The present application is being filed along with an Electronic Sequence Listing as an ASCII text file via EFS-Web. The Electronic Sequence Listing is provided as a file entitled LAUR010001APCSEQLIST.txt, created and last saved on May 14, 2021, which is 78,531 bytes in size. The information in the Electronic Sequence Listing is incorporated herein by reference in its entirety.
The invention relates to methods and reagents for multiplex binding experiments utilizing different polypeptide couples having high affinity, and displaying molecules of interest in an appropriate manner on the surface of a support.
An immunoassay is generally defined as a biochemical test that measures the presence or concentration of a macromolecule or a small molecule in solution through the use of a binder, especially an antibody and/or an antigen. The molecule detected by the immunoassay is often referred to as an analyte and is in many cases a protein, although it may be other kinds of molecules, of different size and nature as long as the proper antibodies that have the adequate properties for the assay are developed. The basic components of an immunoassay generally include an analyte, an antibody and a detectable label, which can be an enzyme (e.g. horseradish peroxidase or HRP, alkaline phosphatase or AP, glucose oxidase, luciferase or Luc), a radioactive isotope (in radioimmunoassays or RIA), a DNA reporter (in e.g. real-time immunoquantitative polymerase chain reaction or iqPCR), a fluorogenic reporter (e.g. phycoerythrin), or an electrochemiluminescent tag.
In some embodiments, the present invention concerns a support for a multiplex binding experiment functionalized with at least two different polypeptides having high affinity to their cognate binding partner.
In some embodiments, the at least two different polypeptides having high affinity to their cognate binding partner are provided as reagents for a multiplex binding experiment, and are further bonded to the support.
In some embodiments, multiplex binding experiment allows simultaneously binding of multiple kinds of molecules in a single run/cycle of the experiment, and not only one kind of molecules at a time.
Colicins (E2, E7, E8 and E9) were coated on Maxisorb 96-well plates as indicated above each graph. Each well (light grey bars) was then incubated with a solution containing an Immunity protein fused to RLuc8 alone as indicated below each bar pair. In a separate well (dark grey bars), the same Immunity protein fused to RLuc8 (as indicated below each bar pair) was incubated with the same Colicin (as indicated above each graph) but in presence of the 3 non-cognate Immunity proteins devoid of Luciferase activity. All proteins were used at 100 nM. Binding affinity constants are indicated above each bar pair, as previously determined by kinetics (mole/L) (Li W. et al., 2004, J Mol Biol., 337(3):743-59.).
Colicins E2, E7, E8 and E9 (10 μM) were sprayed on nitrocellulose membranes as shown on the top of each column Each membrane was then incubated with a solution containing an Immunity protein fused to RLuc8 alone (100 nM) as indicated on the left of each graph (left column). On a separate membrane, the same Immunity protein (fused to RLuc8, 100 nM) was incubated with the same Colicins (10 μM) but in presence of the 3 non-cognate Immunity proteins (devoid of Luciferase activity, at 100 nM) (right column). Intensity plots are represented below each membrane.
Colicins ColE2, ColE7, ColE8, ColE9, ColAP41, ColSyr, ColErw, ColKhan were coated on 96-well plates as indicated above each graph. The “no coating” graph stands for “no Colicin was coated and only the coating buffer was used”. Each well (light grey bars) was then incubated with a solution containing an Immunity protein fused to RLuc8 alone as indicated below each bar pair (“blank” condition stands for “no Immunity protein”). In a separate well (dark grey bars), the same Immunity protein fused to RLuc8 (as indicated below each bar pair) was incubated with the same Colicin (as indicated above each graph) but in presence of the 7 non-cognate Immunity proteins devoid of Luciferase activity. All proteins were used at 100 nM.
Colicins ColE2, ColE8, ColE9, ColAP41, ColSyr, ColErw, ColLeaf, ColKhan were coated on 96-well plates as indicated above each graph. The “no coating” graph stands for no Colicin was coated and only the coating buffer was used. Each well (light grey bars) was then incubated with a solution containing an Immunity protein fused to RLuc8 alone as indicated below each bar pair (“blank” condition stands for “no Immunity protein”). In a separate well (dark grey bars), the same Immunity protein fused to RLuc8 (as indicated below each bar pair) was incubated with the same Colicin (as indicated above each graph) but in presence of the 7 non-cognate Immunity proteins devoid of Luciferase activity. All proteins were used at 100 nM.
Multiplex assays have been developed for the simultaneous measurement of multiple analytes in a single sample. Multiplex testing is becoming indispensable in contemporary clinical diagnosis. With the increasing numbers of (bio)markers discovered, there is often a need to detect several (bio)markers simultaneously to generate meaningful or conclusive information. This is important for reliable disease detection and monitoring, as a single (bio)marker may be indicative of more than one disease, with a statistically inadequate predictive value. In addition, false positives and negatives may appear quite frequently with single (bio)marker detection, but could be minimized by detecting a (bio)marker panel. Therefore multiplex testing ensures precise diagnostics and mitigates patient risk. Another benefit of multiplex testing is the reduction of the required quantity of samples, as well as the reduction of diagnostic time and costs in comparison to performing multiple single tests.
Many multiplex testing methods have been developed for diagnostics. The commonly used ones include multiplex real-time polymerase chain reaction (PCR), microarrays, next-generation sequencing, enzyme immunoassay (EIA)/enzyme-linked immunoabsorbant assay (ELISA), multiplex lateral flow biosensors (LF), vertical flow assays (VFA) or Luminex® multiplex assay.
A well-established format for such multiplex assays makes use of flow-based technology and ligand (e.g. antibody)-coated beads Luminex™ systems are based on xMAP™ (multi-analyte profiling) technology combined with single and multiplex bead-based immunoassays. The beads used in xMAP™ immunoassays are dyed with different concentrations of fluorophores to generate bead sets that can be easily discriminated. Individual bead sets are coated with a capture antibody qualified for one specific analyte. The captured analyte from a sample is detected using an analyte-specific biotinylated antibody that binds to the appropriate epitope of the immobilized analyte, plus streptavidin-conjugated R-phycoerythrin (S-RPE). For detection of the immunoassay sandwich complex, Luminex™ instruments use either light-emitting diodes (LEDs) for excitation of each fluorescent bead combined with a CCD camera for bead and analyte detection, or a flow-based detection system using a red and green laser. High-speed digital signal processors are used to interrogate the data. As each antibody-coated bead is individually identifiable for a specific analyte, multiple beads can be combined to simultaneously measure the levels of up to 500 targets for nucleic acid and typically no more than 50 targets for proteins due to biological interference in a single sample.
EIA is usually performed in a 96-well plate: when based on the competitive enzyme immunoassay principle, the microplate in the kit is coated with a target specific antibody, which is competitively bound by a mixture of the endogenous peptide in the biological sample and biotinylated peptide, provided in the kit and producing a colorimetric signal through its interaction with HRP-streptavidin. Based thereon, the MSD® (Meso Scale Discovery) technology offers a multi-array technology combining electrochemiluminescence (ECL) detection and patterned arrays: Up to 10 working electrodes (enabling multiplexing up to 10 analytes) are spotted in a well, to support a capture antibody able to bind an analyte, further detected via a detection antibody, e.g. SULFO-TAG™ labeled.
Document WO2014/164594 discloses methods for conducting solid-phase multiplex binding assays. In practice, distinct oligonucleotide sequences are located on distinct areas of a multi-assay plate, whereas each capture antibody is labeled with each individual oligonucleotide sequence complement with conventional coupling protocols. After incubation with the plate, the capture antibodies are immobilized to the multi-well plate to form a plurality of binding reagent complexes. A solution including a plurality of analytes is then added, as well as a set of labeled detection antibodies. Alternatively, the individual oligonucleotide sequence complements are bound to streptavidin or avidin, whereas the antibodies are biotinylated so as to prepare a set of individual biotinylated capture antibody/oligonucleotide-SA mixtures.
Concerning lateral flow immunochromatographic assays, document WO03/062824 discloses a lateral flow method and strip capable of quantifying a plurality of analytes at the same time. It illustrates the preparation of monoclonal antibodies specifically reacting with each of the proteins AFP, CEA, CRP and PSA. Said capture antibodies were dispensed sequentially in test lines at intervals of 2 mm Other monoclonal antibodies having epitopes different from the immobilized antibodies were reacted with fluorescent material to be used as detectors when impregnated on a glass fiber pad (antibody/fluorescent conjugate pad). To get a greater sensitivity and reproducibility, it is proposed to immobilize avidin on the support and couple the capture antibodies with biotin. However, the development of multiplex lateral flow biosensors is still compromised by sensitivity and specificity problems, partly due to cross-reaction(s) occurring among a mixture of analytes (Li et Macdonald, Biosensors and Bioelectronics 83(2016) 177-92).
In view of this, there exists a persistent need for developing further multiplex binding assays, efficient, simple, cheap, polyvalent and easy to use.
Having conducted extensive experiments and tests, the inventors have identified new linkers, in the form of polypeptide couples with low dissociation constants, to be used on a support to present molecules of interest, especially analyte-capture entities.
This is of particular interest for multiplex binding experiments: whereas the dissociation constant of an antigen/antibody couple is generally in the nanomolar range, the polypeptide couples used in the frame of the present invention have a dissociation constant at least in the range of the picomolar range, or even in the femtomolar range, leading to an increased specificity and/or sensitivity.
The articles “a” and “an” are used herein to refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, “an element” means one element or more than one element.
“About” as used herein when referring to a measurable value such as an amount, a temporal duration, and the like, is meant to encompass variations of ±20% or ±10%, more preferably ±5%, even more preferably ±1%, and still more preferably ±0.1% from the specified value, as such variations are appropriate to perform the disclosed methods.
Ranges: throughout this disclosure, various aspects of the invention can be presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the invention. Accordingly, the description of a range should be considered to have specifically disclosed all the possible subranges as well as individual numerical values within that range. For example, description of a range such as from 1 to 6 should be considered to have specifically disclosed subranges such as from 1 to 3, from 1 to 4, from 1 to 5, from 2 to 4, from 2 to 6, from 3 to 6 etc., as well as individual numbers within that range, for example, 1, 2, 2.7, 3, 4, 5, 5.3, and 6. This applies regardless of the breadth of the range.
The terms “comprising”, “comprises” and “comprised of” as used herein are synonymous with “including”, “includes” or “containing”, “contains”, and are inclusive or open-ended and do not exclude additional, non-recited members, elements or method steps.
As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence. Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. “Polypeptides” include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homo- or hetero-multimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others. The polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
“Homologous” or “identical” refers to the sequence similarity or sequence identity between two polypeptides or between two nucleic acid molecules. When a position in both of the two compared sequences is occupied by the same base or amino acid monomer subunit, e.g., if a position in each of two DNA molecules is occupied by adenine, then the molecules are homologous or identical at that position. The percent of homology/identity between two sequences is a function of the number of matching or homologous positions shared by the two sequences divided by the number of positions compared ×100. For example, if 6 of 10 of the positions in two sequences are matched or homologous then the two sequences are 60% homologous/identical. Generally, a comparison is made when two sequences are aligned to give maximum homology/identity.
The term “isolated” with reference to a particular component (such as for instance, a protein, polypeptide, peptide or fragment thereof) generally denotes that such component exists in separation from—for example, has been separated from or prepared in separation from—one or more other components of its natural environment. For instance, an isolated human or animal protein, polypeptide, peptide or fragment exists in separation from a human or animal body where it occurs naturally.
The term “isolated” as used herein may preferably also encompass the qualifier “purified”. As used herein, the term “purified” with reference to protein(s), polypeptide(s), peptide(s) and/or fragment(s) thereof does not require absolute purity. Instead, it denotes that such protein(s), polypeptide(s), peptide(s) and/or fragment(s) is (are) in a discrete environment in which their abundance (conveniently expressed in terms of mass or weight or concentration) relative to other proteins is greater than in a biological sample. A discrete environment denotes a single medium, such as for example a single solution, gel, precipitate, lyophilisate, etc. Purified peptides, polypeptides or fragments may be obtained by known methods including, for example, laboratory or recombinant synthesis, chromatography, preparative electrophoresis, centrifugation, precipitation, affinity purification, etc. Purified protein(s), polypeptide(s), peptide(s) and/or fragment(s) may preferably constitute by weight 10%, more preferably 50%, such as 60%, yet more preferably 70%, such as 80%, and still more preferably 90%, such as 95%, 96%, 97%, 98%, 99% or even 100%, of the protein content of the discrete environment. Protein content may be determined, e.g., by the Lowry method (Lowry et al. 1951. J Biol Chem 193: 265), optionally as described by Hartree 1972 (Anal Biochem 48: 422-427). Also, purity of peptides or polypeptides may be determined by SDS-PAGE under reducing or non-reducing conditions using Coomassie blue or, preferably, silver stain.
The term “marker” or “biomarker” is widespread in the art and may broadly denote a biological molecule and/or a detectable portion thereof whose qualitative and/or quantitative evaluation in a subject is informative (e.g., predictive, diagnostic and/or prognostic) with respect to one or more aspects of the subject's phenotype and/or genotype, such as, for example, with respect to the status of the subject as to a given disease or condition.
The terms “assessing risk of” or “risk assessment”, “detecting” or “detection”, “screening”, “diagnosing” or “diagnosis”, “prognosing” or “prognosis”, “predicting” or “prediction”, and “monitoring” are commonplace and well-understood in medical and clinical practice.
By means of further explanation and without limitation, “assessing risk of” or “risk assessment” generally refer to an advance declaration, indication or foretelling of a disease or condition in a subject not (yet) having said disease or condition. For example, a risk assessment of a disease or condition in a subject may indicate a probability, chance or risk that the subject will develop said disease or condition, for example within a certain time period or by a certain age. Said probability, chance or risk may be indicated inter alia as an absolute value, range or statistics, or may be indicated relative to a suitable control subject or subject population (such as, e.g., relative to a general, normal or healthy subject or subject population). Hence, the probability, chance or risk that a subject will develop a disease or condition may be advantageously indicated as increased or decreased, or as fold-increased or fold-decreased relative to a suitable control subject or subject population. As used herein, the term “risk assessment of a disease” in a subject may also particularly mean that the subject is at risk of having said disease (e.g., the risk is significantly increased vis-à-vis a control subject or subject population).
The terms “diagnosing” or “diagnosis” generally refer to the process or act of recognising, deciding on or concluding on a disease or condition in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers characteristic of the diagnosed disease or condition). As used herein, “diagnosis of a disease” in a subject may particularly mean that the subject has said disease, hence, is diagnosed as having said disease. A subject may be diagnosed as taught herein as not having said disease despite displaying one or more conventional symptoms or signs reminiscent thereof.
In the frame of the present invention, the terms “detecting” or “detection” mean in general find the presence of the disease and/or of the agent responsible therefor, and encompass both risk assessment and diagnosis, i.e. refer to the process of measuring the level of a biomarker in subjects having or not having symptoms of the disease, potentially in any subject. The term “screening” is rather used in relation to the detection in subjects having no symptoms of the disease.
The terms “prognosing” or “prognosis” generally refer to an anticipation on the progression of a disease or condition and the prospect (e.g., the probability, duration, and/or extent) of recovery. A good prognosis of a disease may generally encompass anticipation of a satisfactory partial or complete recovery from said disease, preferably within an acceptable time period. A good prognosis of said disease may more commonly encompass anticipation of not further worsening or aggravating of the conditions, preferably within a given time period. A poor prognosis of a disease may generally encompass anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or to substantially no recovery or even further worsening of said disease.
The terms “predicting” or “prediction” generally refer to an anticipation on the efficacy/efficiency of a medical or surgical treatment on the progression of a disease or condition and the prospect (e.g., the probability, duration, and/or extent) of recovery. A good prediction may generally encompass anticipation of a satisfactory partial or complete recovery from said disease in response to the treatment, preferably within an acceptable time period. A good prediction may more commonly encompass anticipation of not further worsening or aggravating of the conditions in response to the treatment, preferably within a given time period. A poor prediction may generally encompass anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or to substantially no recovery or even further worsening of said disease in response to the treatment.
The terms “monitor” or “monitoring” generally refer to observe and check the progress of a disease or condition (e.g. the presence of a pathogen) in a subject over a period of time, e.g. to evaluate the response to treatment, or to identify relapse of the disease.
A molecule or analyte, or a group of two or more molecules or analytes, is “measured” in a sample when the presence or absence and/or quantity of said molecule(s) or analyte(s) is detected or determined in the sample, preferably substantially to the exclusion of other molecules and analytes.
The terms “quantity”, “amount” and “level” are synonymous and generally well-understood in the art. The terms as used herein may particularly refer to an absolute quantification of a molecule or an analyte in a sample, or to a relative quantification of a molecule or analyte in a sample, i.e., relative to another value such as relative to a reference value as taught herein, or to a range of values indicating a base-line expression of the biomarker. These values or ranges can be obtained from a single patient or from a group of patients.
An absolute quantity of a molecule or analyte in a sample may be advantageously expressed as weight or as molar amount, or more commonly as a concentration, e.g., weight per volume or mole per volume.
A relative quantity of a molecule or analyte in a sample may be advantageously expressed as an increase or decrease or as a fold-increase or fold-decrease relative to said another value, such as relative to a reference value as taught herein. Performing a relative comparison between first and second parameters (e.g., first and second quantities) may but need not require to first determine the absolute values of said first and second parameters. For example, a measurement method can produce quantifiable readouts (such as, e.g., signal intensities) for said first and second parameters, wherein said readouts are a function of the value of said parameters, and wherein said readouts can be directly compared to produce a relative value for the first parameter vs. the second parameter, without the actual need to first convert the readouts to absolute values of the respective parameters.
The terms “patient,” “subject,” “individual,” and the like are used interchangeably herein, and refer to any animal, or cells thereof whether in vitro or in situ, amenable to the methods described herein. As used herein they typically denote humans, but may also encompass reference to non-human animals, preferably warm-blooded animals, more preferably mammals, such as, e.g., non-human primates, rodents, canines, felines, equines, ovines, porcines, and the like.
A “disease” is a state of health of an animal wherein the animal cannot maintain homeostasis, and wherein if the disease is not ameliorated then the animal's health continues to deteriorate. In contrast, a “disorder” in an animal is a state of health in which the animal is able to maintain homeostasis, but in which the animal's state of health is less favorable than it would be in the absence of the disorder. Left untreated, a disorder does not necessarily cause a further decrease in the animal's state of health. A disease or disorder is “alleviated” if the severity of a symptom of the disease or disorder, the frequency with which such a symptom is experienced by a patient, or both, is reduced. A disease or disorder is “cured” if the severity of a symptom of the disease or disorder, the frequency with which such a symptom is experienced by a patient, or both, is eliminated.
As used herein, “treating a disease or disorder” means reducing the frequency or severity of at least one sign or symptom of a disease or disorder experienced by a subject. Disease and disorder are used interchangeably herein in the context of treatment.
According to a first aspect, the present invention concerns a support for a multiplex binding experiment functionalized with at least two different polypeptides having high affinity to their cognate binding partner.
According to a specific aspect, the at least two different polypeptides having high affinity to their cognate binding partner are provided as reagents for a multiplex binding experiment, and are further bonded to the support.
In the sense of the invention, multiplex binding experiment allows simultaneously binding of multiple kinds of molecules in a single run/cycle of the experiment, and not only one kind of molecules at a time.
In the frame of the invention, a support is defined as a physical entity able to carry at least two polypeptides. As known by the skilled person, the nature and the form of said support can vary, depending on the technique used to perform the multiplex binding experiment.
In relation to EIA, a support can be a well of a plate, advantageously of a microplate. A microplate, also called microtiter plate, microwell plate or multiwell, is a flat plate with multiple wells used as small test tubes, e.g. in ELISA assays.
A microplate typically has 6, 12, 24, 48, 96, 384 or 1536 sample wells arranged in a 2:3 rectangular matrix. Each well of a microplate typically holds somewhere between tens of nanoliters to several milliliters of liquid. Wells can be either circular or square. Microplates are manufactured in a variety of materials. The most common is polystyrene, possibly colored white by the addition of titanium dioxide for optical absorbance or luminescence detection or black by the addition of carbon for fluorescent biological assays. Polypropylene, polycarbonate, cyclo-olefins or solid pieces of glass and quartz can also be used.
In relation to lateral and vertical flow assays, the support is a membrane or a strip. This technology is based on a series of capillary beds, such as pieces of porous paper, microstructured polymer, or sintered polymer. According to a specific embodiment, the support is made of cellulose or a derivative thereof, advantageously nitrocellulose.
In relation to the Luminex™ technology, the support is made of microcarriers or microbeads.
By “microcarrier”, it is herein referred to any type of particle microscopic in size, typically with the largest dimension being from 100 nm to 300 μm, preferably from 1 μm to 200 μm. The microcarrier may be of any shape but has preferably a spherical shape (microbeads) or the form of a wafer, e.g. a disk-like shape.
The microcarriers may be made from or comprise any material routinely used in high-throughput screening technology and diagnostics, e.g. polystyrene or silica.
According to specific embodiments, the support is polymeric, wherein the polymers are advantageously selected from the group consisting of carbohydrate-based polymers, polyaliphatic alcohols, poly(vinyl) polymers, polyacrylic acids, polyorganic acids, polyamino acids, co-polymers, block copolymers, tertpolymers, polyethers, naturally occurring polymers, polyimids, surfactants, polyesters, branched polymers, cyclo-polymers, polyaldehydes and mixtures thereof, brominated polystyrene, polyacrylic acid, polyacrylonitrile, polyamide, polyacrylamide, polyacrolein, polybutadiene, polycaprolactone, polyester, polyethylene, polyethylene terephthalate, polydimethylsiloxane, polyisoprene, polyurethane, polyvinylacetate, polyvinylchloride polyvinylpyridine, polyvinylbenzylchloride, polyvinyltoluene, polyvinylidene chloride, polydivinylbenzene, polymethylmethacrylate, polylactide, polyglycolide, poly(lactide-co-glycolide), polyanhydride, polyorthoester, polyphosphazene, polyphosophaze, poly-(styrene-co-vinylbenzyl chloride-co-acrylic acid) (85:10:5 molar ratio), poly(styrene-co-acrylic acid) (99:1 molar ratio), poly(styrene-co-methacrylic acid) (90:10 molar ratio), poly(styrene-co-acrylic acid-co-m&p-divinylbenzene) (89:10:1 molar ratio), poly-(styrene-co-2-carboxyethyl acrylate) (90:10 molar ratio), poly(methyl methacrylate-co-acrylic acid) (70:30 molar ratio) and poly(styrene-co-butyl acrylate-co-methacrylic acid) (45:45:10 weight ratio) synthetic polymers polystyrene, polyacrylamide, polyacrylate, latex, and any combinations or modifications thereof.
According to some embodiments, the support may comprise plastic, cellulose, dextran, dextran cross linked with epichlorohydrin, agarose, acrylamide, glass, polystyrene, polyethylene glycol, Teflon, or nylon.
According to the invention, the support is functionalized with at least two different polypeptides. By “functionalized”, it is herein referred to a non-covalent (e.g. electrostatic or ionic) or covalent (e.g. chemical) bonding between the support and the polypeptides. This encompasses adsorption, chemical bonding, especially through thiol, carboxyl or amine functions, and bonding by Ultra-Violet (UV) irradiation.
According to a specific embodiment, the polypeptide(s) can comprise or be fused to an entity having high affinity for the support, e.g. a cellulose-binding domain. As known in the art, the resulting complex (polypeptide+entity) can be obtained recombinantly, by chemical synthesis or through chemical conjugation methods. Advantageously, the entity is a peptide or a protein fused to the polypeptide(s).
According to another embodiment, the support according to the invention is functionalized on 2 distinct sites thereof, with the at least two different polypeptides. By “on 2 distinct sites thereof”, it is herein referred to the fact that each of the polypeptides is individualized on the support, i.e. physically distinguishable. In other words, said sites constitute distinct binding areas on the support.
In that specific case and when the support is a set of microcarriers, each different polypeptide can be immobilized on microcarriers differentially labeled. As an example, the microcarriers may further be encoded, to facilitate their identification. Preferably, a microcarrier to be used in the frame of the invention is encoded in such a way that its function, i.e. the polypeptide functionalized thereon, can be determined by reading the code, preferably using optical means.
Concerning wells or membranes, the different polypeptides can be immobilized on the support in the form of distinct dots or lines, with a sufficient distance between each other.
Moreover, the support according to the invention comprises at least two different polypeptides having high affinity to their cognate binding partner, with preferably at least one polypeptide, more preferably both, having a dissociation constant (Kd) for its/their binding partner inferior or equal to 10−10 M, advantageously inferior or equal to 10−11M, more advantageously inferior or equal to 10−12M.
As known in the art, the binding affinity is the strength of the binding interaction between a single biomolecule, in the present case a polypeptide, to its ligand/binding partner. Binding affinity is typically measured and reported by the equilibrium dissociation constant (Kd), which is used to evaluate and rank order strengths of bimolecular interactions. The smaller the Kd value, the greater the binding affinity of the ligand for its target. The larger the Kd value, the weaker the target molecule and ligand are attracted to and bind to each other.
Binding affinity is influenced by non-covalent intermolecular interactions such as hydrogen bonding, electrostatic interactions, hydrophobic and Van der Waals forces between the two molecules. In addition, binding affinity between a ligand and its target molecule may be affected by the presence of other molecules.
The measurement of a dissociation constant (Kd) as determined by kinetics is routine for the skilled person. There are many techniques available for measuring binding affinity and dissociation constants, such as ELISAs, gel-shift assays, pull-down assays, equilibrium dialysis, analytical ultracentrifugation, Surface Plasma Resonance (SPR), spectroscopic assays and Isothermal Titration calorimetry (ITC).
The Kd value can correspond to the one disclosed in the literature or determined in standard conditions, i.e. using the polypeptide and its binding partner in the optimal conditions for their binding, especially concerning buffer, pH, temperature. Preferably and in the frame of the invention, it corresponds to the value determined in the absence of destabilizing reagents and in the presence of all the cofactors to be used in the binding assay.
According to preferred embodiments of the invention, the support comprises at least one polypeptide having a dissociation constant (Kd) for its binding partner inferior or equal to 10−12M, advantageously inferior or equal to 10−13 M, more advantageously inferior or equal to 10−14 M, or even inferior or equal to 10−15 M. According to a preferred embodiment, the at least one or two polypeptides, or even all the polypeptides, have a dissociation constant (Kd) for their respective cognate binding partner inferior or equal to 10−10 M, 10−11 M or 10−12 M, advantageously inferior or equal to 10−13 M, more advantageously inferior or equal to 10−14M, or even inferior or equal to 10−15 M.
On another hand, since the support comprises at least two different polypeptides having high affinity to their cognate binding partner, it is preferred that each polypeptide has high affinity specifically for its cognate partner. In other words, the dissociation constant (Kd) of a given polypeptide for the binding partners of the other polypeptides (non-cognate) present on the support is advantageously higher, i.e. greater than 10−12M, more advantageously greater than 10−11M, 10−10M, 10−9M, or even 10−8 M, 10−7M, 10−6M.
According to one further embodiment, it is preferred that the ratio between the Kd value of a given polypeptide for its cognate binding partner and the Kd value of said polypeptide for its non-cognate binding partner(s), measured in the same experimental conditions, is inferior or equal to 10−2, advantageously inferior or equal to 10−3, more advantageously inferior or equal to 10−4, or even inferior or equal to 10−5. As an example, in case the Kd value between a first polypeptide and its cognate partner is equal to 10−14 M, the second or further polypeptide(s) will be chosen so that the Kd value between the first polypeptide and its non-cognate partner(s), i.e. the partner(s) of the second or further polypeptide(s), is equal to 10−12M, advantageously 10−11M, more advantageously 10−10M, still more advantageously 10−9M.
As used therein, the polypeptides belong to a binding pair or couple, i.e. they are the first member of a binding pair or couple. Advantageously, they are a member of a high affinity complex, possibly of a protein-protein complex.
According to a specific embodiment, at least one polypeptide is a member of a toxin-antitoxin couple or system, advantageously polypeptidic toxin-antitoxin couple or system.
According to one embodiment, the invention concerns a support for a multiplex binding experiment functionalized with at least two different polypeptides having high affinity to their cognate binding partner. According to a preferred embodiment, each of said two polypeptides is a bacteriocin or its cognate Immunity protein (Im). In the present application, “Immunity protein” or “Immunity polypeptide” have the same meaning and are used interchangeably.
According to a first embodiment, the support is functionalized with bacteriocins, fragments or mutants thereof.
Bacteriocins (or protein antibiotics) are a large and diverse family of multidomain polypeptidic toxins. According to a preferred embodiment, bacteriocins to be used in the frame of the invention are nuclease bacteriocins (NB), i.e. toxins that target nucleic acids (DNA or RNA in case of ribonucleases) in the cytoplasm of bacteria, also called endonucleases.
As shown in the examples below or in previous work (Sharp et al., PLOS Computational Biology, 2017, https://doi.org/10.1371/journal.pcbi.1005652(2), bacteriocins have been identified in a large number of bacterial species, exclusively in γ-proteobacteria, and are particularly abundant in Enterobacteriacae and Pseudomonodaceae families
According to a specific embodiment, the polypeptide used in the context of the invention is a fragment or a mutant of a bacteriocin, advantageously a fragment or a mutant able to bind the cognate Immunity polypeptide with high affinity, more advantageously with a dissociation constant (Kd) as defined above. It has been shown that the region responsible for this binding, also called Immunity Protein Exosite, is located in the C-terminal domain of the bacteriocin.
As an example and in relation to the Escherichia coli Colicin E2 (noted ColE2), Joshi et al. (J Mol Biol., 2015, 427(17), 2852-66) have reported that the region responsible for this binding corresponds to residues 520 to 553 of ColE2. This sequence further corresponds to residues 325 to 358 of SEQ ID NO: 1.
Therefore and according to a preferred embodiment, the fragment or mutant of the bacteriocin contains the Immunity Protein Exosite. As shown by Joshi et al. (J Mol Biol., 2015, 427(17), 2852-66), the relevant domain can be identified in any bacteriocin by sequence alignment. More generally, a fragment or a mutant of a bactericin to be used in the frame of the invention contains the C-terminal part thereof.
As known in the art, the nuclease active site (or cytotoxic domain) of bacteriocins is also located in their C-terminal part. As shown in figure S1 of Sharp et al. (PLOS Computational Biology, 2017, https://doi.org/10.1371/journal.pcbi.1005652), multiple sequence alignments of cytotoxic domains have identified conserved motifs identifiable in the cytotoxic domain of all types of nucleases, i.e. HNH-type DNAses, non HNH-type DNAses, rRNAses and tRNAses.
According to a preferred embodiment, the fragment or mutant of the bacteriocin corresponds to or contains the cytotoxic domain of the bacteriocin.
According to a specific embodiment and in relation to HNH-type DNAses, the bacteriocin or a fragment thereof contains a 30-residue motif (also referred to as the ββα-Me motif) of sequence HH-XXXXXXXXXXXXXX-N-XXXXXXXX-H-XXX-H (SEQ ID NO: 28).
According to a further embodiment and in relation to HNH-type DNAses, the polypeptides used in the frame of the present invention are mutated so as to be deprived of cytotoxic activity. As reported by Walker et al. (Nucleic Acid Research, 2002, 30(14), 3225-34) and in relation to E. coli Colicin E9 (noted ColE9), the enzymatic domain thereof can be inactivated by e g changing a Histidine to Alanine in the N-part of SEQ ID NO: 28 to prevent the DNase activity. As a result, a bacteriocin can contain the sequence HA-XXXXXXXXXXXXXX-N-XXXXXXXX-H-XXX-H (SEQ ID NO: 29) or AH-XXXXXXXXXXXXXX-N-XXXXXXXX-H-XXX-H (SEQ ID NO: 30), advantageously HA-XXXXXXXXXXXXXX-N-XXXXXXXX-H-XXX-H (SEQ ID NO: 29).
Bacteriocins corresponding to DNAses, especially HNH-type DNAses, and rRNAses, together with their cognate Immunity proteins, are advantageously used in the frame of the invention since the Exosite and the catalytic domain are both in the C-terminal part of the bacteriocin but distinct so that the catalytic site can be inactivated without affecting the ability of the bacteriocin to bind to the Immunity protein.
Of particular interest are the HNH-type DNAses because they can be easily identified based on the HNH motif:
Among E. coli colicins, those having an endonuclease (non-specific DNAse) activity are preferred, i.e. the enzymatic E type colicin ColE2, ColE7, ColE8 or ColE9 (Kd in the range of 10−15 M). According to a preferred embodiment, a polypeptide consisting of or comprising the C-terminal part of colicins E2, E7, E8 or E9, advantageously mutated so as to be deprived of cytotoxic activity, is used. According to a preferred embodiment, the polypeptides used in the frame of the invention have or comprise a sequence selected in the following group:
Non-limiting further examples of bacteriocins which can be used in the invention are:
Alternatively, the bacteriocins used in the frame of the invention can have or comprise a sequence selected in the following group:
Said specific sequences correspond to fragments (C-terminal part) of natural bacteriocins, of size ranging from 129 to 136 amino acids, containing the cytotoxic domain but further mutated to be deprived of cytotoxic activity.
Alternatively, E. coli colicins having ribonuclease (RNAse, especially rRNAse) activity can be used, in particular Col E3 (Kd in the range of 10−12 M), E4, E5 or E6, or fragments thereof capable of binding their cognate Immunity protein with high affinity, more advantageously with a dissociation constant (Kd) as disclosed above.
Similarly, P. aeruginosa pyocins having ribonuclease activity may be used, in particular SD1, SD2 or SD3 having tRNAse activity.
Klebicins produced by Klebsiella pneumonia are different types of bacteriocins which can also be used.
Of particular interest in the frame of the invention are fragments of a natural bacteriocin (with an average size of around 650 aa) having the following characteristics:
According to a specific embodiment, the at least two bacteriocins, fragments or mutants thereof are chosen so that they share an identity over their Immunity Protein Exosite or binding site equal to or less than 70%, 65%, 60%, 55%, 50%, 45% or even 40%.
According to another embodiment of the invention, the support is functionalized with the cognate Immunity proteins (Im) of bacteriocins, and possibly fragments or mutants thereof. Fragments or mutants of interest are those having kept the ability to bind the corresponding bacteriocin (or mutant or fragment thereof).
According to a general definition, the Immunity proteins to be used in the present invention are the cognate binding partners of the bacteriocins as disclosed above. In practice, they originate from the same bacteria and the corresponding genes are advantageously located within 500 nucleotides in the genome.
According to particular embodiments, the at least two Immunity polypeptides to be used in the frame of the present invention have or comprise a sequence selected in the following group:
Said specific sequences correspond to fragments of size ranging from 79 to 91 amino acids, originating from natural Immunity proteins having a mean size of 101 amino acids.
According to a specific embodiment, the Immunity proteins, a mutant or a fragment thereof, contain the sequence involved in the binding to the corresponding bacteriocin, advantageously a DNAse Binding Region. Such a region can be identified by sequence alignment as shown in
In relation to E. coli Immunity protein 2 (noted Im2), the cognate binding partner of ColE2, this region (DNAse Binding Region) corresponds to residues 29 to 58 of Im2 This sequence further corresponds to residues 356 to 385 of SEQ ID NO: 5 or residues 44 to 73 of SEQ ID NO: 19.
According to a specific embodiment, the at least two Immunity proteins, fragments or mutants thereof, are chosen so that they share an identity over their DNAse Binding Region equal to or less than 70%, 65%, 60%, 55% or even 50%.
According to a preferred embodiment, the different (at least two) couples of bacteriocin/Immunity protein to be used are selected based on both criteria, i.e.:
Because of its use in multiplex binding experiments, the support of the invention comprises at least 2 different polypeptides. In other words, it can comprise, 2, 3, 4, 5, 6, 7, 8, 9, 10 or even more polypeptides, among which at least 2, and preferably all of them, are different. In the frame of the invention, “different” specially refers to their ability to have a high affinity with a different cognate binding partner.
According to a specific embodiment, all the polypeptides on the support are bacteriocins and/or their cognate Immunity polypeptides (Im).
Alternatively, said support comprises at least two polypeptides which are bacteriocins or their cognate Immunity proteins but also further polypeptide(s) having high affinity to its/their cognate binding partner as defined above.
More generally, other nuclease-inhibitor complexes can be used as e.g. the barnase-barstar complex (Kd in the range of 10−14 M) or the ribonuclease inhibitor (RI) binding angiogenin.
Another system is the Dockerin/Cohesin complex involved in the cellulosome.
According to a further embodiment, one such polypeptide is a binding partner of biotin, advantageously avidin, streptavidin, neutrAvidin (the deglycosylated version of avidin), or an antibiotin antibody. As known by the skilled person, homo-tetramers of said proteins have a high affinity for biotin, with a dissociation constant (Kd) on the order of 10−14 or 10−15 M.
As illustrated in the present application, the use of complexes between bacteriocins, advantageously the inactivated cytotoxic domain of DNAse bacteriocins, and their immunity polypeptides are of particular interest for among reasons:
Advantageously, at least one polypeptide, the at least 2 polypeptides or even all the polypeptides on the support have a sequence selected in the group consisting of: SEQ ID NO: 1 to SEQ ID NO: 27.
Merely to illustrate all the possibilities offered by the present invention and in relation to the ColE2/E7/E8/E9 couples, a support according to the invention can comprise:
According to other specific embodiments, a support according to the invention can comprise:
When used in the context of a lateral flow assay, the following order can be adopted:
A specific embodiment of the invention is based on the use of the couples ErW and AP41 as defined above, advantageously combined with other bacteriocin/immunity protein couple(s), more advantageously those disclosed above.
For any useful purpose, especially purification and labeling (e.g. by fluorescence or bioluminescence), said polypeptides can be linked or fused (recombinantly, by chemical synthesis or through chemical conjugation methods) to another entity, also named a tag. Examples of such tags are: AviTag, Calmodulin-tag, polyglutamate tag, E-tag, FLAG-tag, HA-tag, His-tag, MYC-tag, NE-tag, S-tag, SBP-tag, Softag 1, Softag 3, Spot-tag, Strep-tag, TC tag, Ty tag, V5 tag, VSV-tag, Xpress tag, Isopeptag, SpyTag, SnoopTag, SnoopTagJr, DogTag, Biotin Carboxyl Carrier Protein (BCCP), Glutathione-S-transferase, HaloTag, Maltose binding protein (MBP), Nus, Thioredoxin, Fc, Green fluorescent protein (GFP), Luciferase (e.g. RLuc8 for Renilla Luciferase or FLuc for Firefly Luciferase), mCherry, horseradish peroxidase (HRP), alkaline phosphatase (AP), glucose oxidase. A radioactive isotope, a DNA reporter, a fluorogenic reporter (e.g. phycoerythrin), or an electro-chemiluminescent tag can also be used.
In a remarkable manner, the stoichiometry of the multiplex binding experiment can be controlled based on the control of the distribution of the different polypeptides on the support according to the invention, especially by controlling the ratio between said polypeptides.
According to another aspect, the present invention relates to a reaction mixture to be used together with the support as disclosed above. In other words, said reaction mixture comprises the cognate binding partners of the at least two polypeptides immobilized on the support.
Even if mixtures can be used, it is preferred that when the polypeptides on the support correspond to bacteriocins (or fragments or mutants thereof), then the reaction mixture contains the cognate Immunity proteins (or fragments or mutants thereof). Conversely, when the polypeptides on the support correspond to Immunity proteins (or fragments or mutants thereof), then the reaction mixture contains the cognate bacteriocins (or fragments or mutants thereof).
It is to be noted that such a reaction mixture can be ready to use or can be prepared extemporally by mixing the different binding partners just before the multiplex binding experiment. Such a reaction mixture can be in a liquid form or lyophilized
According to a specific embodiment, at least one of the at least 2 binding partners is a polypeptide. Preferably, all the binding partners are polypeptides.
According to another embodiment, at least one of the at least 2 binding partners comprises or is fused to at least another entity which can serve as a tag for purification and/or labeling purposes, as listed above.
According to a specific embodiment, at least one of the at least 2 binding partners, advantageously the at least 2 binding partners, further comprises or is fused to a molecule of interest in relation to binding experiments. For clarity purposes and in the rest of the description, the molecule of interest is named an analyte-capture entity. It is to be noted that at least the 2 binding partners of the polypeptides on the support can comprise the same analyte-capture entity but advantageously different analyte-capture entities.
After incubation, the support and the reaction mixture which forms a multiplex capture reagent can have a series of applications.
The multiplex capture reagent according to the invention allows immobilizing said analyte-capture entities on the support, while controlling their location, orientation and stoichiometry.
The multiplex capture reagent can be used for detecting, studying or even isolating, and purifying the binding partner of said analyte-capture entities. For clarity purpose and in the rest of the description, the binding partner of the analyte-capture entity is named an analyte.
Therefore and as previously mentioned, it can be used for detection or isolation of analytes contained in a sample or for studying the binding of said analytes with the corresponding analyte-capture entity.
In the frame of the invention, the analyte and/or the analyte-capture entity can be any type of molecules in terms of nature and function, in particular chemical compounds, polypeptides (e.g. viral capsid proteins, glycoproteins, immunoglobulins), metabolites, viruses, biomarkers, lipids, nucleic acids (RNA, miRNA, DNA, aptamers, exosomes, . . . ), imprinted polymers, functionalized nanocages or nanoparticles.
According to a specific embodiment, the analyte(s)/analyte-capture entity(ies) can be e.g. a receptor/ligand couple or an antibody/antigen couple. According to more specific embodiments, the analyte-capture entity is an antigen and the analyte an antibody or the analyte-capture entity is an antibody and the analyte an antigen.
According to a preferred embodiment, the analyte(s) is in solution. According to another embodiment, the analyte(s) is obtained from a sample or biological sample. The terms “sample” or “biological sample” as used herein include any biological specimen obtained from a subject. Samples may include, without limitation, whole blood, plasma, serum, red blood cells, white blood cells (e.g., peripheral blood mononuclear cells), saliva, urine, stool (i.e., faeces), tears, mucus, sweat, sebum, nipple aspirate, ductal lavage, tumour exudates, synovial fluid, cerebrospinal fluid, lymph, fine needle aspirate, amniotic fluid, any other bodily fluid, cell lysates, cellular secretion products, inflammation fluid, vaginal secretions, pleural fluid, spinal fluid, gastric fluid, sweat, semen, fluid from ulcers and/or other surface eruptions, blisters, abscesses, and/or extracts of tissues, such as biopsies of normal, malignant, and/or suspect tissues.
Especially for diagnosis purposes, the analyte-capture entity is preferably a polypeptide, which can be an antigen or an antibody, depending on the techniques used.
In certain embodiments, the analyte may be an antibody and the analyte-capture entity may be an antigen recognized by the antibody analyte. In further embodiments the analyte may be a human antibody; in certain embodiments the analyte antibody may belong to the immunoglobulin (Ig) group A, D, E, G or M. The antibody may be a non-human antibody in other embodiments. In addition, the antibody may be a chimeric antibody.
In certain aspects, the pathogen may be detected by binding of an antibody to a pathogen antigen, e.g. a surface antigen or a secreted antigen. The pathogen antigen may be a protein, glycoprotein, polysaccharide, lipopolysaccharide or lipid. The surface antigen may belong to, but is not limited to, a component of the pathogen's coat, capsule, cell wall, flagella, fimbriae, toxin, pili, cytoplasmic membrane, outer membrane, peptidoglycan layer, periplasmic space, S-layer, capsid, protein coat, or envelope. Said antigen can be present on the pathogen surface or secreted by the pathogen.
In still other embodiments, the analyte may be a pathogen, especially a bacterium, a virus or a parasite. It may be selected from the list of, but is not restricted to Bordetella (e.g. Bordetella pertussis), Borrelia, Brucella, Campylobacter, Chlamydia, Chlamydophila, Clostridium, Corynebacterium, Enterococcus, Escherichia (e.g. Escherichia coli), Francisella, Haemophilus, Helicobacter, Legionella, Leptospira, Listeria, Mycobacterium (e.g. Mycobacterium leprae or Mycobacterium ulcerans), Mycoplasma, Neisseria, Pseudomonas, Rickettsia, Salmonella, Shigella (e.g. Shigella dysenteriae), Staphylococcus, Streptococcus (e.g. Streptococcus pneumoniae), Treponema, Vibrio (e.g. Vibrio cholerae), Yersinia, Plasmodium falciparum, Plasmodium vivax, Plasmodium ovale, Plasmodium malariae, Plasmodium knowlesi, Schistosomiasis mansoni, Schistosomiasis japonicum, Schistosomiasis haematobium, Trypanosoma cruzi, arboviruses such as Dengue virus, Zika virus, Yellow fever virus and Chikungunya virus, Human Immunodeficiency Virus (e.g. HIV1 or HIV2), Hepatitis virus (e.g. HCV or HBV), Human T cell leukemia/lymphoma virus (HTLV), Influenza virus, Norovirus, or Ebola virus.
It is to be noted that a given multiplex diagnostic test can be based on the combined detection of both antigens and antibodies. Moreover, the analytes can originate from the same pathogen or from different pathogens.
Multiplex diagnostic tests, e.g. in the form of rapid diagnostic tests, are useful in medicine and veterinary, especially in the field of cancer, infectious diseases, metabolic diseases, cardiac diseases, or for performing companion tests. Other fields of interest concern e.g. process control (quality control) or environmental control.
In relation to infectious diseases and merely for illustrative purposes, multiplex diagnostic tests can be dedicated to the specific detection of:
Analytes which can be detected according to the invention are for example:
In certain embodiments, the support and the reaction mixture according to the invention are used in multiplex diagnostic tests, advantageously in enzymatic immunoassays (EIA), bead-based immunoassays (e.g. Luminex®), or vertical flow (VF) or lateral flow (LF) assays including assays performed using the Dual Path Platform (DPP) as disclosed in e.g. U.S. Pat. No. 7,189,522.
Said immunoassays require a detection entity, advantageously a labeled detection entity. According to a specific embodiment, the detection entity is an antibody or an antigen able to bind to the analyte (i.e. an antigen or an antibody), without disturbing its binding to the analyte-capture entity. More generally, the detection entity is defined as the analyte-capture entity above, taking into account that it further comprises a labeled moiety.
The presence and/or quantity of the analytes bound on the support is evaluated through the signal evaluation, i.e. the measurement of the labeling (by fluorescence, bioluminescence, electrochemiluminescence, colorimetry, . . . ) of the detection entity during the so-called detection or revelation step.
The detection entity can be a labeled antibody, advantageously a monoclonal antibody, more advantageously chosen in the following group: an antigen-binding fragment (Fab), a single chain variable fragment (scFv), a diabody and a nanobody. The different options for labeling said antibodies are common knowledge in the art. Said antibody can be fused (recombinantly, by chemical synthesis or through chemical conjugation methods) to a tag as disclosed above.
In certain embodiments and without being limitative, the detection entity can comprise a bioluminescent, fluorescent, electrochemiluminescent, or colorimetric reporter which may be selected from the list of, but is not restricted to Green fluorescent protein (GFP), Luciferase, mCherry, horseradish peroxidase (HRP), alkaline phosphatase (AP), glucose oxidase. A radioactive isotope, a DNA reporter, a fluorogenic reporter (e.g. phycoerythrin), or an electro-chemiluminescent tag can also be used.
According to a specific embodiment, the detection entity may comprise a luciferase reporter. The luciferase reporter may comprise a Renilla, Gaussia, Photinus, or Cypridina luciferase. In other embodiments the luciferase may comprise a luciferase from one of the following organisms: Photinus pyralis, Luciola cruciata, Luciola italica, Luciola lateralis, Luciola mingrelica, Photuris pennsylvanica, Pyrophorus plagiophthalamus, Phrixothrix hirtus, Renilla reniformis, Gaussia princeps, Metridia longa or Oplophorus gracilorostris. In other embodiments the luciferase may be North American firefly luciferase, Japanese firefly (Genji-botaru) luciferase, Italian firefly Luciferase, Japanese firefly (Heike) luciferase, East European firefly luciferase, Pennsylvania firefly luciferase, Click beetle luciferase, Railroad worm luciferase, Renilla luciferase, Rluc8 (mutant of Renilla luciferase), Green Renilla luciferase, Gaussia luciferase, Gaussia-Dura luciferase, Cypridina luciferase, Cypridina (Vargula) luciferase, Metridia luciferase, Oplophorus luciferase (OLuc) or a bacterial luciferase. Substrates used in certain embodiments may include Luciferin, Coelenterazine, Vargulin or any compounds based on these substrates. Synthetic luciferases, e.g. NanoLuc® having furimazine as a substrate, can also be used.
According to a specific embodiment and in relation to e.g. antigenic EIA tests or bead-based immunoassays such as Luminex®, the analyte to be detected, possibly from a sample, is an antigen.
In that case and according to a preferred embodiment, the analyte-capture entity is an antibody (Ab), advantageously a monoclonal antibody, more advantageously chosen in the following group: an antigen-binding fragment (Fab), a single chain variable fragment (scFv), a diabody and a nanobody. Nanobodies, also named single domain antibodies (sdAb) or VHH fragments, consist of one heavy chain variable domain, are very stable and relatively small peptide chains of about 110 amino acids which preserve the antigen-binding capacity. Alternatively, synthetic binders also named non-immunoglobulin scaffolds such as Affibodies, Adnectin, Affilin, Anticalin, alphabody or DARPin can be used.
In that context, the detection entity is usually a labeled antibody.
On the contrary, in serological EIA tests, the analytes are usually antibodies possibly contained in a sample, e.g. IgM and/or IgG, and their detection requires a detection entity, i.e. a labeled antibody (indirect detection) or a labeled antigen (sandwich detection), able to further bind said antibodies.
Also in relation to serological EIA tests, the analyte-capture entity can be an antibody or an antigen.
Basically and especially in relation to EIA tests, the diagnostic procedure includes the analyte capture and the addition of the detection entity before revelation. The revelation is usually preceded by a washing step.
According to a first embodiment, the support functionalized with the polypeptides (e.g. ColE proteins or fragments thereof) is coincubated with the binding partners thereof (e.g. the cognate Im proteins) fused to the analyte-capture entities (e.g. an antibody or an antigen) and the analytes or the sample containing said analytes (e.g. an antigen or an antibody). The detection entity (e.g. a labeled antibody or antigen) can be added simultaneously (1 step) or after a wash (2 steps).
According to another embodiment, the support and the reaction mixture (i.e. the cognate binding partners of the polypeptides immobilized on the support, fused to the analyte-capture entities) are previously incubated and then provided as a prefunctionalized support, to which the analytes or the sample containing said analytes (e.g. an antigen or an antibody) are added. The detection entity (e.g. a labeled antibody or antigen) can be added together with the analytes (1 step) or after a wash (2 steps).
The support and the reaction mixture according to the invention can also be used in lateral flow assays (LFA) or vertical flow assays (VFA) which principle is well known to the skilled person.
In that context, the support corresponds to a membrane or strip, which is functionalized with the at least two polypeptides, each polypeptide forming a test line.
Moreover, the reaction mixture of the invention containing the cognate binding partners of the polypeptides immobilized in the test lines fused to an analyte-capture entity, advantageously analyte-capture polypeptides, more advantageously antibodies, corresponds to the so-called capture antibodies.
Typically, the sample containing the analytes of interest, advantageously antigens, is deposit in the sample pad together with the capture antibodies and/or the detection antibodies. Alternatively, the capture antibodies and/or the detection antibodies can be deposit in the conjugate pad.
A control line containing a molecule able to bind the detection antibodies is advantageously present at the end of the strip to ensure that the reaction mixture together with the detection antibodies has properly migrated.
Therefore and according to another aspect, the invention concerns a method for detecting at least 2 analytes, possibly contained in a sample, comprising:
Basically, such a method encompasses 2 steps, i.e. the reaction step during which the binding of the analytes occurs and then a revelation step which allows to conclude about the analyte binding. A washing step is usually performed in between.
In practice, the first step can be performed in one step or sequentially. When performed sequentially and according to a preferred embodiment, the detection entities are added together with the analytes or the sample containing said analytes, or afterwards.
According to a specific embodiment, the support, the reaction mixture and the analytes or the sample(s) containing said analytes are all contacted simultaneously. According to another specific embodiment, the support and the reaction mixture are first contacted and then the analytes or the sample(s) containing said analytes are added. Alternatively, the reaction mixture and the analytes or the sample(s) containing said analytes are first contacted and then added to the support. Before the addition(s), a washing step can be performed.
According to a further aspect, the present invention concerns a kit for practicing the methods of the invention. At the minimum, such a kit contains a support and a reaction mixture as disclosed above.
The support and the reaction mixture can be provided separately or the support can be prefunctionalized, i.e. the polypeptides on the support are already bound to their cognate partners fused to the analyte-capture entities. Said components may be suitably labeled as known from the skilled person.
Said kit can also comprise controls, standards and/or calibrators. It can also comprise means for collecting the sample from the subject.
According to a further embodiment, a kit according to the invention further contains suitable detection entities, advantageously labeled detection entities e.g. labeled antibodies and/or antigens as defined above. Means for detecting and measuring the labels can also been provided.
According to another embodiment, said kit further comprises instructions for use.
The invention is further described in detail by reference to the following experimental examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified.
Without further description, it is believed that one of ordinary skill in the art can, using the preceding description and the following illustrative examples, make and utilize the compounds of the present invention and practice the claimed methods. The following working examples therefore, specifically point out the preferred embodiments of the present invention, and are not to be construed as limiting in any way the remainder of the disclosure.
Material and Methods
Plasmids and Sequences
Plasmids
pBA01 is a plasmid to express proteins in E. coli. The most important functional sequences comprised in the plasmid are:
Between the T7 promoter and its T7 Terminator sequences, there is a multiple cloning site allowing to use a variety of restriction enzymes, such as BamHI, and XhoI used to clone different inserts into the plasmid.
DNA Sequences
The nucleotide sequences encoding some Colicins (Col) and the corresponding Immunity proteins (Im) have already been reported. As an example, the sequences for E. coli ColE2, E7, E8 and E9 are disclosed in WO2017/100584.
In order to prove the feasibility of the present invention using a large number of toxin/antitoxin couples (even not characterized or even not isolated yet), an in silico automated screening approach was applied in order to recover novel candidate bacteriocin sequences.
Profiles were built to capture the conserved residues of both bacteriocins and Immunity proteins, based on a multiple sequence alignment of seven bacteriocin sequences:
and a separate multiple sequence alignment of seven Immunity proteins:
Alignments were performed with Muscle and used to build two separate HMMER3 profiles. Both HMMER3 profiles were used to search for homologous bacteriocins and bacteriocin Immunity proteins against translated open reading frames of 72210 bacterial genomes from the NCBI RefSeq database (accessed on 29 Mar. 2019). Candidate couples were kept if all the following criteria were met:
Based on such a screening, 3935 putative “bacteriocin-bacteriocin Immunity protein” couples have been identified.
Among them, nine bacteriocin/Immunity protein listed in Table 1 below were selected for in vitro validation in multiplex (8 plex) experiments.
Escherichia_coli_E2 (ColE2 or Im2)
Escherichia_coli_E7 (ColE7 or Im7)
Escherichia_coli_E8 (ColE8 or Im8)
Escherichia_coli_E9 (ColE9 or Im9)
Pseudomonas_aeruginosa_AP41
Pectobacterium_carotovorum (ColErW or ImErw)
Pseudomonas_syringae_B728A (ColSyr or ImSyr)
Pseudomonas_sp_Leaf83 (ColLeaf or ImLeaf)
As a further illustration, additional couples, selected merely because they all originate from distinct bacteria species, are shown in Table 2 below:
Citrobacter_europaeus
Citrobacter_freundii
Citrobacter_koseri
Citrobacter_portucalensis
Enterobacter_asburiae
Enterobacter_bugandensis
Enterobacter_cancerogenus
Enterobacter_cloacae
Enterobacter_hormaechei
Enterobacter_kobei
Enterobacter_roggenkampii
Enterovibrio_norvegicus
Erwinia_tasmaniensis
Escherichia_coli
Escherichia_marmotae
Halomonas_anticariensis
Klebsiella_aerogenes
Klebsiella_oxytoca
Klebsiella_pneumoniae
Klebsiella_quasipneumoniae
Klebsiella_variicola
Kluyvera_intermedia
Morganella_morganii
Obesumbacterium_proteus
Pectobacterium_carotovorum
Pectobacterium_parmentieri
Pectobacterium_polaris
Pectobacterium_wasabiae
Photorhabdus_bodei
Photorhabdus_khanii
Photorhabdus_laumondii
Photorhabdus_luminescens
Pragia_fontium
Proteus_mirabilis
Providencia_heimbachae
Providencia_rettgeri
Pseudomonas_aeruginosa
Pseudomonas_alkylphenolica
Pseudomonas_amygdali
Pseudomonas_arsenicoxydans
Pseudomonas_asplenii
Pseudomonas_avellanae
Pseudomonas_azotoformans
Pseudomonas_brassicacearum
Pseudomonas_cannabina
Pseudomonas_caricapapayae
Pseudomonas_cedrina
Pseudomonas_cerasi
Pseudomonas_chlororaphis
Pseudomonas_cichorii
Pseudomonas_citronellolis
Pseudomonas_congelans
Pseudomonas_coronafaciens
Pseudomonas_cremoricolorata
Pseudomonas_denitrificans
Pseudomonas_entomophila
Pseudomonas_extremaustralis
Pseudomonas_floridensis
Pseudomonas_fluorescens
Pseudomonas_fragi
Pseudomonas_frederiksbergensis
Pseudomonas_fulva
Pseudomonas_furukawaii
Pseudomonas_guariconensis
Pseudomonas_indica
Pseudomonas_japonica
Pseudomonas_jessenii
Pseudomonas_knackmussii
Pseudomonas_koreensis
Pseudomonas_kribbensis
Pseudomonas_lundensis
Pseudomonas_mandelii
Pseudomonas_marginalis
Pseudomonas_monteilii
Pseudomonas_moraviensis
Pseudomonas_mosselii
Pseudomonas_mucidolens
Pseudomonas_orientalis
Pseudomonas_parafulva
Pseudomonas_plecoglossicida
Pseudomonas_poae
Pseudomonas_prosekii
Pseudomonas_psychrophila
Pseudomonas_putida
Pseudomonas_reinekei
Pseudomonas_savastanoi
Pseudomonas_silesiensis
Pseudomonas_synxantha
Pseudomonas_syringae
Pseudomonas_thivervalensis
Pseudomonas_umsongensis
Pseudomonas_viridiflava
Rahnella_aquatilis
Salmonella_bongori
Salmonella_enterica
Serratia_liquefaciens
Serratia_marcescens
Serratia_plymuthica
Serratia_rubidaea
Shigella_boydii
Shigella_sonnei
Vibrio_alginolyticus
Vibrio_anguillarum
Vibrio_bivalvicida
Vibrio_campbellii
Vibrio_cholerae
Vibrio_gazogenes
Vibrio_harveyi
Vibrio_hyugaensis
Vibrio_jasicida
Vibrio_ordalii
Vibrio_parahaemolyticus
Vibrio_rhizosphaerae
Vibrio_tasmaniensis
Vibrio_xiamenensis
Xenorhabdus_griffiniae
Xenorhabdus_hominickii
Yersinia_aldovae
Yersinia_aleksiciae
Yersinia_bercovieri
Yersinia_enterocolitica
Yersinia_frederiksenii
Yersinia_intermedia
Yersinia_kristensenii
Yersinia_mollaretii
Yersinia_pekkanenii
Yersinia_pseudotuberculosis
Yersinia_similis
Yersinia_wautersii
Protein Sequences
The sequences corresponding to the Colicins and Immunity proteins of Table 1 encoded by the plasmids are listed below. All fusion proteins harbor a 6His tag at their COOH-terminus. All colicins fusion proteins contained a NH2-terminal Flag tag (underlined) optionally following by a fluorescent protein (in italic) fused to the Colicin NH2-terminus (in bold). ColE2 and ColE7 are in frame with EmGFP while all other Colicins (ColE8, ColE9, ColAP41, ColSyr, ColErw, ColLeaf, ColKhan) are in frame with mCherry. All immunity proteins (in bold) are in frame at their NH2-terminus with a polypeptide comprising a Myc tag or Avitag (underlined). Half of Im proteins are fused to RLuc8 (underlined and italic).
GKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFARYPDHMKQHDFFKSAMPEGYVQ
ERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHKV
YITADKQKNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSA
LSKDPNEKRDHMVLLEFVTAAGITLGMDELYKLESKRNKPGKATGKGKPVGD
KWLDDAGKDSGAPIPDRIADKLRDKEFKNFDDFRKKFWEEVSKDPDLSK
QFKGSNKTNIQKGKAPFARKKDQVGGRERFELHADKPISQDGGVYDMN
NIRVTTPKRHIDIHRGKLEGGGSHHHHHH
KLTLKFICTTGKLPVPWPTLVTTLTYGVQCFARYPDHMKQHDFFKSAMPEGYVQER
TIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHKVYITA
DKQKNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDP
NEKRDHMVLLEFVTAAGITLGMDELYKLESKRNKPGKATGKGKPVNNKWLNN
AGKDLGSPVPDRIANKLRDKEFKSFDDFRKKFWEEVSKDPELSKQESRNNN
DRMKVGKAPKTRTQDVSGKRTSFELHAEKPISQNGGVYDMDNISVVTPKR
HIDIHRGKLEGGGSHHHHHH
PYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKW
ERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSE
RMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHN
EDYTIVEQYERAEGRHSTGGMDELYKLESKRNKPGKATGKGKPVGDKWLDDA
GKDSGAPIPDRIADKLRDKEFKNFDDFRRKFWEEVSKDPELSKQFNPGNKK
RLSQGLAPRARNKDTVGGRRSFELHADKPISQDGGVYDMDNLRITTPKRHI
DIHRGQLEGGGSHHHHHH
PYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKW
ERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSE
RMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHN
EDYTIVEQYERAEGRHSTGGMDELYKLESKRNKPGKATGKGKPVGDKWLDDA
GKDSGAPIPDRIADKLRDKEFKSFDDFRKAVWEEVSKDPELSKNLNPSNKSS
VSKGYSPFTPKNQQVGGRKVYELHADKPISQGGEVYDMDNIRVTTPKRHID
IHRGKLEGGGSHHHHHH
KHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHY
KYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDE
WPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVR
RPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAK
KFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ
KLELKHSISDYTEAE
FLEFVKKICRAEGATEEDDNKLVREFERLTEHPDGSDLIYYPRDDREDSPEG
IVKEIKEWRAANGKSGFKQGLEGGGSHHHHHH
KHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHY
KYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDE
WPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVR
RPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAK
KFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ
KLELKNSISDYTEAE
FVQLLKEIEKENVAATDDVLDVLLEHFVKITEHPDGTDLIYYPSDNRDDSPE
GIVKEIKEWRAANGKPGFKQGLEGGGSHHHHHH
KHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHY
KYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDE
WPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVR
RPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAK
KFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ
KLELKNSISDYTETEF
KKIIEDIINCEGDEKKQDDNLEHFISVTEHPSGSDLIYYPEGNNDGSPEAVIKE
IKEWRAANGKSGFKQGLEGGGSHHHHHH
KHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHY
KYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDE
WPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVR
RPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAK
KFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ
KLELKHSISDYTEAE
FLQLVTTICNADTSSEEELVKLVTHFEEMTEHPSGSDLIYYPKEGDDDSPSGI
VNTVKQWRAANGKLEGGGSHHHHHH
PYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKW
ERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSE
RMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHN
EDYTIVEQYERAEGRHSTGGMDELYKLPGGSDEPGVATGNGQPVTGNWLAGAS
QGDGVPIPSQIADQLRGKEFKSWRDFREQFWMAVSKDPSALENLSPSNRYF
VSQGLAPYAVPEEHLGSKEKFEIHAVVPLESGGALYNIDNLVIVTPKRHSEI
HKELKLKRKEKGGSGGSCLEGGGSHHHHHH
PYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKW
ERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSE
RMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHN
EDYTIVEQYERAEGRHSTGGMDELYKLPGGSRSIPGVASGYGEAVNGVWLGDK
TRAEGASIPAHIADQLRGRREGNEDSLRKATWIAVANDPELVKQFTQHNLE
IMRDGGAPYPRLVDQAGGRTKFEIHAKKHIANGGAVYDIDNLVIMTPRQHI
DHHRSHENDLGGSGGSCLEGGGSHHHHHH
PYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKW
ERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSE
RMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHN
EDYTIVEQYERAEGRHSTGGMDELYKLPGGSRDKPGTVTGKGEVLSSEGKWLE
SASSGLGAPVPAQVADKLRGQKFERFDDFREAFWLAVAECPELMVQFNRS
NQTIIRAGTSPFAIPEEQVGKRKRFEIHAVKNIQHRGEVYNIDNLRVNTPKN
HIGLHGGSGGSCLEGGGSHHHHHH
PYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKW
ERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSE
RMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHN
EDYTIVEQYERAEGRHSTGGMDELYKLGGGGSGGGGSSLRHEPGVVTGQGQDV
TGIWLENAGRELGAPIPSQIADQLRGKQESSEDSFRKREWKTVGTDATLSN
QFISANRKRMLAGKAAKLREKDRVGGRTTYELHAVEKISEGGEVYNVDNL
RVVTAKRHIEIHKTEGKCLEGGGSHHHHHH
PYEGTQTAKLKVTKGGPLPFAWDILSPQFMYGSKAYVKHPADIPDYLKLSFPEGFKW
ERVMNFEDGGVVTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASSE
RMYPEDGALKGEIKQRLKLKDGGHYDAEVKTTYKAKKPVQLPGAYNVNIKLDITSHN
EDYTIVEQYERAEGRHSTGGMDELYKLGGGGSGGGGSNTPRNQPGTVTGQGQK
VEGNWLSRAGQDMGAPIPSQIADKLRGRTENNFDDFRKAFWKEVGNDPEL
AKDLSDVNKKRIKELGYAPFAIPIEQVGGKKKFDIHAVKPIKDGGAVYDLD
NLRVVTPKKHIELHSNCLEGGGSHHHHHH
KHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHY
KYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDE
WPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVR
RPTLSWPREIPLVKGGKPDVV
Q
IVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAK
KFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ
KLPGGSDIKNNLSDY
TESEFLEIIEEFFKNKSGLKGSELEKRMDKLVKHFEEVTSHPRKSGVIFHPK
PGFETPEGIVKEVKEWRAANGLPGFKAGLEGGSGGSGLNDIFEAQKIEWHEL
KHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHY
KYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDE
WPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVR
RPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAK
KFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQK
LPGGSIFKEKIEDYT
EEEFLEFLKGLSSEYSQLHGDEFIKHMDRSVEHFVKITEHPAQTDVIFYPEE
GQEDTPEGILKVIKEWRAKNGKPGFKSGGSGGSGLNDIFEAQKIEWHELEGG
KHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGNGSYRLLDHY
KYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDE
WPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVR
RPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAK
KFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ
KLPGGSNLKEKLEDY
TEAEFISYLKEFFDNPMGLRGKELETHLDSLVEHFDKIVFHPEGNGLIFYPP
DERDDSPEGVLNEIKRWRKSQGLPLFKDSKGGSGGSGLNDIFEAQKIEWHEL
DSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGN
GSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVV
DVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEP
FKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFS
NAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ
GGGSTAGG
LIYYCESDAECTPERITQKVKSWRAANGLPGEKSTLEGGGSHHHHHH
DSFINYYDSEKHAENAVIFLHGNATSSYLWRHVVPHIEPVARCIIPDLIGMGKSGKSGN
GSYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVV
DVIESWDEWPDIEEDIALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEP
FKEKGEVRRPTLSWPREIPLVKGGKPDVVQIVRNYNAYLRASDDLPKLFIESDPGFFS
NAIVEGAKKFPNTEFVKVKGLHFLQEDAPDEMGKYIKSFVERVLKNEQ
GGGSTAGG
GLIFYPENGVEDSPEGVLKVIKEWRAKNGKPGFKKLEGGGSHHHHHH
REFERLTEHPDGSDLIYYPRDDREDSPEGIVKEIKEWRAANGKSGEKQGLE
EHFVKITEHPDGTDLIYYPSDNRDDSPEGIVKEIKEWRAANGKPGFKQGLEG
ISVTEHPSGSDLIYYPEGNNDGSPEAVIKEIKEWRAANGKSGFKQGLEGGGS
HFEEMTEHPSGSDLIYYPKEGDDDSPSGIVNTVKQWRAANGKLEGGGSHHH
DKLVKHFEEVTSHPRKSGVIFHPKPGFETPEGIVKEVKEWRAANGLPGFKA
GLEGGSGGSGLNDIFEAQKIEWHELEGGGSHHHHHH
DRSVEHFVKITEHPAQTDVIFYPEEGQEDTPEGILKVIKEWRAKNGKPGFKS
LDSLVEHFDKIVFHPEGNGLIFYPPDERDDSPEGVLNEIKRWRKSQGLPLFK
DSKGGSGGSGLNDIFEAQKIEWHELEGGGSHHHHHH
EAEFIAFMEDIFRENEAETDDRLDVLLDQFREITGHPDGTDLIYYCESDAEC
TPERITQKVKSWRAANGLPGEKSTLEGGGSHHHHHH
YTEAEFLSLLNKIWAVDVSEEEHDNLIDHFEKLSEHPNGNGLIFYPENGVED
SPEGVLKVIKEWRAKNGKPGFKKLEGGGSHHHHHH
Protein Production and Purification
Each plasmid was sequenced and the corresponding sequence was verified. For protein production, each plasmid was transformed into E. coli bacteria (BL21(DE3) strain, NEB) following manufacturer protocol and bacteria were selected on Kanamycin plate. The day after, all the bacteria from one plate were resuspended in 500 ml of LB medium plus kanamycin (50 μg/ml) and incubated at 37° C. under shaking at 220 rpm. When the culture OD600 was close to 0.6, protein expression was induced with 0.1 mM of Isopropyl 3-D-1-thiogalactopyranoside (IPTG) and incubated overnight at 20° C., shaking at 220 rpm. Bacteria were then centrifuged for 30 mM at 4° C. at 4 000 relative centrifugal force (rcf) and washed in 50 mL of phosphate-buffered saline (PBS). The pellet was then resuspended in 5 mL of lysis buffer (50 mM Tris pH 7.5, 150 mM NaCl, 10 mM imidazole, containing 1× complete EDTA-free protease inhibitor, Roche) and 10 μg/mL of Deoxyribonuclease I from bovine pancreas (Sigma) and 1 mg/mL of lysozyme (Sigma) were added and incubated on ice for 30 mM Bacteria were lysed using glass particles. Alternatively, bacteria were resuspended in 10 ml of lysis buffer and sonicated for 1 minute and this process was repeated 4 times, with 1 minute off between each period of sonication. An other alternative is the disruption of cells at high pressure (2,5Kbar) with a OS system (Constant Systems Limited). The lysate was then centrifuged for 20 mM at 14000 rcf at 4° C. Supernatant containing soluble proteins was then poured onto a Ni2+-NTA resin (QIAGEN) column at room temperature (RT). Resin was washed with 20 bed volumes of 50 mM Tris pH 7.5, 150 mM NaCl, 10 mM imidazole. Elution was performed with 50 mM Tris pH 7.5, 150 mM NaCl, 250 mM imidazole poured onto the column and collected in separate eppendorf tubes. The elution tubes containing the protein of interest were dialysed using Spectrum dialysis membrane Spectra/Por 6 (Thermo) in 4 L, 50 mM Tris H 7.5, 150 mM NaCl overnight at 4° C. Alternatively, eluted proteins were inserted in a gel filtration (GF Hiload 16/600 Superdex 75 μp from GE Healthcare) with the same buffer (50 mM Tris H 7.5, 150 mM NaCl).
Enzyme Immuno-Assay (EIA) Experiments with Colicins and Immunity Proteins, 4 Plex
100 μL of the chosen Colicin protein (SEQ ID NO: 1 to 4) diluted in carbonate buffer (final concentration 100 nM) were individually incubated at 4° C. overnight on Nunc Maxisorp white 96-well plate (ThermoFischer). Each well was washed three times with 200 μL of PBS, 0.05% Tween 20 (PBST). Well saturation was achieved by incubation for 1 hour at RT with 2% (w/v) Bovine Serum Albumin (BSA) in PBST, shaking at 180 rpm. Each well was washed three times with 200 μL of PBST. 50 μL of 100 nM Immunity protein fused to RLuc8 (SEQ ID NO: 5 to 8) with or without Immunity protein (SEQ ID NO: 19 to 22) solutions (dilution in PBST 0.2% BSA (w/v)) were introduced into wells and incubated for 20 mM at RT, shaking at 180 rpm. Each well was washed three times with 200 μL of PB ST. 40 μL of RLuc8 buffer consisting of 25 mM HEPES pH 7.1 mM EDTA, 0.5% (v/v) Tergitol, 50 mM KI and 5 mM Thiosulfate were added into each well and subsequently 10 μL of the same buffer containing 5 μM of Coelenterazine H (Sigma) was added. After shaking at 180 rpm for 10 s, bioluminescence signal was measured with Tecan Infinite 200 Pro, using an integration time of 1000 ms in luminescence mode.
Enzyme Immuno-Assay (EIA) Experiments with Colicins and Immunity Proteins, 8 Plex n° 1
100 μL of the chosen Colicin protein (SEQ ID NO: 1 to 4, 9 to 11 and 13) diluted in carbonate buffer (final concentration 100 nM) were individually incubated at room temperature (RT) overnight on Costar High Binding white 96-well plate (Corning).
Each well was washed three times with 250 μL of PBS, 0.05% Tween 20 (PBST). Well saturation was achieved by incubation for 2 hours at RT with 1% (w/v) Casein in PBST, shaking at 280 rpm. Each well was washed three times with 250 μL of PBST. 100 μL of 100 nM Immunity protein fused to RLuc8 (SEQ ID NO: 5 to 8, 14 to 16 and 18) with or without Immunity protein (SEQ ID NO: 19 to 25 and 27) solutions (dilution in PBST 0.1% Casein (w/v)) were introduced into wells and incubated for 15 mM at RT, shaking at 280 rpm. Each well was washed three times with 250 μL of PBST. 100 μL of RLuc8 revelation buffer consisting of 25 mM HEPES pH 7.1 mM EDTA, 0.5% (v/v) Tergitol, 50 mM KI, 5 mM Thiosulfate and 1 μM of Coelenterazine H were added into each. After shaking manually, bioluminescence signal was measured with the EnSight HH3400 (Perkin Elmer) reader using an integration time of 0.2 s in single luminescence mode.
Enzyme Immuno-Assay (EIA) Experiments with Colicins and Immunity Proteins, 8 Plex n° 2
100 μL of the chosen Colicin protein (SEQ ID NO: 1, 3, 4, 9 to 13) diluted in carbonate buffer (final concentration 100 nM) were individually incubated at room temperature (RT) overnight on Costar High Binding white 96-well plate (Corning). Each well was washed three times with 250 μL of PBS, 0.05% Tween 20 (PBST). Well saturation was achieved by incubation for 2 hours at RT with 1% (w/v) Casein in PBST, shaking at 280 rpm. Each well was washed three times with 250 μL of PBST. 100 μL of 100 nM Immunity protein fused to RLuc8 (SEQ ID NO: 5, 7, 8, 14 to 18) with or without Immunity protein (SEQ ID NO: 19 and 21 to 27) solutions (dilution in PBST 0.1% Casein (w/v)) were introduced into wells and incubated for 15 mM at RT, shaking at 280 rpm. Each well was washed three times with 250 μL of PBST.
100 μL of RLuc8 revelation buffer consisting of 25 mM HEPES pH 7.1 mM EDTA, 0.5% (v/v) Tergitol, 50 mM KI, 5 mM Thiosulfate and 1 μM of Coelenterazine H were added into each. After shaking manually, bioluminescence signal was measured with the EnSight HH3400 (Perkin Elmer) reader using an integration time of 0.2 s in single luminescence mode.
Multiplexed LFA-Liked Experiment with Colicins and Immunity Proteins
Nitrocellulose membranes were sprayed with different mCherry- or EmGFP-fused Colicin proteins (SEQ ID NO: 1 to 4) at 10 μM. 10 μL of 100 nM RLuc8-fused Immunity protein (SEQ ID NO: 5 to 8) solution (alone or in the presence of the 3 other
Immunity proteins as indicated in
Results
A/ Proof of Concept Based on the ColE2/E7/E8/E9 Couples
In an attempt to establish a multiplex analysis, advantage was taken of the very high affinity of DNase Colicins (ColE) to their cognate Immunity protein (Im) (Kd˜10−14/−15 M). Because Im proteins are able to bind to non-cognate Colicin proteins with an affinity ranging from 10−6 to 10−10 M, the capability of these proteins to be used in multiplex assays, without significant cross-reactivity, was first assessed. Experiments were designed to first evaluate the cross-reactivity and second their potential use in a test mimicking a multiplex assay. The interactions of both cognate and non-cognate pairs of proteins were thus tested, each couple separately, to quantify and compare the interactions. Experiments were performed with the Colicin proteins (E2, E7, E8 and E9) that were incubated individually with every Im protein fused to RLuc8 as a reporter and Luciferase activity was evaluated. These experiments were performed using a EIA or LFA format.
1) Immunoassay (EIA) Tests
For EIA experiments, the Colicins (E2, E7, E8 and E9) were individually coated on a well of Maxisorb 96-well plate and one Im protein (Im2 or Im7 or Im8 or Im9) fused to RLuc8 was added into each well. Following incubation at room temperature for 15 minutes and washing steps, the Luciferase activity was monitored following substrate addition. Results are presented in
Then, each ColE was incubated with a mix containing an Im-Rluc8 fusion protein plus the 3 other Im proteins, devoid of Luciferase activity (Im protein without fusion) (
2) LFA Tests
The cross-reactivity of Im proteins towards non cognate biding partners was next evaluated in Lateral Flow Assay, where the 4 ColE proteins (1 μl of each ColE at 10 μM) were sprayed as line on nitrocellulose membranes, in the following order: ColE8, ColE2, ColE9, ColE7. The sample pad is on the left and the adsorbent pad on the right. Each Im protein fused to Rluc8 alone was first applied on the sample pad (7 μl of 10 nM Im-RLuc8 diluted in 100 μl of PBS 0.2% BSA, 0.05% Tween-20) and then the Luciferase activity was monitored on the membrane (
3) Conclusions
In both EIA and LFA formats, a cross-reactive binding between non-cognate pairs was observed when one Im protein is incubated with non cognate ColE, which appears stronger in experimental settings used in LFA. When incubation is carried out with all the 4 Im proteins together in the solution, with only one fused to RLuc8, this cross-reactivity was completely abrogated, in both EIA and LFA, demonstrating the capability of this system to be used in multiplex assays.
B/ Proof of Concept with Further Col/Im Couples at a Larger Scale (8 Plex)
In an attempt to further exemplify the multiplex capability according to the invention, advantage was taken of the very high affinity of five newly identified DNase Colicins to their cognate Immunity proteins (Im). Experiments were designed to evaluate the cross-reactivity and their potential use in a test mimicking a multiplex assay based on 8 couples. The interactions of both cognate and non-cognate pairs of proteins were tested. Experiments were performed with the Colicin proteins ColE2, ColE7, ColE8, ColE9, ColAP41, ColSyr, ColErw, ColKhan for the 8plex n° 1 and ColE2, ColE8, ColE9, ColAP41, ColSyr, ColErw, ColLeaf, ColKhan for the 8plex n° 2 that were incubated individually with Im2, Im7, Im8, Im9, ImAP41, ImSyr, ImErw, ImKhan proteins (for the 8 plex n° 1) or Im2, Im8, Im9, ImAP41, ImSyr, ImErw, ImLeaf, ImKhan proteins (for the 8 plex n° 2) fused or not to RLuc8 as a reporter. Luciferase activity was evaluated. These experiments were performed using an EIA format.
Enzyme Immuno-Assay (EIA) Experiments with Colicins and Immunity Proteins, 8 Plex n° 1
Colicins (ColE2, ColE7, ColE8, ColE9, ColAP41, ColSyr, ColErw, ColKhan) were individually coated on a well of Maxisorb 96-well plate and one Im protein (Im2, Im7, Im8, Im9, ImAP41, ImSyr, ImErw, ImKhan) fused to RLuc8 was added into each well. Following incubation at room temperature for 15 minutes and washing steps, the Luciferase activity was monitored following substrate addition. Results are presented in
Then, each Colicin was incubated with a mix containing an Im-Rluc8 fusion protein plus the 7 other Im proteins, devoid of Luciferase activity (Im protein without fusion) (
Of note, there is no effect on the cognate binding reactions, which validate the concept of using these binding partners in future multiplex assays.
The “no coating” graph (
A non-binding hypothesis is that non-specific binding of Im9 and Im8 to the surface of 96-well plate is occurring. Additional saturating coating agent (proteins, polymers . . . ) could be used to prevent this non-specific binding.
Enzyme Immuno-Assay (EIA) Experiments with Colicins and Immunity Proteins, 8 Plex n° 2
Colicins (ColE2, ColE8, ColE9, ColAP41, ColSyr, ColErw, ColLeaf, ColKhan) were individually coated on a well of Maxisorb 96-well plate and one Im protein (Im2, Im8, Im9, ImAP41, ImSyr, ImErw, ImLeaf, ImKhan) fused to RLuc8 was added into each well. Following incubation at room temperature for 15 minutes and washing steps, the Luciferase activity was monitored following substrate addition. Results are presented in
Then, each Colicin was incubated with a mix containing an Im-Rluc8 fusion protein plus the 7 other Im proteins, devoid of Luciferase activity (Im protein without fusion) (
Of note, there is no effect on the cognate binding reactions, which validate the concept of using these binding partners in future multiplex assays.
The “no coating” graph (
Once again, a non-binding hypothesis is hypothesis is that non-specific binding of Im9 and Im8 to the surface of 96-well plate is occurring. Additional saturating coating agent (proteins, polymers . . . ) could be used to prevent this non-specific binding.
3) Conclusions
A cross-reactive binding between non-cognate pairs was observed when one Im protein is incubated with non cognate Colicin. When incubation is carried out with all the 8 Im proteins together in the solution, with only one fused to RLuc8, this cross-reactivity was abrogated, demonstrating the capability of this system to be used in large multiplex assays.
| Number | Date | Country | Kind |
|---|---|---|---|
| 18306517.6 | Nov 2018 | EP | regional |
This application is the U.S. National Stage Application under 35 U.S.C. § 371 of International Application No. PCT/EP2019/081692, filed Nov. 18, 2019, designating the U.S. and published in the English language as WO 2020/104397 A1 on May 28, 2020, which claims the benefit of European Patent Application No. EP 18306517.6, filed Nov. 19, 2018. Any and all applications for which a foreign or a domestic priority is claimed is/are identified in the Application Data Sheet filed herewith and is/are hereby incorporated by reference in their entirety under 37 C.F.R. § 1.57.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/EP2019/081692 | 11/18/2019 | WO | 00 |