherein the heterocyclyl group is 1-methylpiperidinyl.


Embodiment 81. The compound of any one of embodiments 65-80, wherein the heterocyclyl group is 1-methylpiperidin-4-yl.


Embodiment 82. The compound of any one of embodiments 65-81, wherein the heterocyclyl group is 3-fluoro -1-methylpiperidin-4-yl.


Embodiment 83. The compound of embodiment 70, wherein, the aniline group is substituted with a hydroxyl group, sulfhydryl group, halogens, amino group, nitro group, nitroso group, cyano group, azido group, sulfoxide group, sulfone group, sulfonamide group, carboxyl group, carboxaldehyde group, imine group, alkyl group, halo-alkyl group, cyclic alkyl group, alkenyl group, halo-alkenyl group, alkynyl group, halo-alkynyl group, alkoxy group, aryl group, aryloxy group, aralkyl group, arylalkoxy group, heterocyclyl group, acyl group, acyloxy group, carbamate group, amide group, urethane group, and ester group.


Embodiment 84. The compound of embodiment 70 or 83, wherein the aniline group is substituted with an alkoxy group.


Embodiment 85. The compound of any one of embodiments 70, 83, or 84, wherein the aniline group is substituted with a sulfonamide group.


Embodiment 86. The compound of any one of embodiments 70 or 83-85, wherein the aniline group is substituted with an amide.


Embodiment 87. The compound of any one of embodiments 65-86, wherein the compound is of the formula




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • A is a linking group;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, heterocyclyl, or halo, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent; wherein at least one of R3 and R4 is alkyl, alkylene, alkenyl, alkenylene, alkynyl, alkynylene, aryl, heteroaryl, or heterocyclyl, each of which is substituted with at least halo;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is independently —C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


Embodiment 88. The compound of any one of embodiments 65-87, wherein the compound is of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • A is a linking group;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, heterocyclyl, or halo, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is independently —C(O)R23, —C(O)OR23, —C(O)NR23R24, —OR23, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;


each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and

    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof, wherein the compound is not a compound of Table 1.


Embodiment 89. The compound of any one of embodiments 65-88, wherein the compound is of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the Y atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —OR23, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof, wherein the compound is not a compound of Table 1.


Embodiment 90. The compound of any one of embodiments 65-89, wherein the compound is of the formula:




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent, wherein at least one of R3 and R4 is alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —OR23, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


Embodiment 91. The compound of embodiments 87 or 88, wherein A is alkylene, alkenylene, or alkynylene, each of which is substituted or unsubstituted.


Embodiment 92. The compound of any one of embodiments 87, 88, or 91, wherein A is alkylene.


Embodiment 93. The compound of any one of embodiments 87, 88, or 91, wherein A is alkenylene.


Embodiment 94. The compound of any one of embodiments 87, 99, or 91, wherein A is alkynylene.


Embodiment 95. The compound of any one of embodiments 87-90, wherein Q1 is a bond.


Embodiment 96. The compound of any one of embodiments 87-90, wherein m is 1.


Embodiment 97. The compound of any one of embodiments 87-90, wherein m is 2.


Embodiment 98. The compound of any one of embodiments 87-90, wherein Y is N or O.


Embodiment 99. The compound of any one of embodiments 87-98, Y is N.


Embodiment 100. The compound of any one of embodiments 87-99, wherein R1 is alkyl, alkenyl, —C(O)R16, —C(O)OR16, or —C(O)NR16R17.


Embodiment 101. The compound of any one of embodiments 87-100, wherein R1 is substituted alkyl.


Embodiment 102. The compound of any one of embodiments 87-101, wherein R1 is alkyl substituted with NR16R17.


Embodiment 103. The compound of any one of embodiments 87-102, wherein each R16 and R17 is independently alkyl, alkenyl, aryl, heteroaryl, heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen.


Embodiment 104. The compound of any one of embodiments 87-103, wherein R16 is hydrogen or alkyl.


Embodiment 105. The compound of any one of embodiments 87-104, wherein R17 is aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted.


Embodiment 106. The compound of any one of embodiments 87-105, wherein R17 is substituted aryl.


Embodiment 107. The compound of any one of embodiments 87-106, wherein R17 is substituted phenyl.


Embodiment 108. The compound of any one of embodiments 87-107, wherein R17 is phenyl substituted with a sulfoxide group, carboxyl group, amide group, amino group, alkyl, alkoxy, hydroxy, halo, cyano, or heterocyclyl, each of which is independently substituted or unsubstituted.


Embodiment 109. The compound of any one of embodiments 87-108, wherein R17 is phenyl substituted with methoxy.


Embodiment 110. The compound of any one of embodiments 87-108, wherein R17 is phenyl substituted with a substituted sulfoxide group.


Embodiment 111. The compound of any one of embodiments 87-108, wherein R17 is phenyl substituted with a carboxyl group.


Embodiment 112. The compound of any one of embodiments 87-108, wherein R17 is phenyl substituted with a substituted amide group.


Embodiment 113. The compound of any one of embodiments 87-112, wherein R2 is hydrogen or substituted or unsubstituted alkyl.


Embodiment 114. The compound of any one of embodiments 87-113, wherein R2 is substituted alkyl.


Embodiment 115. The compound of any one of embodiments 87-114, wherein R2 is trifluoroethyl.


Embodiment 116. The compound of any one of embodiments 87-114, wherein R2 is substituted or unsubstituted cycloalkyl.


Embodiment 117. The compound of any one of embodiments 87-116, wherein R13 is substituted or unsubstituted alkyl or alkenyl; hydrogen, or halogen.


Embodiment 118. The compound of any one of embodiments 87-117, wherein R13 is hydrogen.


Embodiment 119. The compound of any one of embodiments 87-118, wherein at least one of R3 and R4 is aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-.


Embodiment 120. The compound of any one of embodiments 87-119, wherein R3 is H, and R4 is aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-.


Embodiment 121. The compound of any one of embodiments 87-120, wherein R4 is aryl substituted at least with fluoro-.


Embodiment 122. The compound of any one of embodiments 87-120, wherein R4 is heteroaryl substituted at least with fluoro-.


Embodiment 123. The compound of any one of embodiments 87-120, wherein R4 is heterocyclyl substituted at least with fluoro-.


Embodiment 124. The compound of any one of embodiments 87-120 or 123, wherein R4 is substituted piperidinyl.


Embodiment 125. The compound of any one of embodiments 87-120, 123, or 124, wherein R4 is piperidinyl substituted at least with alkyl, carboxy, heterocyclyl, or an amide group, each of which is substituted or unsubstituted.


Embodiment 126. The compound of any one of embodiments 87-120 or 123-125, wherein R4 is unsubstituted or substituted methyl piperidinyl.


Embodiment 127. The compound of any one of embodiments 87-120 or 123-126, wherein R4 is 3-fluoro-1-methylpiperidinyl.


Embodiment 128. The compound of any one of embodiments 87-120 or 123-125, wherein R4 is piperidinyl substituted with a substituted or unsubstituted methoxypropanol.


Embodiment 129. The compound of any one of embodiments 87-120 123-125, or 128, wherein R4 is 3-fluoro-1-(2-hydroxy-3-methoxypropyl)piperidinyl.


Embodiment 130. The compound of any one of embodiments 87-120, wherein R4 is unsubstituted or substituted tetrahydropyranyl.


Embodiment 131. The compound of any one of embodiments 87-120 or 130, wherein R4 is tetrahydropyranyl substituted with alkyl.


Embodiment 132. The compound of any one of embodiments 87-120, 130, or 131, wherein R4 is tetrahydrothiopyran-1,1-dioxide.


Embodiment 133. The compound of any one of embodiments 65-132, wherein the compound binds the mutant p53 protein and reconforms the mutant p53 protein to wild type conformation p53.


Embodiment 134. The compound of any one of embodiments 65-133, wherein the compound has oral bioavailability that is at least about 50% greater than that of an analogous compound that lacks the halo substituent on the heterocyclyl group.


Embodiment 135. A method of treating a cancer, the method comprising administering to a subject in need thereof a compound of Formula (I):




embedded image


wherein:

    • each custom-character is independently a single bond or a double bond;
    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, C═O, C═S, —CN, —SiR16R17R18, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently, —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkylene, alkenyl, alkenylene, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the Y atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,
    • or a pharmaceutically acceptable salt thereof;
    • wherein the compound has an SC150 value for p53 Y220C of less than 1 μM as measured by a homogeneous time-resolved fluorescence (HTRF) assay.


Embodiment 136. The method of embodiment 135, wherein the cancer has one p53 mutation.


Embodiment 137. The method of embodiment 135 or 136, wherein the one p53 mutation is Y220C.


Embodiment 138. The method of embodiment 135, wherein the cancer has two p53 mutations.


Embodiment 139. The method of embodiment 138, wherein one of the two p53 mutations is Y220C.


Embodiment 140. The method of embodiment 138 or 139, wherein one of the two p53 mutations is a mutation to R306.


Embodiment 141. The method of embodiment 138 or 139, wherein one of the two p53 mutations is a mutation to A74.


Embodiment 142. The method of embodiment 138, wherein one of the two p53 mutations is a mutation to M237.


Embodiment 143. The method of any one of embodiments 135-142, wherein the compound has an SC150 value of less than 0.2 μM.


Embodiment 144. The method of any one of embodiments 135-143, wherein the compound has an SC150 value of less than 0.1 μM.


Embodiment 145. The method of any one of embodiments 135-144, wherein the compound has an SC150 value of less than 0.05 μM.


Embodiment 146. A compound of the formula:




embedded image


wherein:


each custom-character is independently a single bond or a double bond;

    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • A is a linking group;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —OR16, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, heterocyclyl, or halo, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent; wherein at least one of R3 and R4 is alkyl, alkylene, alkenyl, alkenylene, alkynyl, alkynylene, aryl, heteroaryl, or heterocyclyl, each of which is substituted with at least halo;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is independently —C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof.


Embodiment 147. A compound of the formula:




embedded image


wherein:


each custom-character is independently a single bond or a double bond;

    • X1 is CR5, CR5R6, N, NR5, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X2 is CR7, CR7R8, N, NR7, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X3 is CR9, CR9R10, N, NR9, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X4 is CR11, CR11R12, N, NR11, O, S, C═O, C═S, or a carbon atom connected to Q1;
    • X5 is CR13, N, or NR13;


      wherein at least one of X1, X2, X3, and X4 is a carbon atom connected to Q1;
    • A is a linking group;
    • Q1 is C═O, C═S, C═CR14R15, C═NR14, alkylene, alkenylene, or alkynylene, each of which is independently substituted or unsubstituted, or a bond;
    • m is 1, 2, 3, or 4;
    • Y is N, O, or absent;
    • R1 is —C(O)R16, —C(O)OR16, —C(O)NR16R17, —SR16, —NR16R17, —NR16C(O)R16, —OC(O)R16, —SiR16R17R18, alkyl, alkenyl, alkynyl, alkoxy, aryl, heteroaryl, heterocyclyl, or halo, each of which is independently substituted or unsubstituted, or hydrogen;
    • each R3 and R4 is independently —C(O)R19, —C(O)OR19, —C(O)NR19R20, —SOR19, —SO2R19, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen, or R3 and R4 together with the nitrogen atom to which R3 and R4 are bound form a ring, wherein the ring is substituted or unsubstituted, or R3 is absent;
    • each R2, R5, R6, R7, R8, R9, R10, R11, R12, R13, R14, R15, R16, R17, and R18 is independently —C(O)R21, —C(O)OR21, —C(O)NR21R22, —OR21, —SR21, —NR21R22, —NR21C(O)R22, —OC(O)R21, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R19 and R20 is independently —C(O)R23, —C(O)OR23, —C(O)NR23R24, —SR23, —NR23R24, —NR23C(O)R24, —OC(O)R23, alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen or halogen;
    • each R21 and R22 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen; and
    • each R23 and R24 is independently alkyl, alkenyl, alkynyl, aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen,


      or a pharmaceutically-acceptable salt thereof, wherein the compound is not a compound of Table 1.


Embodiment 148. The compound of embodiment 146 or 147, wherein X1 is a carbon atom connected to Q1.


Embodiment 149. The compound of embodiment 146 or 147, wherein X2 is a carbon atom connected to Q1.


Embodiment 150. The compound of any one of embodiments 146-149, wherein Q1 is a bond.


Embodiment 151. The compound of any one of embodiments 146-150, wherein Y is N or O.


Embodiment 152. The compound of any one of embodiments 146-151, wherein Y is N.


Embodiment 153. The compound of any one of embodiments 146-152, wherein m is 1.


Embodiment 154. The compound of any one of embodiments 146-152, wherein m is 2.


Embodiment 155. The compound of any one of embodiments 146-154, wherein A is alkylene, alkenylene, or alkynylene, each of which is substituted or unsubstituted.


Embodiment 156. The compound of any one of embodiments 146-155, wherein A is alkylene.


Embodiment 157. The compound of any one of embodiments 146-155, wherein A is alkenylene.


Embodiment 158. The compound of any one of embodiments 146-155, wherein A is alkynylene.


Embodiment 159. The compound of any one of embodiments 146-154, wherein A is an aryl group that is substituted or unsubstituted.


Embodiment 160. The compound of any one of embodiments 146-154, wherein A is a heteroaryl group that is substituted or unsubstituted.


Embodiment 161. The compound of any one of embodiments 146-154, wherein A is heterocyclyl group that is substituted or unsubstituted.


Embodiment 162. The compound of any one of embodiments 146-148, 150-153, 155, or 158, wherein the compound is of the formula:




embedded image


Embodiment 163. The compound of any one of embodiments 146-148, 141, 151-153, 155, or 158, wherein the compound is of the formula:




embedded image


Embodiment 164. The compound of any one of embodiments 146, 147, 149-153, 155, or 158, wherein the compound has the formula:




embedded image


Embodiment 165. The compound of any one of embodiments 146, 147, 151-153, 155, or 158, wherein the compound has the formula:




embedded image


Embodiment 166. The compound of any one of embodiments 146-165, wherein R1 is alkyl, alkenyl, —C(O)R16, —C(O)OR16, or —C(O)NR16R17.


Embodiment 167. The compound of any one of embodiments 146-166, wherein R1 is substituted alkyl.


Embodiment 168. The compound of any one of embodiments 146-167, wherein R1 is alkyl substituted with NR16R17.


Embodiment 169. The compound of any one of embodiments 146-148, 150-153, 155, 158, or 166-168, wherein the compound is of the formula:




embedded image


Embodiment 170. The compound of any one of embodiments 146-148, 141, 151-153, 155, 158, or 166-168, wherein the compound is of the formula:




embedded image


Embodiment 171. The compound of any one of embodiments 146, 147, 149-153, 155, 158, or 166-168, wherein the compound is of the formula:




embedded image


Embodiment 172. The compound of any one of embodiments 146, 147, 151-153, 155, 158, or 166-168, wherein the compound is of the formula:




embedded image


Embodiment 173. The compound of any one of embodiments 146-172, wherein each R16 and R17 is independently alkyl, alkenyl, aryl, heteroaryl, heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen.


Embodiment 174. The compound of any one of embodiments 146-173, wherein R16 is hydrogen or alkyl.


Embodiment 175. The compound of any one of embodiments 146-174, wherein R17 is aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted.


Embodiment 176. The compound of any one of embodiments 146-175, wherein R17 is substituted aryl.


Embodiment 177. The compound of any one of embodiments 146-176, wherein R17 is substituted phenyl.


Embodiment 178. The compound of any one of embodiments 146-177, wherein R17 is phenyl substituted with a sulfoxide group, carboxyl group, amide group, amino group, alkyl, alkoxy, hydroxy, halo, cyano, or heterocyclyl, each of which is independently substituted or unsubstituted.


Embodiment 179. The compound of any one of embodiments 146-178, wherein R17 is phenyl substituted with methoxy.


Embodiment 180. The compound of any one of embodiments 146-179, wherein R17 is phenyl substituted with a substituted sulfoxide group.


Embodiment 181. The compound of any one of embodiments 146-179, wherein R17 is phenyl substituted with a carboxyl group.


Embodiment 182. The compound of any one of embodiments 146-179, wherein R17 is phenyl substituted with a substituted amide group.


Embodiment 183. The compound of any one of embodiments 146-182, wherein R2 is hydrogen or substituted or unsubstituted alkyl.


Embodiment 184. The compound of any one of embodiments 146-183, wherein 12_2 is substituted alkyl.


Embodiment 185. The compound of any one of embodiments 146-184, wherein R2 is trifluoroethyl.


Embodiment 186. The compound of any one of embodiments 146-184, wherein R2 is substituted or unsubstituted cycloalkyl.


Embodiment 187. The compound of any one of embodiments 146-186, wherein R13 is substituted or unsubstituted alkyl or alkenyl; hydrogen, or halogen.


Embodiment 188. The compound of any one of embodiments 146-187, wherein R13 is hydrogen.


Embodiment 189. The compound of any one of embodiments 146-148, 141, 151-153, 155, 158, 166-168, 173-185, 187, or 188, wherein the compound has the formula:




embedded image


Embodiment 190. The compound of any one of embodiments 146, 147, 151-153, 155, 158, 166-168, 173-185, 187, or 188 , wherein the compound has the formula:




embedded image


Embodiment 191. The compound of any one of embodiments 146-190, wherein at least one of R3 and R4 is aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-.


Embodiment 192. The compound of any one of embodiments 146-191, wherein R3 is H, and R4 is aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-.


Embodiment 193. The compound of any one of embodiments 146-192, wherein R4 is aryl substituted at least with fluoro-.


Embodiment 194. The compound of any one of embodiments 146-192, wherein R4 is heteroaryl substituted at least with fluoro-.


Embodiment 195. The compound of any one of embodiments 146-192, wherein R4 is heterocyclyl substituted at least with fluoro-.


Embodiment 196. The compound of any one of embodiments 146-191, wherein at least one of R3 and R4 is aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with chloro-.


Embodiment 197. The compound of any one of embodiments 146-191 or 196, wherein R3 is H, and R4 is heterocyclyl substituted at least with chloro-.


Embodiment 198. The compound of any one of embodiments 146-191 or 197, wherein R4 is substituted piperidinyl.


Embodiment 199. The compound of any one of embodiments 146-191, 197, or 198, wherein R4 is piperidinyl substituted at least with alkyl, carboxy, heterocyclyl, or an amide group, each of which is substituted or unsubstituted.


Embodiment 200. The compound of any one of embodiments 146-191 or 197-199, wherein R4 is unsubstituted or substituted methyl piperidinyl.


Embodiment 201. The compound of any one of embodiments 146-191 or 197-200, wherein R4 is 3-fluoro-1-methylpiperidinyl.


Embodiment 202. The compound of any one of embodiments 146-191 or 197-199, wherein R4 is piperidinyl substituted with a substituted or unsubstituted methoxypropanol.


Embodiment 203. The compound of any one of embodiments 146-192, 195, or 202, wherein R4 is 3-fluoro-1-(2-hydroxy-3-methoxypropyl)piperidinyl.


Embodiment 204. The compound of any one of embodiments 146-192, 195, 197, wherein R4 is unsubstituted or substituted tetrahydropyranyl.


Embodiment 205. The compound of any one of embodiments 146-192, 195, 197, or 204, wherein R4 is unsubstituted tetrahydropyranyl.


Embodiment 206. The compound of any one of embodiments 146-192, 195, 197, or 204, wherein R4 is tetrahydropyranyl substituted with alkyl.


Embodiment 207. The compound of any one of embodiments 146-192, 195, 197, 204, or 206, wherein R4 is tetrahydrothiopyran-1,1-dioxide.


Embodiment 208. The compound of any one of embodiments 147, 148, 150-153, 155, 158, 166-168, 173-180, 183-185, 187, 188, or 189, wherein the compound is:




embedded image


Embodiment 209. The compound of any one of embodiments 147, 148, 150-153, 155, 158, 166-168, 173-180, 183-185, 187, 188, or 189, wherein the compound is:




embedded image


Embodiment 210. The compound of any one of embodiments 147, 148, 150-153, 155, 158, 166-168, 173-180, 183-185, 187, 188, or 189, wherein the compound is:




embedded image


Embodiment 211. The compound of any one of embodiments 146-148, 150-153, 155, 158, 166-168, 173-180, 183-185, 187, 188, or 189, wherein the compound is:




embedded image


Embodiment 212. The compound of any one of embodiments 146-148, 150-153, 155, 158, 166-168, 173-180, 183-185, 187, 188, or 189, wherein the compound is:




embedded image


Embodiment 213. The compound of any one of embodiments 147, 148, 150-153, 155, 158, 166-168, 173-180, 183-185, 187, 188, or 189, wherein the compound is:




embedded image


Embodiment 214. The compound of any one of embodiments 147, 148, 150-153, 155, 158, 166-168, 173-180, 183-185, 187, 188, or 189, wherein the compound is:




embedded image


Embodiment 215. The compound of any one of embodiments 147, 148, 150-153, 155, 158, 166-168, 173-180, 183-185, 187, 188, or 189, wherein the compound is:




embedded image


Embodiment 216. The compound of any one of embodiments 146-148, 150-153, 155, 158, 166-168, 173-180, 183-185, 187, 188, or 189, wherein the compound is:




embedded image


Embodiment 217. A method of inducing apoptosis in a cell, the method comprising contacting the cell with a therapeutically-effective amount of a compound that binds a p53 mutant, wherein the compound is a compound of any one of embodiments 1-216.


Embodiment 218. The method of embodiment 217, wherein the compound increases the ability of the p53 mutant to bind DNA.


Embodiment 219. The method of embodiment 217 or 218, wherein the cell expresses the p53.


Embodiment 220. The method of any one of embodiments 217-219, wherein the p53 mutant has a mutation at amino acid 220.


Embodiment 221. The method of any one of embodiments 217-220, wherein the p53 mutant is p53 Y220C.


Embodiment 222. The method of any one of embodiments 217-221, wherein the compound induces a conformational change in the p53 mutant.


Embodiment 223. The method of any one of embodiments 217-222, wherein the compound selectively binds the p53 mutant as compared to a wild type p53.


Embodiment 224. The method of any one of embodiments 217-223, wherein the therapeutically-effective amount is from about 50 mg to about 3000 mg.


Embodiment 225. The method of any one of embodiments 217-224, wherein the compound increases a stability of a biologically-active conformation of the p53 mutant relative to a stability of the biologically-active conformation of the p53 mutant in an absence of the compound.


Embodiment 226. A method of treating a cancer, the method comprising administering to a subject in need thereof a therapeutically-effective amount of a compound of any one of embodiments 1-216.


Embodiment 227. The method of embodiment 226, wherein the cancer is ovarian cancer.


Embodiment 228. The method of embodiment 226, wherein the cancer is breast cancer.


Embodiment 229. The method of embodiment 226, wherein the cancer is lung cancer.


Embodiment 230. The method of any one of embodiments 226-229, wherein the therapeutically-effective amount is from about 20 mg to about 2000 mg.


Embodiment 231. The method of any one of embodiments 74-78, wherein the administration is oral.


Embodiment 232. The method of any one of embodiments 74-78, wherein the administration is intravenous.


Embodiment 233. The method of any one of embodiments 74-78, wherein the administration is subcutaneous.


Embodiment 234. The method of any one of embodiments 74-78, wherein the administration is topical.


Embodiment 235. The method of any one of embodiments 74-82, wherein the subject is human.


Embodiment 236. The method of any one of embodiments 74-83, wherein the compound increases a stability of a biologically-active conformation of the p53 mutant relative to a stability of the biologically-active conformation of the p53 mutant in an absence of the compound.

Claims
  • 1. A compound of the formula:
  • 2. The compound of claim 1, wherein the compound has the formula:
  • 3. The compound of claim 2, wherein X1 is a carbon atom connected to Q1.
  • 4. (canceled)
  • 5. The compound of claim 2, wherein Q1 is a bond.
  • 6. (canceled)
  • 7. The compound of claim 2, wherein Y is N.
  • 8. The compound of claim 2, wherein m is 1.
  • 9. (canceled)
  • 10. The compound of claim 2, wherein the compound is of the formula:
  • 11-13. (canceled)
  • 14. The compound of claim 2, wherein R1 is alkyl, alkenyl, —C(O)R16, —C(O)OR16, or —C(O)NR16R17, each of which is unsubstituted or substituted.
  • 15. (canceled)
  • 16. The compound of claim 14, wherein R1 is alkyl substituted with NR16R17.
  • 17-20. (canceled)
  • 21. The compound of claim 2, wherein each R16 and R17 is independently alkyl, alkenyl, aryl, heteroaryl, heterocyclyl, each of which is independently substituted or unsubstituted, or hydrogen.
  • 22. The compound of claim 21, wherein R16 is hydrogen or alkyl.
  • 23. The compound of claim 21, wherein R17 is aryl, heteroaryl, or heterocyclyl, each of which is independently substituted or unsubstituted.
  • 24. The compound of claim 23, wherein R17 is substituted aryl.
  • 25. (canceled)
  • 26. The compound of claim 24, wherein R17 is phenyl substituted with a sulfoxide group, carboxyl group, amide group, amino group, alkyl, alkoxy, hydroxy, halo, cyano, or heterocyclyl, each of which is independently substituted or unsubstituted.
  • 27-29. (canceled)
  • 30. The compound of claim 26, wherein R17 is phenyl substituted with an amide group.
  • 31. (canceled)
  • 32. The compound of claim 2, wherein R2 is substituted alkyl.
  • 33-39. (canceled)
  • 40. The compound of claim 2, wherein R3 is H, and R4 is aryl, heteroaryl, or heterocyclyl, each of which is substituted at least with halo-.
  • 41. The compound of claim 40, wherein R4 is aryl substituted at least with fluoro-.
  • 42. The compound of claim 40, wherein R4 is heteroaryl substituted at least with fluoro-.
  • 43. The compound of claim 40, wherein R4 is heterocyclyl substituted at least with fluoro-.
  • 44-45. (canceled)
  • 46. The compound of claim 43, wherein R4 is substituted piperidinyl.
  • 47-58. (canceled)
  • 59. The compound of claim 2, wherein the compound is:
  • 60. The compound of claim 2, wherein the compound is:
  • 61-63. (canceled)
  • 64. The compound of claim 2, wherein the compound is:
  • 65-236. (canceled)
  • 237. The compound of claim 1, wherein the compound is:
  • 238. The compound of claim 1, wherein the compound is:
  • 239. The compound of claim 1, wherein the compound is:
  • 240. The compound of claim 1, wherein the compound is:
  • 241. The compound of claim 1, wherein the compound is:
  • 242. The compound of claim 1, wherein the compound is:
  • 243. The compound of claim 1, wherein the compound is:
  • 244. The compound of claim 1, wherein the compound is:
  • 245. The compound of claim 1, wherein the compound is:
CROSS-REFERENCE

This application claims the benefit of U.S. Provisional Application No. 62/904,369, filed Sep. 23, 2019; and U.S. Provisional Application No. 63/038,388, filed Jun. 12, 2020, which are incorporated herein by reference.

Provisional Applications (2)
Number Date Country
63038388 Jun 2020 US
62904369 Sep 2019 US