Methods for Detecting Microorganisms Using Microorganism Detection Protein and Other Applications of Cell Binding Components

Abstract
Disclosed herein are methods and systems for rapid detection of microorganisms using a cell binding component (CBC). The specificity of CBSs for binding microorganisms allows targeted and highly specific detection of a microorganism of interest.
Description
FIELD OF THE INVENTION

The invention relates to methods, apparatuses, systems for detection of microorganism of interest using recombinant and/or conjugated proteins.


BACKGROUND

There is a strong interest in improving speed and sensitivity for detection of bacteria, viruses, and other microorganisms in biological, food, water, and clinical samples. Microbial pathogens can cause substantial morbidity among humans and domestic animals, as well as immense economic loss. Detection of microorganisms is a high priority for the Food and Drug Administration (FDA) and Centers for Disease Control (CDC) given outbreaks of life-threatening or fatal illness caused by ingestion of food contaminated with certain microorganisms, e.g., Staphylococcus spp., Escherichia coli or Salmonella spp.


Traditional microbiological tests for the detection of bacteria rely on non-selective and selective enrichment cultures followed by plating on selective media and further testing to confirm suspect colonies. Such procedures can require several days. A variety of rapid methods have been investigated and introduced into practice to reduce the time requirement. However, to-date, methods reducing the time requirement have drawbacks. For example, techniques involving direct immunoassays or gene probes generally require an overnight enrichment step in order to obtain adequate sensitivity, and therefore lack the ability to deliver same-day results. Polymerase chain reaction (PCR) tests also include an amplification step and therefore are capable of both very high sensitivity and selectivity; however, the sample size that can be economically subjected to PCR testing is limited. Dilute bacterial suspensions capable of being subjected to PCR will be free of cells and therefore purification and/or lengthy enrichment steps are still required.


The time required for traditional biological enrichment is dictated by the growth rate of the target bacterial population of the sample, by the effect of the sample matrix, and by the required sensitivity. In practice, most high sensitivity methods employ an overnight incubation and take about 24 hours overall. Due to the time required for cultivation, these methods can take up to three days, depending upon the organism to be identified and the source of the sample. This lag time is generally unsuitable as such delays allow contaminated food or water or other products to make its way into livestock or humans. In addition, increases in antibiotic-resistant bacteria and biodefense considerations make rapid identification of bacterial pathogens in water, food, and clinical samples critical priorities worldwide.


Therefore, there is a need for more rapid, simple and sensitive detection and identification of microorganisms, such as bacteria and other potentially pathogenic microorganisms.


SUMMARY

Embodiments of the invention comprise compositions, methods, apparatuses, systems, and kits for the detection of microorganisms. In certain embodiments, a cell binding component (CBC) is used to detect microorganisms of interest. The invention may be embodied in a variety of ways.


In one aspect, the present invention comprises methods for testing a sample for the presence of a microorganism of interest using a microorganism detection probe (MDP). In some embodiments the present invention comprises a method to capture and detect as few as a single microorganism of interest in a sample. For example, in certain embodiments, the methods may comprise the steps of incubating the sample with a plurality of MDPs that bind the microorganism of interest, wherein the MDP comprises an indicator moiety and a cell binding component (CBC) under conditions such that the microorganism binds the plurality of MDPs; separating unbound MDP from cell-bound MDP; and detecting the indicator moiety on the cell-bound MDP. In further embodiments, positive detection of the indicator moiety indicates that the microorganism of interest is present in the sample. In some embodiments the plurality of MDPs bound to the single microorganism is at least 1×106. In further embodiments the CBC is specific for Gram-negative bacteria or Gram-positive bacteria. The Gram-negative bacterium can be a Salmonella spp or E. coli O157:H7. The Gram-positive bacterium may be a Listeria spp or Staphylococcus spp.


In other additional and/or alternative aspects, the present invention may comprise methods for separating excess unbound MDP from cell-bound MDP. In some embodiments, the separating comprises capturing the microorganism of interest on a solid support. For example, the solid support may comprise at least one of a multi-well plate, a filter, a bead, a lateral flow strip, a filter strip, filter disc, and filter paper. The method may further comprise a step for washing the captured microorganism, to remove excess unbound MDP. In some embodiments, the microorganism bound to the MDP is fixed on a solid support for examination by fluorescence microscopy.


In other additional and/or alternative aspects, the present invention utilizes the high specificity of MDPs that can bind microorganisms to detect low levels of a microorganism. In some embodiments, the method detects as few as 10, 9, 8, 7, 6, 5, 4, 3, 2, or a single bacterium in a sample of a standard size for the food safety industry. In other embodiments, the sample is first incubated in conditions favoring growth for an enrichment period of 9 hours or less, 8 hours or less, 7 hours or less, 6 hours or less, 5 hours or less, 4 hours or less, 3 hours or less, or 2 hours or less. In some embodiments, the sample is not enriched prior to incubation with the plurality of MDPs.


In another aspect, the invention comprises a recombinant microorganism detection probe (MDP) comprising a cell binding component (CBC) and an indicator moiety. In some embodiments, the CBC is specific for Gram-negative bacteria or Gram-positive bacteria. The CBC can be isolated from an endolysin, or a spanin, or a tail fiber, or a tail spike protein specific for the microorganism of interest. The spanin can be an outside membrane spanin (RZ1) or a truncated variant thereof. Some CBCs isolated from an endolysin further comprise cell binding domain (CBD) or truncated variant thereof.


In some embodiments, the MDP is a recombinant gene product or a conjugated protein. In additional embodiments the recombinant MDP comprises a binding domain having ≥95% homology to the CBC of any of the following bacteriophages: Salmonella phage SPN1S, Salmonella phage 10, Salmonella phage epsilon15, Salmonella phage SEA1, Salmonella phage Spn1s, Salmonella phage P22, Listeria phage LipZ5, Listeria phage P40, Listeria phage vB_LmoM_AG20, Listeria phage P70, Listeria phage A511, Staphylococcus phage P4 W, Staphylococcus phage K, Staphylococcus phage Twort, Staphylococcus phage SA97, or Escherichia coli O157:H7 phage CBA120.


In certain embodiments of recombinant MDPs, the indicator moiety can generate an intrinsic signal. In other embodiments the indicator moiety comprises an enzyme that generates signal upon reaction with substrate. In yet other embodiments, the indicator moiety comprises a cofactor that generates signal upon reaction with one or more additional signal producing components. For example, the indicator moiety comprises at least one of a fluorophore, a fluorescent protein, a particle, and an enzyme. The enzyme may comprise at least one of a luciferase, a phosphatase, a peroxidase, and a glycosidase. The luciferase gene can be a naturally occurring gene, such as Oplophorus luciferase, Firefly luciferase, Lucia luciferase, or Renilla luciferase, or it can be a genetically engineered gene.


Also disclosed herein are methods of preparing a recombinant MDP comprising generating a CBC that is substantially identical to at least one of an endolysin gene, spanin gene, or tail fiber gene of a wild-type bacteriophage or group of bacteriophages that specifically infects a target pathogenic bacterium; preparing a fusion gene of the CBC with an indicator moiety, wherein the fusion protein product is the recombinant MDP; transforming an expression vector with the fusion gene to synthesize the recombinant MDP; and purifying the recombinant MDP.


Additional embodiments include systems and kits for detecting Listeria, Salmonella, Staphylococcus, or E. coli O157:H7, comprising a recombinant MDP. Some embodiments further include a substrate for reacting with an indicator moiety of the MDP. These systems or kits can include features described for the bacteriophage, compositions, and methods of the invention. In still other embodiments, the invention comprises non-transient computer readable media for use with methods or systems according to the invention.


In another aspect, the method to detect one or more microorganism of interest in a sample comprising the steps of: contacting the sample with a solid support of an apparatus, wherein the solid support captures the one or more microorganisms in the sample, if present, wherein the apparatus comprises: a first compartment comprising recombinant bacteriophage having a genetic construct inserted into a bacteriophage genome, wherein the construct comprises a promoter and an indicator gene; contacting the recombinant bacteriophage from the first compartment with the sample such that the recombinant bacteriophage infect the one or more microorganisms in the sample, thereby producing indicator gene product, and detecting the indicator gene product.


In some embodiments, the apparatus further comprises a second compartment comprising a substrate, and wherein detecting the indicator gene product is by contacting the indicator gene product with a substrate. In some embodiments, the solid support is a bead. In some embodiments, the solid support comprises polyethylene (PE), polypropylene (PP), polystyrene (PS), polylactic acid (PLA) and polyvinyl chloride (PVC).


In some embodiments, the solid support comprises one or more molecules of a cell binding component (CBC), wherein the CBC recognizes the one or more microorganism of interest in the sample. In some embodiments, the CBC is specific for Gram-negative bacteria. In some embodiments, the CBC is specific for Gram-positive bacteria. In some embodiments, wherein the Gram-negative bacterium is a Salmonella spp or E. coli O157:H7. In some embodiments, wherein the Gram-positive bacterium is a Listeria spp or Staphylococcus spp.


In some embodiments, the CBC is isolated from an endolysin or a spanin or a receptor binding protein (RBP) specific for the microorganism of interest. In some embodiments, the spanin is an outside membrane spanin (RZ1) or a truncated variant thereof. In some embodiments, the RBP is a tail fiber protein or a truncated variant thereof.


In some embodiments, the CBC is isolated from an endolysin.


In some embodiments, the CBC isolated from an endolysin is a cell binding domain (CBD) or truncated variant thereof.


In some embodiments, the apparatus further comprises a second compartment containing substrate, and wherein the method further comprises adding the substrate from the second compartment to the sample, concurrently with or after adding the recombinant bacteriophage.


In some embodiments, the first compartment comprises a seal, and wherein contacting the recombinant bacteriophage with the sample is by breaking the seal, wherein the breakage of the seal causes the recombinant bacteriophage from the first compartment to be in contact with the sample and infect the one or more microorganisms in the sample, thereby producing indicator gene product


In some embodiments, the bacteriophage is lyophilized.


In some embodiments, wherein the apparatus comprises a third compartment containing growth media.


In some embodiments, the method comprising incubating the solid support that has captured the one or more microorganisms of interest in the growth media for a time period before adding the recombinant bacteriophage.


In some embodiments, wherein the apparatus comprises a stop-lock for phased mixing of the media, the recombinant bacteriophage, and the substrate with the sample.


In some embodiments, the solid support is dry prior to contacting the sample. In some embodiments, the solid support is soaked in media prior to contacting the sample.


In some embodiments, the solid support that has captured the one or more organisms is incubated with the growth media in the third compartment before contacting with the recombinant bacteriophage.


In some embodiments, the incubation is 0-2 hours. In some embodiments, wherein the bacteriophage has been in contact with the sample for 0.5-3 hours before detecting the indicator gene product.


In some embodiments, the indicator gene product comprises at least one of a fluorophore, a fluorescent protein, a particle, and an enzyme. In some embodiments, the enzyme comprises at least one of a luciferase, a phosphatase, a peroxidase, and a glycosidase. In some embodiments, the luciferase is a genetically engineered luciferase. In some embodiments, the sample is a food, environmental, water, commercial, or clinical sample.


In some embodiments, the method detects as few as 10, 9, 8, 7, 6, 5, 4, 3, 2, or a single bacterium in a sample of a standard size for the food safety industry. In some embodiments, the sample comprises meat or vegetables. In some embodiments, the sample is a food, water, dairy, environmental, commercial, or clinical sample.


In some embodiments, the sample is first incubated in conditions favoring growth for an enrichment period of 9 hours or less, 8 hours or less, 7 hours or less, 6 hours or less, 5 hours or less, 4 hours or less, 3 hours or less, or 2 hours or less.


In another aspect, this disclosure provides a system for detecting microorganism of interest in a sample comprising: an apparatus, which comprises: a first compartment comprising recombinant bacteriophage having a genetic construct inserted into a bacteriophage genome, wherein the construct comprises a promoter and an indicator gene; wherein the solid support comprises a cell binding component, and a signal detecting component, wherein the signal detecting component can detect the indicator gene product produced from infecting the sample with the recombinant bacteriophage. In some embodiments, the signal detecting component is a handheld luminometer.





BRIEF DESCRIPTION OF THE FIGURES

The present invention may be better understood by referring to the following non-limiting figures.



FIG. 1 shows one embodiment of a method for detecting a bacterium of interest using MDPs.



FIG. 2 shows the structure of endolysins encoded by bacteriophage specific for Gram-positive bacteria and Gram-negative bacteria.



FIG. 3 shows the results of detecting L. monocytogenes culture using the self-contained apparatus with a swab as a solid support. The signals corresponding to the presence of the bacteria was detected by Hygiena, GloMax, and GloMax 20/20 luminometers. Table 1 shows results from log phase culture and Table 2 shows results from overnight culture.



FIGS. 4A and 4B are plots generated from the data shown in Table 1. FIG. 4A shows measurements of signals detected using Hygiena. Swabs were inoculated with log phase cells at the indicated CFU level. Sample was immediately infected with Listeria phage cocktail for 4 hours. Substrate was added and samples were read on the Hygiena Luminometer. A signal of >10 RLU is considered positive. With this method, approximately 25,000 CFU is required to generate a positive result.



FIG. 4B shows the measurements of signals detected using GloMax 20/20 and GloMax (a.k.a., GloMax 96) luminometers. Swabs were inoculated with log phase cells at the indicated CFU level. Sample was immediately infected with Listeria phage cocktail for 4 hours. Substrate was added and samples were read on either the GloMax 20/20 (1 mL of sample) or GloMax (150 μl of sample) Luminometers. A signal/background ratio of >3.0 is considered positive. With this method, approximately 5,000 CFU is required to generate a positive result.



FIG. 5 shows the results of detecting Salmonella in ground turkey that has been inoculated with Salmonella. Table 3 shows uninoculated control sample, and Table 4 shows inoculated turkey sample. The tests were repeated with varying incubation and infection time.



FIG. 6A and FIG. 6B are plots generated from the data in FIG. 5. FIG. 4A shows that Salmonella-inoculated turkey samples were detected as positive with every incubation and infection time tested. The turkey sample was grown for 24 hours at 41° C. after inoculation before testing with the methods disclosed in the application. For relative signal: 0 HR incubation, 2 HR infection >1 HR incubation, 0.5 HR infection >0 HR incubation, 0.5 HR infection. In addition, comparison of RLU signal shows that the GloMax luminometers have a much higher signal that that of the Hygiena luminometer.



FIG. 6B shows that detecting using GloMax 20/20 and GloMax luminometers produced similar signal/background ratios for the same samples. Although the GloMax 20/20 had a greater signal (FIG. 6A), the background was significantly higher than that with the GloMax. Thus when determining the signal/background, the two luminometers perform similarly.



FIG. 7 shows data of detecting Salmonella in three turkey samples (samples 21, 24, and 26) that had been inoculated with Salmonella before the assays using the self-contained apparatus. The samples were infected for different duration of time as indicated before detection of the signal.



FIGS. 8A-8C are plots generated from the data shown in FIG. 7. FIG. 8A-8C show results of the experiments in which three inoculated ground turkey samples were enriched for 24 hours and swab samples were taken and assayed. Sample 24 (FIG. 8B) and 26 (FIG. 8C) did not show signal on Hygiena handheld luminometer for samples that had 30 min phage infection, but did for sample that had 2 hour infection. The GloMax 20/20 and GloMax luminometer generated relatively low signals.



FIGS. 9A-9C are plots generated from the data shown in FIG. 7. The plots show both GloMax 20/20 and GloMax were able to detect Sample 21 (FIG. 9A) and 26 (FIG. 9B) as positive with 30 minute infection (signal/background ratio of >3.0 is positive), however Sample 24 (FIG. 9C) required a 2 hour infection to show a positive result. The GloMax 20/20 and GloMax luminometer results were similar.



FIG. 10 shows data of detecting L. monocytogenes environmental sponge samples from inoculated surfaces and enriched for 24 hours.



FIG. 11 shows detecting microorganisms in Salmonella-inoculated turkey samples using the apparatus. The signals were measured using three different luminometers: GloMax, 3M, and Hygiena.



FIGS. 12A and 12B depict a view of one embodiment of a self-contained apparatus system for detecting microorganisms, having a swab (FIG. 12A) or a bead coated with molecules of a cell binding component (CBC) (FIG. 12B) inserted into a container comprising three compartments. Each compartment is separated by a snap action seal. The first compartment contains phage, the second compartment contains substrate, and the third compartment contains media. Panel A in all figures represent the solid support is a swab



FIGS. 13A and 13B depict a view of one embodiment of a self-contained apparatus system for detecting microorganisms, having a swab (FIG. 13A) or a bead coated with molecules of a cell binding component (CBC) (FIG. 13B) inserted into a container comprising three compartments. Each compartment is separated by a snap action seal. The first compartment contains phage, the second compartment contains media, and the third compartment contains substrate. After incubation with the phage and media, the seal separating the second and third compartment may be broken.



FIGS. 14A and 14B depict a view of one embodiment of a self-contained apparatus system for detecting microorganisms, having a swab (FIG. 14A) or a bead coated with molecules of a cell binding component (CBC) (FIG. 14B) inserted into a container comprising three compartments. Each compartment is separated by a snap action seal. The first compartment contains media, the second compartment contains phage, and the third compartment contains substrate.



FIGS. 15A and 15B depict a view of one embodiment of a self-contained apparatus system for detecting microorganisms, having a swab (FIG. 15A) or a bead coated with molecules of a cell binding component (CBC) (FIG. 15B) inserted into a container comprising three compartments. Each compartment is separated by a snap action seal. The first compartment contains media, the second compartment contains phage, and the third compartment contains substrate. The apparatus has a stop-lock mechanism for phased mixing of reagents.



FIGS. 16A and 16B depict a view of one embodiment of a self-contained apparatus system for detecting microorganisms, having a swab (FIG. 16A) or a bead coated with molecules of a cell binding component (CBC) (FIG. 16B) inserted into a container comprising three compartments. Each compartment is separated by a snap action seal. The first compartment contains media, the second compartment contains phage, and the third compartment contains substrate. The apparatus has a stop-lock mechanism for phased mixing of reagents.



FIG. 17 depicts a flow diagram of an embodiment utilizing a self-contained apparatus system for detecting microorganisms.





DETAILED DESCRIPTION OF THE INVENTION
Definitions

Unless otherwise defined herein, scientific and technical terms used in connection with the present invention shall have the meanings that are commonly understood by those of ordinary skill in the art. Further, unless otherwise required by context, singular terms shall include pluralities and plural terms shall include the singular. Generally, nomenclatures used in connection with, and techniques of, cell and tissue culture, molecular biology, immunology, microbiology, genetics and protein and nucleic acid chemistry and hybridization described herein are those well-known and commonly used in the art. Known methods and techniques are generally performed according to conventional methods well-known in the art and as described in various general and more specific references that are discussed throughout the present specification unless otherwise indicated. Enzymatic reactions and purification techniques are performed according to manufacturer's specifications, as commonly accomplished in the art or as described herein. The nomenclatures used in connection with the laboratory procedures and techniques described herein are those well-known and commonly used in the art.


The following terms, unless otherwise indicated, shall be understood to have the following meanings:


As used herein, the terms “a”, “an”, and “the” can refer to one or more unless specifically noted otherwise.


The use of the term “or” is used to mean “and/or” unless explicitly indicated to refer to alternatives only or the alternatives are mutually exclusive, although the disclosure supports a definition that refers to only alternatives and “and/or.” As used herein “another” can mean at least a second or more.


Throughout this application, the term “about” is used to indicate that a value includes the inherent variation of error for the device, the method being employed to determine the value, or the variation that exists among samples.


The term “solid support” or “support” means a structure that provides a substrate and/or surface onto which biomolecules may be bound. For example, a solid support may be an assay well (i.e., such as a microtiter plate or multi-well plate), or the solid support may be a location on a filter, an array, or a mobile support, such as a bead or a membrane (e.g., a filter plate or lateral flow strip).


The term “indicator” or “indicator moiety” or “detectable moiety” or “detectable biomolecule” or “reporter” or “label” refers to a molecule that provides a signal that can be measured in a qualitative or quantitative assay. For example, an indicator moiety may comprise an enzyme that may be used to convert a substrate to a product that can be measured. An indicator moiety may be an enzyme that catalyzes a reaction that generates bioluminescent emissions (e.g., luciferase, HRP, or AP). Or, an indicator moiety may be a radioisotope that can be quantified. Or, an indicator moiety may be a fluorophore. Or, other detectable molecules may be used.


As used herein, “bacteriophage” or “phage” includes one or more of a plurality of bacterial viruses. In this disclosure, the terms “bacteriophage” and “phage” include viruses such as mycobacteriophage (such as for TB and paraTB), mycophage (such as for fungi), mycoplasma phage, and any other term that refers to a virus that can invade living bacteria, fungi, mycoplasma, protozoa, yeasts, and other microscopic living organisms and uses them to replicate itself. Here, “microscopic” means that the largest dimension is one millimeter or less. Bacteriophages are viruses that have evolved in nature to use bacteria as a means of replicating themselves.


As used herein, “culture enrichment”, “culturing for enrichment”, “cultured for enrichment”, or “culture for enrichment”, refers to traditional culturing, such as incubation in media favorable to propagation of microorganisms, and should not be confused with other possible uses of the word “enrichment,” such as enrichment by removing the liquid component of a sample to concentrate the microorganism contained therein, or other forms of enrichment that do not include traditional facilitation of microorganism propagation. Culturing for enrichment for short periods of time may be employed in some embodiments of methods described herein, but is not necessary and is for a much shorter period of time than traditional culturing for enrichment, if it is used at all.


As used herein “recombinant” refers to genetic (i.e., nucleic acid) modifications as usually performed in a laboratory to bring together genetic material that would not otherwise be found. This term is used interchangeably with the term “modified” herein.


As used herein “RLU” refers to relative light units as measured by a luminometer (e.g., GLOMAX® 96) or similar instrument that detects light. For example, the detection of the reaction between luciferase and appropriate substrate (e.g., NANOLUC® with NANO-GLO®) is often reported in RLU detected.


Overview

The present invention utilizes the high specificity of cell binding components (CBCs) that can bind to a particular microorganism with high affinity to detect the presence of and/or quantify the specific microorganism in the sample.


Disclosed herein are compositions, methods, kits, and systems that demonstrate surprising sensitivity and speed for detection of a microorganism of interest in test samples (e.g., food, water, dairy, environmental, commercial, clinical, or other biological samples) using assays performed without culturing for enrichment, or in some embodiments with minimal incubation times during which microorganism could potentially multiply. Embodiments disclosed herein include a microorganism detection probe (MDP) that comprises at least a cell binding component (CBC) and an indicator moiety. These compositions, methods, kits, and systems allow detection of microorganisms to be achieved in a shorter timeframe than was previously thought possible.


Embodiments of the compositions, methods, kits, and system of the invention can be applied to detection of a variety of microorganisms (e.g., bacteria, fungi, yeast) in a variety of circumstances, including but not limited to, detection of pathogens from food, water, dairy, environmental, commercial, clinical, or other biological samples. The MDP-based detection embodiments disclosed herein may be adapted to any bacteria or other microorganism of interest (e.g., pathogenic microorganisms) for which a CBC is available that does not cross-react with other microorganisms. The methods of the present invention provide high detection sensitivity and specificity rapidly and without the need for traditional biological enrichment (e.g., culturing). Thus, a variety of microorganisms may be detected using the methods of the invention.


Embodiments of the methods and systems of the invention can be applied to detection and quantification of a variety of microorganisms (e.g., bacteria, fungi, yeast) in a variety of circumstances, including but not limited to detection of pathogens from food, water, dairy, environmental, commercial, clinical, or other biological samples. The methods of the present invention can rapidly provide high detection sensitivity and specificity without the need for traditional biological enrichment (e.g., culturing), which is a surprising aspect as all available methods with the desired sensitivity and specificity require culturing.


Also disclosed herein are systems and methods that uses an apparatus to detect microorganisms in test samples (e.g., food, water, dairy, environmental, commercial, clinical, or other biological samples). The method uses a self-contained apparatus that comprise a solid support, that can be used to collect sample. In some embodiments, the solid support is coated with a cell binding component that binds with high affinity to the microorganism of interest in the sample. This allows the more bacteria binding to the solid support and increase assay sensitivity and specificity. The apparatus further comprises a first compartment comprising bacteriophage having a genetic construct inserted into the bacteriophage genome, wherein the construct comprises a promoter and an indicator gene. The method comprises contacting the recombinant bacteriophage from the first compartment with the sample such that the recombinant bacteriophage infect one or more microorganisms in the sample thereby producing an indicator gene product (“indicator”), and detecting the indicator. In some aspects, the apparatus further comprises a second compartment, which contains a substrate specific for detecting the indicator. In some embodiments, the method further comprises contacting the sample that has been infected by the bacteriophage with the substrate, whereby detecting the indicator. In these embodiments, each compartment is separated from the immediately adjacent compartment by a snap action seal, which upon breakage, allows the content of the compartments to exit the compartment and mix with contents from the sample or contents from other compartments. For example, a user can break the snap action seal such that the recombinant bacteriophage from the first compartment contacts the sample on the solid support, thereby infecting microorganisms that bind thereon. Upon infection of the microorganisms, the indicator gene is expressed to produce an indicator protein, which can be detected by various detection devices. The presence of the signals indicates the presence of the microorganisms in the sample.


Embodiments of the apparatus, compositions, methods, kits, and system of the invention can be applied to detection of a variety of microorganisms (e.g., bacteria, fungi, yeast) in a variety of circumstances, including but not limited to, detection of pathogens from food, water, dairy, environmental, commercial, clinical, or other biological samples. The detection embodiments disclosed herein may be adapted to any bacteria or other microorganism of interest (e.g., pathogenic microorganisms) for which a CBC is available that does not cross-react with other microorganisms. The methods of the present invention provide high detection sensitivity and specificity rapidly and without the need for traditional biological enrichment (e.g., culturing). This is a surprising aspect as all available methods with the desired sensitivity and specificity require culturing. The detection of microorganisms in a sample using the self-contained apparatus, which houses reagents required for detecting the microorganism in separate compartments until the time of detection, is convenient and efficient. The apparatus is easy to use and does not require extensive training.


Samples

Each of the embodiments of the compositions, methods, kits, and systems of the invention allows for the rapid detection and/or quantification of microbes in a sample. For example, methods according to the present invention can be performed in a shortened time period with superior results.


In certain embodiments, a cell binding component (CBC) is used to detect microorganisms of interest. Microorganisms that can be detected by the compositions, methods, kits and systems of the present invention include pathogens that are of commercial, medical, or veterinary concern. Such pathogens include Gram-negative bacteria, Gram-positive bacteria, mycoplasmas, fungi, protozoa, and yeasts. Any microorganism for which a cell binding component (CBC) specific for the particular microbe has been identified can be detected by the methods of the present invention. Those skilled in the art will appreciate that there is no limit to the application of the present methods other than the availability of the necessary specific cell binding component/microbe pairs.


Bacterial cells detectable by the present invention include, but are not limited to, bacterial cells that are food- or water-borne pathogens. Bacterial cells detectable by the present invention include, but are not limited to, all species of Salmonella, all strains of Escherichia coli, including, but not limited to E. coli O157:H7 (and other Shiga toxin—and enterotoxin-producing strains of E. coli), all species of Listeria, including, but not limited to L. monocytogenes, and all species of Campylobacter. Bacterial cells detectable by the present invention include, but are not limited to, bacterial cells that are pathogens of medical or veterinary significance. Such pathogens include, but are not limited to, Bacillus spp., Bordetella pertussis, Brucella spp., Campylobacter jejuni, Chlamydia pneumoniae, Clostridium perfringens, Clostridium botulinum, Enterobacter spp., Klebsiella pneumoniae, Mycoplasma pneumoniae, Salmonella typhi, Salmonella typhimurium, Salmonella enteritidis, Shigella sonnei, Yersinia spp., Vibrio spp. Staphylococcus aureus, and Streptococcus spp.


The sample may be an environmental or food or water sample. Some embodiments may include medical or veterinary samples. Samples may be liquid, solid, or semi-solid. Samples may be swabs of solid surfaces. Samples may include environmental materials, such as water samples, or the filters from air samples, or aerosol samples from cyclone collectors. Samples may be of beef, poultry, processed foods, milk, cheese, or other dairy products. Medical or veterinary samples include, but are not limited to, blood, sputum, cerebrospinal fluid, and fecal samples. In some embodiments, samples may be different types of swabs.


In some embodiments, samples may be used directly in the detection methods of the present invention, without preparation, concentration, or dilution. For example, liquid samples, including but not limited to, milk and juices, may be assayed directly. In other embodiments, samples may be diluted or suspended in solution, which may include, but is not limited to, a buffered solution or a bacterial culture medium. A sample that is a solid or semi-solid may be suspended in a liquid by mincing, mixing or macerating the solid in the liquid. In some embodiments, a sample should be maintained within a pH range that promotes MDP attachment to the host bacterial cell. In some embodiments, the preferred pH range may be one suitable for bacteriophage attached to a bacterial cell. A sample should also contain the appropriate concentrations of divalent and monovalent cations, including but not limited to Na+, Mg2+, and K+.


In some embodiments, the sample is maintained at a temperature that maintains the viability of any pathogen cell present in the sample. During steps in which bacteriophage, are attaching to bacterial cells, the sample may be maintained at a temperature that facilitates bacteriophage activity. Such temperatures are at least about 25° C. and no greater than about 45° C. In some embodiments the sample is maintained at about 37° C. In some embodiments the samples are subjected to gentle mixing or shaking during MDP binding or attach


Methods of Using Recombinant MDPs for Detecting Microorganism

Assays may include various appropriate control samples. For example, control samples containing no MDPs and/or control samples containing MDPs without bacteria may be assayed as controls for background signal levels.


As noted herein, in certain embodiments, the invention may comprise methods of using decorated or signalized microorganism detection probes (MDPs) for detecting microorganisms. The methods of the invention may be embodied in a variety of ways.


In some aspects, the invention comprises a method for detecting a microorganism of interest. The method may use a recombinant MDP or a conjugated MDP for detection of the microorganism of interest. For example, in certain embodiments, the microorganism of interest is a bacterium and the cell binding component (CBC) is derived from a bacteriophage that specifically recognizes the bacterium of interest. In certain embodiments, the method may comprise detection of a bacterium of interest in a sample by incubating the sample with a plurality of recombinant MDPs that can bind to the bacterium of interest. A plurality of MDPs bound to a single microorganism is any number greater than 1, but is preferably at least 5×104, or at least 1×105, or at least 1×106, or at least 1×108, or at least 1×109, or at least 1×1010 MDPs.


In certain embodiments, the recombinant MDP comprises an indicator moiety. The methods may comprise detecting the indicator moiety of the MDP, wherein positive detection of the indicator moiety indicates that the bacterium of interest is present in the sample.


In some embodiments, the invention may comprise a method to detect as few as a single microorganism of interest in a sample comprising the steps of: incubating the sample with a plurality of MDPs that bind the microorganism of interest, wherein the MDP comprises an indicator moiety and a CBC under conditions such that the microorganism binds the plurality of MDPs; separating unbound MDP from cell-bound MDP; and detecting the indicator moiety on the cell-bound MDP, wherein positive detection of the indicator moiety indicates that the microorganism of interest is present in the sample. The amount of MDPs incubating with the sample may be 1 ng, or 10 ng, or 100 ng, or 250 ng, or 500 ng, or 1000 ng. The amount of MDPs incubating with the sample may be at least 5×108, or at least 5×109, or at least 5×1010, or at least 5×1011, or at least 5×1012, or at least 5×1013.


In some embodiments, the detecting step will require addition of a substrate for the indicator enzyme to act on. In other embodiments, the detecting step will require addition of an enzyme and a substrate for the indicator cofactor to act on. The selection of a particular indicator is not critical to the present invention, but the indicator will be capable of generating a detectable signal either by itself, or be instrumentally detectable, or be detectable in conjunction with one or more additional signal producing components, such as an enzyme/substrate signal producing system.


In some embodiments, a plurality of MDPs bind to a single bacterium. A plurality of MDPs bound to a single microorganism is any number greater than 1, but is preferably at least 5×104, or at least 1×105, or at least 1×106, or at least 1×108, or at least 1×109, or at least 1×1010 MDPs.


In certain embodiments, the assay may be performed to utilize a MDP to identify the presence of a specific microorganism. The assay can be modified to accommodate different sample types or sizes and assay formats. Embodiments employing recombinant MDP of the invention may allow rapid detection of specific bacterial strains, with total assay times under 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, 10.0, 10.5, 11.0, 11.5, or 12 hours, depending on the sample type, sample size, and assay format. For example, the amount of time required may be somewhat shorter or longer depending on affinity of the MDPs and/or and types of bacteria to be detected in the assay, type and size of the sample to be tested, complexity of the physical/chemical environment, and the concentration of endogenous non-target bacterial contaminants.



FIG. 1 illustrates an embodiment of an assay for detecting a bacterium of interest using MDP 112 according to an embodiment of the invention. A MDP comprises an indicator moiety 120 (e.g. NANOLUC®) and a CBC 121. Test sample aliquots containing known amounts of bacteria 111 are distributed to individual wells 102 of a multi-well plate 104. Aliquots of MDP 112 are added to individual wells 102 and incubated 202 for a period of time (e.g., 5-60 minutes at 37° C.). The aliquot of MDPs 112 added to the individual well in this embodiment is at least 1×109 MDPs. A plurality of MDPs bind to a single bacterium 116. The plurality of MDPs bound to a single bacterium of interest in this embodiment is at least 1×106. Capture of the bacteria on a solid surface and washing of the captured bacteria 203 allows removal of the excess unbound-MDP 113. The plate wells containing MDP bound to target bacteria may then be assayed 204 to measure the MDP indicator activity on the plate 104 (e.g., luciferase assay). Experiments utilizing this method are described herein. In some embodiments, the test samples are not concentrated (e.g., by centrifugation) but are incubated directly with MDP for a period of time and subsequently assayed for indicator (e.g. luciferase activity). In other embodiments, various tools (e.g., a centrifuge or filter) may be used to concentrate the samples and or capture the microorganisms in samples before enrichment or before testing. For example, a 10 mL aliquot of a prepared sample may be extracted and centrifuged to pellet cells and large debris. The pellet can be resuspended in a smaller volume for testing. In some embodiments, the resuspended pellet of microorganism cells may be enriched before testing.


In some embodiments, the invention comprises a method for detecting a bacterium of interest comprising the step of incubating a test sample with a recombinant or conjugated MDP. In some embodiments, the test sample is incubated with a very high concentration of MDP, or an excess of MDP. Surprisingly, high concentrations of MDPs are suitable for binding a microorganism of interest.


Methods of the invention may comprise various other steps to increase sensitivity. For example, as discussed in more detail herein, the method may comprise a step for capturing and washing the captured and bound bacterium, to remove excess MDP and increase the signal to noise ratio. In some embodiments, positive detection of the indicator moiety requires that the ratio of signal to background generated by detecting the indicator moiety is at least 2.0 or at least 2.5.


In some embodiments of methods for testing samples, the use of a large excess of MDP necessitates separation of any MDP-bound bacteria or other larger entities in the sample from the excess of unbound-MDP. This may be accomplished in many different ways generally known by one of ordinary skill in the art. Microorganism cells can be separated through centrifugation, filtration by size, or selective immobilization. In some embodiments, filtration by size is accomplished through filter wells. In other embodiments, magnetic separation can be used for selective immobilization. For example, the sample may be filtered through a 0.45 μm or 0.22 μm membrane, either before or after incubating with the MDP, to capture the target microorganism (e.g., bacterium) on a solid support. The captured microorganism may then be washed one or more times on the solid support to ensure that only specifically bound MDP remains. Or a mechanism for specific or non-specific binding can be employed to capture the microorganism on micro-beads or another solid surface. Other formats for decorating or signalizing target microorganisms and methods for washing to remove excess unbound-MDP are possible.


A variety of solid supports may be used. In certain embodiments, the solid support may comprise a multi-well plate, a filter, a bead, a lateral flow strip, a filter strip, filter disc, filter paper, or thin films designed for culturing cells (e.g., PetriFilm by 3M). Other solid supports may also be appropriate. For example, in some embodiments the test sample microorganism may be captured by binding to the surface of a plate, or by filtering the sample through a bacteriological filter (e.g., 0.45 μm pore size spin filter or plate filter). In one embodiment, the microorganism captured on the filter or plate surface is subsequently washed one or more times to remove excess unbound-MDP.


Alternatively, in some embodiments the capturing step may be based on other features of the microorganism of interest, such as size. In embodiments utilizing size-based capture, the solid support may be a spin column filter. In some embodiments, the solid support comprises a 96-well filter plate. Or, the solid support for capture may be a location on an array, or a mobile support, such as a bead.


In some embodiments, the sample may be enriched prior to testing by incubation in conditions that encourage growth. In such embodiments, the enrichment period can be 1, 2, 3, 4, 5, 6, 7, or up to 8 hours or longer, depending on the sample type and size.


In other embodiments, the sample may be enriched following capture of the bacterium on a solid support. In such embodiments, the enrichment period can be 1, 2, 3, 4, 5, 6, 7, or up to 8 hours or longer, depending on the sample type and size.


Thus, in some embodiments, the MDP comprises a detectable indicator moiety, and binding to a single pathogenic cell (e.g., bacterium) can be detected by an amplified signal generated via the indicator moiety. Thus the method may comprise detecting an indicator moiety of the MDP, wherein detection of the indicator indicates that the bacterium of interest is present in the sample.


In some embodiments of the methods of the invention, the microorganism may be detected without any isolation or purification of the microorganisms from a sample. For example, in certain embodiments, a sample containing one or more microorganisms of interest may be applied directly to an assay container such as a spin column, a microtiter well, or a filter and the assay is conducted in that assay container. That is, microorganisms are captured on a membrane having pore size too small to allow the microorganisms to pass through. Various embodiments of such assays are disclosed herein.


Aliquots of a test sample may be distributed directly into wells of a multi-well plate, MDP may be added, and after a period of time sufficient for binding, the cells may be captured on a solid surface such as a plate, bead, or a filter substrate, such that excess unbound MDP can be removed in one or more subsequent washing steps. Then a substrate for the indicator moiety (e.g., luciferase substrate for a luciferase indicator) is added and assayed for detection of the indicator signal. Some embodiments of the method can be performed on filter plates. Some embodiments of the method can be performed with or without concentration of the sample before binding with MDP.


For example, in many embodiments, multi-well plates are used to conduct the assays. The choice of plates (or any other container in which detecting may be performed) may affect the detecting step. For example, some plates may include a colored or white background, which may affect the detection of light emissions. Generally, white plates have higher sensitivity but also yield a higher background signal. Other colors of plates may generate lower background signal but also have a slightly lower sensitivity. Additionally, background signal can result from the leakage of light from one well to another, adjacent well. Some plates have white wells while the rest of the plate is black, thus, allowing for a high signal inside the well while preventing well-to-well light leakage. This combination of white wells with black plates may decrease background signal. Thus the choice of plate or other assay vessel may influence the sensitivity and background signal for the assay. In some embodiments, detection of the microorganism of interest may be completed without the need for culturing the sample. For example, in certain embodiments the total time required for detection is less than 12.0 hours, 11.0 hours, 10.0 hours, 9.0 hours, 8.0 hours, 7.0 hours, 6.0 hours, 5.0 hours, 4.0 hours, 3.0 hours, 2.5 hours, 2.0 hours, 1.5 hours, 1.0 hour, 45 minutes, or less than 30 minutes. Minimizing time to result is critical in food and environmental testing for pathogens.


In contrast to assays known in the art, the method of the invention can detect individual microorganisms. Thus, in certain embodiments, the method may detect ≤10 cells of the microorganism (i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 microorganisms) or ≤20, or ≤30, or ≤40, or ≤50, or ≤60, or ≤70, or ≤80, or ≤90, or ≤100, or ≤200, or ≤500, or ≤1000 cells of the microorganism present in a sample. For example, in certain embodiments, the MDP is highly specific for S. aureus, Listeria, Salmonella, or E. coli. In an embodiment, the MDP can distinguish S. aureus, Listeria, Salmonella, or E. coli in the presence of more than 100 other types of bacteria. In an embodiment, the MDP can distinguish a specific serotype within a species of bacteria (e.g., E. coli O157:H7) in the presence of more than 100 other types of bacteria. In certain embodiments, the MDP can be used to detect a single bacterium of the specific type in the sample. In certain embodiments, the recombinant MDP detects as few as 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, or 100 of the specific bacteria in the sample.


Thus, aspects of the present invention provide methods for detection of microorganisms in a test sample via an indicator moiety. In some embodiments, where the microorganism of interest is a bacterium, the indicator moiety may be associated with a MDP. The indicator moiety may react with a substrate to emit a detectable signal or may emit an intrinsic signal (e.g., fluorescent protein). Fluorescent proteins naturally fluoresce (intrinsic fluorescence or autofluorescence) by emitting energy as a photon when the fluorescent moiety containing electrons absorb a photon. Fluorescent proteins (e.g., GFP) can be expressed as a fusion protein. In some embodiments, the detection sensitivity can reveal the presence of as few as 100, 50, 20, 10, 9, 8, 7, 6, 5, 4, 3, or 2 cells of the microorganism of interest in a test sample. In some embodiments, even a single cell of the microorganism of interest may yield a detectable signal.


The selection of a particular indicator moiety is not critical to the present invention, but the indicator moiety will be capable of generating a detectable signal either by itself, or be instrumentally detectable, or be detectable in conjunction with one or more additional signal producing components, such as an enzyme/substrate signal producing system. A number of MDPs can be formed by varying either the indicator moiety and/or the specific CBC of the MDP; it will be appreciated by one skilled in the art that the choice involves consideration of the microorganism to be detected and the desired means of detection.


For example, one or more signal producing components can be reacted with the indicatory moiety to generate a detectable signal. In some embodiments, the indicator can be a bioluminescent compound. If the indicator moiety is an enzyme, then amplification of the detectable signal is obtained by reacting the enzyme with one or more substrates or additional enzymes and substrates to produce a detectable reaction product. In an alternative signal producing system, the indicator can be a fluorescent compound where no enzymatic manipulation of the indicator is required to produce the detectable signal. Fluorescent molecules including, for example, fluorescein and rhodamine and their derivatives and analogs are suitable for use as indicators in such a system. In yet another alternative embodiment, the indicator moiety can be a cofactor, then amplification of the detectable signal is obtained by reacting the cofactor with the enzyme and one or more substrates or additional enzymes and substrates to produces a detectable reaction product. In some embodiments, the detectable signal is colorimetric.


The detectable indicator moiety is a key feature of the MDP, which can be detected directly or indirectly. The indicator moiety provides a detectable signal by which the binding reaction is monitored providing a qualitative and/or quantitative measure. The relative quantity and location of signal generated by the decorated or signalized microorganisms can serve to indicate the presence and/or quantity of the microorganism. The indicator moiety can also be used to select and isolate decorated or signalized microorganisms, such as by flow sorting or using magnetic separation media.


In some embodiments, the indicator moiety of the MDP may be detectable directly or after incubation with a substrate. Many different types of detectable biomolecules suitable for use as indicator moieties are known in the art, and many are commercially available. In some embodiments the MDP comprises an enzyme, which serves as the indicator moiety. In some embodiments, the MDP encodes a detectable enzyme. The indicator moiety may emit light and/or may be detectable by a color change. Various appropriate enzymes are commercially available, such as alkaline phosphatase (AP), horseradish peroxidase (HRP), green fluorescent protein (GFP), or luciferase (Luc). In some embodiments, these enzymes may serve as the indicator moiety. In some embodiments, Firefly luciferase is the indicator moiety. In some embodiments, Oplophorus luciferase is the indicator moiety. In some embodiments, NANOLUC® is the indicator moiety. Other engineered luciferases or other enzymes that generate detectable signals may also be appropriate indicator moieties.


Thus, in some embodiments, the recombinant MDP of the methods, systems or kits is a fusion protein prepared from fusion of a portion of a wild-type bacteriophage with the sequence of an indicator protein, such as a fluorescent protein or a luciferase protein.


Bacteriophages are able to infect and lyse specific bacteria. Bacteriophage genomes encode for three proteins; holins, endolysins, and spanins, which together are responsible for progeny release during the phage lytic cycle. As shown in FIG. 2, endolysins (also called peptidoglycan hydrolases or murein hydrolases) bind and lyse the cell wall of the particular type of bacteria they infect. Holin molecules disrupt the cytoplasmic membrane, allowing endolysins to access peptidoglycan in the cell wall. In Gram-positive bacteria, endolysins are able to contact peptidoglycan of the cells; however, the outer membrane of Gram-negative bacteria prevents binding between endolysins and the cell wall. Generally, endolysins produced by phages specific for Gram-negative bacteria have only a single, catalytic domain, responsible for lysis. By contrast endolysins produced by phages specific for Gram-positive bacteria have two domains: an enzymatic activity domain (EAD) for lysis and a cell wall binding domain (CBD) for host recognition and high-affinity binding. More specifically, a CBD of the endolysin allows the bacteriophage to recognize the bacterium with high specificity (the lysis function is not needed). In some embodiments the portion of a wild-type bacteriophage is an endolysin sequence, specifically a cell binding domain, or a truncated portion thereof. Typically, the CBD is located at the C-terminus end, but can be found at the N-terminus end or as a central domain in some cases.


Other types of infectious agents similarly employ cell binding proteins for specificity. In some cases, nucleic acid sequences responsible for cell binding have been found within the single, globular EAD of endolysins encoded by bacteriophages specific for Gram-negative bacteria. A third type of protein, spanins, are responsible for disruption of the outer-membrane in Gram-negative hosts. RZ1 is an outer membrane lipoprotein of the spanin complex. During the lytic cycle, the spanin complex disrupts the outer membrane following destruction of the cell wall by the endolysins. In some embodiments, the cell binding component will comprise a conserved amino acid sequence with binding functionality from at least one of an endolysin or a spanin.


In some instances, phage can bind specific bacteria through receptor binding proteins (RBPs). Interactions between a RBP and the cell surface of a bacteria determines RBP specificity. In some phage, RBPs are located in the tail shaft, tail fibers, or tail spikes. Phage tail fiber proteins play a role in both adsorption to the cell surface and polysaccharide degradation. Tail spike proteins are a component of the tail of many bacteriophages. Tail spike proteins bind to the cell surface of bacterial hosts and mediate bacterial host recognition.


It is possible that the invention can be used to detect Gram-negative bacteria. Generally, the outer membrane of Gram-negative bacteria prevents endolysins from contacting the cell wall. However, the outer membrane can be disrupted (e.g., EDTA, detergents, etc. . . . ) so that a MDP can attach and bind to the cell wall of Gram-negative bacteria. In some embodiments, a CBC is isolated from the enzymatic domain of an endolysin encoded by a bacteriophage specific for Gram-negative bacteria. In some embodiments, conserved sequences of amino acids within the enzymatic domain are responsible for cell binding and may therefore be used as a CBC. In other embodiments, the portion of a wild-type bacteriophage is an o-spanin (RZ1), a tail spike, or a tail fiber. In other embodiments, the CBC comprises conserved amino acid sequences with cell binding functionality from at least one of the following proteins: endolysins, holins, spanins, tail fibers, or tail spikes.


A CBC that binds to a particular type of organism can be derived from a particular infectious agent and used as part of an indicator to identify the presence of that organism in a test sample. Thus the present invention proposes the use of MDPs for decorating or signalizing microbial cells. A MDP can be a recombinant or conjugated protein or otherwise have an indicator moiety attached. Thus embodiments of the invention disclosed herein comprise a decorating or signalizing molecule having a cell binding moiety and an indicator moiety.


The lysis function of the endolysin is not needed—only the cell binding function. Thus in some embodiments, the indicator moiety is fused to a CBD and comprises a protein that emits an intrinsic signal, such as a fluorescent protein or bioluminescent protein. The indicator may emit light and/or may be detectable by a color change. For example, a fluorescent protein does not require substrate but is detectable directly with proper equipment (e.g., fluorescent microscope or fluorescence activated cell sorting (FACS)). In some embodiments, the indicator gene encodes an enzyme (e.g., luciferase) that interacts with a substrate to generate signal. In some embodiments, the indicator gene is a luciferase gene. In some embodiments, the luciferase gene is one of Oplophorus luciferase, Firefly luciferase, Renilla luciferase, External Gaussia luciferase, Lucia luciferase, or an engineered luciferase such as NANOLUC®, Rluc8.6-535, or Orange Nano-lantern.


Detecting the indicator may include detecting emissions of light. In some embodiments, a luminometer may be used to detect the reaction of indicator (e.g., luciferase) with a substrate. The detection of RLU can be achieved with a luminometer, or other machines or devices may also be used. For example, a spectrophotometer, CCD camera, or CMOS camera may detect color changes and other light emissions. Absolute RLU are important for detection, but the signal to background ratio also needs to be high (e.g., >2.0, >2.5, or >3.0) in order for single cells or low numbers of cells to be detected reliably.


In some embodiments, the reaction of indicator moiety (e.g., luciferase) with substrate may continue for 30 minutes or more, and detection at various time points may be desirable for optimizing sensitivity. For example, in embodiments using 96-well filter plates as the solid support and luciferase as the indicator, luminometer readings may be taken initially and at 3-, or 5-, or 10-, or 15-minute intervals until the reaction is completed.


Thus in some embodiments utilizing MDP, the invention comprises a method for detecting a microorganism of interest comprising the steps of capturing at least one sample bacterium; incubating the at least one bacterium with a plurality of MDP; allowing time for binding of CBP to target microorganism in the sample; and detecting the indicator moiety, wherein detection of the indicator moiety demonstrates that the bacterium is present in the sample.


For example, in some embodiments the test sample bacterium may be captured by binding to the surface of a plate, or by filtering the sample through a bacteriological filter (e.g., 0.45 μm pore size spin filter or plate filter). In an embodiment, the MDP is added in a minimal or modest volume to the captured sample directly on the filter. In an embodiment, the microorganism captured on the filter or plate surface is subsequently washed one or more times to remove excess unbound-MDP.


In some embodiments, aliquots of a test sample comprising bacteria may be applied to a spin column and after incubation with a recombinant MDP and washing to remove any excess MDP, the amount of indicator detected will be proportional to the amount of target bacteria present in the sample.


The indicator (e.g., luciferase) bound to the bacteria may then be measured and quantified. In an embodiment, the solution is spun through the filter, and the filtrate collected for assay in a new receptacle (e.g., in a luminometer) following addition of a substrate for the indicator enzyme (e.g., luciferase substrate). Alternatively, the indicator signal may be measured directly on the filter.


In an embodiment, the microorganism is a bacterium and the MDP includes a CBC derived from a bacteriophage. In an embodiment, the indicator moiety is luciferase. Thus, in an alternate embodiment, the indicator substrate (e.g., luciferase substrate) may be incubated with the portion of the sample that remains on a filter or bound to a plate surface. Accordingly, in some embodiments the solid support is a 96-well filter plate (or regular 96-well plate), and the substrate reaction may be detected by placing the plate directly in the luminometer.


For example, in an embodiment, the invention may comprise a method for detecting a pathogenic bacterium of interest comprising the steps of: binding cells captured on a 96-well filter plate with a plurality of MDP; washing excess MDP away; and detecting the indicator (e.g., luciferase) by adding substrate and measuring enzyme activity directly in the 96-well plate, wherein detection of enzyme activity indicates that the bacterium of interest is present in the sample.


In another embodiment, the invention may comprise a method for detecting a microorganism of interest, such as S. Aureus, comprising the steps of: binding cells in liquid solution or suspension in a 96-well plate with a plurality of MDP; washing unbound-MDP away from cells having bound-MDP; and detecting the indicator (e.g., luciferase) by adding substrate and measuring enzyme activity directly in the 96-well plate, wherein detection of enzyme activity indicates that the microorganism of interest, such as S. Aureus, is present in the sample. In some embodiments, the microorganism of interest may be captured on a solid support such as on beads or a filter. This capturing can occur either before or after incubation with the MDP. In some embodiments no capturing step is necessary.


In some embodiments, the liquid solution or suspension may be a consumable test sample, such as a vegetable wash. In some embodiments, the liquid solution or suspension may be vegetable wash fortified with concentrated LB Broth, Tryptic/Tryptone Soy Broth, Peptone Water, or Nutrient Broth. In some embodiments, the liquid solution or suspension may be bacteria diluted in LB Broth.


In some embodiments, target microorganism cells need to be intact for proper detection. That is, the cells need not be viable, but the cell wall must be structurally intact. Thus it is desirable to minimize lysis of the bacterium before the detection step.


In some embodiments, an initial concentration step for the sample is useful. That is, any microorganisms or other relatively large substances in the sample are concentrated to remove excess liquid. However it is possible to perform the assay without an initial concentration step. Some embodiments do include an initial concentration step, and in some embodiments this concentration step allows a shorter enrichment incubation time. In other embodiments, no enrichment period is necessary.


Some embodiments of testing methods may further include confirmatory assays. A variety of assays are known in the art for confirming an initial result, usually at a later point in time. For example, the samples can be cultured (e.g., CHROMAGAR®/DYNABEADS® assay), PCR can be utilized to confirm the presence of the microbial DNA, or other confirmatory assays can be used to confirm the initial result.


Embodiments of food safety assays include sample preparation steps. Some embodiments can include enrichment time. For example, enrichment for 1, 2, 3, 4, 5, 6, 7, or 8 hours may be needed, depending on sample type and size. Following these sample preparation steps, binding with a high concentration of recombinant MDP that comprises a reporter or indicator can be performed in a variety of assay formats, such as that shown in FIG. 1.


Embodiments of food assays can detect a single pathogenic bacterium in sample sizes corresponding to industry standards, with a reduction in time-to-results of at least 20%, or at least 30%, or at least 40% or at least 50% or at least 60% depending on the sample type and size.


Thus, some embodiments of the present invention solve a need by using recombinant protein-based methods for amplifying a detectable signal indicating the presence of bacteria. In certain embodiments as little as a single bacterium is detected. The principles applied herein can be applied to the detection of a variety of microorganisms. Because of numerous binding sites for a signal-generating MDP on the surface of a microorganism, the indicator moieties of numerous MDPs can be more readily detectable than the microorganism by itself. In this way, embodiments of the present invention can achieve tremendous signal amplification from even a single cell of the microorganism of interest.


Aspects of the present invention utilize the high specificity of binding components that can bind to particular microorganisms, such as the recognition and binding component of infectious agents, as a means to detect and/or quantify the specific microorganism in a sample. In some embodiments, the present invention takes advantage of the high specificity of the cell binding domain of infectious agents such as bacteriophage.


Some embodiments of the invention disclosed and described herein utilize the discovery that a single microorganism is capable of binding a very large number of MDPs. This principle allows amplification of indicator signal from one or a few cells based on specific recognition of the microorganism surface by numerous small proteins. For example, by exposing even a single cell of a bacterium to a plurality of MDPs, the indicator signal is amplified such that a single bacterium is detectable.


The unprecedented speed and sensitivity of detecting a microorganism with MDPs are unexpected results. In some embodiments, the methods of the invention require less than 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, or 2 hours for detection of a microorganism of interest. These are shorter timeframes than were previously thought possible. In some embodiments, the methods can detect as few as 100, 50, 20, 10, 9, 8, 7, 6, 5, 4, 3, or 2 cells of the bacterium of interest. In some embodiments, even a single cell of the bacterium is detectable. In additional embodiments, the invention comprises systems (e.g., computer systems, automated systems or kits) comprising components for performing the methods disclosed herein, and/or using the MDPs described herein.


Existing protocols for detection of pathogenic bacteria in foods are complicated, expensive, slow, labor-intensive and prone for false positives. Moreover, phage-based detection methods include the added complication and regulatory implications of infectious reagents. Detection with a recombinant MDP specific for a given pathogen offers an effective, fast and simple testing alternative.


Methods of Preparing Recombinant MDP

Some embodiments of methods for making MDP begin with selection of a wild-type bacteriophage for the sequence of the cell binding domain. Some bacteriophage are highly specific for a target bacterium. This presents an opportunity for highly specific detection.


Thus, the methods of the present invention utilize the high specificity of the binding agents associated with infectious agents to recognize and bind to a particular microorganism of interest. The potential for a large number of MDP molecules to bind a single microorganism provides a means to amplify an indicator signal and thereby to allow detection of low levels of a microorganism (e.g., a single microorganism) present in a sample.


Bacteriophages are able to infect and lyse specific bacteria. Bacteriophage genomes encode for three proteins; holins, endolysins, and spanins which together are responsible for progeny release during the phage lytic cycle. As shown in FIG. 2, endolysins (also called peptidoglycan hydrolases or murein hydrolases) bind to and lyse the cell wall of the particular type of bacteria they infect. Holin molecules disrupt the cytoplasmic membrane, allowing endolysins to access peptidoglycan in the cell wall. In Gram-positive bacteria, endolysins are able to contact peptidoglycan of the cells; however, the outer membrane of Gram-negative bacteria prevents binding between endolysins and the cell wall. Generally, endolysins produced by phages specific for Gram-negative bacteria have only a single, catalytic domain, responsible for lysis. Endolysins produced by phages specific for Gram-positive bacteria have two domains: an enzymatic activity domain (EAD) for lysis and a cell wall binding domain (CBD) for host recognition and high-affinity binding. More specifically, a CBD of the endolysin allows the bacteriophage to recognize the bacterium with high specificity (the lysis function is not needed). Other types of infectious agents similarly employ cell binding proteins for specificity. In some cases, nucleic acid sequences responsible for cell binding have been found within the single, globular EAD of endolysins encoded by bacteriophages specific for Gram-negative bacteria.


A third type of protein, spanins, are responsible for disruption of the outer-membrane in Gram-negative hosts. RZ1 is an outer membrane lipoprotein of the spanin complex. During the lytic cycle, the spanin complex disrupts the outer membrane followed by destruction of the cell wall by the endolysins. In some embodiments, the CBC comprises conserved amino acid sequences with cell binding functionality from at least one of the following proteins: endolysins, holins, spanins, tail spikes, or tail fibers. In other embodiments, the CBC comprises conserved amino acid sequences with cell binding functionality from endolysins and conserved amino acid sequences from at least one of holins, spanins, tail spikes, or tail fibers.


In some instances, phage can bind specific bacteria through receptor binding proteins (RBPs). Interactions between a RBP and the cell surface of a bacteria determines RBP specificity. In some phage, RBPs are located in the tail shaft, tail fibers, or tail spikes. Phage tail fiber proteins play a role in both adsorption to the cell surface and polysaccharide degradation. Tail spike proteins are a component of the tail of many bacteriophages. Tail spike proteins bind to the cell surface of bacterial hosts and mediate bacterial host recognition. Phage tail spike and/or tail fiber proteins play a role in both adsorption to the cell surface and polysaccharide degradation by allowing phage to attach to bacteria.


Some phages, including CBA120, Vi1, and P22, have tail spikes. Other phages such as T4, JG04, SEA1, Saka2, and Saka4 have tail fibers. A CBC that binds to a particular type of organism can be derived from a particular infectious agent and used as part of an indicator to identify the presence of that organism in a test sample. Thus the present invention proposes the use of MDPs to decorate or signalize microbial cells by adsorption. A MDP can be a recombinant or conjugated protein or otherwise have an indicator moiety attached. In other embodiments, the CBC comprises conserved amino acid sequences with cell binding functionality from endolysins and conserved amino acid sequences from at least one of holins, spanins, tail spikes, or tail fibers. Thus embodiments of the invention disclosed herein comprise a decorating or signalizing molecule having a cell binding moiety and an indicator moiety.


Infectious agents can be highly specific to a particular type of organism. For example, a bacteriophage may be specific to a particular genus of a bacterium, such as Listeria. For example, the A511 bacteriophage is specific for the genus Listeria. Or a bacteriophage may be specific to a particular species of bacterium, such as E. coli. For some types of bacteria, bacteriophages may even recognize particular subtypes of that organism with high specificity. For example, the CBA120 bacteriophage is highly specific for E. coli O157:H7 and the φYeO3-12 bacteriophage is highly specific for Y. enterocolitica serotype O:3.


In some embodiments of the MDPs described herein, the CBC is one aspect of a recombinant protein or a conjugated protein. A particular stretch of amino acids, encoded by a particular segment of a bacteriophage gene coding for endolysin, can serve as part of a highly specific cell type label. The CBC can be derived from T7, T4, T4-like, ViI, ViI-like, AR1, A511, A118, A006, A500, PSA, P35, P40, B025, B054, A97, phiSM101, phi3626, CBA120, SPN1S, 10, epsilon15, P22, LipZ5, P40, vB_LmoM_AG20, P70, A511, P4 W, K, Twort, or SA97. A MDP also includes an indicator moiety, such as a fluorescent moiety, a fluorescent protein, a bioluminescent protein, or an enzyme, that allows the MDP to generate a signal. In a recombinant MDP, various types of reporters can be attached to CBP, to serve as an indicator moiety. In some embodiments, the MDP fusion protein includes the amino acid sequence for an enzyme, such as a luciferase, which is only detectable upon addition of an appropriate substrate. For example, luciferase, alkaline phosphatase, and other reporter enzymes react with an appropriate substrate to provide a detectable signal. Some embodiments of a recombinant MDP comprise a wild-type luciferase or an engineered luciferase, such as NANOLUC®. Other embodiments include a fluorescent protein or another reporter protein.


A variety of infectious agents may be studied and/or can serve as a model for the cell binding domain of the CBC. In alternate embodiments, bacteriophages, phages, mycobacteriophages (such as for TB and paraTB), mycophages (such as for fungi), mycoplasma phages, and any other virus that can invade living bacteria, fungi, mycoplasma, protozoa, yeasts, and other microscopic living organisms can be studied or copied to target a microorganism of interest. In an embodiment, where the microorganism of interest is a bacterium, the CBC may comprise a cell binding domain from a bacteriophage. For example, well-studied phages of E. coli include T1, T2, T3, T4, T5, T7, and lambda; other E. coli phages available in the ATCC collection, for example, include phiX174, S13, Ox6, MS2, phiV1, fd, PR772, and ZIK1. Salmonella phages include SPN1S, 10, epsilon15, SEA1, and P22. Listeria phages include LipZ5, P40, vB_LmoM_AG20, P70, and A511. Staphylococcus phages include P4 W, virus K, Twort, phil1, 187, P68, and phiWMY.


Some embodiments of methods for preparing a recombinant MDP include sequencing or studying published sequences for various bacteriophages in order to ascertain the precise location and sequence of their cell binding components. The sequence is characterized to find homology between known cell binding components and the phage sequence. For example, the endolysin of Listeria phages is deduced from Listeria phage sequences as compared to other endolysin sequences. Thus the sequence of a Listeria-specific cell binding domain is selected or designed and used as one aspect of a MDP for detecting Listeria.


Some embodiments of the invention utilize the specificity of binding of a recombinant MDP for rapid and sensitive targeting to bind and facilitate detection of a bacterium of interest.


Recombinant Microorganism Detection Probes

As described in more detail herein, the compositions, methods, systems and kits of the invention may comprise microorganism detection probes (MDPs) for use in detection of pathogenic microorganisms. In certain embodiments, the invention comprises a recombinant MDP having a cell binding component (CBC) and an indicator or reporter gene.


In some embodiments a gene fragment encoding a CBC is isolated from a bacteriophage specific for the target of detection. In some embodiments, a CBC is derived from a bacteriophage, such as from T7, T4 or another similar phage. A bacteriophage CBC may also be derived from T4-like, T7-like, ViI, ViI-like, AR1, A511, A118, A006, A500, PSA, P35, P40, B025, B054, A97, phiSM101, phi3626, CBA120, SPN1S, 10, epsilon15, P22, LipZ5, P40, vB_LmoM_AG20, P70, A511, P4 W, K, Twort, or SA97. In some embodiments the CBC can be a CBD of an endolysin or a portion thereof that acts as a functional binding domain. A functional binding domain can be a conserved amino acid sequence within the CBD responsible for binding functions/bacterium specificity. In other embodiments the CBC can be a functional binding domain of another type of protein encoded by a bacteriophage genome including, but not limited to o-spanins, tails spikes, and tail fibers. In some embodiments the o-spanin can be RZ1.


In some embodiments, the CBC may be reverse translated to DNA and synthesized for cloning into an indicator fusion protein. A small MDP will allow more molecules to bind to a single cell and generate a signal. With this consideration, a smaller indicator gene product may also be desirable (however, note that even a large MDP is likely to be much smaller than an antibody). OpLuc and NANOLUC® proteins are only about 20 kDa (approximately 500-600 bp to encode), while FLuc is about 62 kDa and requires approximately 1,700 bp to encode. For comparison, the genome of T7 is around 40 kbp, while the T4 genome is about 170 kbp. In some embodiments the CBC is cloned into a NANOLUC® fusion plasmid. In some embodiments the fusion plasmid is created by mutation of the stop codon and insertion of a restriction endonuclease site via site-directed mutagenesis. In some embodiments, the CBC gene fragment is cloned into the restriction enzyme sites of the fusion plasmid resulting in the MDP construct. The MDP construct may be transformed into E. coli and cultured in LB medium. Expression of the MDP may be induced by the addition of the proper inducer. In one embodiment, the addition of Isopropyll ß-D-1 thiogalactopyranoside (IPTG) can be used to induce expression of the MDP. In some embodiments, the culture may be shaken in order to induce expression of the MDP.


Moreover, the indicator should generate a high signal to background ratio and should be readily detectable in a timely manner. Promega's NANOLUC® is a modified Oplophorus gracilirostris (deep sea shrimp) luciferase. In some embodiments, NANOLUC® combined with Promega's NANO-GLO®, an imidazopyrazinone substrate (furimazine), can provide a robust signal with low background.


In some MDP embodiments, an indicator moiety is fused to the CBC. An indicator can be any of a variety of biomolecules. The indicator can be a detectable product or an enzyme that produces a detectable product or a cofactor for an enzyme that produces a detectable product. In some embodiments, the indicator moiety of a MDP is a reporter, such as a detectable enzyme. The indicator gene product may generate light and/or may be detectable by a color change. Various appropriate enzymes are commercially available, such as alkaline phosphatase (AP), horseradish peroxidase (HRP), or luciferase (Luc). For example, in one embodiment the indicator is a luciferase enzyme. Various types of luciferase may be used. In alternate embodiments, and as described in more detail herein, the luciferase is one of Oplophorus luciferase, Firefly luciferase, Lucia luciferase, Renilla luciferase, or an engineered luciferase. In some embodiments, the luciferase is derived from Oplophorus. In some embodiments, the indicator is a genetically modified luciferase, such as NANOLUC®. Other engineered luciferases or other enzymes that generate detectable signals may also be appropriate indicator moieties. In some embodiments, these enzymes may serve as the indicator moiety.


Alternative MDP embodiments comprise a conjugated indicator moiety. For example, FITC can be conjugated to a CBC to create a functional MDP. In some embodiments, a MDP can include additional moieties or segments, such as a segment for binding to a solid support to facilitate separation of bound MDP from unbound MDP. The conjugation with an indicator moiety does not affect the affinity of the CBD for microorganisms.


Compositions of the invention may comprise one or more MDPs derived from one or more wild-type infectious agents (e.g., bacteriophages) and one or more indicator moieties. In some embodiments, compositions can include cocktails of different MDPs that may generate the same or different indicator signals. That is, a composition for detecting a microorganism can include all the same or different MDPs.


An MDP applied as described above comprises a cell binding component (CBC) that facilitates the specific detection of microorganisms based on the specificity of the CBC. In another approach that can utilize a CBC for specificity, the previously described assays using recombinant bacteriophage which recognize and bind to specific bacteria can be employed. The recombinant bacteriophage assays can be performed in an apparatus as described further herein.


Recombinant Bacteriophage

As described in more detail herein, the apparatus, methods, systems and kits of the invention comprise recombinant bacteriophage for use in detection of microorganisms of interest. The recombinant bacteriophage are comprised in the first compartment of the apparatus disclosed above. In some embodiments, the invention may include a composition comprising a recombinant bacteriophage having an indicator gene incorporated into the genome of the bacteriophage. In some embodiments, the indicator gene is operably linked to a promoter that is not a native promoter of the bacteriophage. In some embodiments, the indicator gene is operably linked to a native promoter of the bacteriophage. The recombinant bacteriophage comprising the indicator or reporter gene are also referred to as indicator bacteriophage in this disclosure.


A recombinant bacteriophage can include a reporter or indicator gene. In certain embodiments of the bacteriophage, the indicator gene does not encode a fusion protein. For example, in certain embodiments, expression of the indicator gene during bacteriophage replication following infection of a host bacterium results in a soluble indicator protein product. In certain embodiments, the indicator gene may be inserted into a late gene region of the bacteriophage. Late genes are generally expressed at higher levels than other phage genes, as they code for structural proteins. The late gene region may be a class III gene region and may include a gene for a major capsid protein.


Some embodiments include designing (and optionally preparing) a sequence for homologous recombination downstream of the major capsid protein gene. Other embodiments include designing (and optionally preparing) a sequence for homologous recombination upstream of the major capsid protein gene. In some embodiments, the sequence comprises a codon-optimized reporter gene preceded by an untranslated region. The untranslated region may include a phage late gene promoter and ribosomal entry site.


In some embodiments, an indicator bacteriophage is derived from A511, P100, Listeria phage LMTA-94, LMA4, LMA8, T7, T4 or another similar phage. An indicator bacteriophage may also be derived from P100virus, T4-like, T7-like, ViI, ViI-like, Cronobacter-, Salmonella-, Listeria- or Staphylococcus-specific bacteriophage, or another bacteriophage having a genome with at least 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% homology to T7, T7-like, T4, T4-like, P100virus, Cronobacter-, Salmonella-, Listeria- or Staphylococcus-specific bacteriophage, ViI, or ViI-like (or Vi1 virus-like, per GenBank/NCBI) bacteriophages. In some embodiments, the indicator phage is derived from a bacteriophage that is highly specific for a particular pathogenic microorganism. The genetic modifications may avoid deletions of wild-type genes and thus the modified phage may remain more similar to the wild-type bacteriophage than many commercially available phage. Environmentally derived bacteriophage may be more specific for bacteria that are found in the environment and as such, genetically distinct from phage available commercially.


Moreover, phage genes thought to be nonessential may have unrecognized function. For example, an apparently nonessential gene may have an important function in elevating burst size such as subtle cutting, fitting, or trimming functions in assembly. Therefore, deleting genes to insert an indicator may be detrimental. Most phages can package a DNA that is a few percent larger than their natural genome. With this consideration, a smaller indicator gene may be a more appropriate choice for modifying a bacteriophage, especially one with a smaller genome. OpLuc and NANOLUC® proteins are only about 20 kDa (approximately 500-600 bp to encode), while FLuc is about 62 kDa (approximately 1,700 bp to encode). For comparison, the genome of T7 is around 40 kbp, while the T4 genome is about 170 kbp, and the genome of Cronobacter-, Salmonella-, or Staphylococcus-specific bacteriophage is about 157 kbp. Moreover, the reporter gene should not be expressed endogenously by the bacteria (i.e., is not part of the bacterial genome), should generate a high signal to background ratio, and should be readily detectable in a timely manner. Promega's NANOLUC® is a modified Oplophorus gracilirostris (deep sea shrimp) luciferase. In some embodiments, NANOLUC® combined with Promega's NANO-GLO®, an imidazopyrazinone substrate (furimazine), can provide a robust signal with low background.


In some indicator phage embodiments, the indicator gene can be inserted into an untranslated region to avoid disruption of functional genes, leaving wild-type phage genes intact, which may lead to greater fitness when infecting non-laboratory strains of bacteria. Additionally, including stop codons in all three reading frames may help to increase expression by reducing read-through, also known as leaky expression. This strategy may also eliminate the possibility of a fusion protein being made at low levels, which would manifest as background signal (e.g., luciferase) that cannot be separated from the phage.


An indicator gene may express a variety of biomolecules. The indicator gene is a gene that expresses a detectable product or an enzyme that produces a detectable product. For example, in one embodiment the indicator gene encodes a luciferase enzyme. Various types of luciferase may be used. In alternate embodiments, and as described in more detail herein, the luciferase is one of Oplophorus luciferase, Firefly luciferase, Lucia luciferase, Renilla luciferase, or an engineered luciferase. In some embodiments, the luciferase gene is derived from Oplophorus. In some embodiments, the indicator gene is a genetically modified luciferase gene, such as NANOLUC®.


Thus, in some embodiments, the present invention comprises a genetically modified bacteriophage comprising a non-bacteriophage indicator gene in the late (class III) gene region. In some embodiments, the non-native indicator gene is under the control of a late promoter. Using a viral late gene promoter insures the reporter gene (e.g., luciferase) is not only expressed at high levels, like viral capsid proteins, but also does not shut down like endogenous bacterial genes or even early viral genes.


In some embodiments, the late promoter is a P100virus, T4-, T7-, or ViI-like promoter, or another phage promoter similar to that found in the selected wild-type phage, i.e., without genetic modification. The late gene region may be a class III gene region, and the bacteriophage may be derived from T7, T4, T4-like, ViI, ViI-like, Cronobacter-, Salmonella-, Staphylococcus-, Listeria- or S. aureus-specific bacteriophage, or another natural bacteriophage having a genome with at least 70, 75, 80, 85, 90 or 95% homology to T7, T4, T4-like, ViI, ViI-like, or Cronobacter-, Salmonella-, Staphylococcus-, Listeria- or S. aureus-specific bacteriophage.


Genetic modifications to bacteriophages may include insertions, deletions, or substitutions of a small fragment of nucleic acid, a substantial part of a gene, or an entire gene. In some embodiments, inserted or substituted nucleic acids comprise non-native sequences. A non-native indicator gene may be inserted into a bacteriophage genome such that it is under the control of a bacteriophage promoter. In some embodiments, the non-native indicator gene is not part of a fusion protein. That is, in some embodiments, a genetic modification may be configured such that the indicator protein product does not comprise polypeptides of the wild-type bacteriophage. In some embodiments, the indicator protein product is soluble. In some embodiments, the invention comprises a method for detecting a bacterium of interest comprising the step of incubating a test sample with such a recombinant bacteriophage.


In some embodiments, expression of the indicator gene in progeny bacteriophage following infection of host bacteria results in a free, soluble protein product. In some embodiments, the non-native indicator gene is not contiguous with a gene encoding a structural phage protein and therefore does not yield a fusion protein. Unlike systems that employ a fusion of a detection moiety to the capsid protein (i.e., a fusion protein), some embodiments of the present invention express a soluble indicator or reporter (e.g., soluble luciferase). In some embodiments, the indicator or reporter is ideally free of the bacteriophage structure. That is, the indicator or reporter is not attached to the phage structure. As such, the gene for the indicator or reporter is not fused with other genes in the recombinant phage genome. This may greatly increase the sensitivity of the assay (down to a single bacterium), and simplifies the assay, allowing the assay to be completed in less than an hour for some embodiments, as opposed to several hours due to additional purification steps required with constructs that produce detectable fusion proteins. Further, fusion proteins may be less active than soluble proteins due, e.g., to protein folding constraints that may alter the conformation of the enzyme active site or access to the substrate.


Moreover, fusion proteins by definition limit the number of the moieties attached to subunits of a protein in the bacteriophage. For example, using a commercially available system designed to serve as a platform for a fusion protein would result in about 415 copies of the fusion moiety, corresponding to the about 415 copies of the gene 10B capsid protein in each T7 bacteriophage particle. Without this constraint, infected bacteria can be expected to express many more copies of the detection moiety (e.g., luciferase) than can fit on the bacteriophage. Additionally, large fusion proteins, such as a capsid-luciferase fusion, may inhibit assembly of the bacteriophage particle, thus yielding fewer bacteriophage progeny. Thus a soluble, non-fusion indicator gene product may be preferable.


In some embodiments, the indicator phage encodes a reporter, such as a detectable enzyme. The indicator gene product may generate light and/or may be detectable by a color change. Various appropriate enzymes are commercially available, such as alkaline phosphatase (AP), horseradish peroxidase (HRP), or luciferase (Luc). In some embodiments, these enzymes may serve as the indicator moiety. In some embodiments, Firefly luciferase is the indicator moiety. In some embodiments, Oplophorus luciferase is the indicator moiety. In some embodiments, NANOLUC® is the indicator moiety. Other engineered luciferases or other enzymes that generate detectable signals may also be appropriate indicator moieties.


In some embodiments, the use of a soluble detection moiety eliminates the need to remove contaminating parental phage from the lysate of the infected sample cells. With a fusion protein system, any bacteriophage used to infect sample cells would have the detection moiety attached, and would be indistinguishable from the daughter bacteriophage also containing the detection moiety. As detection of sample bacteria relies on the detection of a newly created (de novo synthesized) detection moiety, using fusion constructs requires additional steps to separate old (parental) moieties from newly created (daughter bacteriophage) moieties. This may be accomplished by washing the infected cells multiple times, prior to the completion of the bacteriophage life cycle, inactivating excess parental phage after infection by physical or chemical means, and/or chemically modifying the parental bacteriophage with a binding moiety (such as biotin), which can then be bound and separated (such as by streptavidin-coated sepharose beads). However, even with all these attempts at removal, parental phage can remain when a high concentration of parental phage is used to assure infection of a low number of sample cells, creating background signal that may obscure detection of signal from infected cell progeny phage.


By contrast, with the soluble detection moiety expressed in some embodiments of the present invention, purification of the parental phage from the final lysate is unnecessary, as the parental phage do not have any detection moiety attached. Thus any detection moiety present after infection must have been created de novo, indicating the presence of an infected bacterium or bacteria. To take advantage of this benefit, the production and preparation of parental phage may include purification of the phage from any free detection moiety produced during the production of parental bacteriophage in bacterial culture. Standard bacteriophage purification techniques may be employed to purify some embodiments of phage according to the present invention, such as sucrose density gradient centrifugation, cesium chloride isopycnic density gradient centrifugation, HPLC, size exclusion chromatography, and dialysis or derived technologies (such as Amicon brand concentrators—Millipore, Inc.). Cesium chloride isopycnic ultracentrifugation can be employed as part of the preparation of recombinant phage of the invention, to separate parental phage particles from contaminating luciferase protein produced upon propagation of the phage in the bacterial host. In this way, the parental recombinant bacteriophage of the invention is substantially free of any luciferase generated during production in the bacteria. Removal of residual luciferase present in the phage stock can substantially reduce background signal observed when the recombinant bacteriophage are incubated with a test sample.


In some embodiments of modified bacteriophage, the late promoter (class III promoter, e.g., from Listeria-specific phage, T7, T4, or ViI) has high affinity for RNA polymerase of the same bacteriophage that transcribes genes for structural proteins assembled into the bacteriophage particle. These proteins are the most abundant proteins made by the phage, as each bacteriophage particle comprises dozens or hundreds of copies of these molecules. The use of a viral late promoter can ensure optimally high level of expression of the luciferase detection moiety. The use of a late viral promoter derived from, specific to, or active under the original wild-type bacteriophage the indicator phage is derived from (e.g., a Listeria-specific phage, T4, T7, or ViI late promoter with a T4-, T7-, or ViI-based system) can further ensure optimal expression of the detection moiety. The use of a standard bacterial (non-viral/non-bacteriophage) promoter may in some cases be detrimental to expression, as these promoters are often down-regulated during bacteriophage infection (in order for the bacteriophage to prioritize the bacterial resources for phage protein production). Thus, in some embodiments, the phage is preferably engineered to encode and express at high level a soluble (free) indicator moiety, using a placement in the genome that does not limit expression to the number of subunits of a phage structural component.


Compositions of the invention may comprise one or more wild-type or genetically modified bacteriophages (e.g., bacteriophages) and one or more indicator genes. In some embodiments, compositions can include cocktails of different indicator phages that may encode and express the same or different indicator proteins. In some embodiments, the cocktail of bacteriophage comprises at least two different types of recombinant bacteriophages.


Apparatus

Embodiments of the invention are directed to methods of detecting microorganisms of interest using a self-contained apparatus. The apparatus comprises a solid support, which can be used for collecting a sample comprising the microorganisms of interest. In some embodiments, an apparatus according to the invention comprises a tube with separate compartments, either arranged sequentially or in branching configuration (e.g., “ears” on a tube). The apparatus may comprise a number of compartments which can be configured for varied mixing of reagents and timing of method steps. In some embodiments, the uppermost or superior compartment of the tube contains recombinant bacteriophage, and the substrate compartment is below the bacteriophage compartment. In some embodiments, the tube contains growth media.


In the simplest embodiments, a first compartment contains recombinant bacteriophage, and a second compartment contains substrate or developer reagent. In some such embodiments both reagents are mixed with a sample (captured on the solid support) at the same time. In other embodiments, a sample is initially added to the first compartment to initiate infection. After a period of time, a conduit to the second compartment is opened to allow addition and mixing of the substrate or developer reagent into the infected sample.


In an alternative embodiment, the first compartment contains microorganisms detection probes (MDPs) and a second compartment contains substrate or developer reagent. In some such embodiments both reagents are mixed with a sample (captured on the solid support) at the same time. In other embodiments, a sample is initially added to the first compartment. After a period of time, a conduit to the second compartment is opened to allow addition and mixing of the substrate or developer reagent into the infected sample.


In some embodiments, a seal separates adjacent compartments, the user breaks the seal(s), both substrate and phage encounter the swab at the same time. As luciferase is produced and reacts with the substrate to produce a detectable signal.


In some embodiments, the substrate compartment may be positioned between a media compartment and a recombinant bacteriophage compartment. When a user breaks the seal to apply a reagent to a sample that is captured on the solid support, both reagents are applied at the same time.


In alternative embodiments, the substrate compartment may be positioned between a media compartment and a MDP compartment. When a user breaks the seal to apply a reagent to a sample that is captured on the solid support, both reagents are applied at the same time.


In some embodiments, a solid support is added to a tube where the substrate or developer is at the bottom of the tube; the solid support is pushed into the bottom to begin the reaction between the enzyme and substrate or other reporter and paired reagent. The solid support may be attached to a shaft for ease of handling.


The following figures provide illustrative examples of embodiments of the invention.


In one embodiment, the present disclosure provides a self-contained microorganism detection apparatus system. FIG. 12 shows an embodiment of an apparatus 100. The apparatus comprises a solid support 16 and a container comprising three compartments. Each of the compartments is separated by a snap action seal. The first compartment 10 contains phage, the second compartment 12 contains substrate, and the third compartment 14 contains media. This apparatus allows the phage and substrate to be incubated with the sample at the same time.



FIG. 13 shows a second embodiment of an apparatus 200. The apparatus comprises a solid support 26 and a container comprising three compartments. Each of the compartments is separated by a snap action seal. The first compartment 20 contains phage, the second compartment 22 contains media, and the third compartment 24 contains substrate. In embodiments, using the apparatus depicted in FIG. 13, the sample is first incubated with the phage, prior to incubation with the substrate. In further embodiments using the apparatus depicted in FIG. 13, the solid support is soaked with media prior to collection of the sample.



FIG. 14 depicts a third embodiment of an apparatus 300. The apparatus comprises a solid support 36 and a container comprising three compartments. Each of the compartments is separated by a snap action seal. The first compartment 30 contains media, the second compartment 32 contains phage, and the third compartment 34 contains substrate. In embodiments, using the apparatus depicted in FIG. 14, the sample is first incubated with the phage, prior to incubation with the substrate. In further embodiments using the apparatus depicted in FIG. 14, the solid support is dry prior to collection of the sample.



FIG. 15 shows a fourth embodiment of an apparatus 400. The apparatus comprises a solid support 46 and a container comprising three compartments. Each of the compartments is separated by a snap action seal. The first compartment 40 contains media, the second compartment 42 contains phage, and the third compartment 46 contains substrate. The apparatus has a stop-lock mechanism for phased mixing of reagents. In embodiments, using the apparatus depicted in FIG. 15, the sample is first incubated with the phage, prior to incubation with the substrate. In further embodiments using the apparatus depicted in FIG. 15, the solid support is soaked with media prior to collection of the sample.



FIG. 16 depicts a fifth embodiment of an apparatus 500. The apparatus comprises a solid support 56 and a container comprising three compartments. Each of the compartments is separated by a snap action seal. The first compartment 50 contains media, the second compartment 52 contains phage, and the third compartment 54 contains substrate. The apparatus has a stop-lock mechanism for phased mixing of reagents. In embodiments, using the apparatus depicted in FIG. 16, the sample is first incubated with the phage, prior to incubation with the substrate. In further embodiments using the apparatus depicted in FIG. 16, the solid support is dry prior to collection of the sample.



FIG. 17 depicts a method for detecting microorganisms comprising (i) enriching a sample overnight, (ii) using a solid support from a self-contained apparatus to collect the sample that has been enriched overnight, (iii) infecting the sample with phage contained within a compartment of the self-contained apparatus, and (iv) detecting the presence of microorganisms by reading/detecting the signal produced by the infection step.


In some embodiments, compartments contained in projections or branches from the central tube allow mixing of reagents from more than 2 directions, e.g., in the form of “ears.” For example, two squeeze bulbs could be used to add media and then phage sequentially or simultaneously to the main compartment, or to add other reagents. Various arrangements of other compartments with respect to a central compartment allows for addition and mixing of different reagents into the larger adjacent compartment.


Solid Support Coated with Cell Binding Components


As discussed above, the apparatus of the disclosure may comprise a solid support. A variety of solid supports may be used. In certain embodiments, the solid support may comprise, a swab, a filter, a bead, a lateral flow strip, a filter strip, filter disc, filter paper, or thin films designed for culturing cells (e.g., PetriFilm by 3M). In some embodiments, the solid support comprises plastic materials. In some embodiments, the solid support comprises polyethylene (PE), polypropylene (PP), polystyrene (PS), polylactic acid (PLA) and polyvinyl chloride (PVC). In some embodiments, the solid support is coated with a cell binding component that has high affinity for the microorganisms to be detected. In some embodiments, the solid support is a polystyrene bead or a bead made of a similar or other material (e.g., polylactic acid), such that the bead can be coated with proteins but does not react with other components in the assay.


In some embodiments, the bead is sufficiently large such that a plurality of a cell-binding component (CBC) that bind to a particular microorganism can be attached to the bead. The bead should also be of an appropriate size such that it fits inside the tube of the apparatus. For example, the bead may range in size from 0.1 to 100 mm, 1 to 10 mm, 4 to 8 mm, or from 6 to 7 mm, in diameter. The amount of CBC per the solid support may vary. It generally depends on the size of the bead and also the concentration of the bacteria in the sample. In some embodiments, the number of CBCs on each bead may be at least 5×107, or at least 5×108, or at least 5×1010 or at least 5×1013, or at least 5×1014, or at least 5×1016 molecules.


The CBC coated on the solid support of the apparatus can bind to microorganism of interest with high affinity and thus enrich the amount of microorganism the solid support can capture. For example, in certain embodiments, the CBC is highly specific for S. aureus, Listeria, Salmonella, or E. coli. In an embodiment, the CBC can distinguish S. aureus, Listeria, Salmonella, or E. coli in the presence of more than 100 other types of bacteria. In an embodiment, the CBC can distinguish a specific serotype within a species of bacteria (e.g., E. coli O157:H7) in the presence of more than 100 other types of bacteria. In certain embodiments, the method using the apparatus comprising the solid support coated with CBC can be used to detect a single bacterium of the specific type in the sample. In certain embodiments, the CBC detects as few as 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 30, 40, 50, 60, 70, 80, 90, or 100 of the specific bacteria in the sample. Thus, in certain embodiments, the method may detect ≤10 cells of the microorganism (i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 microorganisms) or ≤20, or ≤30, or ≤40, or ≤50, or ≤60, or ≤70, or ≤80, or ≤90, or ≤100, or ≤200, or ≤500, or ≤1000 cells of the microorganism present in a sample.


In some embodiments, the CBC is a protein, also referred to as a microorganism detection protein in this disclosure. In some embodiments, CBC is a protein that binds to the cell wall of gram-positive bacteria. In some embodiments, the CBC is a phage tail protein that is used to attach to the outer surface of specific microorganisms, including Gram-negative bacteria. In some embodiments, the phage tail protein is a phage lambda tail protein. In some embodiments the CBC is a protein produced by expressing a gene fragment isolated from a bacteriophage specific for the detection of the microorganism.


In some embodiments, the CBC that is used to capture a particular type of microorganisms can be derived from a particular bacteriophage, for example, T7, T4 or another similar phage. In some embodiments, the CBC can be lysins encoded and expressed by phages of the bacteria. A bacteriophage CBC may also be derived from T4-like, T7-like, ViI, ViI-like, AR1, A511, A118, A006, A500, PSA, P35, P40, B025, B054, A97, phiSM101, phi3626, CBA120, SPN1S, 10, epsilon15, P22, LipZ5, P40, vB_LmoM_AG20, P70, A511, P4 W, K, Twort, or SA97.


In some instances, the CBC can be a receptor binding protein through which phage can bind specific bacteria. Interactions between a RBP and the cell surface of a bacteria determines RBP specificity. In some phage, RBPs are located in the tail shaft, tail fibers, or tail spikes. Phage tail fiber proteins play a role in both adsorption to the cell surface and polysaccharide degradation. Tail spike proteins are a component of the tail of many bacteriophages. Tail spike proteins bind to the cell surface of bacterial hosts and mediate bacterial host recognition. Thus, in some embodiments, the CBC can be tail fibers, tail spikes of the bacteriophage that are specific for the microorganisms.


In some embodiments the CBC can be one or more of the endolysin, holins, spanins, or a function binding domain thereof that can bind to the microorganisms with high affinity. These three proteins are encoded by bacteriophage and together are responsible for progeny release during the phage lytic cycle. In some embodiments, the CBC comprises the cell wall binding domain (“CBD”) of an endolysin, which allows the bacteriophage to recognize the bacterium with high specificity. In some embodiments, the CBC comprises the conserved amino acid sequence that is responsible for binding the microorganisms. Typically, the CBD is located at the C-terminus end, but can be found at the N-terminus end or as a central domain in some cases.


In some embodiments, the CBC can be a protein that shares substantial amino acid sequence identity with a protein selected from the group consisting of: endolysins, holins, spanins, o-spanins (e.g., RZ1), tails spikes, and tail fibers or, or a function binding domain thereof. A functional binding domain can be a conserved amino acid sequence within the polypeptide that is responsible for binding functions/bacterium specificity. For example the CBC may share at least 80%, at least 90%, at least 95%, at least 98% or at least 99% amino acid sequence identity with endolysin (SEQ ID NO: 1; or YP_001468459) or the CBD of endolysin (SEQ ID NO: 2) or any of the proteins that are known to possess high affinity for the microorganisms of interest. An exemplary method of expressing the CBD of the endolysin is shown in Example 6.


In some embodiments, the CBC may be reverse translated to DNA and synthesized for cloning into an expression vector. The CBC expression vector may be transformed into E. coli and cultured in LB medium. Expression of the CBC may be induced by the addition of the proper inducer. In one embodiment, the addition of Isopropyll β-D-1 thiogalactopyranoside (IPTG) can be used to induce expression of the CBC.


Various methods for coating a solid support are well known in the art. In one embodiment, the solid support may comprise streptavidin and biotinylated CBC, and the coating of the solid support involves the biotin-streptavidin interaction. In some instances, the CBC may be conjugated to amines to facilitate binding to avidins that have been attached to the surface of the solid support.


Methods of Using the Apparatus for Detecting Microorganisms

As noted herein, in certain embodiments, the invention may include methods of detecting the microorganism, the method comprising contacting the sample with a solid support such that the microorganisms are captured on the solid support, contacting the recombinant bacteriophage from the first compartment with the microorganisms captured on the solid support by e.g., breaking a snap action seal of the first compartment. During and/or after the infection, the bacteriophage express the indicator gene to produce an indicator, which can be detected by various detection devices. In some embodiments, the detection of the indicator may require adding a substrate, which reacts with the indicator to produce a detectable signal. The presence of the signals indicate the presence of the microorganisms in the sample.


In an alternative embodiments, the invention may include methods of detecting the microorganism, the method comprising contacting the sample with a solid support such that the microorganisms are captured on the solid support, contacting the MDPs from the first compartment with the microorganisms captured on the solid support by e.g., breaking a snap action seal of the first compartment. The indicator moiety of the MDP can be detected by various detection devices. In some embodiments, the detection of the indicator may require adding a substrate, which reacts with the indicator to produce a detectable signal. The presence of the signals indicate the presence of the microorganisms in the sample.


Sampling


In some embodiments, samples may be used directly in the detection methods of the present invention, without preparation, concentration, or dilution. For example, liquid samples, including but not limited to, milk and juices, may be assayed directly. In other embodiments, samples may be diluted or suspended in solution, which may include, but is not limited to, a buffered solution or a bacterial culture medium. A sample that is a solid or semi-solid may be suspended in a liquid by mincing, mixing or macerating the solid in the liquid. In some embodiments, a sample should be maintained within a pH range that promotes the CBC's attachment to the host bacterial cell. In some embodiments, the preferred pH range may be one suitable for bacteriophage attached to a bacterial cell. A sample should also contain the appropriate concentrations of divalent and monovalent cations, including but not limited to Na+, Mg2+, and K+.


Preferably throughout detection assays, the sample is maintained at a temperature that maintains the viability of any pathogen cell present in the sample. During steps in which bacteriophage, are attaching to bacterial cells, it is preferable to maintain the sample at a temperature that facilitates bacteriophage activity. Such temperatures are at least about 25° C. and no greater than about 45° C. In some embodiments, the samples are maintained at about 37° C. In some embodiments the samples are subjected to gentle mixing or shaking during CBC binding or attachment.


Assays may include various appropriate control samples. For example, control samples, e.g., food samples, without bacteria may be assayed as controls for background signal levels.


Sampling can be performed using a variety of ways. In some embodiments, the samples, e.g., food samples are first liquefied and the solid support, e.g., the solid support or bead, is dipped into the liquid sample. In some embodiments, the solid support is first soaked in the culture media in the tube before sampling. In some embodiments, the solid support is dry before sampling. In some embodiments, the liquid sample is first cultured for a period of time (“culture enrichment”), for example, less than 24 hours, less than 12 hours, less than an enrichment period of 9 hours or less, 8 hours or less, 7 hours or less, 6 hours or less, 5 hours or less, 4 hours or less, 3 hours or less, or 2 hours or less.


In other embodiments, the sample may be enriched following capture of the microorganisms on the solid support. In some embodiments, the solid support with microorganisms can be incubated in growth media in the third compartment of the apparatus to allow the microorganism to expand in number. This step is referred to as incubation enrichment. In such embodiments, the enrichment period can be 1, 2, 3, 4, 5, 6, 7, or up to 8 hours or longer, depending on the sample type and size.


In some embodiments of the methods of the invention, the microorganisms may be detected without any isolation or purification of the microorganisms from a sample. For example, in certain embodiments, a sample containing one or more microorganisms of interest may be applied directly to the solid support and the assay is conducted in the apparatus.


Infection


The methods disclosed herein comprises operating the apparatus to cause the recombinant bacteriophage to contact the microorganisms of interest. Upon contacting the microorganisms, the bacteriophage replicate and express the indicator gene or reporter gene. See the section entitled “Recombinant Bacteriophage”. The infection time, i.e., a time period between the time point when the sample is first contacted with bacteriophage and the time point when the substrate is added to the mixture, may vary, depending on the type of bacteriophage and concentration of the microorganisms in the sample. Using the apparatus in which the bacteria are captured on solid support can significantly reduce the time required for infection, for example, the infection time can be one hour or less, while in a standard assay, where no solid support is used to capture the bacteria, the infection is typically at least 4 hours, In certain embodiments, the time of infection for the methods disclosed herein is less than 6.0 hours, 5.0 hours, 4.0 hours, 3.0 hours, 2.5 hours, 2.0 hours, 1.5 hours, 1.0 hour, 45 minutes, or less than 30 minutes. In some embodiments, the time of infection is about 1 hour, about 2 hours, or about 3 hours.


Developing Signal


The indicator, produced by expression of the indicator gene, can be detected using methods well known to one or ordinary skill in the art. For example, one or more signal producing components can be reacted with the indicator to generate a detectable signal. In some embodiments, the indicator can be a bioluminescent compound. If the indicator is an enzyme, then amplification of the detectable signal is obtained by reacting the enzyme with one or more substrates or additional enzymes and substrates to produce a detectable reaction product. In an alternative signal producing system, the indicator can be a fluorescent compound where no enzymatic manipulation of the indicator is required to produce the detectable signal. Fluorescent molecules including, for example, fluorescein and rhodamine and their derivatives and analogs are suitable for use as indicators in such a system. In yet another alternative embodiment, the indicator moiety can be a cofactor, then amplification of the detectable signal is obtained by reacting the cofactor with the enzyme and one or more substrates or additional enzymes and substrates to produces a detectable reaction product. In some embodiments, the detectable signal is colorimetric. It is noted that the selection of a particular indicator is not critical to the present invention, but the indicator will be capable of generating a detectable signal either by itself, or be instrumentally detectable, or be detectable in conjunction with one or more additional signal producing components, such as an enzyme/substrate signal producing system.


In some embodiments, the detecting step will require addition of a substrate for the indicator enzyme to act on. Substrate can be added in a variety of ways. In some embodiments, the substrate is comprised in the second compartment of the apparatus and breaking the snap action seal causes the phage (in the first compartment in the apparatus) and substrate to contact the microorganisms (captured on the solid support) concurrently. See FIG. 12. In some embodiments, the snap action seals are broken sequentially, causing the microorgansims to contact the bacteriophage before contact the substrate. See FIGS. 13A and 13B. In some embodiments, the method comprises operating the stop-lock to enable phased mixing such that the microorganisms contact bacteriophage before contacting the substrate.


In some embodiments, the reaction of indicator (e.g., luciferase) with substrate may continue for 30 minutes or more, and detection at various time points may be desirable for optimizing sensitivity. In some embodiments, luminometer readings may be taken initially and at 3-, or 5-, or 10-, or 15-minute intervals until the reaction is completed.


Detecting Signal


Detecting the signal produced by the indicator may include detecting emission of light. In some embodiments the compartment of the apparatus in which the substrate is mixed with the test sample is transparent, such that any signal resulting from the infection and subsequent incubation with substrate is visible. In this case, the signal can be detected through the wall of the compartment. In some embodiments, the apparatus containing the reacted sample is inserted into an instrument for detecting the signal that results. In other embodiments, a detecting instrument is used to scan the apparatus containing the reacted sample.


In some embodiments, a luminometer may be used to detect the indicator (e.g., luciferase), e.g., GloMax® 20/20 and GloMax® from Promega (Madison, Wis.). In some embodiments, a spectrophotometer, CCD camera, or CMOS camera may be used to detect color changes and other light emissions. Absolute RLU are important for detection, but the signal to background ratio also needs to be high (e.g., >2.0, >2.5, or >3.0) in order for single cells or low numbers of cells to be detected reliably. The background signal can be obtained by measuring control sample that does not contain microorganism using the same procedure as described above. In some embodiments, detection of signal from the reporter or indicator gene may include, for example, use of an instrument that employs photodiode or PMT (photomultiplier tube) technology. In some embodiments, a handheld luminometer may be employed for detection of signal. Suitable PMT handheld luminometers are available from 3M (Maplewood, Minn.), BioControl (Seattle, Wash.), and Charm Science (Lawrence, Mass.). Suitable photodiode handheld luminometers are available from Hygiena (Camarillo, Calif.) and Neogen (Lansing, Mich.). These handheld luminometers typically produce much lower readings as compared to traditional luminometers (GloMax or GloMax 20/20) for the same sample. As shown in the Examples, multiple experiments show that the signals produced by the reactions were sufficient to be detected by these handheld luminometers. The assays were repeated multiple times with different types of microorganisms, including L. monocytogenes and Salmonella, and similar results were obtained each time. This indicates that the detection method using the apparatus is sufficiently sensitive and robust. Being able to use these handheld devices to detect the microorganism also offers convenience and flexibility that is often lacking with detection methods using traditional, non-handheld detection devices.


Systems and Kits of the Invention

In some embodiments, the invention comprises systems (e.g., automated systems) or kits comprising components for performing the methods disclosed herein. In some embodiments, the apparatus is comprised in systems or kits according to the invention. Methods described herein may also utilize such systems or kits. Some embodiments described herein are particularly suitable for automation and/or kits, given the minimal amount of reagents and materials required to perform the methods. In certain embodiments, each of the components of a kit may comprise a self-contained unit that is deliverable from a first site to a second site.


In some embodiments, the invention comprises systems or kits for rapid detection of a microorganism of interest in a sample. The systems or kits may in certain embodiments comprise: an apparatus as described above, wherein the solid support comprises a cell binding component as described above, and a signal detecting component, wherein the signal detecting component can detect the indicator gene product produced from infecting the sample with the recombinant bacteriophage. In some embodiments, the signal detecting component is a handheld device. In some embodiments, the signal detecting component is a handheld luminometer.


Thus in certain embodiments, the invention may comprise a system or kit for rapid detection of a microorganism of interest in a sample, comprising: apparatus comprises: a first compartment comprising recombinant bacteriophage having a genetic construct inserted into a bacteriophage genome, wherein the construct comprises a promoter and an indicator gene. The system or kit may further comprise a second compartment that contain substrate, and/or a third compartment that contain media. One or more of these compartments are sealed and separate from the other portion of the apparatus by a snap-action seal, and the breaking the snap-action seal causes the contents from the compartment to leave the compartment and mix with the sample.


In some embodiments, the system may comprise a component for isolating the microorganism of interest from the other components in the sample.


In some systems and/or kits, the same component may be used for multiple steps. In some systems and/or kits, the steps are automated or controlled by the user via computer input and/or wherein a liquid-handling robot performs at least one step. In a computerized system, the system may be fully automated, semi-automated, or directed by the user through a computer (or some combination thereof).


These systems and kits of the invention include various components. As used herein, the term “component” is broadly defined and includes any suitable apparatus or collections of apparatuses suitable for carrying out the recited method. The components need not be integrally connected or situated with respect to each other in any particular way. The invention includes any suitable arrangements of the components with respect to each other. For example, the components need not be in the same room. But in some embodiments, the components are connected to each other in an integral unit. In some embodiments, the same components may perform multiple functions.


Computer Systems and Computer Readable Media

In certain embodiments, the invention may comprise a system. The system may include at least some of the compositions of the invention. Also, the system may comprise at least some of the components for performing the method. In certain embodiments, the system is formulated as a kit. Thus, in certain embodiments, the invention may comprise a system for rapid detection of a microorganism of interest in a sample. The system may include at least some of the compositions of the invention. Also, the system may comprise at least some of the components for performing the method. In certain embodiments, the system is formulated as a kit. Thus, in certain embodiments, the invention may comprise a system for rapid detection of a microorganism of interest in a sample, comprising an apparatus as described above. For example, the apparatus may comprise a first compartment comprising recombinant bacteriophage having a genetic construct inserted into a bacteriophage genome, wherein the construct comprises a promoter and an indicator gene; wherein the solid support comprises a cell binding component. In some embodiments, the system also comprises a handheld detection device.


The system, as described in the present technique or any of its components, may be embodied in the form of a computer system. Typical examples of a computer system include a general-purpose computer, a programmed microprocessor, a microcontroller, a peripheral integrated circuit element, and other devices or arrangements of devices that are capable of implementing the steps that constitute the method of the present technique.


A computer system may comprise a computer, an input device, a display unit, and/or the Internet. The computer may further comprise a microprocessor. The microprocessor may be connected to a communication bus. The computer may also include a memory. The memory may include random access memory (RAM) and read only memory (ROM). The computer system may further comprise a storage device. The storage device can be a hard disk drive or a removable storage drive such as a floppy disk drive, optical disk drive, etc. The storage device can also be other similar means for loading computer programs or other instructions into the computer system. The computer system may also include a communication unit. The communication unit allows the computer to connect to other databases and the Internet through an I/O interface. The communication unit allows the transfer to, as well as reception of data from, other databases. The communication unit may include a modem, an Ethernet card, or any similar device which enables the computer system to connect to databases and networks such as LAN, MAN, WAN and the Internet. The computer system thus may facilitate inputs from a user through input device, accessible to the system through I/O interface.


A computing device typically will include an operating system that provides executable program instructions for the general administration and operation of that computing device, and typically will include a computer-readable storage medium (e.g., a hard disk, random access memory, read only memory, etc.) storing instructions that, when executed by a processor of the server, allow the computing device to perform its intended functions. Suitable implementations for the operating system and general functionality of the computing device are known or commercially available, and are readily implemented by persons having ordinary skill in the art, particularly in light of the disclosure herein.


The computer system executes a set of instructions that are stored in one or more storage elements, in order to process input data. The storage elements may also hold data or other information as desired. The storage element may be in the form of an information source or a physical memory element present in the processing machine.


The environment can include a variety of data stores and other memory and storage media as discussed above. These can reside in a variety of locations, such as on a storage medium local to (and/or resident in) one or more of the computers or remote from any or all of the computers across the network. In a particular set of embodiments, the information may reside in a storage-area network (“SAN”) familiar to those skilled in the art. Similarly, any necessary files for performing the functions attributed to the computers, servers, or other network devices may be stored locally and/or remotely, as appropriate. Where a system includes computing devices, each such device can include hardware elements that may be electrically coupled via a bus, the elements including, for example, at least one central processing unit (CPU), at least one input device (e.g., a mouse, keyboard, controller, touch screen, or keypad), and at least one output device (e.g., a display device, printer, or speaker). Such a system may also include one or more storage devices, such as disk drives, optical storage devices, and solid-state storage devices such as random access memory (“RAM”) or read-only memory (“ROM”), as well as removable media devices, memory cards, flash cards, etc.


Such devices also can include a computer-readable storage media reader, a communications device (e.g., a modem, a network card (wireless or wired), an infrared communication device, etc.), and working memory as described above. The computer-readable storage media reader can be connected with, or configured to receive, a computer-readable storage medium, representing remote, local, fixed, and/or removable storage devices as well as storage media for temporarily and/or more permanently containing, storing, transmitting, and retrieving computer-readable information. The system and various devices also typically will include a number of software applications, modules, services, or other elements located within at least one working memory device, including an operating system and application programs, such as a client application or Web browser. It should be appreciated that alternate embodiments may have numerous variations from that described above. For example, customized hardware might also be used and/or particular elements might be implemented in hardware, software (including portable software, such as applets), or both. Further, connection to other computing devices such as network input/output devices may be employed.


Non-transient storage media and computer readable media for containing code, or portions of code, can include any appropriate media known or used in the art, including storage media and communication media, such as but not limited to volatile and non-volatile, removable and non-removable media implemented in any method or technology for storage and/or transmission of information such as computer readable instructions, data structures, program modules, or other data, including RAM, ROM, EEPROM, flash memory or other memory technology, CD-ROM, digital versatile disk (DVD) or other optical storage, magnetic cassettes, magnetic tape, magnetic disk storage or other magnetic storage devices, or any other medium which can be used to store the desired information and which can be accessed by the a system device. Based on the disclosure and teachings provided herein, a person of ordinary skill in the art will appreciate other ways and/or methods to implement the various embodiments.


A computer-readable medium may comprise, but is not limited to, an electronic, optical, magnetic, or other storage device capable of providing a processor with computer-readable instructions. Other examples include, but are not limited to, a floppy disk, CD-ROM, DVD, magnetic disk, memory chip, ROM, RAM, SRAM, DRAM, content-addressable memory (“CAM”), DDR, flash memory such as NAND flash or NOR flash, an ASIC, a configured processor, optical storage, magnetic tape or other magnetic storage, or any other medium from which a computer processor can read instructions. In one embodiment, the computing device may comprise a single type of computer-readable medium such as random access memory (RAM). In other embodiments, the computing device may comprise two or more types of computer-readable medium such as random access memory (RAM), a disk drive, and cache. The computing device may be in communication with one or more external computer-readable mediums such as an external hard disk drive or an external DVD or Blu-Ray drive.


As discussed above, the embodiment comprises a processor which is configured to execute computer-executable program instructions and/or to access information stored in memory. The instructions may comprise processor-specific instructions generated by a compiler and/or an interpreter from code written in any suitable computer-programming language including, for example, C, C++, C#, Visual Basic, Java, Python, Perl, JavaScript, and ActionScript (Adobe Systems, Mountain View, Calif.). In an embodiment, the computing device comprises a single processor. In other embodiments, the device comprises two or more processors. Such processors may comprise a microprocessor, a digital signal processor (DSP), an application-specific integrated circuit (ASIC), field programmable gate arrays (FPGAs), and state machines. Such processors may further comprise programmable electronic devices such as PLCs, programmable interrupt controllers (PICs), programmable logic devices (PLDs), programmable read-only memories (PROMs), electronically programmable read-only memories (EPROMs or EEPROMs), or other similar devices.


The computing device comprises a network interface. In some embodiments, the network interface is configured for communicating via wired or wireless communication links. For example, the network interface may allow for communication over networks via Ethernet, IEEE 802.11 (Wi-Fi), 802.16 (Wi-Max), Bluetooth, infrared, etc. As another example, network interface may allow for communication over networks such as CDMA, GSM, UMTS, or other cellular communication networks. In some embodiments, the network interface may allow for point-to-point connections with another device, such as via the Universal Serial Bus (USB), 1394 FireWire, serial or parallel connections, or similar interfaces. Some embodiments of suitable computing devices may comprise two or more network interfaces for communication over one or more networks. In some embodiments, the computing device may include a data store in addition to or in place of a network interface.


Some embodiments of suitable computing devices may comprise or be in communication with a number of external or internal devices such as a mouse, a CD-ROM, DVD, a keyboard, a display, audio speakers, one or more microphones, or any other input or output devices. For example, the computing device may be in communication with various user interface devices and a display. The display may use any suitable technology including, but not limited to, LCD, LED, CRT, and the like.


The set of instructions for execution by the computer system may include various commands that instruct the processing machine to perform specific tasks such as the steps that constitute the method of the present technique. The set of instructions may be in the form of a software program. Further, the software may be in the form of a collection of separate programs, a program module with a larger program or a portion of a program module, as in the present technique. The software may also include modular programming in the form of object-oriented programming. The processing of input data by the processing machine may be in response to user commands, results of previous processing, or a request made by another processing machine.


While the present invention has been disclosed with references to certain embodiments, numerous modifications, alterations and changes to the described embodiments are possible without departing from the scope and spirit of the present invention, as defined in the appended claims. Accordingly, it is intended that the present invention not be limited to the described embodiments, but that it have the full scope defined by the language of the following claims, and equivalents thereof.


EXAMPLES

The following examples describe detection of a low number of cells, even a single bacterium, in a shortened time to results and are to illustrate but not limit the invention.


Example 1. Creation of Recombinant MDP for Detecting Staphylococcus aureus

A gene fragment encoding a CBC was isolated from Staphylococcus phage Twort (GenBank: CAA 69021.1), reverse translated to DNA, and commercially synthesized for cloning into a NANOLUC® fusion plasmid. The His-NANOLUC-pET-15b fusion plasmid was created by mutation of the stop codon and insertion of a restriction endonuclease XhoI site via site-directed mutagenesis. The CBC gene fragment encoding 75 amino acids was then cloned into the BamHI-XhoI restriction enzyme sites of the HIS-NANOLUC-pET15b plasmid, resulting in an N-terminal NANOLUC®-S. aureus CBC construct (MDP). The NANOLUC®-CBC construct was transformed into the E. coli strain BL21(DE3) pLysS. The transformed cells were cultured in liquid Luria-Bertani (LB) medium at 37° C. to an optical density (OD) of 0.5-1.0. Expression of the MDP was induced by the addition of Isopropyl β-D-1-thiogalactopyranoside (IPTG). The culture was shaken while incubating for 5 hours at 37° C.


Example 2. Bacterial Detection Via MDP Using Spin Column Filters

In an example experiment, S. aureus A300 was grown in Luria-Bertani broth (LB) at 37° C. with shaking. NANOLUC®-CBC were diluted to 1 μg/ml.


For each 1 mL of sample, 0.1 mL was added to filters in triplicate. Filters were spun at 600 g for 1 minute. Next, 40 μL of each of NANOLUC®-CBC fusion proteins was added to each filter, followed by incubation for 15 min at room temperature. Filters were washed twice by addition of 400 μL PBS, followed by centrifugation at 600 g for 1 minute. Next 150 μL LB was added and the suspension was transferred to a LUMITRAC® 200 96-well luminometer plate, and a luciferase assay was performed in a Promega luminometer with injection of 100 μL NANO-GLO®. The signal to background ratio was obtained by dividing each well's signal by the average of signal from zero cell controls.


Example 3 Bacterial Detection Via MDP Using 96-Well Filter Plates

NANOLUC®-CBC fusion proteins were diluted to 1 μg/ml. For each sample, 0.150 mL was added to multiple wells in a 96-well filter plate. The 96-well filter plate was spun at 1200 rpm (263 rcf) for 3 minutes. Next 100 μL of 1 μg/ml NANOLUC®-CBC MDP was added to each filter and incubated for 15 minutes at room temperature. The cells were washed twice by addition of 300 μL PBS followed by centrifugation at 600 g for 1 minute to remove unbound MDP. The luciferase assay was performed directly in the original filter plate with 100 μL NANO-GLO® injection using a Promega Luminometer, and plates were read 3 minutes after the addition of the NANO-GLO® substrate. Signal to background ratios were obtained by dividing each well's signal by the average of signal from zero cell controls.


Example 4 Listeria Detection Via MDP Using 96-Well Plates

NANOLUC®-CBC fusion proteins are diluted to 1 μg/ml. 100 μL samples are transferred to a 96 well plate coated with GtxListeria. The minimum cell concentration for samples is 10 cells/ml. Samples with cell concentrations less than 10 cells/mL are enriched prior to testing. Samples are then incubated in the 96 well plate for 30 minutes at 30° C. Following incubation, the plate is washed 3× with 300 ul PBS. Next, 100 μL of 1 ug/ml NANOLUC®-CBC MDP is added to each well and incubates for 15 minutes at room temperature. The cells are washed twice by addition of 300 μL PBS to remove unbound MDP. The luciferase assay is performed directly in the original plate with 100 μL NANO-GLO® injection using a Promega Luminometer, and plates are read 3 minutes after the addition of the NANO-GLO® substrate. Signal to background ratios are obtained by dividing each well's signal by the average of signal from zero cell controls.


Example 5. Detect Microorganism of Interest in Bacterial Culture

This example demonstrates that using the apparatus is able to detect bacteria present in a bacterial culture.


Assembling the Apparatus


100 μl A511/P100 Phage cocktail (1.2×10e9 Pfu/mL) and 100 μl BHI media +1 mM CaCl2 were added into top bulb of the apparatus (first compartment). A511/p100 phage is a phage that targets Listeria moncytogenes. A solid support press was used to press top components of the apparatus together. The apparatus tube was filled with 900 ul BHI media+1 mM CaCl2. The solid support was then placed in the apparatus tube to absorb some media. The assembled apparatus (containing solid support soaked in media) were then kept overnight at 4° C.


Growing the Bacteria Culture



Listeria moncytogenes were grown overnight in BHI media (Beckton Dickinson, Sparks, Md., USA in a shaking incubator. The overnight culture was then subcultured in BHI media to log phase at 37° C. Log phase cells were then diluted to appropriate number of cells (see FIG. 3). The solid support was removed from the apparatus and diluted cultures were spiked onto the solid support at the indicated CFU levels The solid support that were spiked with bacteria or media alone (control) were placed back into the apparatus tube and the tube was gently shaken to mix the content. (FIG. 3, Table 1)


In a similar experimental, 2 solid support was spiked with 10 CFU each of the bacteria. An uninoculated sample was used as a control. These samples were incubated overnight at 35° C. to expand the bacteria number before infection and substrate exposure (FIG. 3, Table 2)


Infection


The Snap-Valve was then broken by holding solid support firmly and breaking valve with thumb and forefinger. The phage (200 ul of 6×10e8 Pfu/mL) was expelled down by squeezing the bulb on the top of solid support tube. The contents in the solid support tube was gently mixed by swirling. The solid support was then placed in 30° C. incubator for 4 hours for phage infection of the bacteria. The NanoGlo substrate (Promega, Madison, Wis.) was diluted 1:4 with 70% ethanol and 10 ul diluted substrate was added into solid support tube. The content of the apparatus tube was mixed by vortexing and then let sit for 3 minutes.


Detection


Three detection methods were used. The solid support tube was inserted into Hygiena Handheld Luminometer. 1 mL of the infection mixture was removed and transferred to 1.5 mL microfuge tube to read on GloMax 20/20 Luminometer (“GloMax 20/20”), and 150 μl of the infection mixture was transferred to 96-well plate to be read on GloMax Luminometer (“GloMax”),


The detection was then performed with solid supports that have been soaked in media overnight, with an infection time of 2 hours. The results are shown in FIG. 5, Tables 1 and 2. and the graphic representations of the results are shown in FIGS. 4A and 4B. The results show that with no growth enrichment (no overnight culturing of the sample before capturing with the solid support), the test is sensitive enough to detect 25,000 CFU on a Hygiena Handheld luminometer (FIG. 4A)—the readings for bacteria inoculated samples were all above the detection threshold of 10 relative luminescence unit (RLU) criteria for positive samples and detect approximately 5,000 CFU on a GloMax 20/20 or a GloMax (FIG. 4B).


Example 6. Detect Microorganism in Turkey Sample

Assemble the Apparatus


The apparatus was assembled as described in Example 1, except that the top bulb was filled with 100 μl SEA1/TSP1 Phage cocktail (1.2×10e7 Pfu/mL) and 100 μl TSB Media (ThermoFisher Oxoid, Grand Islan, N.Y. USA) and the apparatus tube was filled with 1 mL TSB media. SEA1/TSP1 phage is a phage that targets Salmonella.


Bacterial Inoculation of Ground Turkey



Salmonella culture was grown overnight and diluted for high and low CFU samples as described below


25 g test portions of ground turkey were divided into three groups: uninoculated group (5 samples), high inoculated group (5 samples), and low inoculated group (20 samples). Each 25 g sample of the high group was inoculated with 2-10 CFU of Salmonella, and each sample of the low group was inoculated with 0.2-2 CFU of Salmonella. Samples were then placed in filtered sample bags and stored at 4° C. for 48-72 hours.


Enrichment of Bacteria in Inoculated Ground Turkey


Pre-warmed TSB media (41° C.) was added to each sample at a sample to medium ratio of 1:3. The sample was then blended on STOMACHER® for 30 seconds on high, and then incubated at 41° C. without shaking for 24 hours to enrich the bacteria in the sample.


Sampling


The test sample was obtained by dipping the solid support into each enriched sample and swirling around for 10 seconds to absorb maximum amount of sample. The solid support was placed into the apparatus tube filled with TSB media. The tube was gently shaken to mix the contents in the tube, and then either immediately infected or placed in 37° C. for an additional hour before infection.


Infection


The Snap-Valve of the compartment housing the bacteriophage was then broken by holding solid support firmly and breaking valve with thumb and forefinger. The phage (200 μl of 6×10e6 Pfu/mL) was expelled down into the tube by squeezing the bulb on the top of apparatus tube. The contents in the apparatus tube was gently mixed by swirling. The solid support was then placed in 37° C. incubator for 30 min or 2 hours for phage infection of the bacteria. The NanoGlo substrate (Promega, Madison, Wis.) was diluted 1:4 with 70% ethanol and 10 μl diluted substrate was added into the apparatus tube. The content of the apparatus tube was mixed by vortexing and then let sit for 3 minutes. The signals were detected as described in Example 1. The results from uninoculated samples (control group) are shown in Table 3 and inoculated samples (experimental group) are shown in Table 4. The graphic representation of the results are show in FIG. 6A and FIG. 6B.


The results show that each of the three detection devices used were able to detect all turkey samples that were positive for Salmonella after a 24 hour culture enrichment. Signal from GloMax and GloMax 20/20 were much higher than Hygiena Luminometer. Incubation time (i.e., incubation of the solid support that has captured the bacteria with the media before infection) and infection time are factors that may affect the signal intensity. Of the various additional incubation times and infection times tested, 0 hour incubation time and 2 hour infection time resulted in the highest RLUs followed by samples that have 1 hour incubation time and 0.5 hour infection time, and then by samples that have 0 hour incubation time and 0.5 hour infection time. The results also show that 0 hour incubation and 2 hour infection has the lowest background signal.


Example 7. Additional Studies for Testing Effect of Infection Time on Sensitivity of the Assay

The experiment was set up as described in Example 2, except that after the solid support was dipped into the bacterial turkey sample, the solid support was placed in media and infection is performed immediately, i.e., no incubation time for the bacteria on the solid support to grow. The infection time varied from 30 min to 2 hour. The signals were detected as described above. The results of three samples are shown in FIG. 7 and the data are plotted in FIG. 8A-8C. The results show that infection of 2 hours can increase signal as indicated in samples 24 and 26 did not show signal in Hygiena at 30 min but did for 2 hour infection.



FIG. 9A-9C shows comparison between the GloMax and the GloMax 20/20 different devices. GloMax and GloMax 20/20 showed similar results.


Example 8. Testing L. monocytogenes 19115 Environmental Sponge Samples


L. monocytogenes were inoculated onto ceramic tiles surfaces and allowed to dry and sit at room temperature for 18-24 hours. Sample sponges were used to swab the ceramic tiles and sponges were placed into a bag for enrichment for 24 hours at 35° C. The solid support was then used to sample the enriched samples as described in Example 2. 100 μl Listeria phages (at a concentration of 1.2×10e8 PFU/ml) were used to infect the bacterial turkey culture for one hour at 30° C. The signals were detected using GloMax and Hygiena. The results were shown in FIG. 10. The results show that Hygiena handheld can detect L. moncytogenes-contaminated environmental sample.


Example 9. Different Detection Devices

Experiments were set up as described in Example 2. The phage infection time was 1 hour at 37° C. The signals were read on GloMax, a 3M handheld luminometer (“3M”), and Hygiena the results are shown in FIG. 11. It shows that 3M is more sensitive in detecting signals.


Example 10. Creation of CBC for Detecting Microorganisms

A gene fragment encoding a CBD from endolysin (NCBI accession YP_001468459) was obtained by performing PCR on genomic DNA from A511 phage using forward primer: tttagcgggcagtagcggagggTATGCTTACTTAAGCTCATG and reverse primer: tcgtcagtcagtcacgatgcTTATTTTTTGATAACTGCTCCTG. The sequence was then subcloned into pGEX4T-3 expression vector using Gibson Assembly following manufacturer's instructions to produce a GST-A511-CBD fusion protein. The map of the GST-A511-CBD expression plasmid is shown in FIG. 16. The construct encoding the CBD of endolysin was then transformed into the E. coli strain BL21(DE3) pLysS. The transformed cells were cultured in liquid Luria-Bertani (LB) medium at 37° C. to an optical density (OD) of 0.5-1.0. Expression of the CBC was induced by the addition of Isopropyl β-D-1-thiogalactopyranoside (IPTG). The culture incubated for 5 hours at 25° C. with shaking.


Cells were harvested from the culture and lysed and the GST-A511-CBD fusion protein were purified using GE glutathione sepharose 4B resin. The elution fractions from the resin were pooled and protein concentrations were detected at 280 nm and aliquoted and stored at −20° C.


The GST-A511-CBD protein was then biotinylated and used to bind streptavidin magnetic beads (Dynabead M-280 Streptavidin beads).


Example 11. Detecting Microorganisms Using a Bead as the Solid Support

1-2 ml of Listeria monocytogenes contaminated turkey sample prepared as described in Example 1 is transferred to a tube. The bead that is coated with the CBD of the endolysin protein as described above is dipped into the sample. The bead is kept in the sample for a period of time in order to capture maximum amount of bacteria. The bead is then transferred back to the apparatus tube and media is added. Solid support can either be incubated in the media to expand the number of bacteria or phage can be added to start infection cycle. After infection cycle is completed, substrate is added and sample is read in a handheld luminometer.












Illustrative sequences















SEQ ID NO: 1 endolysin (YP_001468459)


MVKYTVENKIIAGLPKGKLKGANFVIAHETANSKSTIDNEVSYMTRNWKN





AFVTHFVGGGGRVVQVANVNYVSWGAGQYANSYSYAQVELCRTSNATTFK





KDYEVYCQLLVDLAKKAGIPITLDSGSKTSDKGIKSHKWVADKLGGTTHQ







embedded image






embedded image






embedded image






embedded image







SEQ ID NO: 2 the CBD domain of endolysin




embedded image






embedded image






embedded image






embedded image










Claims
  • 1. A method to capture and detect as few as a single microorganism of interest in a sample comprising the steps of: incubating the sample with a plurality of microorganism detection probes (MDPs) that bind the microorganism of interest, wherein the MDP comprises an indicator moiety and a cell binding component (CBC) under conditions such that the microorganism binds the plurality of MDPs;separating unbound MDP from cell-bound MDP; anddetecting the indicator moiety on the cell-bound MDP, wherein positive detection of the indicator moiety indicates that the microorganism of interest is present in the sample.
  • 2. (canceled)
  • 3. The method of claim 1, wherein the CBC is specific for Gram-negative bacteria.
  • 4. The method of claim 1, wherein the CBC is specific for Gram-positive bacteria.
  • 5. The method of claim 3, wherein the Gram-negative bacterium is a Salmonella spp or E. coli O157:H7.
  • 6. The method of claim 4, wherein the Gram-positive bacterium is a Listeria spp or Staphylococcus spp.
  • 7.-9. (canceled)
  • 10. The method of claim 1, wherein the CBC is isolated from an endolysin.
  • 11. (canceled)
  • 12. The method of claim 1, wherein a binding domain has ≥95% homology to the CBC of at least one of the following bacteriophages: Salmonella phage SPN1S, Salmonella phage 10, Salmonella phage epsilon15, Salmonella phage SEA1, Salmonella phage Spn1s, Salmonella phage P22, Listeria phage LipZ5, Listeria phage P40, Listeria phage vB_LmoM_AG20, Listeria phage P70, Listeria phage A511, Staphylococcus phage P4 W, Staphylococcus phage K, Staphylococcus phage Twort, Staphylococcus phage SA97, or Escherichia coli O157:H7 phage CBA120.
  • 13. The method of claim 1, wherein the separating comprises capturing the microorganism of interest on a solid support.
  • 14.-26. (canceled)
  • 27. A recombinant microorganism detection probe (MDP) comprising a cell binding component (CBC) and an indicator moiety.
  • 28.-42. (canceled)
  • 43. A method of preparing the recombinant MDP of claim 27 comprising: generating a CBC that is substantially identical to at least one of an endolysin gene, spanin gene, or tail fiber gene of a wild-type bacteriophage or group of bacteriophages that specifically infects a target pathogenic bacterium;preparing a fusion gene of the CBC with an indicator moiety, wherein the fusion protein product is the recombinant MDP;transforming an expression vector with the fusion gene to synthesize the recombinant MDP; andpurifying the recombinant MDP.
  • 44. A kit for detecting Listeria, Salmonella, Staphylococcus, or E. coli O157:H7, comprising a recombinant MDP of claim 27.
  • 45. (canceled)
  • 46. A system for detecting Listeria, Salmonella, Staphylococcus, or E. coli O157:H7 comprising a recombinant MDP according to claim 27.
  • 47. A method to detect one or more microorganism of interest in a sample comprising the steps of: contacting the sample with a solid support of an apparatus, wherein the solid support captures the one or more microorganisms in the sample, if present,wherein the apparatus comprises: a first compartment comprising recombinant bacteriophage having a genetic construct inserted into a bacteriophage genome, wherein the construct comprises a promoter and an indicator gene;contacting the recombinant bacteriophage from the first compartment with the sample such that the recombinant bacteriophage infect the one or more microorganisms in the sample, thereby producing indicator gene product, anddetecting the indicator gene product.
  • 48. The method of claim 47, wherein the apparatus further comprises a second compartment comprising a substrate, and wherein detecting the indicator gene product is by contacting the indicator gene product with a substrate.
  • 49. (canceled)
  • 50. The method of claim 47, wherein the solid support comprises polyethylene (PE), polypropylene (PP), polystyrene (PS), polylactic acid (PLA) and polyvinyl chloride (PVC).
  • 51. The method of claim 47, wherein the solid support comprises one or more molecules of a cell binding component (CBC), wherein the CBC recognizes the one or more microorganism of interest in the sample.
  • 52.-58. (canceled)
  • 59. The method of claim 0, wherein the CBC is isolated from an endolysin.
  • 60. (canceled)
  • 61. The method of claim 47, wherein the apparatus further comprises a second compartment containing substrate, and wherein the method further comprises: adding the substrate from the second compartment to the sample, concurrently with or after adding the recombinant bacteriophage.
  • 62.-79. (canceled)
  • 80. A method to detect one or more microorganism of interest in a sample comprising the steps of: contacting the sample with a solid support of an apparatus, wherein the solid support captures the one or more microorganisms in the sample, if present,wherein the apparatus comprises: a first compartment comprising the MDP of claim 1,contacting the MDP from the first compartment with the sample, and detecting the indicator gene product.
  • 81. A system for detecting microorganism of interest in a sample comprising: an apparatus comprising: a first compartment comprising recombinant bacteriophage having a genetic construct inserted into a bacteriophage genome, wherein the construct comprises a promoter and an indicator gene;wherein the solid support comprises a cell binding component, anda signal detecting component, wherein the signal detecting component can detect the indicator gene product produced from infecting the sample with the recombinant bacteriophage.
  • 82. (canceled)
CROSS REFERENCE TO RELATED APPLICATION

The present application claims priority to U.S. provisional Application No. 62/640,793, filed on Mar. 9, 2018 and 62/798,980, filed on Jan. 30, 2019. The disclosures of U.S. application Ser. Nos. 13/773,339, 14/625,481, 15/263,619, 15/409,258 and U.S. provisional Application Nos. 62/616,956, 62/628,616, 62/661,739, 62/640,793, and 62/798,980 are hereby incorporated by reference in their entirety herein.

Provisional Applications (2)
Number Date Country
62640793 Mar 2018 US
62798980 Jan 2019 US