METHODS AND MATERIALS FOR PROVIDING TEETH WITH A WHITE APPEARANCE

Information

  • Patent Application
  • 20140271500
  • Publication Number
    20140271500
  • Date Filed
    March 14, 2014
    12 years ago
  • Date Published
    September 18, 2014
    11 years ago
Abstract
This document provides methods and materials for providing teeth with a white appearance. For example, methods and materials are provided for contacting teeth with one or more fluorescence emitting polypeptides (e.g., a blue fluorescent protein (BFP)) and adhesive molecules (e.g., mussel adhesive polypeptides) to provide the teeth with a whiter appearance.
Description
BACKGROUND

1. Technical Field


This document relates to methods and materials involved in providing teeth with a white appearance. For example, this document relates to methods and materials for contacting teeth with one or more adhesive molecules (e.g., one or more mussel adhesive polypeptides) and fluorescence emitting polypeptides (e.g., a blue fluorescent protein) to provide the teeth with a whiter appearance.


2. Background Information


In general, white teeth are considered cosmetically desirable. Teeth, however, can become discolored in the absence of intervention. The tooth structure that is generally responsible for presenting a stained appearance is the enamel layer. Several factors can contribute to enamel discoloration. For example, the formation of plaque and tartar matrices on the tooth surface can entrap stains, thereby leading to enamel discoloration.


Over-the-counter tooth whitening preparations have been developed to address the cosmetic preference of many to restore luster to tooth enamel discolored by surface entrapped materials. While all dentifrices and mouthwashes contain some cleaning and polishing agents, some enamel deposits or other alterations to enamel appearance become intractable to being fully removed, oxidized, or re-colored by these agents under normal use conditions. Smokers often develop discolored enamel because the tars and particulates in exhaled cigarette smoke collect on the teeth. In some case, foods and drinks (e.g., tea) can stain or discolor tooth enamel.


SUMMARY

This document provides methods and materials for providing teeth with a whiter appearance. For example, this document provides methods and materials for contacting teeth with one or more adhesive molecules (e.g., one or more mussel adhesive polypeptides) and fluorescence emitting polypeptides (e.g., a blue fluorescent protein (BFP)) to provide the teeth with a whiter appearance. As described herein, adhesive molecules can be applied to teeth in combination with fluorescence emitting polypeptides such as BFP polypeptides. The adhesive molecule can include a plurality of 3,4-dihydroxyphenyl-L-alanine (DOPA) residues and can have the ability to interact with or bind to a tooth, a tooth component such as enamel, hydroxyapatite, or acquired dental pellicle, or inorganic dental materials such as crowns, caps, braces, or fillings. The methods and materials described herein can be used on dry teeth or on wet teeth. For example, the methods and materials described herein can be useful under typical conditions found in the mouth, such as the presence of saliva on the teeth and food, and under the duress of brushing or eating.


The fluorescence emitting polypeptides can emit fluorescence at a particular wavelength. In the case of BFP polypeptides, the BFP polypeptides can emit fluorescence in the range of about 440 nm to about 500 nm (e.g., between about 450 nm and about 490 nm), which when emitted from teeth give the teeth a white appearance. This white appearance can occur even when the underlying teeth are not naturally that white. For example, the methods and materials provided herein can allow a person to have white appearing teeth even though the teeth may be stained or have been discolored due to a chemical such as tetracycline. Thus, white appearing teeth can be obtained using the methods and materials provided herein without harsh bleaching (e.g., without dental bleaching treatments such as those involving hydrogen peroxide or carbimide peroxide) or de-staining techniques. The methods and materials described herein provide teeth with a natural appearance as the fluorescent polypeptides mimic the natural fluorescence of teeth and help to preserve translucence by not being entirely opaque.


In general, one aspect of this document features a method for altering the appearance of teeth. The method comprises, or consists essentially of, applying to teeth (e.g., to dry human or animal teeth, to wet human or animal teeth, or to human or animal teeth under typical conditions found in the mouth) an adhesive molecule that contains a plurality of DOPA residues and a fluorescence emitting polypeptide (e.g., a BFP polypeptide), wherein the adhesive molecule has the ability to interact with or bind to a tooth, a tooth component, or inorganic dental materials, and wherein fluorescence emitted from the fluorescence emitting polypeptide alters the appearance of the teeth. The adhesive molecule and fluorescence emitting polypeptide can be applied sequentially or applied together. The method further can include altering the appearance of the teeth such that the teeth appear whiter. The method further can include applying whitening particles (e.g., nanoparticles) to the teeth. The whitening particles can include titanium dioxide, silicon dioxide, hydroxyapatite, or zinc oxide. Such particles can enhance the whiter appearance of the fluorescing teeth under certain conditions and allow the appearance to be more consistent over the surface of the teeth.


In some cases, the adhesive molecule can be one or more mussel adhesive polypeptides (e.g., two or more mussel adhesive polypeptides). The mussel adhesive polypeptide can include a mussel foot protein-1 (MFP-1), MFP-3, MFP-5, or a combination thereof. For example, the mussel adhesive polypeptide can include a combination of MFP-1 and MFP-5 polypeptides. The mussel adhesive polypeptide can be a chimeric polypeptide comprising (i) an amino acid sequence of MFP-1 and an amino acid sequence of MFP-5 or (ii) an amino acid sequence of MFP-1 and an amino acid sequence of MFP-3. The fluorescence emitting polypeptide can be conjugated to the mussel adhesive polypeptide.


In some cases, the fluorescence emitting polypeptide and the mussel adhesive polypeptide are part of a chimeric polypeptide that contains an amino acid sequence of the fluorescence emitting polypeptide and an amino acid sequence of the mussel adhesive polypeptide.


In some embodiments, the adhesive molecule is a polymer that includes a plurality of lysine residues and the plurality of DOPA residues. The fluorescence emitting polypeptide can be conjugated to the polymer.


In some cases, the adhesive molecule is a polymethacrylate polymer comprising the plurality of DOPA residues. The fluorescence emitting polypeptide can be conjugated to the polymethacrylate polymer.


In some cases, the fluorescence emitting polypeptide can be one unit of a polymer comprising two or more fluorescence emitting polypeptides. The polymer can be attached to a mussel adhesive polypeptide to form a complex, wherein the complex is applied to the teeth.


The adhesive molecule and fluorescence emitting polypeptide can be present within tooth paste, mouth rinse, mouth wash, application gel, or ingested substance and the applying step can include applying (e.g., directly applying) the tooth paste, mouth rinse, mouth wash, application gel, or ingested substance to teeth. In some cases, the mouth wash, mouth rinse, application gel, or ingested substance are in contact with teeth or tooth component for a period of time sufficient for the teeth or tooth component to be saturated.


In another aspect, this document features a method for altering the appearance of teeth. The method comprises, or consists essentially of, applying (e.g., to dry human or animal teeth, to wet human or animal teeth, or to human or animal teeth under typical conditions found in the mouth) an adhesive molecule and whitening particles (e.g., nanoparticles) to teeth, the adhesive molecule comprising a plurality of DOPA residues and having the ability to interact with or bind to a tooth, a tooth component, or inorganic dental materials and wherein the whitening particles alter the appearance of the teeth (e.g., make the teeth appear whiter). The adhesive molecule and whitening particles can be applied sequentially or applied together. The whitening particles can include titanium dioxide, silicon dioxide, hydroxyapatite, or zinc oxide particles. The adhesive molecule can include a polymethacrylate polymer comprising the plurality of DOPA residues. The adhesive molecule can include one or more mussel adhesive polypeptides. The adhesive molecule can include a polymer comprising a plurality of lysine residues and the plurality of DOPA residues.


This document also features a composition comprising, or consisting essentially of, a fluorescence emitting polypeptide and an adhesive molecule comprising a plurality of DOPA residues, the adhesive molecule having the ability to interact with or bind to a tooth, a tooth component, or inorganic dental material. The composition further can include whitening particles such as titanium dioxide, silicon dioxide, hydroxyapatite, or zinc oxide particles. The adhesive molecule can be a polymer comprising a plurality of lysine residues and the plurality of DOPA residues. The adhesive molecule can be one or more mussel adhesive polypeptides. The fluorescence emitting polypeptide can be conjugated to the mussel adhesive polypeptide. The adhesive molecule can be a polymethacrylate polymer comprising the plurality of DOPA residues. The fluorescence emitting polypeptide can be conjugated to the polymethacrylate polymer.


In another aspect, this document features a composition comprising, or consisting essentially of, an adhesive molecule and whitening particles, the adhesive molecule comprising a plurality of DOPA residues and having the ability to interact with or bind to a tooth, a tooth component, or inorganic dental material. The adhesive molecule can be a polymer comprising a plurality of lysine residues and the plurality of DOPA residues. The adhesive molecule can be one or more mussel adhesive polypeptides. The adhesive molecule can be a polymethacrylate polymer comprising the plurality of DOPA residues. The composition further can include a fluorescence emitting polypeptide. The fluorescence emitting polypeptide can be conjugated to the adhesive molecule (e.g., mussel adhesive polypeptide, polymethacrylate polymer, or polymer comprising a plurality of lysine and DOPA residues).


Any of the compositions described herein can be a tooth paste, a mouth rinse, application gel, or ingested substance.


In another aspect, this document features a chimeric polypeptide comprising, or consisting essentially of, an amino acid sequence of 20 or more residues in length of a fluorescence emitting polypeptide and an amino acid sequence of 20 or more residues in length of a mussel adhesive polypeptide. The chimeric polypeptide can comprise a full length fluorescence emitting polypeptide or fragment thereof that is at least about 90 percent identical to the full length fluorescence emitting polypeptide. The chimeric polypeptide can comprise a full length mussel adhesive polypeptide or fragment thereof that is at least about 80 percent identical to the full length mussel adhesive polypeptide. The chimeric polypeptide can comprise the ability to emit fluorescence and the ability to interact with or bind to a tooth, a tooth component, or inorganic dental material.


Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention pertains. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.


Other features and advantages of the invention will be apparent from the following detailed description, and from the claims.





DESCRIPTION OF DRAWINGS


FIG. 1 is a listing of a nucleic acid sequence (SEQ ID NO:1) that encodes an exemplary BFP polypeptide (GenBank Accession No. U70497.1; GI No. 1619752).



FIG. 2 is a listing of an amino acid sequence (SEQ ID NO:2) of an exemplary BFP polypeptide (GenBank Accession No. AAB16959.1; GI No. 1619753).



FIG. 3 is a listing of an amino acid sequence (SEQ ID NO:3) of an exemplary BFP polypeptide.



FIG. 4 is a listing of the nucleic acid sequence (SEQ ID NO:4) that encodes an exemplary mussel adhesive polypeptide (GenBank Accession No. AY521220.1; GI No. 41350294).



FIG. 5 is a listing of an amino acid sequence (SEQ ID NO: 5) of an exemplary mussel adhesive polypeptide (GenBank Accession No. AAS00463; GI No. 41350295).



FIG. 6 is a listing of an amino acid sequence (SEQ ID NO: 6) of an exemplary mussel adhesive polypeptide (GenBank Accession No. AAL35297.1; GI No. 17066511).



FIG. 7 is a listing of an acid sequence (SEQ ID NO: 7) of an exemplary mussel adhesive polypeptide (GenBank Accession No. ABE01084.1; GI No. 90823165).



FIG. 8 is a listing of an amino acid sequence (SEQ ID NO: 8) of an exemplary mussel adhesive polypeptide (GenBank Accession No. AAF89290.1; GI No. 9587380).



FIG. 9 is a listing of an amino acid sequence (SEQ ID NO: 9) of an exemplary mussel adhesive polypeptide (GenBank Accession No. AAY29129.1; GI No. 63055693).



FIG. 10 is a listing of an amino acid sequence (SEQ ID NO: 10) of an exemplary mussel adhesive polypeptide (GenBank Accession No. BAB16314.1; GI No. 10641127).



FIG. 11 is a listing of an amino acid sequence (SEQ ID NO: 11) of an exemplary mussel adhesive polypeptide (GenBank Accession No. AAX23968.1; GI No. 60548042).



FIG. 12 is a listing of an amino acid sequence (SEQ ID NO: 12) of an exemplary mussel adhesive polypeptide (GenBank Accession No. AAY29131.1; GI No. 63055728).





DETAILED DESCRIPTION

This document provides methods and materials for using an adhesive molecule comprising a plurality of DOPA residues to adhere another molecule (e.g., a fluorescent molecule, a polymer, an antibiotic or other therapeutic agent, a polypeptide, a nucleic acid, or other biological moiety) to biological substrates such as bone, teeth, cartilage, or cells, and non-biological substrates such as plastic, metal, or glass. For example, this document provides methods and materials for attaching molecules to teeth for providing a whiter appearance, breath freshening, delivery of antibacterial agents, or other therapeutic uses. In some cases, this document provides methods and materials for contacting teeth with an adhesive molecule and one or more fluorescence emitting polypeptides (e.g., a blue fluorescent protein (BFP)) to provide the teeth with a whiter appearance that can be maintained after brushing. The adhesive molecule can include a plurality of DOPA residues and have the ability to interact with or bind to a tooth, a tooth component (e.g., enamel, hydroxyapatite, acquired dental pellicle, cementum, crown, cervix, cementoenamel junction, or apex), or inorganic dental materials such as crowns, caps, braces, or fillings.


Examples of adhesive molecules that can be used as described herein include mussel adhesive polypeptides (e.g., mussel foot proteins 1, 2, 3, 4, 5, 6, or combinations thereof). Mussel adhesive polypeptides can include one or more DOPA residues formed, for example, via enzymatic oxidation of tyrosine residues. For example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, percent or more of the total amino acids of a mussel adhesive polypeptide can be DOPA residues. The tyrosine residues of a recombinant polypeptide can be converted to DOPA residues using a tyrosinase (e.g., a mushroom tyrosinase). See Choi et al., Microb Cell Fact., 11:139 (2012).


A mussel adhesive polypeptide that can be used as described herein can have an amino acid sequence that is naturally occurring in any type of mussel. For example, a mussel adhesive polypeptide that can be used as described herein can have an amino acid sequence that is naturally occurring in Mytilus edulis (common blue mussel), Mytilus byssus, Mytilus galloprovincialis, Mytilus Californians, Mytilus coruscus, Mytilus trossulusor, or Perna viridis (green mussel).


For example, a mussel adhesive polypeptide that can be used as described herein includes, without limitation, mfp-5 from Mytilus galloprovincialis (GenBank Accession No. AAS00463), Mytilus edulis (GenBank Accession No. AAL35297.1), or Mytilus californianus (GenBank Accession No. ABE01084.1); mfp-3 from Mytilis californianus (GenBank Accession No. AAY29129.1) or Mytilus galloprovincialis (GenBank Accession No. BAB16314.1); or mfp-1 from Mytilus edulis (GenBank Accession No., AAX23968.1), Mytilis californianus (GenBank Accession No. AAY29131.1), or Mytilus galloprovincialis (UniProtKB/Swiss-Prot Q27409.1).


In some cases, a mfp-1 mussel adhesive polypeptide can include one or more copies of a consensus sequence such as AKPSYPPTYK (SEQ ID NO:13) or PKISYPPTYK (SEQ ID NO:14). For example, a mussel adhesive polypeptide can include 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, or 75 repeats of the consensus sequences set forth in SEQ ID NO:13 or SEQ ID NO:14. In some cases, the proline residues at position 6 and/or 7 are hydroxyproline residues. In some cases, the tyrosine residues at positions 5 and/or 9 are DOPA residues.


In some cases, a mfp-2 mussel adhesive polypeptide can include one or more copies of a consensus sequence such as TDKAYKPNPCVVSKPCKNRGKCIWNGKAYRCKCAYGYGGRHC (SEQ ID NO:15). For example, a mussel adhesive polypeptide can include 2, 4, 5, 6, 7, 8, 9, 10, or 11 repeats of the consensus sequences set forth in SEQ ID NO:15. In some cases, the tyrosine residues at positions 5, 29, 35, and/or 37 of SEQ ID NO:15 are DOPA residues.


In some cases, a mfp-3 mussel adhesive polypeptide can include one or more copies of a consensus sequence such as ADYYGPNYGPPRRYGGGNYNRYNRYGRRYGGYKGWNNGWNRGRRGKYW (SEQ ID NO:16). In some cases, the tyrosine residues at positions 3, 4, 8, 14, 19, 22, 25, 29, 32, and/or 47 of SEQ ID NO:16 are DOPA residues.


In some cases, a mfp-4 mussel adhesive polypeptide can include one or more copies of a consensus sequence such as HVHTHRVLHK (SEQ ID NO:17) or DDHVNDIAQTA (SEQ ID NO:18). For example, a mussel adhesive polypeptide can include 5, 10, 12, 14, 16, 20, 25, 30, 32, 34, 35, or 36 repeats of the consensus sequences set forth in SEQ ID NO:17 or SEQ ID NO:18.


In some cases, a mfp-5 mussel adhesive polypeptide can include one or more copies of a consensus sequence such as SSEEYKGGYYPGNAYHYSGGSYHGSGYHGGYKGKYYGKAKKYYYKYKNSGKYKYLK KARKYHRKGYKYYGGSS (SEQ ID NO:19). In some cases, the tyrosine residues at positions 5, 9, 10, 15, 17, 22, 27, 31, 35, 36, 42, 43, 44, 46, 52, 54, 61, 66, 68, and/or 69 of SEQ ID NO:19 are DOPA residues.


In some cases, a mfp-6 mussel adhesive polypeptide can include one or more copies of a consensus sequence such as GGGNYRGYCSNKGCRSGYIFYDNRGFCKYGSSSYKYDCG NYACLPRNPYGRVKYYCTKKYSCPDDFYYYNNKGYYYYNDKDYGCFNCGSYNGCCLR SGY (SEQ ID NO:20). In some cases, the tyrosine residues at positions 5, 8, 18, 21, 29, 34, 36, 41, 49, 54, 55, 60, 67, 68, 69, 74, 75, 76, 77, 82, 90, and/or 99 of SEQ ID NO:20 are DOPA residues.


In some cases, a mussel adhesive polypeptide having the amino acid sequence set forth in any one of FIGS. 5-12 or having an amino acid sequence encoded by the sequence set forth in FIG. 4 can be used as described herein.


In some cases, a mussel adhesive polypeptide can be a portion of a full-length mussel adhesive polypeptide. For example, a mussel adhesive polypeptide can be used as described herein that includes six repeats of the decapeptide AKPSYPPTYK (SEQ ID NO:13). See, Kitamura et al., J. Polymer Science: Part A: Polymer Chemistry, 37:729-736 (1991).


In some cases, a mussel adhesive polypeptide that can be used as described herein can be a chimeric polypeptide that includes six decapeptide (AKPSYPPTYK; SEQ ID NO:13) repeats of MFP-1 at both the N- and C-termini of MFP-3 (e.g., SEQ ID NO:8). See, Lim, et al., Biomaterials, 31:3715-3722 (2010); and Hwang et al., Biomaterials, 28:3560-3568 (2007). In some cases, the proline residues at position 6 and/or 7 of SEQ ID NO:13 are hydroxyproline residues. In some cases, the tyrosine residues at positions 5 and/or 9 of SEQ ID NO:13 are DOPA residues.


In some cases, a mussel adhesive polypeptide that can be used as described herein can be a chimeric polypeptide that includes six decapeptide (AKPSYPPTYK; SEQ ID NO:13) repeats of MFP-1 at both the N- and C-termini of MFP-5 (SEQ ID NO: 6). See, Lim, et al., Biomaterials, 31:3715-3722 (2010); and Hwang et al., Biomaterials, 28:3560-3568 (2007). In some cases, the proline residues at position 6 and/or 7 of SEQ ID NO:13 are hydroxyproline residues. In some cases, the tyrosine residues at positions 5 and/or 9 of SEQ ID NO:13 are DOPA residues.


Mussel adhesive polypeptides can be extracted from any type of mussel or can be recombinantly produced using polypeptide expression techniques (e.g., heterologous expression techniques using bacterial cells, insect cells, or mammalian cells). Preparations of mussel adhesive polypeptides that are extracted from mussels are commercially available from Cell-Tek (Catalog No. 354240) and ACRO Biosystems (Catalog No. MAP-04012). In some cases, mussel adhesive polypeptides can be made as described elsewhere (e.g., Kitamura et al., J. Polymer Science: Part A: Polymer Chemistry, 37:729-736 (1991); Lim et al., Biomaterials, 31: 3715-3722 (2010); and Hwang et al., Biomaterials, 28:3560-3568 (2007)). In some cases, standard polypeptide synthesis techniques (e.g., liquid-phase polypeptide synthesis techniques or solid-phase polypeptide synthesis techniques) can be used to produce mussel adhesive polypeptides synthetically.


Other examples of adhesive molecules that can be used as described herein include polymers that include a plurality of DOPA residues. The polymer can have a peptidic or non-peptidic backbone, and can be synthesized by solid phase or solution phase synthesis. Such synthesis techniques allow a high percentage of DOPA (e.g., greater than 10%, greater than 15%, greater than 20%, greater than 30% of DOPA, or greater than 40% DOPA) to be incorporated into the polymers. For example, an adhesive molecule can be a polypeptide containing a random mixture of DOPA and lysine residues, a random mixture of DOPA, lysine, and glycine residues, or random mixture of DOPA and N5-(2-hydroxyethyl)-L-Glutamine. See, for example, Wang et al., Biomaterials, 28:3456-3468 (2007); and Anderson et al., Advanced Functional Materials, 20:4196-4205 (2010). An adhesive molecule also can be a polyamino acid containing catechols. See, for example, U.S. Pat. No. 6,506,577.


An adhesive molecule can have a poly(acrylic acid) backbone with a plurality of DOPA residues. For example, an adhesive molecule can have a poly[butadiene-co-(maleic acid)] or poly[ethylene-co-(maleic acid)] backbone with a plurality of DOPA residues, and optionally a plurality of lysine residues, attached as side chains. See, for example, Laulicht et al., Macromol. Biosci., 12: 1555-1565 (2012). Such polymers containing a plurality of DOPA residues are soluble at basic pH values. The addition of lysine residues can increase the solubility at both acid and basic values. An adhesive molecule can have a polymethacrylate backbone with a plurality of DOPA residues, and optionally a plurality of lysine residues, incorporated. See, Kim et al., J. Porous Mater., 20:177-182 (2013). A polymethacrylate polymer containing a plurality of DOPA residues can be soluble at both acid and basic pH values.


In some cases, an adhesive molecule can be a DOPA containing polypeptide or a poly(dopamine) polymer. See, for example, Fuller et al., Biopolymers, 17:2939-2943 (1998); and Lee et al., Adv. Mater., 21:431-434 (2009). A poly(dopamine) polymer can be prepared, for example, by in situ polymerization.


In some cases, an adhesive molecule can be a polyethylene glycol terminated with DOPA. See, for example, Dalsin et al., J. Am. Chem. Soc., 125:4253-4258 (2003).


In some cases, the adhesive molecule and other molecule (e.g., polypeptide, nucleic acid, fluorescent moiety, antibiotic or other drug) can be applied sequentially to a substrate (e.g., a biological or non-biological substrate). For example, an adhesive molecule and one or more fluorescence emitting polypeptides can be applied sequentially, i.e., the adhesive molecule can be applied to teeth (under dry conditions, under wet conditions, or under conditions typically found in the mouth, e.g., saliva on the teeth) and then the one or more fluorescence emitting polypeptides can be applied.


In some cases, the adhesive molecule and other molecule (e.g., polypeptide, nucleic acid, fluorescent moiety, antibiotic or other drug) can be applied together, e.g., the adhesive molecule and other molecule are attached to each other (e.g., conjugated to each other). For example, an adhesive molecule and fluorescence emitting polypeptide can be conjugated to each other. In either case, the fluorescence emitting polypeptides are applied to teeth (under dry conditions, under wet conditions, or under conditions typically found in the mouth, e.g., saliva on the teeth) such that fluorescence is emitted from the teeth.


Any appropriate fluorescence emitting polypeptide can be used. For example, when the desire is to have whiter appearing teeth, a polypeptide that emits blue fluorescence can be applied to a person's teeth. Such blue fluorescence can have an emission wavelength between about 440 nm and about 500 nm (e.g., between about 450 nm and about 500 nm, between about 460 nm and about 500 nm, between about 470 nm and about 500 nm, between about 480 nm and about 500 nm, between about 440 nm and about 490 nm, between about 440 nm and about 480 nm, between about 440 nm and about 470 nm, between about 440 nm and about 460 nm, between about 450 nm and about 490 nm, or between about 460 nm and about 480 nm). In some cases, a fluorescence emitting polypeptide that emits fluorescence at an emission wavelength of between about 420 nm and about 450 nm, between about 430 nm and about 450 nm, between about 440 nm and about 450 nm, between about 420 nm and about 440 nm, or between about 485 nm and about 505 nm can be applied to teeth as described herein.


When the desire is to have teeth of a different color, a polypeptide that emits fluorescence in the red, green, or yellow spectrum can be applied to the person's teeth. Red fluorescence can have an emission wavelength between about 555 nm and about 655 nm (e.g., between about 565 nm and about 645 nm, between about 575 nm and about 635 nm, or between about 585 nm and about 625 nm). Green fluorescence can have an emission wavelength between about 500 nm and about 525 nm (e.g., between about 505 nm and about 520 nm or between about 510 nm and about 515 nm). Yellow fluorescence can have a wavelength between about 525 nm and about 555 nm (e.g., between about 530 nm and about 550 nm or 535 nm and about 545 nm). In some cases, a combination of different fluorescence emitting polypeptides can be applied to a person's teeth. For example, a combination of BFP polypeptides and red fluorescent protein (RFP) polypeptides can be applied to a person's teeth. In some cases, a combination of RFP polypeptides and green fluorescent protein (GFP) polypeptides can be applied to a person's teeth.


Any appropriate BFP polypeptide can be used as described herein. Examples of BFP polypeptides that can be used as described herein include, without limitation, EBFP (e.g., an EBFP having an emission max of 460 nm), fluorescent protein SBFP1 (GenBank® Accession No. ABM97856; GI No. 124264536), fluorescent protein SBFP2 (GenBank® Accession No. ABM97857, GI No. 124264538), EBFP2 (GenBank® Accession No. EF517318, GI No. 145666498), Azurite (Mena et al., Nature Biotechnology, 24:1569-1571 (2006)), mKalama1 (GenBank® Accession No. EF517317, GI No. 145666496), zinc finger protein 383 (GenBank® Accession No. EDU39924.1, GI No. 187972425), SEQ ID NO:445 set forth in U.S. Pat. No. 7,166,424 (GenBank® Accession No. ABN30727.1; GI No. 125148618), soluble-modified blue fluorescent protein (smBFP) (GenBank® Accession No. U70497.1; GI No. 1619752), polypeptides having the sequence set forth in GenBank® Accession No. CAE00365.1 (GI No. 32260521), polypeptides having the sequence set forth in GenBank® Accession No. CAE00361.1 (GI No. 32260509), polypeptides having the sequence set forth in GenBank® Accession No. CAE00361.1 (GI No. 32260509), ECFP polypeptides (GenBank® Accession No. ACO48275.1; GI No. 226331138), Cerulean polypeptides (GenBank® Accession No. ADE48834.1; GI No. 293612838), Fluorescent Protein Cypet polypeptides (GenBank® Accession No. 3GEX_A; GI No. 290789997), MiCy polypeptides (GenBank® Accession No. ADE48830.1; GI No. 293612833), and mTFP1 fluorescent protein polypeptides (GenBank® Accession No. ACO48263.1; GI No. 226320339). In some cases, a BFP polypeptide set forth in U.S. Patent Application Publication No. 2010/0062460 can be used as described herein.


Any appropriate RFP polypeptide and GFP polypeptide can be used as described herein. Examples of RFP polypeptides that can be used as described herein include, without limitation, soluble-modified red-shifted green fluorescent protein (smRSGFP) polypeptides (GenBank® Accession No. U70496.1; GI No. 1619750), red fluorescent protein polypeptides having the sequence set forth in GenBank® Accession No. AAG16224.1 (GI No. 10304307); AB038175.1 (GI No. 133753343); or AAU06852.1 (GI No. 51593130), Orange-Emitting Gfp-Like Protein polypeptides (GenBank® Accession No. 2ZMW_D; GI No. 209870302), mOrange fluorescent protein polypeptides (GenBank® Accession No. ACO48285.1; GI No. 226331152), NLS-dTomato polypeptides (GenBank® Accession No. ADC42843.1; GI No. 288188779), red fluorescent protein tdTomato polypeptides (GenBank® Accession No. ACQ43939.1; GI No. 228484713), DsRed polypeptides (GenBank® Accession No. BAE53441.1; GI No. 83016748), DsRed2 polypeptides (GenBank® Accession No. AAV73970.1; GI No. 56119204), DsRed-Express polypeptides (GenBank® Accession No. ACU30027.1; GI No. 255689290), DsRed-Monomer polypeptides (GenBank® Accession No. ACF35425.1; GI No. 194245628), monomeric orange-red fluorescent protein polypeptides (GenBank® Accession No. AAV52170.1; GI No. 55420625), monomeric orange-red fluorescent protein polypeptide (GenBank® Accession No. AAV52166.1; GI No. 55420617), mCherry polypeptides (GenBank® Accession No. ACY24904.1; GI No. 262089840), polypeptides having the amino acid sequence of SEQ ID NO:3 set forth in U.S. Pat. No. 7,393,923 (GenBank Accession No. ACH06540.1; GI No. 197013979), and polypeptides having the amino acid sequence of SEQ ID NO:5 set forth in U.S. Pat. No. 7,393,923 (GenBank® Accession No. ACH06541.1; GI No. 197013980).


Examples of GFP polypeptides that can be used as described herein include, without limitation, soluble-modified green fluorescent protein (smGFP) polypeptides (GenBank® Accession No. U70495.1; GI No. 1619748), modified green fluorescent protein GFP-ER (mfgp4-ER) polypeptides (GenBank® Accession No. U87625.1; GI No. 1842446), GFP polypeptides (GenBank® Accession No. ACJ06700.1, GI No. 210076685), enhanced GFP polypeptides (GenBank® Accession No. ACV20892.1; GI No. 256708579), turboGFP polypeptides (GenBank® Accession No. ADD23343.1; GI No. 290131407), VisGreen GFP polypeptides (GenBank® Accession No. ABR26680.1; GI No. 149393496), and Azami-Green polypeptides (GenBank® Accession No. BAD52001.1; GI No. 52839539).


In some cases, a fluorescence emitting polypeptide such as those described by Subach et al. (Chem. Biol., 15:1116-1124 (2008)) can be used as described herein. See, also, GenBank® Accession No. 3M24_A (GI No. 296863586), GenBank® Accession No. 3M24_B (GI:296863587), GenBank® Accession No. 3M24_C (GI:296863588), and GenBank® Accession No. 3M24 D (GI:296863589). Additional examples of fluorescence emitting polypeptides that can be used as described herein include, without limitation, those described elsewhere (Alieva et al. PLoS ONE, 3(7):e2680 (2008) and Chudafov et al., Physiol. Rev., 90:1103-1163 (2010)). See, e.g., Table 1 of the Alieva et al. reference and FIGS. 5, 10, 12, and 14 of the Chudafov et al. reference. In some cases, a coral fluorescence emitting polypeptide can be used as described herein. In some cases, a fluorescence emitting polypeptide having the amino acid sequence set forth in FIG. 2 or 3 or having an amino acid sequence encoded by the sequence set forth in FIG. 1 can be used as described herein.


Any appropriate method can be used to make a fluorescence emitting polypeptide. For example, polypeptide expression techniques (e.g., heterologous expression techniques using bacterial cells, insect cells, or mammalian cells) can be used to make a fluorescence emitting polypeptide. In some cases, fluorescence emitting polypeptides such as BFP polypeptides can be made as described elsewhere (Yakhnin et al., Protein Expr. Purif., 14:382-386 (1998) and Jain et al., J. Chromatography A, 1035:83-86 (2004)). In some cases, standard polypeptide synthesis techniques (e.g., liquid-phase polypeptide synthesis techniques or solid-phase polypeptide synthesis techniques) can be used to produce fluorescence emitting polypeptides synthetically.


A fluorescence emitting polypeptide can be covalently or non-covalently attached to an adhesive molecule such as a mussel adhesive polypeptide or polymer containing a plurality of DOPA residues.


Any appropriate method can be used to covalently or non-covalently attach a fluorescence emitting polypeptide to a molecule (e.g., a polypeptide or polymer) having the ability to interact with or bind to a tooth or a tooth component. For example, a fluorescence emitting polypeptide such as a BFP polypeptide can be chemically conjugated to a mussel adhesive polypeptide or polymer via one or more coordinate covalent bonds, covalent bonds, disulfide bonds, high energy bonds, hydrogen bonds, ionic bonds, or peptide bonds. In some cases, a fluorescence emitting polypeptide can be chemically conjugated to an amine group present on a polypeptide having the ability to interact with or bind to a tooth or a tooth component (e.g., a mussel adhesive polypeptide). Such an amine group can be located at the N-terminus of the polypeptide, the C-terminus of the polypeptide, or in between the N- and C-termini of the polypeptide.


In some cases, the polypeptides to be conjugated can be activated prior to conjugation. For example, a polypeptide (e.g., a mussel adhesive polypeptide) can be activated by incorporation of a reactive thiol group. For example, a mussel adhesive polypeptide can be thiolated by reaction with 2-iminothiolane (e.g., a Traut's reagent) as described elsewhere (McCall et al., Bioconjugate Chem., 1:222-226 (1990)). The reaction conditions can be varied to maximize the yield of molecules activated with one or two thiols to decrease the possibility that conjugation may interfere with teeth binding. The degree of thiol incorporation can be measured using a sensitive fluorescence assay as described elsewhere (Lacy et al., Analytical Biochemistry, 382:66-68 (2008)).


A fluorescence emitting polypeptide can be substituted with one or more maleimide groups via reaction of the polypeptide's amines with a bifunctional reagent containing a maleimide group and a reactive N-hydroxysuccinimide ester. The maleimide substituted fluorescence emitting polypeptide can then be conjugated to the thiol groups of the polypeptide having the ability to interact with or bind to a tooth or a tooth component. The degree to which the fluorescence emitting polypeptide is substituted with maleimide groups can be varied as described elsewhere (Singh, Bioconjugate Chem., 5:348-351 (1994)).


Additional examples of conjugation methods that can be used to conjugate a fluorescence emitting polypeptide to a molecule (e.g., a polypeptide) having the ability to interact with or bind to a tooth or a tooth component include, without limitation, those described in elsewhere (e.g., Hermanson, G. T. Bioconjugate Techniques, Second Edition, 2008, Elsevier). See, e.g., Part I, Section 4 and Part II, Section 5.


In some cases, the fluorescent signal that is obtained using the methods and materials provided herein can be enhanced by linking multiple fluorescence emitting polypeptides to a single molecule (e.g., a polypeptide) having the ability to interact with or bind to a tooth or a tooth component. Because of steric effects, this amplification can be effectively accomplished by first preparing a polymer containing multiple fluorescence emitting polypeptides and then linking this polymer to an adhesive molecule (e.g., a mussel adhesive polypeptide) having the ability to interact with or bind to a tooth or a tooth component. In some cases, a polymer can be formed to have multiple fluorescence emitting polypeptides linked to a polypeptide such as a casein polypeptide, and this polymer can be applied with the adhesive molecule. Examples of methods (e.g., polymerization methods) that can be used to form polymers containing multiple fluorescence emitting polypeptides include, without limitation, those described elsewhere (e.g., Hermanson, G. T. Bioconjugate Techniques, Second Edition, 2008, Elsevier). See, e.g., Part II, Section 25. See also U.S. Patent Publication No. 2010/0203533; U.S. Patent Publication No. 2013/0022555, including the sections describing conjugations to casein polypeptides; U.S. Pat. No. 4,657,853; and Hoshino et al., J. Biochem. 102:785-791 (1987).


In some cases, a fluorescence emitting polypeptide can be produced as a fusion or chimeric polypeptide with a polypeptide having the ability to interact with or bind to a tooth or a tooth component. For example, heterologous polypeptide expression techniques or synthetic polypeptide synthesis techniques can be used to produce a single polypeptide chain having an amino acid sequence of a fluorescence emitting polypeptide and an amino acid sequence of a polypeptide having the ability to interact with or bind to a tooth or a tooth component. In some cases, the single polypeptide chain can have (a) an amino acid sequence of a fluorescence emitting polypeptide followed by an amino acid sequence of a polypeptide having the ability to interact with or bind to a tooth or a tooth component or (b) an amino acid sequence of a polypeptide having the ability to interact with or bind to a tooth or a tooth component followed by an amino acid sequence of a fluorescence emitting polypeptide. In some cases, the single polypeptide chain can have one or more (e.g., one, two, three, four, or five) amino acid sequences with each encoding a fluorescence emitting polypeptide and one or more (e.g., one, two, three, four, or five) amino acid sequences with each encoding a polypeptide having the ability to interact with or bind to a tooth or a tooth component.


In some cases, a fusion or chimeric polypeptide provided herein can include other amino acid sequences (e.g., spacers or binding residues). For example, a fusion or chimeric polypeptide having an amino acid sequence of a fluorescence emitting polypeptide and an amino acid sequence of a polypeptide having the ability to interact with or bind to a tooth or a tooth component can include one or more additional amino acid residues such as glycine, lysine, alanine, arginine, asparagine, aspartic acid, cysteine, glutamine acid, glutamine, isoleucine, leucine, methionine, phenylalanine, threonine, tryptophan, proline, histidine, valine serine, tyrosine, ornithine, taurine, pyrolysine, or seleocysteine residues, or amino acid derivatives (e.g., 5-hydroxytryptophan, L-dihydroxyphenylalanine, or α-difluoromethylornithine). Such additional amino acid residues can be designed to be spacers (e.g., a string of five or more glycine residues) or can be designed to allow polypeptides or other molecules to be chemically conjugated to the fusion or chimeric polypeptide. For example, a fusion or chimeric polypeptide having an amino acid sequence of a fluorescence emitting polypeptide and an amino acid sequence of a polypeptide having the ability to interact with or bind to a tooth or a tooth component can include one, two, three, four, five, or more additional lysine residues such that one or more polypeptides having the ability to interact with or bind to a tooth or a tooth component (e.g., mussel adhesive polypeptides) can be chemically conjugated to the fusion or chimeric polypeptide.


The methods described herein can include applying whitening particles to teeth instead of, or in addition to, the fluorescence emitting polypeptide, to provide the teeth with a whiter appearance. Whitening particles can be nanoparticles composed of titanium dioxide. Other useful whitening particles can be composed of silicon dioxide, hydroxyapatite, zirconium silicate, calcium phosphate, or zinc oxide. See, e.g., Photochem. Photobiol. Sci., 9, 495-509 (2010); and U.S. Pat. No. 6,004,567. In some cases, adhesive molecules and whitening particles can be applied sequentially, i.e., the adhesive molecule can be applied to teeth and then the whitening particles can be applied. In some cases, the adhesive molecule and whitening particles can be applied at the same time. In some cases, the adhesive molecule, the fluorescence emitting polypeptide, and the whitening particles are applied sequentially. In some cases, the adhesive molecule, the fluorescence emitting polypeptide, and the whitening particles are applied at the same time. In some cases, using the whitening particles in combination with the fluorescence emitting polypeptides can help even out the whiter appearance of the teeth.


A composition provided herein containing an adhesive molecule and one or more other molecules (e.g., a composition containing an adhesive molecule attached to an antibiotic or other therapeutic molecule such as insulin or human growth hormone) can be administered to a subject to deliver the other molecule(s) to particular locations within a body. For example, a composition containing an adhesive molecule and an antibiotic can be formulated as a gel, mouthrinse, mouthwash, or deodorant. In some cases, the composition can include one or more pharmaceutical excipients.


A composition provided herein containing an adhesive molecule and a fluorescence emitting polypeptide (e.g., a composition containing a fluorescence emitting polypeptide/mussel adhesive polypeptide conjugate, or a fluorescence emitting polypeptide/mussel adhesive polypeptide fusion polypeptide) can be applied to teeth under dry or wet conditions to alter the appearance of the teeth. In some cases, the composition can be applied under typical conditions found in the mouth (e.g., the presence of saliva). A composition provided herein containing an adhesive molecule and whitening particles (e.g., a composition containing an adhesive molecule and titanium dioxide nanoparticles) can be applied to teeth under dry or wet conditions to alter the appearance of the teeth.


A composition provided herein containing an adhesive molecule, a fluorescence emitting polypeptide, and whitening particles (e.g., a composition titanium dioxide nanoparticles and a fluorescence emitting polypeptide/mussel adhesive polypeptide conjugate or a fluorescence emitting polypeptide/mussel adhesive polypeptide fusion polypeptide) can be applied to teeth under dry or wet conditions to alter the appearance of the teeth. In some cases, the composition can be applied under typical conditions found in the mouth (e.g., the presence of saliva).


Any appropriate method can be used to deliver a composition provided herein to teeth. For example, a composition provided herein can be incorporated into a tooth paste, a mouth wash, a mouth rinse, an ingestable substance such as a drink or a food product, gum, gels (an application gel), powders, or creams.


In some cases, an effective amount of the adhesive molecule and fluorescence emitting polypeptide and/or whitening particles can be delivered to teeth such that the appearance of the teeth is altered.


In some cases, an effective amount of a composition provided herein can be delivered to teeth such that the appearance of the teeth is altered (e.g., the appearance of the teeth becomes whiter). An effective amount of adhesive molecules, fluorescence emitting polypeptides, and/or whitening particles, or a composition provided herein can be any amount that alters the appearance of teeth without inducing significant toxicity. For example, a composition provided herein can be incorporated into a tooth paste, mouth rinse, or gel product in an amount that results in between about 0.0001 mg and about 100 mg (e.g., between about 0.001 mg and about 100 mg, between about 0.01 mg and about 100 mg, between about 0.1 mg and about 100 mg, between about 0.5 mg and about 100 mg, between about 0.5 mg and about 50 mg, between about 0.5 mg and about 25 mg, between about 1 mg and about 100 mg, between about 1 mg and about 50 mg, or between about 1 mg and about 25 mg) of fluorescence emitting polypeptide per gram of tooth paste. It will be appreciated that the amount can be higher for certain formulations, e.g., mouthwash.


In some cases, a composition provided herein can be applied to teeth for a period of time prior to washing, swallowing, or removal such that the appearance of the teeth is altered (e.g., the appearance of the teeth becomes whiter). For example, a tooth paste or application configured to include an adhesive molecule and a fluorescence emitting polypeptide and/or whitening particles as described herein can be applied (e.g., directly applied) to teeth and remain in contact with those teeth, without rinsing, for between 30 seconds and 10 minutes (e.g., between 30 seconds and 5 minutes, between 30 seconds and 2.5 minutes, between 30 seconds and two minutes, between 1 minute and 10 minutes, between 2 minutes and 10 minutes, or between one minute and 5 minutes). In some cases such as with a mouth wash, mouth rinse, application gel or ingested substance, the composition is allowed to be in contact with the teeth for a period of time for the composition to saturate the teeth or tooth component. The compositions described herein can be applied to teeth under wet or dry conditions.


In some cases, a person's teeth can be prepared prior to delivering a composition provided herein. For example, a person's teeth can be washed, brushed, or polished (e.g., polished with pumice) prior to delivering a composition provided herein. In some cases, the surface of the tooth or teeth to be treated can be treated with one or more agents capable of exposing calcium phosphate binding sites. For example, teeth to be treated with a composition provided herein can be contacted with EDTA or phosphoric acid to expose calcium phosphate binding sites present on the teeth. In the case of phosphoric acid treatment, only the tooth enamel can be exposed to the acid to prevent or reduce the risk of soft tissue damage.


In some cases, a two or more step process can be used to apply the adhesive molecule and fluorescence emitting polypeptide to teeth. For example, a composition containing an adhesive molecule (e.g., mussel adhesive polypeptide or polymer containing a plurality of DOPA residues) having the ability to interact with or bind to a tooth, a tooth component, or inorganic dental material can be delivered to the teeth to be treated as one step followed by a step of delivering a fluorescence emitting polypeptide having the ability to interact with or bind to the delivered molecule. In some case, these two steps can be performed at the same time using a single composition that contains the molecule separate from the fluorescence emitting polypeptide or using separate compositions where one composition contains the adhesive molecule and another composition contains the fluorescence emitting polypeptide.


In some cases, an assay can be performed to confirm that a composition provided herein or a component of a composition provided herein (e.g., a mussel adhesive polypeptide or polymer containing a plurality of DOPA residues) has binding affinity for teeth, a tooth component, or inorganic dental material. For example, a material to be tested can be incubated with a hydroxyapatite (HA) matrix and the amount of material in solution after HA binding can be compared with the initial concentration to determine, by difference, the amount of bound material. See, e.g., Raj et al., J. Biol. Chem., 267:5968-5976 (1992). In some cases, the HA bound material can be directly measured after dissolving the HA matrix with EDTA (Lamkin et al., J. Dent. Res., 75:803-808 (1996)). In the case of a polypeptide material, the polypeptide concentration in solution can be measured using a bicinchoninic acid assay and/or an ortho-phthalaldehyde amine assay. Binding constants can be determined using the Langmuir Model (Bouropoulos and Moradian-Oldak, Calcif. Tissue Int., 72:599-603 (2003)). In some case, an assay can be performed with an HA matrix that was pre-incubated with human saliva to coat the HA with proteins as described elsewhere (Lamkin et al., J. Dent. Res., 75:803-808 (1996)). In such cases, unbound saliva proteins can be removed by washing since their presence may interfere with the polypeptide concentration determinations.


Any appropriate method can be used to assess the affinity of a composition provided herein for teeth or an HA matrix. For example, bound and unbound compositions can be quantified by measuring the fluorescence of the fluorescence emitting polypeptide of the composition. The ability to utilize fluorescence for quantification can allow for one to measure the binding of the composition to HA in the presence of human saliva. In some cases, a composition provided herein can be assessed for the ability to bind in vitro to human teeth. The teeth can be subjected to different degrees of cleaning, such as brushing or polishing with pumice. The teeth can then be treated with human saliva to form the acquired dental pellicle and incubated with a composition provided herein in the presence and absence of saliva. The binding to teeth can be determined both by measuring the bound and unbound fluorescence. The extraction of bound fluorescence emitting polypeptides from teeth can be completed using gentle procedures. For example, teeth can be swabbed with filter paper collection strips, and the polypeptides can be extracted from the paper under mild conditions as described elsewhere (Siqueira and Oppenheim, Archives of Oral Biology, 54:437-444 (2009)). In some cases, the teeth can be analyzed by fluorescence microscopy to assess the relative amount of fluorescence emitting polypeptide bound under different conditions.


Any appropriate method can be used to assess a composition provided herein for the ability to alter the appearance of teeth. For example, visual inspection techniques can be used to determine whether or not a composition provided herein can alter the appearance of teeth. Such visual inspection techniques can include using shade guides for comparison as described elsewhere (Paravina et al., J. Esthet. Reston. Dent., 19:276-283 (2007)). In some cases, the ability of a composition provided herein to alter the appearance of teeth (e.g., to make teeth appear whiter) can be measured using reflectance spectrophotometry. In such cases, the teeth can be illuminated with a white light source and analyzed as to the amount of light absorbed at different wavelengths by reflectance spectrophotometry (colorimetry). These measurements can then be repeated with the UV light filtered from the light source. The difference in the reflectance values obtained with the inclusion and exclusion of UV light is the UV fluorescence spectrum of the tooth surface (see, e.g., Park et al., M. Dental Materials, 23:731-735 (2007)).


A composition provided herein can have a low risk of toxicity to the person using the composition, can contain one or more polypeptides of human origin, can contain one or more polypeptides naturally present in food or drink products, and/or can lack potentially toxic dyes.


The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.


EXAMPLES
Example 1
DOPA Content of Mussel Adhesive Polypeptides

A UV difference assay was used to determine the DOPA content of recombinant mussel adhesive polypeptides (MAP 22.6 kDa, catalog #260012; MAP 37 kDa, catalog #260022, purchased from Amsbio) as well as commercially extracted, native mussel adhesive polypeptides (purchased from Cell-Tak and ACRO Biosystems). The recombinant polypeptides are single chain polypeptides that contain sequences from both MFP-1 and MFP-5.


In the UV difference assay, the difference in absorption is measured in two different solutions; 0.2 M borate buffer, pH 8.0, and 0.2 M HCl. L-DOPA forms complexes with borate that causes a shift in the absorption at pH 8.0. The difference in absorption between 0.2 M HCl and 0.2 M borate buffer is greatest at 292 nm, the wavelength at which the samples are measured. A sample containing an unknown amount of DOPA is diluted into 0.2 M borate buffer or 0.2 M HCl using the same dilution factor. The absorption is measured and the absorption difference is calculated. The DOPA content is calculated using Lambert-Beer' Law with an extinction coefficient of 1885 M−1 cm−1. The assay is measured at room temperature. It was found that a good range to measure the DOPA content was between 25 to 200 μM L-DOPA.


The recombinant 22.6 kDa mussel adhesive polypeptide had a DOPA content of 10.8%. The recombinant 37 kDa mussel adhesive polypeptide had a DOPA content of 3.9%. The mussel adhesive polypeptides from ACRO and Cell-Tak precipitated in the assay so their DOPA content was not measured by this method.


Example 2
Oxidative Stability of DOPA Residues

Experiments were performed to test the susceptibility of DOPA residues to oxidation at different pH values to ensure that the subsequent conjugation reactions did not result in the oxidation of the DOPA residues. Both a colorimetric assay and a UV assay (as described in Example 1) were used to monitor the stability of the DOPA residues. In the colorimetric assay, a stock solution of 10 mM DOPA was prepared in 1% acetic acid and used to prepare a standard curve from 500 μM to 0 μM DOPA. The samples were diluted 1:10 into a variety of different buffers and 1 M NaOH was used to insure that the pH of the buffer solution remained at the desired value. The samples were incubated at room temperature and samples were taken every couple of hours and diluted into 1% acetic acid to determine the extend of DOPA oxidation.


When L-DOPA is oxidized in the presence of tetrazolium blue (TZB), the TZB is reduced to its pink-purple colored di-formazan form in a non-aqueous medium. The maximum absorption is found at 525 nm. A master mix solution containing TZB is added to the standard curve samples and the unknown samples. The master mix has a final TZB concentration of 0.25 mg/ml in ethanol containing 0.01% w/v KOH. In some cases small amounts of NaOH were added to achieve a pH of 12 or higher. The assay is incubated at 37 C, for 30 min., the samples are cooled back to room temperature, and their absorption at 525 nm is measured.


Samples were also inspected by eye and in some cases pictures of the oxidized samples were taken. Oxidation of DOPA was indicated by a brown to dark brown coloration of DOPA.


It was determined that DOPA was stable to oxidation for at least 24 hours in pH 5 acetate, pH 7 HEPES, and pH 8 borate buffer. In pH 8.5 and pH 9.0 bicarbonate buffers, most of the DOPA oxidized in 24 hours. Borate buffer at pH 8 and 8.5 prevented oxidation of DOPA residues. DOPA residues in this case are assumed to form a complex with the borate ion that is stable to oxidation.


Example 3
BFP—Stability at Acid pH Values

The stability of BFP in acid was assessed by incubating the protein (66 μg/ml) in phosphate buffered saline (PBS), 1% acetic acid (pH ˜2.7), 5% acetic acid (pH ˜2.4), acetate, pH 4, or acetate pH 5 for up to 72 hours, and then measuring the fluorescence. The BFP stock solution was at a concentration 4 mg/mL in PBS and was diluted in respective pH solution at ratio 1:60 v/v.


BFP was stable for several days at pH values≧4. In contrast, fluorescence was lost in 1% acetic acid (pH ˜2.7) and 5% acetic acid (pH ˜2.4). When the same experiments were performed in the presence of 0.05% Tween 20, BFP was unstable at pH 4 but remained stable at pH values pH≧5.


In BFP samples incubated with 1% acetic acid, over 50% of the fluorescence was restored by increasing the pH to 8. In contrast, in BFP samples incubated for 3 hours in 5% acetic acid, no activity was restored by increasing the pH.


Example 4
Binding of Different MAP Proteins to Teeth

In order to compare the binding of different mussel adhesive polypeptides to bovine teeth, the amount of protein bound per a fixed tooth surface area was determined. Because each tooth is unique in its size and shape, the surface area from tooth to tooth is different and it is difficult to calculate the surface area. A method was developed to standardize the surface area for each tooth by adhering a small polypropylene cup onto the tooth using silicone as a sealant. In this way the amount of protein bound to a fixed tooth surface area can be measured and is independent of tooth variations.


The binding of the mussel adhesive polypeptides described in Example 1 to bovine teeth was assessed. Bovine teeth were incubated with different MAPs for 2 hours at 37° C. using a range of different amounts of MAP from 15 μg to 0 μg (negative control). Different buffers were used to investigate binding at different pH values (carbonate buffer pH 9; 0.2 M MOPS pH 7; 0.2 M acetate buffer pH 5; 1% acetic acid pH 2.75). After binding, unbound protein was washed away with water, and the amount of protein bound was measured via a colorimetric assay (Bradford). Binding was observed with the recombinant 22.6 kDa polypeptide, the recombinant 37 kDa polypeptide, and the Cell-Tek sample, with the recombinant 22.6 kDa polypeptide having the best binding. Significant binding was not observed with the ACRO sample.


To establish how different tooth pre-treatments affected the binding of the mussel adhesive polypeptides, the bovine teeth were cleaned and pumiced. Two sets of teeth were further treated with either 5% EDTA, pH 7 or 5% citric acid, and the binding of the recombinant 22.6 kDa and 37 kDa polypeptides, and the Cell-Tak product were tested. The best binding was observed when the bovine teeth were pretreated with citric acid. The recombinant 22.6 kDa and 37 kDa polypeptides had similar binding after citric acid pretreatment. However, this is a harsh treatment and may not be useful for treatment of humans. For teeth pretreated with either EDTA or water, the recombinant 22.6 kDa polypeptide had the highest amount of binding.


In another experiment, a small volume of mussel adhesive polypeptide was applied to bovine teeth using the silicone ring method, dried at 37° C. for about 90 minutes, and then extensively washed with water. A film could be seen as a circle in the middle of the teeth. The teeth were then brushed using a toothbrush and water. After brushing, the mussel adhesive polypeptide film could not be easily seen. To detect binding, teeth were stained with Coomassie blue (Coomassie Brilliant Blue R-250 staining solution from BioRad, Cat. No. 161-0436) for 1 min, washed in water, inspected for Coomassie stain, brushed with toothpaste and inspected again for Coomassie stain. The brushing step removed non-specifically bound Coomassie blue.


Using the Coomassie staining procedure, it was clear that the polypeptide remained on the teeth after brushing. The stained mussel adhesive polypeptide could not be removed from the teeth by brushing with toothpaste.


Other experiments were performed by adding small amounts of mussel adhesive polypeptides (MAP 22 kDa), MAP precursor (a recombinant MAP in which tyrosine residues are not converted to DOPA residues) or bovine serum albumin (BSA) in 1% acetic acid to bovine teeth and allowing the teeth to dry at 37° C. The samples were washed, stained with Coomassie Blue, washed again, photographed, and then brushed with toothpaste. MAP, MAP precursor, and BSA all bound to teeth after drying in 1% acetic acid, and remained on the teeth after brushing. In contrast, casein and BFP do not significantly bind to teeth under these conditions. Incubation for 1, 2, or 4 hours did not change the amount of binding. Similar results were observed with human teeth.


In another experiment, MAP and MAP Precursor in 1% acetic acid were incubated on teeth without drying for 3.5 hours. Only the MAP bound under these conditions, as determined by Coomassie staining, and remained after brushing. Qualitatively, it appears that MAP dried onto teeth is more resistant to brushing than MAP bound to teeth under wet conditions.


To determine the affect of pH, MAP was incubated on teeth without drying at pH 2.7 (1% acetic acid), pH 5.3 acetate buffer), and pH 7.3 HEPES buffer for 3.5 hours. After washing with water and drying, no film was visible on any tooth. Treatment with Coomassie resulted in strong staining for the 1% acetic acid treated teeth, weak staining for the pH 5.3 treated teeth, and no apparent staining for the pH 7 treated teeth.


Example 5
Preparation of Mussel Adhesive Polypeptide-BFP Conjugates

The 22.6 kDa mussel adhesive polypeptide (MAP) was activated for conjugation by thiolating the lysine residues using Traut's reagent (2-iminothiolane (IT)). The polypeptide (0.4 mg/ml) was incubated with 1.8 mM or 5 mM IT at pH 8 for 40 minutes at room temperature in the presence of sodium borate to protect the DOPA residues of the mussel adhesive polypeptide from oxidation. Two batches of MAP were produced with different numbers of thiols attached, MAP-Hi-SH (5 mM IT) and MAP-Lo-SH (1.8 mM IT).


BFP (1 mg/mL) was activated with two concentrations of maleimide (MAL-dPEG4-NHS ester; Quanta BioDesign, catalog #10214; 0.3 mg/ml, 0.6 mg/ml). This resulted in two batches of BFP with different numbers of maleimides attached, BFP-Hi-MAL (0.6 mg/ml MAL-dPEG4-NHS ester) and BFP-low-MAL (0.3 mg/ml MAL-dPEG4-NHS ester).


A series of small scale (analytical amounts of protein) conjugation reactions were performed that contained the following:

    • Three reactions containing MAP-Lo-SH+BFP-Lo-MAL at MAP/BFP ratios of 3:1, 1:1, and 1:3
    • Three reactions containing MAP-Lo-SH+BFP-Hi-MAL at MAP/BFP ratios of 3:1, 1:1, and 1:3
    • Three reactions containing MAP-Hi-SH+BFP-Lo-MAL at MAP/BFP ratios of 3:1, 1:1, and 1:3
    • Three reactions containing MAP-Hi-SH+BFP-Hi-MAL at MAP/BFP ratios of 3:1, 1:1, and 1:3.


The reaction products were analyzed by SDS-PAGE. All of the MAP was converted to conjugate when using a MAP:BFP ratio of 1:3 and MAP-hi-SH+BFP-hi-MAL. When MAP: BFP ratios of 3:1 and 1:1 were used, lower amounts of conjugates were produced, with a slightly different molecular weight pattern observed on the gel.


In a medium scale conjugation ((1.4 mg-5.6 mg total protein), two MAP-BFP conjugates were prepared with a 1:1 MAP to BFP ratio and a 1:3 MAP:BFP ratio. A precipitate formed during the conjugation reactions and the yields of soluble conjugate were low. Precipitation also may have occurred in the small scale reaction described above, but the small volumes made any precipitate difficult to see. The soluble reaction products were analyzed by SDS-PAGE. The precipitate also was analyzed by SDS Page electrophoresis and appeared to contain a large polymer that did not enter the SDS gel.


Example 6
Binding of MAP Conjugates to Teeth

Bovine teeth were prepared for binding experiments by first cleaning them with a toothbrush and toothpaste and then pumicing them using a hand held dental polisher with a rubber cup. In certain experiments, teeth were incubated for 2 hours at room temperature with either 5% Disodium EDTA or 7.5% Citric Acid.


The precipitate from the 1:1 MAP/BFP medium scale reaction (Example 5) was converted to a cloudy suspension by pipetting the precipitate in pH 5 acetate buffer up and down multiple times. This suspension was dried onto the citric acid treated bovine teeth and formed a fairly homogeneous coating that was visible to the naked eye. This coating was not removed by extensive washing and showed strong fluorescence when illuminated with the 360 nm lamp.


The coating had a slight yellow tinge. It was determined that when the recombinant 22.6 kDa polypeptide was dissolved in acetic acid, the solution was yellow. In contrast, when the recombinant 37 kDa polypeptide was dissolved in acetic acid, the solution was clear. Since both of these products contain the same components (mfp1+mfp5), it is likely that there was a difference in their preparation. As such, the yellow tinge can be avoided by preparing the adhesive polypeptides under conditions in which the oxidation of the DOPA residues is minimized.


Example 7
Analysis of BFP-MAP Conjugate Precipitates Dried on Human Teeth

The re-suspended precipitates formed in the medium scale reactions between activated MAP and activated BFP (Example 5) were applied to human teeth, washed extensively with water, and then analyzed for whitening by photography in the presence of lighting that mimicked outdoor conditions. Two application methods were used. In the “silicone ring” method, the conjugate was added to a tooth area bounded by a silicone ring and dried. In the “submerged” method, the tooth was incubated in a conjugate suspension overnight.


Using the silicone ring method, the MAP conjugate formed a coating on the teeth that had a visible yellow tint. Although a significant amount of BFP:MAP conjugate bound to teeth, the yellow tint hid any whitening that may have occurred due to the immobilization of BFP on the tooth (in most cases, the D shades decreased rather than increased indicating that the surface was less white than before treatment, see Table 2). No coating was visible using the Submerged Method (see Table 1).














TABLE 1







Tooth
BFP:MAP
Application




id
Ratio
Method
D shades





















131
1:1
Silicon ring
−2



132
1:1
Silicon ring
−3



133
1:3
Silicon ring
−1



134
1:3
Silicon ring
2



135
Control
Silicon ring
1



136
1:1
Submerged
0



137
1:3
Submerged
0



138
Control
Submerged
0










In order to obtain a semi-quantitative measure of BFP immobilized on the teeth, the values of blue light that were obtained after eliminating the red and green channels were calculated. This measurement is affected less by the yellow tint in the coating. The results are shown below in Table 2.









TABLE 2







BFP - MAP Conjugate and BFP-P-MAP Conjugate


Application: Measurement of Enhancement in


Blue channel Before and After Treatment












Tooth
BFP:MAP
Application
Before
After



id
Ratio
method
Blue
Blue
D blue















131
1:1
Silicon ring
188.21
201.02
12.80


132
1:1
Silicon ring
212.14
219.42
7.27


133
1:3
Silicon ring
201.74
203.98
2.24


134
1:3
Silicon ring
227.92
230.67
2.75


135
Control
Silicon ring
207.53
206.15
−1.38









The blue channel had significantly higher values for the 1:1 conjugate that was dried onto the teeth. The blue channel value is also higher than previously found for binding of the casein-BFP conjugate to pumiced teeth.


Example 8
Preparation of BFP Polymer-MAP Conjugate

BFP polymer was prepared and activated as follows. BFP was split into two batches; one batch was activated with Trauts reagents to add thiol groups to BFP and the second batch was activated with MAL-dPEG4-NHS ester to add maleimide groups to BFP. The activation of BFP with Trauts reagent was done in 50 mM borate buffer pH 8.0 containing 2 mM EDTA and 0.05% Tween-20. The final concentration of iminothiolane was 45 mM. BFP was kept at 1 mg/ml. The reaction was incubated at RT for 40 min. Unreacted IT was removed from the reaction by gel filtration in 50 mM phosphate buffer, 2 mM EDTA, 0.05% Tween-20 pH 7.0. In the maleimide reaction, BFP was at a concentration of 1 mg/ml and MAL-dPEG4-NHS ester was added to yield a final concentration of 3 mg/ml in a buffer of 50 mM phosphate, 2 mM EDTA, 0.05% Tween-20. The reaction was incubated for 40 min at room temperature. Unreacted MAL-dPEG4-NHS ester was separated from BFP-M by gel filtration chromatography on a Sephadex G25 column (GE Healthcare) in 5 mM MES, 2 mM EDTA, 0.05% Tween-20, pH 6.


The two activated BFP species were then reacted together to form poly-BFP. Activated BFP species were combined at a 1:3 ratio of BFP-maleimide and BFP-SH and incubated for 1 hour at room temperature in 50 mM phosphate buffer, pH 7.0, 2 mM EDTA, 0.05% Tween-20. The reaction was quenched with NMM. The sample was concentrated and applied to a size exclusion column (Superdex 200, GE Healthcare) to separate poly-BFP of different sizes and to remove unreacted BFP.


In order to react poly-BFP with MAP-SH, a BFP-poly fraction with molecular weight of more than 220 kDa was used. Polymeric BFP was activated by reaction with 0.33 mg/mL MAL-dPEG4-NHS ester in a 50 mM phosphate buffer containing 2 mM EDTA and 0.05% Tween 20 at pH 7 and, after unreacted reagent was removed by gel filtration, reacted with MAP-SH (activated with 5 mM iminothiolane) at different MAP/BFP ratios (MAP: BFP; 4:1; 2:1; 1:1; 1:2; 1:4). It was found that ˜75% of the BFP precipitated at high MAP/BFP ratios of 1:2 or 1:4. Under these conditions, there was sufficient MAP to coat the polymeric BFP and further polymerization or aggregation followed by precipitation did not occur. Increasing the relative amount of BFP in the conjugation decreased the amount of BFP in the precipitate.


Example 9
Successive Binding of MAP and BFP to Teeth (Double Sided Tape)

Binding of the native MAP (ACRO Biosystems; referred to as MAP1) or recombinant MAP (Amsbio; 22.6 kDa referred to as MAP2; 37 kDa referred to as MAP3), and BFP to bovine teeth was assessed by applying the MAP followed by the BFP to teeth. The MAP were incubated in sodium borate (SB) buffer, pH 8.0 for 4 hours at 37° C. followed by incubation with BFP (1 mg/ml) overnight at 37° C. For MAP 1, the concentration was 20 μg in 1 mL; for MAP 2, the concentration was 80 μg in 1 mL; for MAP 3, the concentration was 80 μg in 1 mL. The teeth had no pretreatment and one set of teeth were pumiced to assess if there is any effect of pumicing the teeth. Binding was assessed after overnight incubation, washing and pictures of the teeth were taken for analysis (pictures of the same teeth were recorded before the experiment for data comparison). The results are shown in Table 3. Only minor whitening was observed.














TABLE 3





Pretreatment
Composition
Before
After
d RGB
d Shades




















Pumice
MAP1 + BFP
205.962
222.34
16.378
5



MAP2 + BFP
199.762
205.963
6.201
2



MAP3 + BFP
194.64
202.938
8.298
3



MAP1 Control
196.91
206.687
9.777
3



BFP Control
185.361
**


No Pumice
MAP1 + BFP
183.667
200.383
16.716
6



MAP2 + BFP
190.141
201.548
11.407
4



MAP3 + BFP
182.027
**



MAP3 Control
195.354
200.168
4.814
2



BFP Control
200.231
206.186
5.955
2





** data cannot be calculated.






Example 10
Titanium Dioxide Particles

Titanium dioxide particles (20 nm) and MAP 37 were mixed at a 10:1 nanoparticle:MAP37 ratio and incubated in acetic acid for 2 hours at 37° C. Different amounts of the suspension were pipetted onto the dentin part of bovine teeth (tooth was silver stained), and incubated at 37° C. for about 30 min to dry the mussel adhesive polypeptide and nanoparticles on the teeth. The teeth were then washed with water and incubated in water on a gel shaker for 44 hours. The particles remained on the teeth after the water wash but were removed by brushing in water.


Example 11
Preparation of a MAP Inspired Peptide Containing 30% DOPA Residues

The following peptide was made by solid phase amino acid synthesis (Ohio Peptide): KYKGKGYKGG YKGKYYGKGK KYYYKYKGKG KYKYGKKKGK YKGKGYKYYG, where Y refers to L-DOPA (L-dihydroxyphenylalanine) (SEQ ID NO:21). This peptide contains 30% DOPA, 42% Lysine, and 28% Glycine. The sequence was adapted from amino acid 46-95 of the Mfp-5 sequence of Mytilis edulis (SEQ ID NO:6) with residues that are not Y, K, or G substituted with K or G.


The peptide was dissolved in 1% acetic acid to a concentration of 5 mg/mL and applied to bovine teeth under wet and dry binding conditions. For wet binding, the teeth were incubated with 10 μl of the peptide solution for 30 min at 37° C. over a reservoir of 1% acetic acid. A series of concentrations were tested ranging from 1000 μg/mL to 1.6 μg/mL. After brushing with toothpaste and staining the teeth with Coomassie Blue Dye, a strong stain was visible for all concentrations down to 8 μg/ml. A weak stain was still visible at 1.6 μg/ml. Under dry binding conditions, two concentrations (1000 μg/mL and 200 μg/mL) were tested. Ten μL of the peptide solution was applied on the teeth, dried over night at 37° C., and brushed with toothpaste. Again, a strong Coomassie stain was visible.


Example 12
Synthesis of Organic Polymers Substituted with DOPA

Poly DOPA was synthesized using three different polymers: polymethacrylic acid (PMA), poly[ethylene-co-(maleic anhydride) (PEMA), and poly[butadiene-co-(maleic anhydride) (PBMA).


Poly-L-DOPA-PMA polymers were synthesized using different concentrations of DOPA. 1-Ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC; 0.5 g) and N-hydroxysuccinimide (NHS; 0.5 g) were dissolved in a PBS solution containing 2.5 g of PMA (MW 9.5 kDa, Sigma) solution. After the solution was mixed for 4 h at room temperature, L-DOPA (0 g for PMA 1, 0.25 g for PMA2 and 0.75 g for PMA3) was added to the respective polymer solutions (Table 4). The reaction volumes were adjusted to 10 ml with PBS and the reactions were stirred for approximately 2 h. The precipitated reaction products were then washed well with ethanol, the precipitated poly(L-DOPA) was dried, and the product stored in vacuum desiccator.


Poly-L-DOPA-PEMA and Poly-L-DOPA-PBMA polymers were synthesized as follows. In a round bottom flask attached with a cold water condenser, 0.5 g of each polymer poly[ethylene-co-(maleic anhydride)] 1:1 (PEMA, MW, 400 kDa, Polysciences) and poly[butadiene-co-(maleic anhydride)] 1:1 (PBMA, MW 10-15 kDa, Polysciences) was added to 0.65 g DOPA in 50 ml ethanol. The reactions were refluxed at 70-90° C. on hot plates in water or oil bath for 12 h with constant stirring. After 12 h, the reactions were cooled to room temperature and the precipitated polymers were dried and stored in a vacuum desiccator (Table 4).









TABLE 4







Synthesis of poly-L-DOPA with PMA, PEMA and PBMA.













Molecular







wt



%



(average)


Yield
Dopa


Polymer
kDa
Color
Solubility
grams
by wt















PMA1
9.5
White
Water
2.11
0


PMA2
11-12
White
Water
2.23
9.91%


PMA3
12-13
White
Water
2.56
22.24%


PBMA
20-25
Off white
Alkaline/0.5MHCl
0.767
33.4%


PEMA
600
White
Alkaline/0.2MHCl
0.964
39.9%









Example 13
Initial Binding Studies of DOPA Substituted Organic Polymers

The binding of the polymers from Example 2 to bovine teeth was assessed as follows. Ten μl of PMA 1, 2, and 3 (5 mg/ml) in 1% acetic acid, or PEMA or PBMA in 0.2M HCl at 2 mg/ml were applied to each tooth under dry conditions and incubated overnight. The teeth were stained with Coomassie blue as described above, washed with water, and brushed extensively with toothpaste. Strong binding was observed of all polymers containing DOPA. Very low binding was observed in control reactions using PMA with no DOPA (PMA 1).


In a related experiment, the PMA polymers in 1% acetic acid were dried on teeth, washed with water, and then incubated in pH 8.5 bicarbonate buffer overnight. For PMA2 and PMA3, the bicarbonate solution turned brown because of dissolved DOPA but the teeth remained white. These teeth showed strong Coomassie staining after brushing with toothpaste. Again, PMA1 showed no significant staining


Other Embodiments

It is to be understood that while the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.

Claims
  • 1. A method for altering the appearance of teeth, said method comprising applying to teeth an adhesive molecule comprising a plurality of 3,4-dihydroxyphenyl-L-alanine (DOPA) residues and a fluorescence emitting polypeptide, said adhesive molecule having the ability to interact with or bind to a tooth, a tooth component, or inorganic dental material, and wherein fluorescence emitted from said fluorescence emitting polypeptide alters the appearance of said teeth.
  • 2. The method of claim 1, wherein said teeth are human teeth.
  • 3. The method of claim 1, wherein said method comprises altering the appearance of said teeth such that said teeth appear whiter.
  • 4. The method of claim 1, wherein said adhesive molecule is a mussel adhesive polypeptide.
  • 5. The method of claim 4, wherein said fluorescence emitting polypeptide is conjugated to said mussel adhesive polypeptide.
  • 6. The method of claim 4, wherein said mussel adhesive polypeptide comprises mussel foot protein-1 (MFP-1), MFP-3, or MFP-5, or a combination thereof.
  • 7. The method of claim 6, wherein said muscle adhesive polypeptide is a chimeric polypeptide, said chimeric polypeptide comprising (i) an amino acid sequence of MFP-1 and an amino acid sequence of MFP-5 or (ii) an amino acid sequence of MFP-1 and an amino acid sequence of MFP-3.
  • 8. The method of claim 1, wherein said fluorescence emitting polypeptide is a BFP polypeptide.
  • 9. The method of claim 1, wherein said adhesive molecule is a polymer comprising a plurality of lysine residues and said plurality of DOPA residues.
  • 10. The method of claim 9, wherein said fluorescence emitting polypeptide is conjugated to said polymer.
  • 11. The method of claim 1, wherein said adhesive molecule is a polymethacrylate polymer comprising said plurality of DOPA residues.
  • 12. The method of claim 11, wherein said fluorescence emitting polypeptide is conjugated to said polymethacrylate polymer.
  • 13. The method of claim 1, further comprising applying whitening particles to said teeth.
  • 14. The method of claim 13, wherein said whitening particles are nanoparticles.
  • 15. The method of claim 13, wherein said whitening particles comprise titanium dioxide, silicon dioxide, hydroxyapatite, or zinc oxide.
  • 16. The method of claim 13, wherein said whitening particles comprise titanium dioxide.
  • 17. The method of claim 1, wherein said composition is present within tooth paste, mouth rinse, gel, or an ingested substance, and said applying step comprises applying said tooth paste, mouth rinse, gel, or ingested substance to said teeth or tooth components.
  • 18. The method of claim 1, wherein said fluorescence emitting polypeptide is one unit of a polymer comprising two or more fluorescence emitting polypeptides.
  • 19. The method of claim 1, wherein said adhesive molecule and said fluorescence emitting polypeptide are applied sequentially.
  • 20. The method of claim 1, wherein said adhesive molecule and said fluorescence emitting polypeptide are applied together.
  • 21. A method for altering the appearance of teeth, said method comprising applying an adhesive molecule and whitening particles to teeth, said adhesive molecule comprising a plurality of DOPA residues and having the ability to interact with or bind to a tooth, a tooth component, or inorganic dental material, and wherein said whitening particles alter the appearance of said teeth.
  • 22. The method of claim 21, wherein said adhesive molecule and said whitening particles are applied sequentially.
  • 23. The method of claim 21, wherein said adhesive molecule and said whitening particles are applied together.
  • 24. The method of claim 21, wherein said whitening particles are nanoparticles.
  • 25. The method of claim 21, wherein said whitening particles comprise titanium dioxide, silicon dioxide, hydroxyapatite, or zinc oxide.
  • 26. The method of claim 21, wherein said whitening particles comprise titanium dioxide.
  • 27. The method of claim 21, wherein said adhesive molecule comprises a polymethacrylate polymer, said polymer comprising said plurality of DOPA residues.
  • 28. The method of claim 21, wherein said adhesive molecule comprises a mussel adhesive polypeptide.
  • 29. The method of claim 21, wherein said adhesive molecule comprises a polymer comprising a plurality of lysine residues and said plurality of DOPA residues.
  • 30. A composition comprising a fluorescence emitting polypeptide and an adhesive molecule comprising a plurality of DOPA residues, said adhesive molecule having the ability to interact with or bind to a tooth, a tooth component, or inorganic dental material.
  • 31. The composition of claim 30, said composition further comprising whitening particles.
  • 32. The composition of claim 31, wherein said whitening particles comprise titanium dioxide, silicon dioxide, hydroxyapatite, or zinc oxide.
  • 33. The composition of claim 30, wherein said adhesive molecule is a polymer comprising a plurality of lysine residues and said plurality of DOPA residues.
  • 34. The composition of claim 30, wherein said adhesive molecule is a mussel adhesive polypeptide.
  • 35. The composition of claim 34, wherein said fluorescence emitting polypeptide is conjugated to said mussel adhesive polypeptide.
  • 36. The composition of claim 30, wherein said adhesive molecule is a polymethacrylate polymer comprising said plurality of DOPA residues.
  • 37. The composition of claim 36, wherein said fluorescence emitting polypeptide is conjugated to said polymethacrylate polymer.
  • 38. A composition comprising an adhesive molecule and whitening particles, said adhesive molecule comprising a plurality of DOPA residues and having the ability to interact with or bind to a tooth, a tooth component, or inorganic dental material.
  • 39. The composition of claim 38, wherein said adhesive molecule is a mussel adhesive polypeptide.
  • 40. The composition of claim 38, wherein said adhesive molecule is a polymer comprising a plurality of lysine residues and said plurality of DOPA residues.
  • 41. The composition of claim 38, said composition further comprising a fluorescence emitting polypeptide.
  • 42. The composition of claim 41, wherein said fluorescence emitting polypeptide is conjugated to said adhesive molecule.
  • 43. The composition of claim 38, wherein said adhesive molecule is a polymethacrylate polymer comprising said plurality of DOPA residues.
  • 44. The composition of claim 30, wherein said composition is a tooth paste, gel, mouth rinse, or ingested substance.
  • 45. A chimeric polypeptide comprising an amino acid sequence of 20 or more residues in length of a fluorescence emitting polypeptide and an amino acid sequence of 20 or more residues in length of a mussel adhesive polypeptide.
  • 46. The chimeric polypeptide of claim 45, wherein said chimeric polypeptide comprises a full length fluorescence emitting polypeptide or fragment thereof that is at least about 90 percent identical to said full length fluorescence emitting polypeptide, wherein said chimeric polypeptide comprises a full length mussel adhesive polypeptide or fragment thereof that is at least about 80 percent identical to said full length mussel adhesive polypeptide, and wherein said chimeric polypeptide comprises the ability to emit fluorescence and the ability to interact with or bind to a tooth, a tooth component, or inorganic dental material.
  • 47. The method of claim 1, wherein said adhesive molecule and fluorescence emitting polypeptide are applied to a tooth, a tooth component, or inorganic dental material in the presence of saliva.
CROSS-REFERENCE TO RELATED APPLICATIONS

This application claims the benefit of U.S. Provisional Application Ser. No. 61/785,966, filed Mar. 14, 2013. The disclosure of the prior application is considered part of (and is incorporated by reference in) the disclosure of this application.

Provisional Applications (1)
Number Date Country
61785966 Mar 2013 US