The instant application contains a Sequence Listing which has been submitted in ASCII format via EFS-Web and is hereby incorporated by reference in its entirety. Said ASCII copy, created on May 27, 2020 is named P1322WO00_SEQLISTING_06-17-2020_ST25 and is 385,059 bytes in size.
Plant breeding and genetic engineering have been used now for many decades to improve plant performance and provide agricultural improvement of plants especially crop plants. A drawback in plant transformation techniques is the low regeneration efficiency of certain plants, including low efficiency in select plant genus and species and even particular genotypes within a plant species. Therefore, there is a need to improve regeneration efficiency of plants.
The present methods are to improving plant regeneration efficiency. The methods employ introducing into one or more plant cells a Growth Regulating Factor (GRF) and/or GRF-Interacting Factor protein (GIF) that are introduced into a plant cell, or a GRF-GIF chimera introduced into a plant cell. Introducing a nucleic acid molecule encoding the polypeptides or introducing the polypeptides increases regeneration efficiency. In certain embodiments, the methods increase regeneration efficiency of low regeneration efficiency plants. Other embodiments provide for accelerating the time to produce transgenic plants. Embodiments provide for mutating the miR396 target region of the GRF sequence, to reduce repression of the GRF protein by miR396 in plant cells. Still further embodiments provide that the presence of the GRF, and GIF or GRF-GIF chimera polypeptide in the plant cell allows the cell to be regenerated on media that has cytokinin concentration too low for regeneration of plant cells that do not comprise the polypeptides so introduced. Plants may be selected on such media without the need of an additional marker sequence. In certain embodiments, plants transformed with GRF and/or GIF or GRF-GIF that have high regeneration efficiency are used for subsequent transformation experiments. Operably linking the GRF, GIF or GRF-GIF chimera to an inducible promoter or domain also allows for selection of timing of expression or activity of the polypeptides. In certain embodiments, plants transformed with GRF and/or GIF or GRF-GIF that have high regeneration efficiency are used for subsequent transformation experiments. Still further embodiments provide that the GRF, GIF or GRF-GIF chimera are combined with gene editing technologies, and that the GRF, GIF or GRF-GIF chimera together with the gene editing constructs may be removed by segregation in the progeny of the edited plant.
This disclosure relates generally to methods of plant regeneration. More specifically, this disclosure relates to methods for improving plant regeneration efficiency by transformation with a Growth-Regulating Factor (GRF) and/or a GRF-Interacting Factor (GIF), or a GRF-GIF chimera.
The present disclosure provides methods of using Growth-Regulating Factor proteins (GRFs) and GRF-Interacting Factor proteins (GIFs), either alone or in combination or as a fused chimera, to improve plant regeneration efficiency. The GRF genes belong to a conserved plant-specific family of transcription factors (TFs) (van der Knaap et al., 2000; Kim et al 2003). The GRF family is defined by the presence of the domains QLQ and WRC, which mediate protein-protein and protein-DNA interactions respectively (Kim et al., 2003, Kim and Kende 2004, Horiguchi et al., 2005). The GRF TFs are highly conserved in land plants, and GRF genes have been identified in dicots, monocots, gymnosperms and moss (Omidbakhshfard et al., 2015). These genes are also conserved targets of the microRNA miR396 (Debernardi et al., 2012). GRFs can control the size of many plant organs, and act as promoters of growth by increasing cell proliferation in developing organs (Rodriguez et al., 2010). Loss-of-function mutations in GRFs or downregulation by overexpression of miR396, can significantly reduce plant size in species like Arabidopsis and rice (Horiguchi et al., 2005; Kim et al., 2003; Kim and Kende, 2004; Wang et al., 2011; Liu et al., 2009; Rodriguez et al., 2010; Li S et al., 2016). On the other hand, increased GRF activity can produce larger organs, including larger leaves, grain and roots in Arabidopsis, rice, wheat, and brassicas, among others (Horiguchi et al., 2005; Rodriguez et al., 2010; Debernardi et al., 2014; Beltramino et al., 2018; Li, S. et al. 2018).
The GRF proteins can form complexes and work together with proteins encoded by members of the GIF gene family. GIF proteins do not have a DNA binding domain (Kim and Kende, 2004), but it has been demonstrated that GIF proteins interact with GRFs and with chromatin remodeling complexes in vivo (Debernardi et al., 2014; Vercruyssen et al., 2014). Based on that observation, it was proposed that GIFs could act as co-activators bringing chromatin remodeling complexes to DNA sequences recognized by the GRFs (Debernardi et al., 2014, Vercruyssen et al., 2014). Mutation in GIF genes mimic most of the phenotypes observed in GRF loss-of-function, while overexpression of GIF can promote organ growth and can boost the activity of GRFs (Kim and Kende 2004, Horiguchi et al., 2005; He et al., 2017; Shimano et al., 2018; Zhang et al., 2018; Debernardi et al., 2014). It has been previously observed that when Arabidopsis GRF3 and GIF1 are expressed together as a chimera, they can promote a larger increase of leaf size relative to the individual separate genes (patent WO 2013/102762 A1).
In an embodiment, the plant into which the GRF and/or GIF sequences are introduced is transgenic, that is, one which has had a heterologous nucleic acid molecule or polypeptide introduced, or which has had its genome edited by any of the techniques available including the examples provided herein. Such a heterologous nucleic acid molecule or polypeptide is any which is not naturally found next to the adjacent nucleic acid molecule or where the levels of polypeptide are higher or lower than that of a plant not comprising the heterologous nucleic acid molecule or polypeptide. In another example the nucleic acid molecule or polypeptide may be from another organism. When referring to a heterologous nucleic acid molecule it includes such a molecule linked to the promoter that does not naturally occur with the promoter sequence and/or is modified in genomic locus by human intervention. The nucleotide sequence in an example is heterologous to the promoter sequence, but it may be from any source, and it may be homologous or native and found naturally occurring in the plant cell, or heterologous or foreign to the plant host. Using the methods described here, a plant transformed with a GRF-GIF chimera or the GRF and/or GIF transgenes and the heterologous nucleic acid molecule or polypeptide has increased regeneration efficiency. The present disclosure provides methods that may significantly expand the number of plant species amenable to efficient transformation technology by significantly increasing plant regeneration efficiency. The methods provided herein may also be used to expand the genotypes that can be transformed within a certain crop. In wheat, for example, only a few cultivars including Bobwhite, Fielder and Kronos can be transformed efficiently, and those still show low regeneration efficiency. The ability to transform different genotypes is important for breeding applications, because the ability to transform directly top producing genotypes would eliminate the need of costly and lengthy backcrossing processes. The methods provided herein may be used to accelerate the production of transgenic plants from leaf explants instead of embryos.
In certain embodiments, the present disclosure provides methods of producing a plant having an improved regeneration efficiency. This method comprises the steps of (1) transforming one or more cells of the plant with one or more nucleic acid molecules, wherein the one or more nucleic acid molecules encode a GRF protein, a GIF protein, or a GRF-GIF chimera; and (2) culturing the one or more plant cells in regeneration media. Embodiments provide the GRF and GIF nucleic acid molecule or polypeptide may be introduced separately or may be introduced into the plant as a chimera. Constructs may comprise nucleic acid molecules encoding the chimera or multiple constructs may be introduced in embodiments.
The one or more cells of the plant may be transiently or stably transformed. The cells may be derived from any plant tissue, for example, from a leaf explant, microspore, ovule, etc. The cells may be protoplasts.
Embodiments provide that the time to produce a transgenic plant from the time of transformation is greatly reduced. The time to produce such a plant may be accelerated such that the time to produce the transgenic plant is decreased by five days, ten days, 15 days, 20 days, 25 days, 30 days, or more, or amounts in-between, compared to time to produce a transgenic plant where the GRF/GIF proteins are not introduced into the plant. For example, use of the proteins and nucleic acid molecules encoding same in wheat accelerates the production of transgenic plants from 90 to 60 days.
The term plant or plant material or plant part is used broadly herein to include any plant at any stage of development, or part of a plant, including a plant cutting, a plant cell, a plant cell culture, a plant organ, a plant seed, and a plantlet. A plant cell is the structural and physiological unit of the plant, comprising a protoplast and a cell wall. A plant cell can be in the form of an isolated single cell or aggregate of cells such as a friable callus, or a cultured cell, or can be part of a higher organized unit, for example, a plant tissue, plant organ, or plant. Thus, a plant cell can be a protoplast, a gamete producing cell, or a cell or collection of cells that can regenerate into a whole plant. As such, a seed, which comprises multiple plant cells and is capable of regenerating into a whole plant, is considered a plant cell for purposes of this disclosure. A plant tissue or plant organ can be a seed, protoplast, callus, or any other groups of plant cells that is organized into a structural or functional unit. Particularly useful parts of a plant include harvestable parts and parts useful for propagation of progeny plants. A harvestable part of a plant can be any useful part of a plant, for example, flowers, pollen, seedlings, tubers, leaves, stems, fruit, seeds, roots, and the like. A part of a plant useful for propagation includes, for example, seeds, fruits, cuttings, seedlings, tubers, rootstocks, and the like. The tissue culture will preferably be capable of regenerating plants. Preferably, the regenerable cells in such tissue cultures will be embryos, protoplasts, meristematic cells, callus, pollen, leaves, anthers, roots, root tips, silk, flowers, kernels, ears, cobs, husks or stalks. Still further, provided are plants regenerated from the tissue cultures.
Improved or increased regeneration efficiency refers to increasing the number of plant cells, tissue or plants regenerated from the one or more cells having introduced the GRF, GIF or GRF/GIF chimera. In an embodiment the number of shoot regeneration and embryogenesis is increased. Further embodiments provide the regeneration can occur on media that has cytokinin concentration that is too low for the plant cell to regenerate. Using this type of method, it is possible to select for plants comprising the GRF, GIF or GRF-GIF chimera without the need for a separate marker to identify transformed cells. Plants that can grow on such media will comprise the molecules or proteins. In certain embodiments, the GRF protein can be a wheat GRF1, GRF2, GRF3, GRF4, GRF5, GRF6 or GRF9 polypeptide or the related proteins in other plant species. Embodiments provide in one example the GRF protein is wheat, rice, Arabidopsis, Vitis, Citrus or Capsicum GRF polypeptide. Still further embodiments provide the GRF protein is a wheat GRF4 or a protein that shares significant identity with a wheat GRF4, and the GIF is wheat GIF1 or a protein that shares significant identity with a wheat GIF1. Exemplary embodiments provide the GRF polypeptide may be as shown in any one of SEQ ID NO: 9-23, and 37-39, Examples of GIF sequences are any of those shown at SEQ ID NO: 24-30, 43-44, and 52. In some embodiments, the GRF is at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% identical to the above listed sequences. In some embodiments, the GIF is at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 99% identical to the above listed sequences. In some embodiments, the one or more nucleic acid molecules encode a chimeric GRF-GIF construct in which the GRF portion is at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% identical to a corresponding portion of a wheat GRF4 or other above listed GRF sequences and the GIF portion is at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or at least about 99% identical to the corresponding portion of the above GIF sequences and in an embodiment to the wheat GIF1 sequence. In some embodiments, the one or more nucleic acid molecules encode a chimeric GRF4-GIF1 construct.
In some embodiments, the GRF protein comprises QLQ and WRC domains that are at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99% identical to at least one of the domains as may be found in SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, or SEQ ID NO:22. In other embodiments, the GRF comprises QLQ and WRC domains that are at least 70%, at least 85%, at least 90%, at least 95%, at least 99% identical to at least one of the QLQ domain of at least one of SEQ ID NO: 69-83 and the WRC domain of at least one of SEQ ID NO: 84-95 which are found in the full length GRF sequences of SEQ ID NO:9, SEQ ID NO:10, SEQ ID NO:11, SEQ ID NO:12, SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, or SEQ ID NO:22. In examples, QLQ domains are those as shown in SEQ ID NO: 69-83 and WRC domains are those as shown in SEQ ID NO: 84-95 and having such identity thereto.
In some embodiments, the GIF comprises an SNH domain that is at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99% identical to at least one of SEQ ID NO: 97-103 which are found in the full length GIF sequences of SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, or SEQ ID NO:29 or SEQ ID NO: 133 (Os11g40100); SEQ ID NO: 134 (Os12g31350) or SEQ ID NO: 135 (Os03g52320). Examples of such domains are those found at SEQ ID NO: 97-103, 136 and 137nd having such sequence identity thereto.
In some embodiments, the one or more nucleic acid molecules encoding the GRF comprise one or more mutations in the recognition site of miR396. Further embodiments provided the mutations are silent mutations. Still further embodiments provide the mutations reduce repression of the GRF protein. Yet further embodiments provide the mutations are made to a miR396 target site as shown in wild type sequence of SEQ ID NO: 53 and in one example can produce the modified miR396 of SEQ ID NO: 54.
The term nucleic acid molecule refers to a nucleic acid molecule, which can be a RNA molecule as well as DNA molecule, and can be a molecule that encodes for a desired polypeptide or protein, but also may refer to nucleic acid molecules that do not constitute an entire gene, and which do not necessarily encode a polypeptide or protein. For example, when used in a homologous recombination process, the promoter may be placed in a construct with a sequence that is similar to an area of the chromosome in the plant that may not encode a protein. If desired, the nucleotide sequence of interest can be optimized for plant translation by optimizing the codons used for plants and the sequence around the translational start site for plants. Sequences resulting in potential mRNA instability can also be avoided.
Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g. degenerate codon substitutions) and complementary sequences as well as the sequence explicitly indicated. The term conservatively modified variants applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or conservatively modified variants of the amino acid sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are silent variations and represent one species of conservatively modified variation. Every nucleic acid sequence herein that encodes a polypeptide also, by reference to the genetic code, describes every possible silent variation of the nucleic acid. One of ordinary skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine; and UGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described polypeptide sequence and is within the scope of the products and processes described.
As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant” referred to herein as a “variant” where the alteration results in the substitution of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. See, for example, Davis et al., “Basic Methods in Molecular Biology” Appleton & Lange, Norwalk, Conn. (1994).
The following eight groups each contain amino acids that are conservative substitutions for one another: 1) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (N), Glutamine (Q); 4) Arginine (R), Lysine (K); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., see, e.g., Creighton, Proteins: Structures and Molecular Properties (WH Freeman & Co.; 2nd edition (December 1993)).
In an embodiment the GRF polypeptide or nucleic acid molecule encoding same is selected from a wheat GRF1, GRF2, GRF3, GRF4, GRF5, GRF6, GRF9 polypeptide or nucleic acid molecule encoding same or homolog thereof. An embodiment provides the GIF polypeptide or nucleic acid molecule encoding same is selected from a wheat GIF1, GIF2 or GIF3 polypeptide or nucleic acid molecule encoding same or homolog thereof. Embodiments provide the polypeptide or nucleic acid molecule encoding same is a wheat GRF1, GRF2, GRF3, GRF4, GRF5, GRF6, GRF9 polypeptide or nucleic acid molecule encoding same or a homolog of such wheat polypeptide or nucleic acid molecule encoding same. Further embodiments provide the polypeptide or nucleic acid molecule encoding same is a wheat GIF1, GIF2 or GIF3 polypeptide or nucleic acid molecule encoding same or homolog thereof. A homolog is a gene or polypeptide inherited in different species retaining the same biological function. The GRF family is defined herein and are transcription factors having the conserved QLQ and WRC domains which mediate protein-protein and protein-DNA interactions, are highly conserved in land plants and identified in dicots, monocots, gymnosperms and moss, as discussed herein. GIF proteins interact with GRFs and have a conserved SNH domain. Such GRF and GIF polypeptides have the property of increasing regeneration efficiency, particularly when combined in a chimeric protein. Examples of such homologs are provided herein, such as those found in rice, Citrus, Vitis, Capsicum and Arabidopsis. A person of skill in the art can readily identify such homologs. For example, NCBI provides searching for homologs for a gene or the protein in other organisms. See ncbi.nlm.nih.gov/homologene. Further, such sequences include those that hybridize to the sequences of the GRF and GIF nucleic acid molecules or polypeptides shown herein under stringent hybridization conditions.
Methods of alignment of sequences for comparison are well known in the art. Thus, the determination of percent identity between any two sequences can be accomplished using a mathematical algorithm.
Optimal alignment of sequences for comparison can use any means to analyze sequence identity (homology) known in the art, e.g., by the progressive alignment method of termed “PILEUP” (Morrison, (1997) Mol. Biol. Evol. 14:428-441, as an example of the use of PILEUP); by the local homology algorithm of Smith & Waterman (Adv. Appl. Math. 2: 482 (1981)); by the homology alignment algorithm of Needleman & Wunsch (J. Mol. Biol. 48:443-453 (1970)); by the search for similarity method of Pearson (Proc. Natl. Acad. Sci. USA 85: 2444 (1988)); by computerized implementations of these algorithms (e.g., GAP, BEST FIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.); ClustalW (CLUSTAL in the PC/Gene program by Intelligenetics, Mountain View, Calif., described by, e.g., Higgins (1988), Gene 73: 237-244; Corpet (1988), Nucleic Acids Res. 16:10881-10890; Huang, Computer Applications in the Biosciences 8:155-165 (1992); and Pearson (1994), Methods in Mol. Biol. 24:307-331); Pfam (Sonnhammer (1998), Nucleic Acids Res. 26:322-325); TreeAlign (Hein (1994), Methods Mol. Biol. 25:349-364); MEG-ALIGN, and SAM sequence alignment computer programs; or, by manual visual inspection.
Another example of algorithm that is suitable for determining sequence similarity is the BLAST algorithm, which is described in Altschul et al, (1990) J. Mol. Biol. 215: 403-410. The BLAST programs (Basic Local Alignment Search Tool) of Altschul, S. F., et al., searches under default parameters for identity to sequences contained in the BLAST “GENEMBL” database. A sequence can be analyzed for identity to all publicly available DNA sequences contained in the GENEMBL database using the BLASTN algorithm under the default parameters.
Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information, www.ncbi.nlm.nih.gov/; see also Zhang (1997), Genome Res. 7:649-656 for the “PowerBLAST” variation. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence that either match or satisfy some positive valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al (1990), J. Mol. Biol. 215: 403-410). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T and X determine the sensitivity and speed of the alignment. The BLAST program uses as defaults a wordlength (W) of 11, the BLOSUM62 scoring matrix (see Henikoff (1992), Proc. Natl. Acad. Sci. USA 89:10915-10919) alignments (B) of 50, expectation (E) of 10, M=5, N=−4, and a comparison of both strands. The term BLAST refers to the BLAST algorithm which performs a statistical analysis of the similarity between two sequences; see, e.g., Karlin (1993), Proc. Natl. Acad. Sci. USA 90:5873-5787. One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
In an embodiment, GAP (Global Alignment Program) can be used. GAP uses the algorithm of Needleman and Wunsch (J. Mol. Biol. 48:443-453, 1970) to find the alignment of two complete sequences that maximizes the number of matches and minimizes the number of gaps. Default gap creation penalty values and gap extension penalty values in the commonly used Version 10 of the Wisconsin Package® (Accelrys, Inc., San Diego, Calif.) for protein sequences are 8 and 2, respectively. For nucleotide sequences the default gap creation penalty is 50 while the default gap extension penalty is 3. Percent Similarity is the percent of the symbols that are similar. Symbols that are across from gaps are ignored. A similarity is scored when the scoring matrix value for a pair of symbols is greater than or equal to 0.50, the similarity threshold. A general purpose scoring system is the BLOSUM62 matrix (Henikoff and Henikoff (1993), Proteins 17: 49-61), which is currently the default choice for BLAST programs. BLOSUM62 uses a combination of three matrices to cover all contingencies. Altschul, J. Mol. Biol. 36: 290-300 (1993), herein incorporated by reference in its entirety and is the scoring matrix used in Version 10 of the Wisconsin Package® (Accelrys, Inc., San Diego, Calif.) (see Henikoff & Henikoff (1989) Proc. Natl. Acad. Sci. USA 89:10915).
(c) As used herein, “sequence identity” or “identity” in the context of two nucleic acid sequences makes reference to the residues in the two sequences that are the same when aligned for maximum correspondence over a specified comparison window.
(d) As used herein, “percentage of sequence identity” means the value determined by comparing two optimally aligned sequences over a comparison window, wherein the portion of the polynucleotide sequence in the comparison window may comprise additions or deletions (i.e., gaps) as compared to the reference sequence (which does not comprise additions or deletions) for optimal alignment of the two sequences. The percentage is calculated by determining the number of positions at which the identical nucleic acid base occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the window of comparison, and multiplying the result by 100 to yield the percentage of sequence identity.
When referring to hybridization techniques, all or part of a known nucleotide sequence can be used as a probe that selectively hybridizes to other corresponding nucleotide sequences present in a population of cloned genomic DNA fragments or cDNA fragments (i.e., genomic or cDNA libraries) from a chosen organism. The hybridization probes may be genomic DNA fragments, cDNA fragments, RNA fragments, or other oligonucleotides, and may be labeled with a detectable group such as 32P, or any other detectable marker. Thus, for example, probes for hybridization can be made by labeling synthetic oligonucleotides based on the DNA sequences. Methods for preparation of probes for hybridization and for construction of cDNA and genomic libraries are generally known in the art and are disclosed (Sambrook et al., 2001).
For example, the sequence disclosed herein, or one or more portions thereof, may be used as a probe capable of specifically hybridizing to corresponding sequences. To achieve specific hybridization under a variety of conditions, such probes include sequences that are unique among the sequences to be screened and are preferably at least about 10 nucleotides in length, and most preferably at least about 20 nucleotides in length. Such sequences may alternatively be used to amplify corresponding sequences from a chosen plant by PCR. This technique may be used to isolate sequences from a desired plant or as a diagnostic assay to determine the presence of sequences in a plant. Hybridization techniques include hybridization screening of DNA libraries plated as either plaques or colonies (Sambrook et al., 2001).
Hybridization of such sequences may be carried out under stringent conditions. By “stringent conditions” or “stringent hybridization conditions” is intended conditions under which a probe will hybridize to its target sequence to a detectably greater degree than to other sequences (e.g., at least 2-fold over background). Stringent conditions are sequence-dependent and will be different in different circumstances. By controlling the stringency of the hybridization and/or washing conditions, target sequences that are 100% complementary to the probe can be identified (homologous probing). Alternatively, stringency conditions can be adjusted to allow some mismatching in sequences so that lower degrees of similarity are detected (heterologous probing). Generally, a probe is less than about 1000 nucleotides in length, preferably less than 500 nucleotides in length.
Typically, stringent conditions will be those in which the salt concentration is less than about 1.5 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30° C. for short probes (e.g., 10 to 50 nucleotides) and at least about 60° C. for long probes (e.g., greater than 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. Exemplary low stringency conditions include hybridization with a buffer solution of 30 to 35% formamide, 1 M NaCl, 1% SDS (sodium dodecyl sulphate) at 37° C., and a wash in 1× to 2×SSC (20×SSC=3.0 M NaCl/0.3 M trisodium citrate) at 50 to 55° C. Exemplary moderate stringency conditions include hybridization in 40 to 45% formamide, 1 M NaCl, 1% SDS at 37° C., and a wash in 0.5× to 1×SSC at 55 to 50° C. Exemplary high stringency conditions include hybridization in 50% formamide, 1 M NaCl, 0.1% SDS at 37° C., and a wash in 0.1×SSC at 60 to 65° C.
Specificity is typically the function of post-hybridization washes, the critical factors being the ionic strength and temperature of the final wash solution. For DNA-DNA hybrids, the Tm can be approximated from the equation of Meinkoth and Wahl, Anal. Biochem., 138:267-284 (1984): Tm=81.5° C.+16.6 (log M)+0.41 (% GC)−0.61 (% form)−500/L; where M is the molarity of monovalent cations, % GC is the percentage of guanosine and cytosine nucleotides in the DNA, % form is the percentage of formamide in the hybridization solution, and L is the length of the hybrid in base pairs. The Tm is the temperature (under defined ionic strength and pH) at which 50% of the complementary target sequence hybridizes to a perfectly matched probe. Tm is reduced by about 1° C. for each 1% of mismatching; thus, Tm, hybridization and/or wash conditions can be adjusted to hybridize to sequences of the desired identity. For example, if sequences with ˜90% identity are sought, the Tm can be decreased 10° C. Generally, stringent conditions are selected to be about 5° C. lower than the thermal melting point (Tm) for the specific sequence and its complement at a defined ionic strength and pH. However, severely stringent conditions can utilize a hybridization and/or wash at 1, 2, 3, or 4° C. lower than the thermal melting point (Tm); moderately stringent conditions can utilize a hybridization and/or wash at 6, 7, 8, 9, or 10° C. lower than the thermal melting point (Tm); low stringency conditions can utilize a hybridization and/or wash at 11, 12, 13, 14, 15, or 20° C. lower than the thermal melting point (Tm). Using the equation, hybridization and wash compositions, and desired Tm, those of ordinary skill will understand that variations in the stringency of hybridization and/or wash solutions are inherently described. If the desired degree of mismatching results in a Tm of less than 45° C. (aqueous solution) or 32° C. (formamide solution) it is preferred to increase the SSC concentration so that a higher temperature can be used. An extensive guide to the hybridization of nucleic acids is found in Tijssen (1993) Laboratory Techniques in Biochemistry and Molecular Biology—Hybridization with Nucleic Acid Probes, Part I, Chapter 2 (Elsevier, New York); and Ausubel et al., eds. (1995) Current Protocols in Molecular Biology, Chapter 2 (Greene Publishing and Wiley-Interscience, New York). See Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual (3rd ed., Cold Spring Harbor Laboratory Press, Plainview, N.Y.) and Haymes et al. (1985) In: Nucleic Acid Hybridization, a Practical Approach, IRL Press, Washington, D.C.
The term introduced in the context of inserting a nucleic acid or polypeptide into a cell, includes transfection or transformation or transduction and includes in embodiments reference to the incorporation of a nucleic acid into a eukaryotic or prokaryotic cell where the nucleic acid may be incorporated into the genome of the cell (e.g., chromosome, plasmid, plastid or mitochondrial DNA), converted into an autonomous replicon, or transiently expressed (e.g., transfected mRNA). As discussed below, introduction of proteins into plants can utilize methods such as those described in Example 8.
Various methods of transformation/transfection are available. As newer methods are available to transform crops or other host cells they may be directly applied. Accordingly, a wide variety of methods have been developed to insert a DNA sequence into the genome of a host cell to obtain the transcription or transcript and translation of the sequence to effect phenotypic changes in the organism. Thus, any method which provides for efficient transformation/transfection may be employed. Utilizing the methods here, increased regeneration efficiency is provided.
By way of example without limitation, methods for introducing expression vectors into plant tissue available to one skilled in the art are varied and will depend on the plant selected. Procedures for transforming a wide variety of plant species are well known and described throughout the literature. (See, for example, Miki and McHugh (2004) Biotechnol. 107, 193-232; Klein et al. (1992) Biotechnology (N Y) 10, 286-291; and Weising et al. (1988) Annu. Rev. Genet. 22, 421-477). For example, the DNA construct may be introduced into the genomic DNA of the plant cell using techniques such as microprojectile-mediated delivery (Klein et al. 1992, supra), electroporation (Fromm et al., 1985 Proc. Natl. Acad. Sci. USA 82, 5824-5828), polyethylene glycol (PEG) precipitation (Mathur and Koncz, 1998 Methods Mol. Biol. 82, 267-276), direct gene transfer (WO 85/01856 and EP-A-275 069), in vitro protoplast transformation (U.S. Pat. No. 4,684,611), and microinjection of plant cell protoplasts or embryogenic callus (Crossway, A. (1985) Mol. Gen. Genet. 202, 179-185). Agrobacterium transformation methods of Ishida et al. (1996) and also described in U.S. Pat. No. 5,591,616 are yet another option. Co-cultivation of plant tissue with Agrobacterium tumefaciens is a variation, where the DNA constructs are placed into a binary vector system (Ishida et al., 1996 Nat. Biotechnol. 14, 745-750). The virulence functions of the Agrobacterium tumefaciens host will direct the insertion of the construct into the plant cell DNA when the cell is infected by the bacteria. See, for example, Fraley et al. (1983) Proc. Natl. Acad. Sci. USA, 80, 4803-4807. Agrobacterium is primarily used in dicots, but monocots including maize can be transformed by Agrobacterium. See, for example, U.S. Pat. No. 5,550,318. In one of many variations on the method, Agrobacterium infection of corn can be used with heat shocking of immature embryos (Wilson et al. U.S. Pat. No. 6,420,630) or with antibiotic selection of Type II callus (Wilson et al., U.S. Pat. No. 6,919,494).
Rice transformation is described by Hiei et al. (1994) Plant J. 6, 271-282 and Lee et al. (1991) Proc. Nat. Acad. Sci. USA 88, 6389-6393. Standard methods for transformation of canola are described by Moloney et al. (1989) Plant Cell Reports 8, 238-242. Corn transformation is described by Fromm et al. (1990) Biotechnology (N Y) 8, 833-839 and Gordon-Kamm et al. (1990) supra. Wheat can be transformed by techniques similar to those used for transforming corn or rice. Sorghum transformation is described by Casas et al. (Casas et al. (1993) Transgenic sorghum plants via microprojectile bombardment. Proc. Natl. Acad. Sci. USA 90, 11212-11216) and barley transformation is described by Wan and Lemaux (Wan and Lemaux (1994) Generation of large numbers of independently transformed fertile barley plants. Plant Physiol. 104, 37-48). Soybean transformation is described in a number of publications, including U.S. Pat. No. 5,015,580. In certain embodiments, the regulatory sequence comprises an inducible promoter. In other embodiments the activity of GRF, GIF or the GRF-GIF chimera is regulated by an inducible system. The inducible system may be or may include a glucocorticoid receptor fused to the GRF, GIF or GRF-GIF proteins. Other inducible systems may also be used.
In certain embodiments described herein, the one of more transformed plant cells may be cultured in regeneration media that comprises a suboptimal concentration of exogenous cytokinins. The term “suboptimal concentration” is defined as any concentration that is too low to allow adequate regeneration of plant cells that are not transformed with a GRF-GIF chimera or the GRF and/or GIF transgenes. A suboptimal concentration may be, e.g., less than about 50%, less than about 10%, less than about 5%, less than about 1%, or less than 0.01% of the cytokinin concentration than is typically used for plant regeneration. Cytokinin concentrations can be tested to determine an optimal concentration that permits regeneration of plant cells transformed with the GRF-GIF chimera but that is not sufficient to induce regeneration of non-transgenic plants. This can be used as a positive selection method to identify transgenic shoots without using antibiotic markers.
In certain embodiments, the methods disclosed herein increase regeneration efficiency. Regeneration efficiency refers to the number of plant cells that can be regenerated. The methods provide that efficiency is increased compared to regeneration in which a GRF/GIF polypeptide or nucleotide is not introduced into the plant. The regeneration efficiency can be increased by 1%, 2%, 3%, 4%, 5%, 10%, 15%, 20%, 25%, 30%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 80%, 90% or more or amounts in-between. By way of example without limitation a plant having 10% regeneration efficiency without use of GRF/GIF can be increased to 50-70%. A plant having 1% efficiency can be increased to 10-20% and a plant that has zero regeneration efficiency can be increased to 1-5%.
In some embodiments, the one or more nucleic acid molecules used in the methods disclosed here may, in addition to encoding a GRF and a GIF, encode at least one additional polynucleotide of interest.
The methods disclosed herein may be used in a variety of plants. In certain embodiments, the methods may be used in a plant that has a low regeneration efficiency. In certain embodiments, the plant is a monocot species. In certain other embodiments, the plant is a dicot species. In yet other embodiments, the plant is neither a monocot nor a dicot species. Example species include but are not limited to corn (Zea mays), canola (Brassica napus, Brassica rapa ssp.), alfalfa (Medicago sativa), rice (Oryza sativa), rye (Secale cereale), sorghum (Sorghum bicolor, Sorghum vulgare), sunflower (Helianthus annuus), wheat (Triticum aestivum), Triticale ((x Triticosecale, a cross of wheat and rye), Triticale (x Triticosecale, a cross of wheat and rye), soybean (Glycine max), tobacco (Nicotiana tabacum), potato (Solanum tuberosum), peanuts (Arachis hypogaea), cotton (Gossypium hirsutum), sweet potato (Ipomoea batatus), cassava (Manihot esculenta), coffee (Cofea spp.), coconut (Cocos mucifera), pineapple (Ananas comosus), citrus trees (Citrus spp.), cocoa (Theobroma cacao), tea (Camellia sinensis), banana (Musa spp.), avocado (Persea americana), fig (Ficus casica), guava (Psidium guajava), mango (Mangifera indica), olive (Olea europaea), papaya (Carica papaya), cashew (Anacardium occidentale), macadamia (Macadamia integrifolia), almond (Prunus amygdalus), sugar beets (Beta vulgaris), oats (Avena), barley (Hordeum), vegetables, ornamentals, and conifers. Vegetables include tomatoes (Lycopersicon esculentum), pepper (Capsicum annuum), lettuce (e.g., Lactuca sativa), green beans (Phaseolus vulgaris), lima beans (Phaseolus limensis), peas (Lathyrus spp.) and members of the genus Cucumis such as cucumber (C. sativus), cantaloupe (C. cantalupensis), and musk melon (C. melo). Ornamentals include azalea (Rhododendron spp.), hydrangea (Macrophylla hydrangea), hibiscus (Hibiscus rosasanensis), roses (Rosa spp.), tulips (Tulipa spp.), daffodils (Narcissus spp.), petunias (Petunia hybrida), carnation (Dianthus caryophyllus), poinsettia (Euphorbia pulcherrima), and chrysanthemum. Conifers which may be employed in practicing the present invention include, for example, pines such as loblolly pine (Pinus taeda), slash pine (Pinus elliotii), ponderosa pine (Pinus ponderosa), lodgepole pine (Pinus contotta), and Monterey pine (Pinus radiata); Douglas-fir (Pseudotsuga menziesii); Western hemlock (Tsuga canadensis); Sitka spruce (Picea glauca); redwood (Sequoia sempervirens); true firs such as silver fir (Abies amabilis) and balsam fir (Abies balsamea); and cedars such as Western red cedar (Thuja plicata) and Alaska yellow-cedar (Chamaecyparis nootkatensis).
The plant in preferred embodiments may be selected from a species of Oryza, Gossypium, Glycine, Vitis, Medicago, Juglans, Citrus, Capsicum, Sorghum, Zea, Hordeum or Triticum or other appropriate plant species. In certain embodiments, the plant is Triticum turgidum or Triticum aestivum.
The present disclosure also provides plants that are produced by any of the methods described herein.
The present disclosure provides methods to modulate the expression of GRF and GIF genes in plants to improve regeneration efficiency and to allow regeneration in the absence of exogenous cytokinin. These methods may be practiced by increasing the protein levels and activities of GRF and/or GIF or GRF-GIF chimera in a plant, plant cell, or protoplast.
In some embodiments, the GRF genes and GIF genes may be increased in a plant or plant cell by various means, including using vectors that each have only a GRF gene or a GIF gene, or a vector with a GRF-GIF chimera. The GRF gene may be mutated to render it less sensitive to the repression by miR396. The one or more nucleic acid molecules that encode a Growth-Regulating Factor protein (GRF) and/or a GRF-Interacting Factor protein (GIF) may be operably linked to a regulatory sequence operable in the plant cell. The genes in the vectors may be controlled by various types of promoters, including inducible, tissue-specific, and constitutive promoters. The plant or plant cell may be transformed by various means, including by using Agrobacterium harboring a vector with GRF and GIF genes or bombardment.
Gene editing may be used in combination with the present methods. For example, a vector with GRF and/or GIF, or GRF-GIF chimera and Cas9 may be used for gene editing of a plant or plant cell. The plants or plant cells may be transformed to express the nucleic acids transiently or stably. GRF and/or GIF, or GRF-GIF chimera proteins may be delivered to plants or plant cells to increase regeneration efficiency using methods described by other investigators to deliver CRISPR/Cas9 preassembled ribonucleoprotein complexes (RNPs) (Woo et al., 2015; Subburaj et al., 2016; Malnoy et al., 2016; Kim et al., 2017; Liang et al., 2017; Svitashev et al., 2016; Wolter et al., 2017).
Methods which provides for targeting of a molecule of interest (MOI) to the target site of the target gene may be utilized in the method. The following is provided by way of example rather than limitation. A guide nucleic acid molecule is one that directs the nuclease to the specific cut site in the genome, whether via use of a binding domain, recognition domains, guide RNAs or other mechanisms. The guide nucleic acid molecule is introduced into the cell under conditions appropriate for operation of the guide nucleic acid molecule in directing cleavage to the target locus. A person of skill in the art will have available a number of methods that may be used, the most common utilizing a nuclease to cleave the target region of the gene, along with sequences which will recognize sequences at the target locus and direct cleavage to the locus. Any nuclease that can cleave the phosphodiester bond of a polynucleotide chain may be used in the methods described here. By way of example without limitation, available systems include those utilizing site specific nucleases (SSN) such as ZFNs (Zinc finger nuclease), Whyte, et al. Cell Biology Symposium: Zinc finger nucleases to create custom-designed modifications. J Anim Sci 90, 1111-1117 (2012)); TALENs (Transcription activator-like effector nucleases) (see, Carlson, D. F. et al. Efficient TALEN-mediated gene knockout in animals. Proc Natl Acad Sci USA 109, 17382-17387 (2012); Tan, W. et al. Efficient nonmeiotic allele introgression in livestock using custom endonucleases. Proc Natl Acad Sci USA 110, 16526-16531 (2013); and the CRISPR (Clustered regularly interspaced short palindromic repeats)-associated (Cas) nuclease system (Hai, T., Teng, F., Guo, R., Li, W. & Zhou, Q. One-step generation of knockout pigs by zygote injection of CRISPR/Cas system. Cell Res 24, 372-375 (2014)) that have permitted editing of animal genomes. The use of recombinases such as FLP/FRT as described in U.S. Pat. No. 6,720,475, or CRE/LOX as described in U.S. Pat. No. 5,658,772, can be utilized to integrate a polynucleotide sequence into a specific chromosomal site. Meganucleases have been used for targeting donor polynucleotides into a specific chromosomal location as described in Puchta et al., PNAS USA 93 (1996) pp. 5055-5060. ZFNs work with proteins or domains of proteins binding to a binding domain having a stabilized structure as a result of use a zinc ion. TALENs utilize domains with repeats of amino acids, which can specifically recognize a base pair in a DNA sequence. For a discussion of both systems, see Voytas et al. U.S. Pat. No. 8,697,853, incorporated herein by reference in its entirety. These systems utilize enzymes prepared for each target sequence.
In referring to a target gene or molecule is meant to refer to any nucleic acid molecule within the genome desired to be modified as described or where it is desired to delete or insert a nucleic acid molecule or modify the molecule in some manner. Where the target molecule is a nucleic acid sequence, the target molecule can, for example, be a sequence coding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or a junk DNA).
The term “regeneration” as used herein means generation of a plant or plant cells from another plant or plant cell. This includes the generation of shoots from calli generated from a plant embryo or young leaflets. In some embodiments, plants, plant cells, or protoplasts may be regenerated from plants, plant cells, or protoplasts that have been transformed to have increased GRF and/or GIF or GRF-GIF chimera expression. In some embodiments, plants, plant cells, or protoplasts regenerated from plants, plant cells, or protoplasts that have been transformed to have increased GRF and/or GIF or GRF-GIF chimera expression may be further transformed with at least one additional polypeptide.
In various embodiments, the plant or plant cell may originate from various plant species, including those resistant to transformation, having low regeneration efficiency, and those in Triticum, Vitis, Oryza, Gossypium, Citrus, Capsicum, Sorghum, and Juglans genus.
The present disclosure also provides methods to regenerate a plant or plant cell in the absence of exogenous cytokinins. In certain embodiments, such methods comprise introducing a GRF gene and/or a GIF gene, or a GRF-GIF chimera into plant cells and culturing the cells in medium substantially free of exogenous cytokinins to regenerate a plant. The GRF and GIF genes may be of Triticum aestivum, Triticum turgidum ssp. durum or of another plant species, including those that have low regeneration efficiency or are resistant to transformation.
In various embodiments, a plant may be transformed using vectors that each have only a GRF gene or a GIF gene, a vector with a GRF and GIF as a chimera, or a vector with a GRF and a GIF in a non-chimeric form.
In certain embodiments, the plant is or is considered recalcitrant to regeneration.
The nucleic acid molecule or polypeptide may be introduced into the plant along with other components. As used herein, a nucleotide segment is referred to as operably linked when it is placed into a functional relationship with another DNA segment. For example, DNA for a signal sequence is operably linked to DNA encoding a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it stimulates the transcription of the sequence. Operably linked elements may be contiguous or non-contiguous. When used to refer to the joining of two protein coding regions, by operably linked it is intended that the coding regions are in the same reading frame. Alternatively, the additional gene(s) can be provided on multiple expression cassettes. Such an expression cassette is provided with a plurality of restriction sites and/or recombination sites for insertion of the polynucleotide to be under the transcriptional regulation of the regulatory regions. The expression cassette can include one or more enhancers in addition to a promoter. By enhancer is intended a cis-acting sequence that increases the utilization of a promoter. Such enhancers can be native to a gene or from a heterologous gene. Further, it is recognized that some promoters can contain one or more enhancers or enhancer-like elements. An example of one such enhancer is the 35S enhancer, which can be a single enhancer, or duplicated. See for example, McPherson et al, U.S. Pat. No. 5,322,938.
The terms promoter, promoter region or promoter sequence refer generally to transcriptional regulatory regions of a gene, which may be found at the 5′ or 3′ side of the coding region, or within the coding region, or within introns. Typically, a promoter is a DNA regulatory region capable of binding RNA polymerase in a cell and initiating transcription of a downstream (3′ direction) coding sequence. The typical 5′ promoter sequence is bounded at its 3′ terminus by the transcription initiation site and extends upstream (5′ direction) to include the minimum number of bases or elements necessary to initiate transcription at levels detectable above background. Within the promoter sequence is a transcription initiation site (conveniently defined by mapping with nuclease Si), as well as protein binding domains (consensus sequences) responsible for the binding of RNA polymerase.
Spatial and temporal control is also often important in driving gene expression in plants. For example, selectable and scoreable markers must be expressed at a suitable time and in an appropriate tissue to allow for screening and controlling enzymes and regulatory factors must be produced in metabolically active and physiologically responsive tissues, respectively. Similarly, genes conferring host protection must be expressed in the target tissues for the pathogen or pest, and plant produced protein products should be expressed in tissues suitable for protein accumulation and storage. Furthermore, since certain protein products may have detrimental effects on plant health and yield when expressed in metabolically active plant tissues that are essential for survival and growth, promoters may be favored that are active in the chosen plant storage tissues but show low or no activity in other, non-storage tissues.
In the methods, a number of promoters that direct expression of a nucleic acid molecule in a plant can be employed. Such promoters can be selected from constitutive, chemically-regulated, inducible, tissue-specific, and seed-preferred promoters. Constitutive promoters include, for example, the core CaMV 35S promoter (Odell et al. (1985) Nature 313:810-812); rice actin (McElroy et al. (1990) Plant Cell 2:163-171); ubiquitin (European patent application no. 0 342 926; Christensen et al. (1989) Plant Mol. Biol. 12:619-632 and Christensen et al. (1992) Plant Mol. Biol. 18:675-689); pEMU (Last et al. (1991) Theor. Appl. Genet. 81:581-588); MAS (Velten et al. (1984)EMBO J. 3:2723-2730), the core promoter of the Rsyn7 promoter and other constitutive promoters disclosed in WO 99/43838 and U.S. Pat. No. 6,072,050; to name a few.
A skilled person appreciates a promoter sequence can be modified to provide for a range of expression levels of and operably linked heterologous nucleic acid molecule. Less than the entire promoter region can be utilized and the ability to drive expression retained. However, it is recognized that expression levels of mRNA can be decreased with deletions of portions of the promoter sequence. Thus, the promoter can be modified to be a weak or strong promoter. Generally, by “weak promoter” is intended a promoter that drives expression of a coding sequence at a low level. By “low level” is intended levels of about 1/10,000 transcripts to about 1/100,000 transcripts to about 1/500,000 transcripts. Conversely, a strong promoter drives expression of a coding sequence at a high level, or at about 1/10 transcripts to about 1/100 transcripts to about 1/1,000 transcripts.
Tissue-preferred promoters can be utilized to target enhanced transcription and/or expression within a particular plant tissue. When referring to preferential expression, what is meant is expression at a higher level in the particular plant tissue than in other plant tissue. Examples of these type of promoters include seed preferred expression such as that provided by the phaseolin promoter (Bustos et al. (1989) The Plant Cell Vol. 1, 839-853), and the maize globulin-1 gene, Belanger, et al. (1991) Genetics 129:863-972.
The range of available plant compatible promoters includes inducible promoters. Any inducible promoter can be used in the instant process. See Ward et al. Plant Mol. Biol. 22: 361-366 (1993). Exemplary inducible promoters include ecdysone receptor promoters, U.S. Pat. No. 6,504,082; promoters from the ACE1 system which responds to copper (Mett et al. PNAS 90: 4567-4571 (1993)); In2-1 and In2-2 gene from maize which respond to benzenesulfonamide herbicide safeners (U.S. Pat. No. 5,364,780; Hershey et al., Mol. Gen. Genetics 227: 229-237 (1991) and Gatz et al., Mol. Gen. Genetics 243: 32-38 (1994)) Tet repressor from Tn10 (Gatz et al., Mol. Gen. Genet. 227: 229-237 (1991); or from a steroid hormone gene, the transcriptional activity of which is induced by a glucocorticosteroid hormone. Schena et al., Proc. Natl. Acad. Sci. U.S.A. 88: 10421 (1991); the maize GST promoter, which is activated by hydrophobic electrophilic compounds that are used as pre-emergent herbicides; and the tobacco PR-1a promoter, which is activated by salicylic acid. Other chemical-regulated promoters of interest include steroid-responsive promoters (see, for example, the glucocorticoid-inducible promoter in Schena et al. (1991) Proc. Natl. Acad. Sci. USA 88:10421-10425 and McNellis et al. (1998) Plant J. 14(2):247-257) and tetracycline-inducible and tetracycline-repressible promoters (see, for example, Gatz et al. (1991) Mol. Gen. Genet. 227:229-237, and U.S. Pat. Nos. 5,814,618 and 5,789,156).
A cold responsive regulatory element or a heat shock regulatory element, the transcription of which can be effected in response to exposure to cold or heat, respectively (Takahashi et al., Plant Physiol. 99:383-390, 1992); the promoter of the alcohol dehydrogenase gene (Gerlach et al., PNAS USA 79:2981-2985 (1982); Walker et al., PNAS 84(19):6624-6628 (1987)), inducible by anaerobic conditions; and the light-inducible promoter derived from the pea rbcS gene or pea psaDb gene (Yamamoto et al. (1997) Plant J. 12(2):255-265); a light-inducible regulatory element (Feinbaum et al., Mol. Gen. Genet. 226:449, 1991; Lam and Chua, Science 248:471, 1990; Matsuoka et al. (1993) Proc. Natl. Acad. Sci. USA 90(20):9586-9590; Orozco et al. (1993) Plant Mol. Bio. 23(6):1129-1138), a plant hormone inducible regulatory element (Yamaguchi-Shinozaki et al., Plant Mol. Biol. 15:905, 1990; Kares et al., Plant Mol. Biol. 15:225, 1990), and the like. An inducible regulatory element also can be the promoter of the maize Int-1 or Int-2 gene, which responds to benzenesulfonamide herbicide safeners (Hershey et al., Mol. Gen. Gente. 227:229-237, 1991; Gatz et al., Mol. Gen. Genet. 243:32-38, 1994), and the Tet repressor of transposon Tn10 (Gatz et al., Mol. Gen. Genet. 227:229-237, 1991). Stress inducible promoters include salt/water stress-inducible promoters such as P5CS (Zang et al. (1997) Plant Sciences 129:81-89); cold-inducible promoters, such as, cor15a (Hajela et al. (1990) Plant Physiol. 93:1246-1252), cor15b (Wilhelm et al. (1993) Plant Mol Biol 23:1073-1077), wsc120 (Ouellet et al. (1998) FEBS Lett. 423-324-328), ci7 (Kirch et al. (1997) Plant Mol Biol. 33:897-909), ci21A (Schneider et al. (1997) Plant Physiol. 113:335-45); drought-inducible promoters, such as, Trg-31 (Chaudhary et al (1996) Plant Mol. Biol. 30:1247-57), rd29 (Kasuga et al. (1999) Nature Biotechnology 18:287-291); osmotic inducible promoters, such as Rab17 (Vilardell et al. (1991) Plant Mol. Biol. 17:985-93) and osmotin (Raghothama et al. (1993) Plant Mol Biol 23:1117-28); and heat inducible promoters, such as heat shock proteins (Barros et al. (1992) Plant Mol. 19:665-75; Marrs et al. (1993) Dev. Genet. 14:27-41), smHSP (Waters et al. (1996) J. Experimental Botany 47:325-338), and the heat-shock inducible element from the parsley ubiquitin promoter (WO 03/102198). Other stress-inducible promoters include rip2 (U.S. Pat. No. 5,332,808 and rd29a (Yamaguchi-Shinozaki et al. (1993) Mol. Gen. Genet. 236:331-340). Certain promoters are inducible by wounding, including the Agrobacterium pmas promoter (Guevara-Garcia et al. (1993) Plant J. 4(3):495-505) and the Agrobacterium ORF 13 promoter (Hansen et al., (1997) Mol. Gen. Genet. 254(3):337-343).
In addition, markers that facilitate identification of a plant cell containing the polynucleotide encoding the marker may be employed. Scorable or screenable markers are useful, where presence of the sequence produces a measurable product and can produce the product without destruction of the plant cell. Examples include a β-glucuronidase, or uidA gene (GUS), which encodes an enzyme for which various chromogenic substrates are known (for example, U.S. Pat. Nos. 5,268,463 and 5,599,670); chloramphenicol acetyl transferase (Jefferson et al. (1987) The EMBO Journal vol. 6 No. 13 pp. 3901-3907); alkaline phosphatase. Other screenable markers include the anthocyanin/flavonoid genes in general (See discussion at Taylor and Briggs, (1990) The Plant Cell 2:115-127) including, for example, a R-locus gene, which encodes a product that regulates the production of anthocyanin pigments (red color) in plant tissues (Dellaporta et al., in Chromosome Structure and Function, Kluwer Academic Publishers, Appels and Gustafson eds., pp. 263-282 (1988)); the genes which control biosynthesis of flavonoid pigments, such as the maize C1 gene (Kao et al., (1996) Plant Cell 8: 1171-1179; Scheffler et al. (1994)Mol. Gen. Genet. 242:40-48) and maize C2 (Wienand et al., (1986) Mol. Gen. Genet. 203:202-207); the B gene (Chandler et al., (1989) Plant Cell 1:1175-1183), the p1 gene (Grotewold et al, (1991 Proc. Natl. Acad. Sci USA) 88:4587-4591; Grotewold et al., (1994) Cell 76:543-553; Sidorenko et al., (1999) Plant Mol. Biol. 39:11-19); the bronze locus genes (Ralston et al., (1988) Genetics 119:185-197; Nash et al., (1990) Plant Cell 2(11): 1039-1049), among others. As discussed herein, when using the present invention with a culture media that has lower cytokine levels that necessary for regeneration of the plant cell, use of the GRF or GIF or GRF-GIF chimera may be utilized without an additional selectable marker.
A wide variety of other components such as signal sequences and polyadenylation sequences may be included with the vector as is desired.
The following examples are for illustration only. In light of this disclosure, those of skill in the art will recognize that variations of these examples and other embodiments of the disclosed subject matter are enabled without undue experimentation. In reference to experiments herein, see
In an effort to increase plant biomass to promote increases in grain yield of agriculturally important crops, we tested the effects of GRF, GIF and GRF-GIF chimeras on wheat growth. Transgenic plants that expressed a wheat GRF-GIF chimera under the maize UBIQUITIN promoter were generated. We identified 10 GRFs and 3 GIFs in the wheat genome by Molecular Phylogenetic analysis using the Neighbor-Joining method (
We then transformed the wheat GRF4-GIF1 chimera into tetraploid wheat Kronos (Triticum turgidum ssp. durum) by Agrobacterium-mediated transformation. The plant cells infected with Agrobacterium harboring the GRF4-GIF1 binary vector (a schematic representation of the construct shown in
We next analyzed the frequency of callus pieces regenerating shoots in two independent wheat transformation experiments using the GRF4-GIF1 chimera and two experiments without the chimera. The statistical analysis demonstrated that the average number of callus pieces regenerating shoots was more than 15-fold higher (P=0.0019) in the callus transformed with the GRF4-GIF1 chimera (92.8%±3.2%) than in the callus transformed with constructs without the GRF4-GIF1 chimera (6.0%±2%). The last numbers are representative of Kronos wheat transformations, where usually only one or two shoots are recovered from plates containing 25 callus (
We transferred to soil 26 independent T0 plants to verify the presence of the GRF4-GIF1 chimera. PCR amplification of genomic DNA from the 26 independent T0 plants using primers Fw-GRF4b (5′-CCTCCGACTCCAAGTATTGC-3′) (SEQ ID NO: 104) and Rev-GIF1c (5′-ATCATCAGGTTGGACGGGTA-3′) (SEQ ID NO: 105) confirmed that 23 out of the 26 To plants had the GRF4-GIF1 transgene inserted in the genomic DNA (
Wheat transformation experiments were performed using only GRF4 (SEQ ID NO:1) or only GIF1 (SEQ ID NO:2) in the same pLC41 vector as described for the GRF4-GIF1 chimera. We also observed a significant increase in regeneration efficiency relative to the control (
In wheat, the GRF4-GIF1 chimera resulted in significantly higher regeneration efficiency than either of the two genes alone. It is, however, possible that in other plant species or tissues transformation with only one of these two genes might be sufficient to improve regeneration efficiency to a similar level as for plants transformed with the chimera. For example, if one of these genes is expressed at sufficiently high levels in a particular plant, transformation with the other gene alone could be sufficient to achieve significantly higher regeneration efficiency in that plant.
Clones of five independent GRF4-GIF1 To wheat lines and one DsRed T0 control line were generated and maintained in culture. Very young leaf blades were aseptically dissected under a stereomicroscope and the outer 1-2 whorls of leaves removed. The base of the inner laminas were removed and plated onto a callus induction medium containing auxins to induce callus formation. After 14 days, tissue was sub-cultured to fresh callus induction medium. After an additional 21 days, calli were transferred to shoot regeneration media containing cytokinin. The number of calli regenerating shoots was scored after 28 days.
Leaf explants transformed with the GRF4-GIF1 chimera showed a regeneration efficiency of 55%, which was 2.8-fold higher than the regeneration efficiency in leaf explants transformed with constructs without the GRF4-GIF1 chimera (
In regular transformations, immature embryos were first inoculated with Agrobacterium, and then placed through different media containing different hormones to regenerate the transgenic plants. Initially, a medium containing auxin induces callus formation. Next, the calli are transferred to media containing cytokinin, which promotes shoot development (
The results from
To avoid this potential problem, we generated a modified GRF gene (alone and in the GRF-GIF chimera, SEQ ID NO:34) which has silent mutations in the miR396 target site that render them less sensitive to the repression by miR396 (
In wheat, we did not observe deleterious effects of the GRF4-GIF1 chimera on the plant phenotype, likely because the presence of endogenous miR396 was sufficient to cleave any excess GRF4 generated by expression of the transgene. However, it is possible that in other species the presence of a GRF-GIF chimera could affect the phenotype in undesirable ways. These effects might be more significant when using a GRF variants with mutations in the miR396 target site that render them less sensitive to the repression by miR396.
The ability to control the expression and/or activity of this chimera in plants by using an inducible system could address this possibility. Debernardi and Palatnik (patent application WO 2016/098027 A1) have demonstrated that in Arabidopsis the activity of a similar GRF-GIF chimera can be controlled exogenously by cloning a rat Glucocorticoid Receptor (GR) in the middle of GRF-GIF. The new GRF-GR-GIF chimera is activated only in the presence of the synthetic hormone dexamethasone. Using this strategy, we generated GRF-GR-GIF chimeras for Vitis vinifera (SEQ ID NO:31) and wheat (SEQ ID NO:32 and SEQ ID NO:33), which can be selectively induced only in the transformation media, and will not be active later in the transformed T0 plants or in subsequent generations, avoiding potential effects on plant development.
Additionally, the inducible system would allow the use of hyperactive versions of the GRF4-GIF1 chimera, while limiting potential effects on plant development. For example, the incorporation of synonymous mutations in the miR396 target site of the GRF eliminates the miR396-mediated posttranscriptional repression of the chimera, boosting its expression and probably its activity even in tissues where miR396 is expressed (e.g., leaves). Through the inducible system, the GRF4-GIF1 chimera could be overexpressed only during regeneration. Another option is the use of tissue specific promoters.
It is possible to deliver proteins to plant cells. Targeted mutagenesis was obtained in many plant species by delivering CRISPR/Cas9 preassembled ribonucleoprotein complexes (RNPs) (Woo et al., 2015; Subburaj et al., 2016; Malnoy et al., 2016; Kim et al., 2017; Liang et al., 2017; Svitashev et al., 2016; Wolter et al., 2017). The methods previously described could be performed by delivering GRF, GIF or GRF-GIF chimeric proteins into plants cells. As an example, GRF, GIF or GRF-GIF chimeras could be delivered together with CRISPR/Cas9 RNPs to boost the regeneration of the edited plant cells. After protein delivery, the plant tissues could then be cultured in regeneration media.
Once a plant is transformed with a GRF, GIF or GRF-GIF chimera and acquires high regeneration ability, cells from this plant or its progeny could be further used for transient or stable transformation with vectors other than the GRF, GIF or GRF-GIF chimera vectors. The plant would still have high regeneration ability. The plant cells could then be cultured in regeneration media with either normal or reduced levels of cytokinins.
The methods previously described could be performed with other GRF genes or related nucleotide sequences, e.g., in which the encoded amino acid sequences of QLQ and WRC domains of the GRF proteins are at least about 70%, about 80%, about 90%, or about 95% identical to the sequences of the QLQ and WRC domains of wheat proteins TaGRF1 (SEQ ID NO:9), TaGRF2 (SEQ ID NO:10), TaGRF3 (SEQ ID NO:11), TaGRF4 (SEQ ID NO:12), or TaGRF5 (SEQ ID NO:13), or to Arabidopsis proteins AtGRF3 (SEQ ID NO:19), AtGRF4 (SEQ ID NO:20), AtGRF5 (SEQ ID NO:21), or AtGRF6 (SEQ ID NO:22).
The methods may also be performed using a GRF gene in which the encoded amino acid sequence of the QLQ and WRC domains is at least about 80% similar, about 90% similar, or about 95% similar to the sequences provided in the preceding paragraph.
The percent identity and similarity are calculated by BLASTP using only the concatenated QLQ (underlined below) and WRC domains (in bold below), in the protein sequences presented in this disclosure. An example of a concatenated QLQ-WRC domain (SEQ ID NO: 96) is presented below for wheat TaGRF4 (for which the complete protein sequence is SEQ ID NO:12):
PFTAAQYEELEHQALIYKYLVAGVSVPPDLVLPIR
DPEPGRCRRTD
GKKWRCAKEAASDSKYCERHMHRGRNRSRKPVE
Pairwise comparison of the concatenated QLQ-WRC domains among the five wheat proteins are presented in Table 1. All pairwise comparisons are higher than 70% identical and 80% similar, confirming their similarity and potential overlapping functions.
As an additional example of the conservation of these proteins, we included the comparison between the QLQ-WRC domains from the wheat GRF proteins and the corresponding domains in the orthologous rice (Oryza sativa) proteins. All pairwise comparisons show >70% identity and >80% similar (Table 2). These criteria exclude distantly related GRFs, such as OsGRF10 (LOC_Os02g45570.1), OsGRF11 (LOC_Os07g28430.1), and OsGRF12 (LOC_Os04g48510.1).
As a reference for dicot species, we compared the concatenated QLQ-WRC domains from the closest Arabidopsis GRF protein sequences AtGRF3 (SEQ ID NO:19), AtGRF4 (SEQ ID NO:20), AtGRF5 (SEQ ID NO:21), and AtGRF6 (SEQ ID NO:22) (Table 3). Table 3 shows that these Arabidopsis proteins are at least 70% identical or 80% similar to at least one of the wheat GRF proteins. The relatively high level of similarity found between the critical domains of this group of proteins in highly divergent dicot and monocot plants confirms the conservation of these proteins and the potential overlap in their functions. This potential is also supported by the observation that higher activity of Arabidopsis GRF3 (SEQ ID NO:19) or rice GRF4 (SEQ ID NO:17) due to mutations in the site recognized by miR396 increase seed size in these two distantly related species (Beltramino et al., 2018; Duan et al., 2015; Hu et al., 2015; Che et al., 2015; Sun et al. 2016; Li et al. 2018).
Likewise, the methods of this disclosure could be performed with other GIF genes or related nucleotide sequences, e.g., in which the encoded amino acid sequences of SNH domains of the GIF proteins are at least about 70% identical, about 80%, about 90%, or about 95% to the sequences of the SNH domains of wheat protein TaGIF1 (SEQ ID NO:27), TaGIF2 (SEQ ID NO:28), or TaGIF3 (SEQ ID NO:29), or to the Arabidopsis proteins AtGIF1 (SEQ ID NO:24), AtGIF2 (SEQ ID NO:25), or AtGIF3 (SEQ ID NO:26).
The methods may also be performed using a GIF gene in which the encoded amino acid sequence of the SNH domain is at least about 80% similar, about 90% similar, or about 95% similar to the sequences provided in the preceding paragraph.
A mutation in Arabidopsis GIF1, also known as ANGUSTIFOLIA3 (AN3), causes smaller, narrower leaves and petals, with a reduced number of cells, similar to the phenotypes seen in multiple grf mutants (Kim and Kende 2004; Horiguchi et al. 2005). Single gift and gif3 mutants are similar to wild type plants, suggesting that GIF1 has a larger impact on leaf development than other members of the GIF family (Lee et al. 2009). However, the phenotypes of double mutants gif1,2 or gif1,3 and of the triple mutant gif1,2,3 are more severe, indicating that GIF genes have redundant functions (Lee et al. 2009). In addition, ectopic overexpression of all three GIFs can rescue a mutation in GIF1 (Lee et al. 2009).
Based on the overlapping GIF functions described above, we predict that different GIF paralogs in wheat can have similar effects on the improvement of regeneration efficiency of transgenic plants either alone or as protein chimeras with different GRFs. Therefore, we include in this application Arabidopsis proteins AtGIF1 (SEQ ID NO:24), AtGIF2 (SEQ ID NO:25), AtGIF3 (SEQ ID NO:26) as well as the three closest wheat homologous proteins TaGIF1 (SEQ ID NO:27), TaGIF2 (SEQ ID NO:28), and TaGIF3 (SEQ ID NO:29), and any other plant protein that shows at least 70% identity or 80% similarity for the conserved SNH domain highlighted in the protein sequences described at the end of this document. Comparisons among the SNH domains of the three wheat GIF proteins showed identities of at least 70% and similarities of at least 89% (Table 4).
When the wheat SNH domains were compared with the corresponding SNH domains from Arabidopsis, identities varied between 66% and 91% and similarities between 89 and 96% (Table 5). Each Arabidopsis SNH domain was at least 70% identical or 80% similar to at least one of the three wheat SNH domains (Table 5).
The methods provided in this disclosure may be ideal for use in combination with genome editing since the transgene can be segregated-out after the editing events are completed. This eliminates the risk that the GRF-GIF chimera would negatively affect the plant phenotype. The high transformation efficiency of the disclosed methods could expand the list of plant varieties that would benefit from CRISPR-screens to test panels of mutants in the regulatory and coding regions of important agronomic genes. We have confirmed high regeneration efficiency (
The methods disclosed herein may be used to avoid the use of selectable markers, which are objected to by people opposed to the use of transgenic plants. The ability of the GRF4-GIF1 chimera to regenerate in the absence of cytokinins demonstrates that transgenic cells can be selected from non-transgenic ones by simply eliminating or greatly reducing the concentration of cytokinins.
Materials and Methods for Examples 1 to 12.
Vectors. All cloning PCRs were performed with Phusion High-Fidelity DNA Polymerase (NEB). Cloning reactions were done using the Gateway Cloning technology (Invitrogen). RNA was extracted from spikes using the Spectrum Plant Total RNA Kit (Sigma-Aldrich), treated with RQ1 RNase-free DNase (Promega), and then cDNA synthesis was carried out using SuperScript II Reverse Transcriptase (Invitrogen). To clone the coding region of wheat GRF4 encoding the protein described in (SEQ ID NO:12) and GIF1 encoding the protein described in (SEQ ID NO:27), PCRs were performed on the cDNA generated from Kronos spike. The sequence of the primers specific for GRF4 (Fw-GRF4a/Rev-GRF4a) and GIF1 (Fw-GIF1a/Rev-GIF1a) are indicated in Table 6.
The PCR fragments were first cloned in pDONR by a B/P gateway reaction and transformed into chemical competent E. coli DH5a. The sequence of the clones was confirmed by Sanger sequencing. The GRF4-GIF1 chimera was generated by overlapping PCR. In a first step, GRF4 and GIF1 coding sequences were amplified with primers FW-GRF4a/Rev-GRF4b and Fw-GIF1b/Rev-GIF1b from the pDONR-GRF4 and pDONR-GIF1 clones as template. The primer Rev-GRF4b generates a 3′ end that overlaps 12 nucleotides with the 5′ end of Fw-GIF1b. Those 12 nucleotides generate a bridge of four alanine amino acids between GRF4 and GIF1. Both PCR fragments were gel-purified and used as template in a second PCR with the primers Fw-GRF4/Rev-GIF1b. The sequence of the primers are indicated in Table 6. The resulting product was cloned in pDONR by B/P gateway reaction and transformed into chemical competent E. coli DH5a. The sequence of the vector was validated by Sanger sequencing. Next, the GRF4, the GIF1 and the chimera GRF4-GIF1 genes were cloned in the binary vector pLC41 by a L/R gateway reaction under the maize UBIQUITIN promoter and transformed into chemical competent E. coli DH5a. The resulting vectors for the individual genes pLC41:GRF4 (SEQ ID NO:1) and pLC41:GIF1 (SEQ ID NO:2), and for the chimera pLC41:GRF4-GIF1 (SEQ ID NO:5) were verified by restriction digestion and transformed by electroporation in Agrobacterium EHA105.
The Vitis vinifera VviGRF4-GIF1 chimera (DNA, SEQ ID NO:6), Protein, SEQ ID NO:7) was generated by gene synthesis. The DNA fragment was cloned into pDONR by B/P gateway reaction and transformed into chemical competent E. coli DH5a. The sequence of the vector was validated by Sanger sequencing. Next, the Vitis chimera GRF4-GIF1 was cloned in the binary vector pGWB14 binary vector by a L/R gateway reaction under the viral 35S promoter and transformed into chemical competent E. coli DH5a. The resulting vector pGWB14-VviGRF4-GIF1 (DNA, SEQ ID NO:8) was verified by restriction digestion and transformed by electroporation in agrobacterium EHA105. A dexamethasone inducible version VviGRF4-GR-GIF1 (SEQ ID NO:31) was generated by overlapping PCR.
The wheat dexamethasone inducible GRF4-GR-GIF1 chimera encoding protein (SEQ ID NO:32) was generated by overlapping PCR. In a first step, GRF4, GIF1 and a rat Glucocorticoid Receptor (GR) were amplified with primers FW-GRF4a/Rev-GRF4b, Fw-GIF1-GR/Rev-GIF1b, Fw-GR/Rev-GR. The primer Rev-GRF4b generates a 3′ end that overlap 12 nucleotides with the 5′ end of Fw-GR, and the Rev-GR generates a 3′ end that overlap 12 nucleotides with the 5′ end of Fw-GIF1-GR. Those 12 nucleotides generate a bridge of four alanine amino acids between GRF4 and GR and GR and GIF1. The three PCR fragments were gel-purified and used as template in a second PCR with the primers Fw-GRF4/Rev-GIF1b. The sequence of the primers are indicated in Table 6. The resulting product was cloned in pDONR by B/P gateway reaction and transformed into chemical competent E. coli DH5α. The sequence of the vector was validated by Sanger sequencing. Next, the chimera GRF4-GR-GIF1 was cloned in the binary vector pLC41 by a L/R gateway reaction under the maize UBIQUITIN promoter and transformed into chemical competent E. coli DH5α. The resulting vector pLC41:GRF4-GR-GIF1 (SEQ ID NO:33) was verified by restriction digestion and transformed by electroporation in Agrobacterium EHA105.
A miR396-resistant version of wheat GRF4-GIF1 (rGRF4-GIF1) (SEQ ID NO:34) was generated by overlapping PCR. In a first step, two PCR were performed with primers Fw-GRF4a/rGRF-Rev and rGRF-Fw/Rev-GIF1b using pLC41-GRF4-GIF1 clone as template. The primers rGRF-Fw and rGRF-Rev overlap in 17 nt and introduce silent mutations in the miR396 target site. Both PCR fragments were gel-purified and used as template in a second PCR with the primers Fw-GRF4/Rev-GIF1b. The sequence of the primers are indicated in Table 6. The resulting product was cloned in pDONR by B/P gateway reaction and transformed into chemical competent E. coli DH5α. The sequence of the vector was validated by Sanger sequencing. Next, the chimera rGRF4-GIF1 was cloned in the binary vector pLC41 by a L/R gateway reaction under the maize UBIQUITIN promoter and transformed into chemical competent E. coli DH5α. The resulting vector pLC41:GRF4-GIF1 was verified by restriction digestion and transformed by electroporation in Agrobacterium EHA105. A dexamethasone inducible version rGRF4-GR-GIF1 was generated by overlapping PCR.
To generate the JD635-GRF4-GIF1-Cas9- gRNA-GeneQ vector, a cassette including the maize UBIQUITIN promoter, the GRF4-GIF1 chimera and the Nos terminator was amplified by PCR. The PCR product was gel-purified and cloned by In-fusion (Takara Bio USA, Inc.) into the Asci site of the pYP25F binary vector containing a wheat codon optimized Cas9 (TaCas9) and transformed into chemical competent E. coli DH5α. The vector sequence was validated by Sanger sequencing. Next, a guide RNA construct targeting the coding region of Gene Q was cloned by Golden Gate reaction into two AarI sites of the vector and transformed into chemical competent E. coli DH5α. The resulting JD635-GRF4-GIF1-Cas9-gRNA-GeneQ vector (SEQ ID NO:35) was validated by Sanger sequencing and transformed by electroporation into Agrobacterium EHA105.
Control vectors: The JD518 vector, in pLC41 backbone, contains the GLOSSY promoter driving the expression of LhG4, which is an artificial transcription factor with no targets in wheat. The pOp:FT1 vector, in pLC41 backbone, contains the FT1 coding sequence cloned downstream of pOp, which is an artificial promoter. The pLC41-DsRed in pLC41 backbone, contains the DsRed coding sequence cloned downstream of maize UBIQUITIN promoter.
Wheat transformation. Transgenic wheat plants were initially generated using technology from Japan Tobacco (JT) technology. However, cytokinin concentrations were reduced in some of the later experiments. Two independent experiments were performed for each vector. In each experiment, at least 25 immature embryos from Kronos were transformed using Agrobacterium EHA105 with the pLC41 constructs described before. Selection of transgenic plants was conducted using hygromycin, except in the experiments with reduced cytokinins (
aagcTgccgcGgccATGCAGCAG
aaaaacaaag (SEQ ID NO:
CATGGCCGCGGCAGCTTTTTGAT
GAAACAGAAG (SEQ ID
TCTAGAAAACCGGTCGAAACGCA
GCTCG (SEQ ID NO: 117)
Plant growth conditions. Transgenics plants were grown in PGR15 growth chambers (Conviron) adjusted to 16 h of light (22° C.) and 8 h of darkness (18° C.). Intensity of the sodium halide lights measured at plant heads height was (˜260 μM m−2s−1).
Phylogenetic analysis. The amino acid sequence of the GRF and GIF genes from Arabidopsis and rice were obtained from phytozome (phytozome.jgi.doe.gov/pz/portal.html). The amino acid sequences of wheat GRF and GIF genes were obtained from the wheat genome RefSeq v1.0. The phylogenetic analysis was performed using MEGA6.
Wheat transformation experiments were performed using GRF4-GIF1 chimera (SEQ ID NO:5), GRF4 (SEQ ID NO:1) or GIF1 (SEQ ID NO:2) alone or within the same construct (
We then compared the effect on regeneration efficiency of having the GRF4 and GIF1 fused in a chimera or expressed separately within the same construct by individual Ubi promoters (not fused, SEQ ID NO: 36) (
The GRF and GIF gene families contain several members (
We tested GRF genes from different clades (
We generated chimeras for all the selected GRFs with GIF1 (
Next, we compared the activity of the three wheat GIF genes included in the phylogenetic tree (
We then tested the potential of the GRF4-GIF1 chimera to generate transgenic plants from commercial durum, bread wheat and Triticale lines that were previously recalcitrant to Agrobacterium-mediated or had low regeneration efficiency at the UCD Plant Transformation Facility (
We also tested the wheat GRF4-GIF1 chimera in the rice variety Kitaake. In two independent transformation experiments, we observed a 2 to 3-fold increase in rice regeneration efficiency in the calli transformed with the wheat GRF4-GIF1 chimera (average 40.1±5.4%) compared with those transformed with the control vectors (17.6±5.9%, Table 9C). These results suggest that the wheat GRF4-GIF1 chimera is effective in enhancing regeneration in another agronomically important monocotyledonous species.
We generated an inducible version of the wheat GRF4-GIF1 chimera by cloning a rat Glucocorticoid Receptor (GR) in the middle of GRF4-GIF1 (SEQ ID NO:32, 33) (
In many plant transformation systems cytokinins are required to regenerate shoots (
Based on the previous results, we developed a protocol to select transgenic shoots in auxin media without using antibiotic-based markers. In three experiment we recovered 40 shoots using a GRF4-GIF1 marker-free vector (SEQ ID NO:47) and 15 for the empty vector. Genotyping revealed that 10 out of the 40 (25%) GRF4-GIF1 shoots were transgenic, while none of the control was positive (
The wheat GRF4-GIF1 chimera accelerates the regeneration process, which allowed us to develop a faster wheat transformation protocol that takes 56 days instead of the 91 days required for all the wheat experiments presented in this manuscript (
We performed a series of Citrus transformation experiments to test the effect of the GRF-GIF technology in a dicot crop with limited regeneration efficiency. We generated heterologous citrus (SEQ ID NO:48) and grape (SEQ ID NO: 6-8) GRF4-GIF1 chimeras using the closest homologs to wheat GRF4 (citrus Ciclev10032065m and grape GSVIVT01024326001), and GIF1 (citrus Ciclev10022144m and grape GSVIVT01036262001), in both species (
We also tested the effect of a miR396-resistant grape GRF4-GIF1 version (henceforth, rGRF4-GIF1, SEQ ID NO:50), in which we introduced silent mutations in the GRF binding site for miR396 to avoid cleavage (
We tested the grape rGRF41-GIF1 chimera in grape transformation. The grape transformation process is slow and very laborious requiring 8 to 12 months for generating transgenic plant lines. Pro-embryogenic callus generated from anther filaments of immature flowers were inoculated with agrobacterium harboring the empty vector and the rGRF4-GIF1 vector. After 6 month of culture we observed that 87% of calli transformed with rGRF4-GIF1 regenerated shoots, while only 12% of the control calli produce shoots (
We then tested the GRF-GIF technology in pepper (Capsicum annuum) transformation using the cultivar “R&C cayenne”. In Capsicum annuum, there are two close paralogs of GRF4, designated here as GRF4.1 and GRF4.2, and two close paralogs of GIF1, designated here as GIF1.1 and GIF1.2. We used the GRF4.1 (LOC107869915) and GIF1.1 (LOC107870303) paralogs in the construction of the GRF4.1-GIF1.1 chimera (SEQ ID NO: 138-139), which was cloned into the binary vector pEarleyGate100 that carries BAR selection. For the transformation experiment, we used the basal portion of the cotyledons proximal to the shoot apex, with the petiole still attached. The 40 cotyledon pieces transformed with the pepper GRF4.1-GIF1.1 chimera showed a 23.8% regeneration efficiency, which was 4.76-fold higher than the regeneration efficiency of cotyledon pieces transformed with the empty vector pEarleyGate100 (5.0% regeneration efficiency, Table 11,
Methods for Examples 13 to 20.
Method 1. Vectors Used in the Transformation Experiments.
Wheat vectors. To generate the vector expressing both GRF4 and GRF1 but not fused (Ubi::GRF4-term Ubi::GIF1-term, SEQ ID NO: 36), the complete Ubi::GRF4-term cassette was amplified by PCR using pLC41:GRF4 (SEQ ID NO:1) as template with primers
Fw_HindIII gccactcagcaagctttgcagcgt (SEQ ID NO: 119) and
Rev-HindIII TCACGCTGCAAAGCTCTAATTCCCGATCTAGTAAC (SEQ ID NO: 120). We cloned the PCR fragment in pGEMT-easy and we sub-cloned the Ubi::GRF4-term fragment into the HindIII site of pLC41:GIF1 (SEQ ID NO:2).
To generate the different wheat GRF-GIF chimeras, the coding sequences of GRF1 (SEQ ID NO: 38), GRF5 (SEQ ID NO:37), GRF9 (SEQ ID NO: 39), GIF2 (SEQ ID NO: 43) and GIF3 (SEQ ID NO: 44) were obtained by gene synthesis. Then, the different chimeras (GRF1-GIF1, GRF5-GIF1, GRF9-GIF1, GRF4-GIF2, GRF4-GIF3) were generated by overlapping PCR following the same strategy described to generate GRF4-GIF1. We cloned all the chimeras in pLC41 vector by L/R reaction and verified the vectors by restriction digestion and transformed by electroporation in Agrobacterium strain EHA105.
We generated the citrus GRF4-GIF1 chimera (SEQ ID NO: 48) by gene synthesis and cloned in pDONR. After checking the sequence by Sanger sequencing, we cloned it by L/R reaction into pGWB14 binary vector under the viral 35S promoter and transformed it into chemical competent E. coli DH5α. We verified the resulting vector pGWB14-citrus GRF4-GIF1 (DNA, SEQ ID NO:49) by restriction digestion and transformed by electroporation in Agrobacterium EHA105.
We generated a miR396-resistant version of Vitis GRF4-GIF1 (rGRF4-GIF1) by overlapping PCR. Two PCR reactions were performed with primers
using pGBW14-vitis GRF4-GIF1 clone as template (SEQ ID NO: 8). The primers rGRF-Fw and rGRF-Rev overlap in 17 nucleotides and introduce silent mutations in the miR396 target site (
We generated the pepper GRF4.1-GIF1.1 chimera (SEQ ID: NO: 140) by gene synthesis and cloned it into the binary vector pEarleyGate100 under the 35S promoter. pEarleyGate100 has a BAR selection marker. We transformed the construct, designated pTH1903, in Agrobacterium strain EHA105 by electroporation. As a control, we used the empty vector pEarleyGate100.
Plant Transformation
Method 2. Wheat transformation protocol. Wheat transformation followed previously published protocols. Briefly, we grew the different wheat and triticale cultivars in a growth chamber under long-day photoperiod (16 h of 380 μM m−2s−1 light, 26° C. day and 18° C. night). We harvested immature grains from spikes approximately 2 weeks after anthesis, and surface sterilized for 1 minute in 70% ethanol followed by 10 minutes in 1.2% (v/v) sodium hypochlorite solution plus 5 μl tween. After surface sterilization, we washed the seeds three times with sterilized water and isolated immature embryos under stereoscopic microscope.
We centrifuged the isolated immature embryos in liquid medium and then inoculated with Agrobacterium. We transferred the embryos to co-cultivation medium with the scutellum-side up and incubated at 23° C. in the dark. After 2-3 days, we excised the embryo axis, and transferred them to callus induction medium without selection, where we incubated them at 25° C. in the dark. After 5 days, we transferred the embryos to selection medium with 30 mg/l of hygromycin and incubated them at 25° C. in the dark.
After 3 weeks, we transferred the calli to selection medium that contained 100 mg/l of hygromycin. After an additional 3 weeks, we transferred the proliferating tissue to regeneration medium containing 50 mg/l of hygromycin and incubated them at 25° C. under continuous light (30 μM m−2s−1) for 2 weeks. We transferred the regenerated shoots into rooting medium contained 50 mg/l of hygromycin. Rooted plants were acclimated to soil by transferring them to a 1020 tray containing a 36 sheet inserts filled with Sunshine potting mix and covered with an 11×21×2 inch clear plastic dome for 10 days under 16 hour of 100 μM light and 26° C. More recently, we developed a shorter transformation protocol to generate GRF4-GIF1 transgenic wheat plants that is summarized in
Method 3. Rice transformation protocol. Rice transformation followed previously published protocols (Ishida et al. 2015, Proc. 12th Int. Wheat Genet. Symp. 167-173). Briefly, we selected fresh rice seeds, de-husked them and surface sterilized them in a rotating flask containing 20% (v/v) bleach for 30 min. Then, rinsed the seeds 3 times with sterile water. We placed about 25-50 seeds per plate on callus induction media (MSD, 1× Murashige and Skoog with vitamins medium containing 30 g/l sucrose, 2 mg/l 2,4-dichlorophenoxyacetic acid, 1.2% (w/v) agar, pH 5.6-5.8) without letting the embryo touch the media, wrapped plate with surgical tape end incubated under 16 h light/8 h dark at 28° C. After 10-14 d, we separated the callus from the rest of the germinating seed and transferred to fresh MSD agar plates for another 5 d before co-cultivation.
Agrobacterium culture: We prepared a glycerol freezer stock from a single bacterial colony isolated from a plate. We then inoculated 1 ml LB containing the appropriate antibiotics to maintain the Agrobacterium and the plasmid, and we incubated it overnight at 28° C. at 250 rpm. The following day we added 300 μl of the Agrobacterium culture to 20 ml TY (pH 5.5) containing the appropriate antibiotics and 200 μM acetosyringone. We incubated the culture 28° C. for in a shaking incubator set at 250 rpm until the culture reached an OD600 between 0.1-0.2 (approximately 2-4 h).
Transformation and co-cultivation: We placed the calli in Agrobacterium suspension for 30 min and shook the suspension to ensure uniform access to the calli. After the shaking incubation, we dried the calli on sterile Whatman paper to remove excess bacterial suspension. We transferred the calli onto co-cultivation medium (MSD+S+AS, 1× Murashige and Skoog with vitamins medium containing 30 g/l sucrose, 5% sorbitol, 2 mg/l 2,4-dichlorophenoxyacetic acid, 200 μM acetosyringone, 1.6% (w/v) agar, pH 5.6-5.8) and incubated for 3 d in the dark at 22° C.
Selection: We transferred the co-cultivated calli to selection media (MSD+CH+PPM, 1× Murashige and Skoog with vitamins medium containing 30 g/l sucrose, 2 mg/l 2,4-dichlorophenoxyacetic acid, 400 mg/L carbenicillin, 200 mg/l timentin, 1 ml/l Plant Preservative Mixture, 80 mg/L hygromycin, 1.2% agar, pH 5.6-5.8) and incubated the plates under continuous light at 28° C. We subcultured these calli onto fresh selection media every 8-9 d.
Regeneration and Rooting: After 4-5 weeks on selection media, resistant micro-calli of approximately 2-5 mm wide started to appear. We picked these off the original callus and transferred them to Petri dishes with regeneration media (BN+S+CH, 1× Murashige and Skoog with vitamins medium containing 30 g/l sucrose, 5% sorbitol, 3 mg/l BAP, 0.5 mg/l NAA, 400 mg/l carbenicillin, 200 mg/l timentin, 1 ml/l Plant Preservative Mixture, 50 mg/l hygromycin, 1.6% (w/v) agar, pH 5.6-5.8), and incubated under continuous light at 28° C. We subculture these calli onto fresh regeneration media every 8-9 days. After 4-5 weeks, when calli started to turn green, the regenerated plants were transferred to rooting media (MS+H, 1× Murashige and Skoog with vitamins medium containing 50 mg/l hygromycin, 1.2% (w/v) agar, pH 5.6-5.) and incubated in 16 h light/8 h dark 28° C. When the roots were well developed, we transferred the plants to soil.
Method 4. Citrus transformation protocol. We placed seeds of Carrizo citrange rootstock in water to imbibe and then peel off the seed coats making sure not to remove the integument. We surface sterilized seeds in 0.6% (v/v) sodium hypochlorite solution plus 5-μl tween 20 by placing them in a 50 ml centrifuge tube and shaking at 100 rpms for 20 minutes. We rinse the seeds 3× in 150-200 ml of sterile distilled water. We placed seeds on agar solidified ½× Murashige and Skoog minimal organics medium (½×MSO) containing 15 g/l sucrose, 7 gm TC agar (pH 5.6-5.8), and push seeds slightly into the medium for more uniform germination. Incubate in the dark at 26° C.
Agrobacterium culture: We prepared a glycerol freezer stock from a single bacterial colony isolated from a plate. We then used 40 μl of the stock to inoculate 20 ml of MGL medium (pH 7.0) containing the appropriate antibiotics to maintain the Agrobacterium and the plasmid, and we incubated overnight at 28° C. at 250 rpm. The following day, we removed 5 ml of the overnight growth and transferred it to 15 ml of TY medium (pH 5.5) containing the appropriate antibiotics and 200 μM acetosyringone. We incubated the culture overnight at 28° C. at 250 rpm and then diluted the overnight culture grown in TY medium to an O.D 600 nm of 0.1 to 0.2.
Co-cultivation: We collected 2-5 week old etiolated epicotyls and place in a petri dish containing 10 ml of the Agrobacterium solution prepared above (0.1-0.2 OD 600). We cut submerged epicotyls into 0.5 cm sections and soak for 10 min. We transferred the epicotyl sections onto co-cultivation medium consisting of Murashige and Skoog minimal organics medium (MSO) modified with 30 g/l sucrose 3.0 mg/l BAP, 0.1 mg/l NAA, and 200-μM acetosyringone pH 5.6-5.8. Incubate at 23° C. in the dark.
Induction: After 2-3 days, we transferred the epicotyl pieces to induction medium consisting of MSO modified with 30 g/l sucrose, 3.0 mg/l BAP, 0.1 mg/l NAA, 400 mg/l carbenicillin, 150 mg/l timentin and 100 mg/l kanamycin sulfate, and incubated them in the dark. After 10 days, we subcultured the epicotyl sections to fresh medium of the same formulation and then subcultured them every 21 d. After the second 21-day cycle in the dark, we transferred cultures to light under a 30 μM light and a photoperiod of 16 h light 8 h dark. We continued to transfer every 21 d to fresh medium of the same media until organogenic shoot buds develop at the cut ends.
Elongation: Once shoots began to form, we transferred the developing shoots to elongation medium consisting of MSO modified with 30 g/l sucrose, 0.1 mg/l BA, 400 mg/l carbenicillin, 150 mg/l timentin, and 100 mg/l kanamycin sulfate. We incubated as above and subcultured the cultures every 21 d as needed until shoots elongated.
Rooting: Once a shoot reached 2-4 cm in height, we harvested the shoots and transferred them to rooting medium consisting of MSO modified with 30 g/l sucrose, 5 mg/l NAA, 250 mg/l cefotaxime, and 100 mg/l kanamycin. After three to five days, we transferred shoots to MSO modified with 30 g/l sucrose, 0.0 mg/l NAA, 400 mg/l carbenicillin and 100 mg/l kanamycin. Shoots started rooting in 14 days.
Method 5. Grape transformation protocol. For generating transgenic grape (Thompson Seedless), we transferred somatic embryos to 5 ml of liquid Lloyd and McCown WPM supplemented with 20 g/l sucrose, 1 g/l casein, 1 mM IVIES, 500 mg/l activated charcoal, 0.5 mg/l BAP, 0.1 mg/l NAA, 200 μM acetosyringone and 12.5 μl pluronic F68. We heat-shocked the embryos by placing the tube in a 45° C. bath for 10 min.
We added Agrobacterium to the solution to an OD of 0.1 to 0.2, and then transferred the embryos to an empty 100×20 mm petri dish containing a 7 mm Whatman filter paper disk. We wrapped the petri dish with parafilm, and incubated it in the dark at 23° C. After 2-3 days, we harvested the embryos and transferred them to WPM selection medium. We supplemented the medium with 20 g/l sucrose, 1 g/l casein, 1 mM IVIES, 500 mg/l activated charcoal, 0.5 mg/l BAP, 0.1 mg/l NAA, 400 mg/l carbenicillin, 150 mg/l timentin, 200 mg/l kanamycin (or 25 mg/l hygromycin), 50 g/sorbitol, 14 g/l agar and 4 ml plant preservative mixture (PPM).
We incubate the embryos in the dark at 26° C. and after 7 days, we subcultured the embryos to fresh medium of the same formulation. After 14 and 28 days, we subcultured the embryos to fresh medium. After an additional 14 days, we transferred the embryos to the same WPM supplemented medium but without sorbitol and with 8 g/l agar. We divided the embryos on the plate into independent clusters and incubated them under 16 h light at 26° C., with subcultures every two to three weeks. We continue subculturing every 14-21 days until plants form.
To harvest the germinating plants, we excised the root and placed the shoot on WPM supplemented with 30 g/l sucrose, 0.01 mg/l IBA, 150 mg/l timentin, 400 mg/l carbenicillin and 100 mg/l kanamycin (or 25 mg/l hygromycin). Once shoots rooted, we transferred them to a 2-inch pot containing moistened soil (1 part sunshine mix 2 part vermiculite) and placed the pot into a sealed Ziploc bag for 7 days. Incubate at 26° C. under 16 h of 100 μM m-2 s-1 light covering the flat with a plastic dome. After one week, we opened the Ziploc bag to reduce humidity. Once new growth was evident, we removed the plants from the Ziploc bag and place them under the dome for an additional 7 days to complete acclimatization.
Method 6. Pepper Transformation Protocol.
We surface sterilized Capsicum annuum cultivar “R&C cayenne” seeds in a 1.2% (v/v) sodium hypochlorite solution containing 5 ul tween 20. We agitated the seeds on an orbital shaker at 100 rpms for 20 m followed by one rinse in 150-200 ml of sterile distilled water. We transferred them to agar-solidified ½ strength Murashige and Skoog minimal organics medium (½×MSO) supplemented with 16 g/l glucose, 600 mg/l IVIES, 8 gm PhytoAgar (Plantmedia cat number 40100072-4) (pH 5.6-5.8). We incubated the seeds at 26° C. under a 16 h photoperiod and 30 μM m2 s-1 light.
After 10 d, we placed the seedlings in a solution of Agrobacterium tumefaciens (strain EHA 105) adjusted to an O.D. 600 of 0.1-0.2. While submersing the seedlings in the Agrobacterium solution, we removed ⅔ of the tip of the cotyledons and then remove the cotyledons from the seedling taking care to retain the petiole of the cotyledon but not the apical meristem. After 5 minutes, we transferred the explants into 100×20 mm petri dishes containing co-cultivation medium consisting of MSO medium modified with 16 g/l glucose, 600 mg/l IVIES, 10 mg/l benzlaminopurine (BAP), 1.0 mg/l indole-3-acetic acid (IAA), and 200 μM acetosyringone pH 5.6-5.8. We incubated the tissue in the dark at 23° C.
After 2-3 d, we transferred the cotyledon pieces to induction medium consisting of MSO medium supplemented with 16 g/l glucose, 600 mg/l MES, 10 mg/l BAP, 1.0 mg/l IAA, 300 mg/l timentin, 400 mg/l carbenicillin, 8 mg/l glufosinate (Sigma-Aldrich catalog number 45520). After 10 d, we sub-cultured the cotyledons to fresh medium and then subsequently every 21 d.
Once buds began to form, we transferred the developing buds to elongation medium. This medium consisted of Driver and Kuniyaki Walnut (DKW) medium, supplemented with 30 g/l glucose, 1.3 g/l ca gluconate, 2.0 mg/l meta-topolin, (MT) 10 mg/l gibberellic acid (GA3), 2 ml/l of a silver thiosulfate stock (STS) (1.0 ml of a 100 mg/ml stock of AgNO3 added to 1.0 ml of a 12 mM (95 mg/50 ml water stock), 300 mg/l timentin, 400 mg/l carbenicillin, 4 ml/l PPM and 8 mg/l glufosinate.
As shoots begin to develop from the buds, we transferred them to elongation medium consisting of DKW supplemented with 30 g/l glucose, 1.3 g/l ca gluconate, 0.5 mg/l MT, 10 mg/l GA3, 2.0 ml/l STS, 300 mg/l timentin, 400 mg/l carbenicillin, 4 ml/l PPM and 8 mg/l glufosinate. We incubated as above transferring to fresh medium every 14 days. We removed any developing callus at the base of the shoots at each subculture (
After two consecutive, 14 d subcultures, we transferred elongating shoots to DKW medium supplemented with 30 g/l glucose, 1.3 g/l ca gluconate, 0.1 mg/l MT, 10 mg/l GA3, 1.0 ml/l STS, 300 mg/l timentin, 400 mg/l carbenicillin, 4 ml/l PPM and 8 mg/l glufosinate. When shoots reached a size of 2-3 cm, we transferred them to rooting medium consisting of DKW medium supplemented with 30 g/l sucrose, 0.1 mg/l NAA, 2 ml/l STS, 300 mg/l timentin 400 mg/l carbenicillin 4 ml/L PPM and 4 g/l glufosinate.
Sequences used in the comparison (QLQ underlined, WRC bold)
PFTATQWQELEHQALIYKYMASGVPIPSDLLLPLRRSF
DPEPGRCRRTD
GKKWRCSKEAYPDSKYCEKHMHRGKNRSRKPVE
LFTASQWRELEHQALIYKYMAAGSQVPHELVLPLRHRD
DPEPGRCRRTD
GKKWRCSREAYGESKYCDRHMHRGKNRSRKPVE
PFTAAQYEELEHQALIYKYLVAGVSVPPDLVLPIRRGI
DPEPGRCRRTD
GKKWRCAKEAASDSKYCERHMHRGRNRSRKPVE
TFTAAQYEELEQQALIYKYLVAGVPVPPDLLLPIRRGF
DPEPGRCRRTD
GKKWRCSKEAAQDSKYCERHMHRGRNRSRKPVE
VFTPAQWAELEQQALIYKYLMAGVPVPPDLLLPIRPHP
DPEPWRCRRTD
GKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVE
PFTPSQWMELEHQALIYKYLNAKAPIPSGLLISISKSF
DPEPGRCRRTD
GKKWRCSKEAMAEHKYCERHINRNRHRSRKPVE
PFTPSQWMELEHQALIYKYLAANIAVPHSLLVPIRRSV
DLEPGRCRRTD
GKKWRCSRDAVADQKYCERHMNRGRHRSRKHVE
ALTFMQQQELEHQVLIYRYFAAGAPVPVHLVLPIWKSV
EPEPGRCRRTD
GKKWRCSRDVVQGHKYCERHVHRGRGRSRKPVE
Table 9. Regeneration frequencies in plants transformed with the wheat GRF4-GIF1 chimera or the empty vector. A) Tetraploid and hexaploid wheat commercial cultivars. B) Triticale breeding line and C) Rice cultivar Kitaake. In all experiments we used the pLC41 vector (optimized for wheat), except for the second rice experiment where we used the pCAMBIA1300 vector which is more frequently used in rice. EHA105 and AGL1 are two different Agrobacterium strains used for infiltration (we observed no differences between the two strains). In the number of inoculated embryos (n) the first number indicates those inoculated with the empty vector and the second number the embryos inoculated with the GRF4-GIF1 chimera.
SEQ ID NO:
1: Full vector pLC41 having TaGRF4 nucleotide sequence
2: Full vector pLC41 having TaGIF1 nucleotide sequence
3: TaGRF4-GIF1 chimera nucleotide sequence
4: TaGRF4-GIF1 amino acid sequence
5: Full construct pLC41 wheat GRF4-GIF1 chimera
6: Vitis vinifera GRF4-GIF1 chimera nucleotide sequence
7: Vitis vinifera GRF4-GIF1 chimera protein sequence
8: Full construct pGWB14 having Vitis vinifera GRF4-GIF1 chimera
9: TaGRF1 amino acid sequence
10: TaGRF2 amino acid sequence
11: TaGRF3 amino acid sequence
12: TaGRF4 amino acid sequence
13: TaGRF5 amino acid sequence
14: OsGRF1 amino acid sequence
15: OsGRF2 amino acid sequence
16: OsGRF3 amino acid sequence
17: OsGRF4 amino acid sequence
18: OsGRF5 amino acid sequence
19: AtGRF3 amino acid sequence
20: AtGRF4 amino acid sequence
21: AtGRF5 amino acid sequence
22: AtGRF6 amino acid sequence
23: Vitis vinifera GRF4 (SVIVT01024326001) used in the chimera
24: AtGIF1 amino acid sequence
25: AtGIF2 amino acid sequence
26: AtGIF3 amino acid sequence
27: TaGIF1 amino acid sequence
28: TaGIF2 amino acid sequence
29: TaGIF3 amino acid sequence
30: Vitis vinifera GIF1 (GSVIVT01036262001)
31: Dexamethasone inducible chimera of Vitis vinifera GRF4-GR-GIF1 protein
32: Dexamethasone inducible TaGRF4-GR-GIF1
33: Full vector of pLC41 with wheat GRF4-GR-GIF1 chimera
34: wheat rGRF4-GIF1 with four mutation in miR396 target site
35: Full construct JD635 with wheat GRF4-GIF1 chimera
36: Full construct pLC41 with separate Ubi::GRF4-Ubi::GIF1
37: TaGRF5
38: TaGRF1
39: TaGRF9
40: TaGRF1-GIF1
41: TaGRF5-GIF1
42: TaGRF9-GIF1
43: TaGIF2
44: TaGIF3
45: TaGRF4-GIF2
46: TaGRF4-GIF3
47: Full vector pLC41 marker free with wheat GRF4-GIF1 chimera
48: Citrus GRF4-GIF1
49: Full pGWB14 construct with Citrus GRF4-GIF1
50: Vitis rGRF4-GIF1 miR396 resistant chimera
51 TaGRF4 nucleotide sequence—From SEQ ID NO: 1 vector
52 TaGIF1 nucleotide sequence—From SEQ ID NO: 2 vector
53 wild-type miR396 target site
54: miR396 target site with silent mutations
55: Mature miR396 sequence
56: Protein sequence is
57: LB of pLC41
58: RB of pLC41
59: Zea maize UBIQUITIN promoter
60: HA tag
61: nos terminator
62: 35s promoter
63: HPT
64: TaCas9 from SEQ ID NO: 35
65: TaU6 promoter from SEQ ID NO: 35
66: Guide RNA gene Q from SEQ ID NO: 35
67: Guide RNA scaffold from SEQ ID NO: 35
68: Sequence in
69: QLQ domain from SEQ ID NO: 9
70: QLQ domain from SEQ ID NO: 10
71: QLQ domain from SEQ ID NO: 11
72: QLQ domain from SEQ ID NO: 12
73: QLQ domain from SEQ ID NO: 13
74: QLQ domain from SEQ ID NO: 14
75: QLQ domain from SEQ ID NO: 15
76: QLQ domain from SEQ ID NO: 16
77: QLQ domain from SEQ ID NO: 17
78: QLQ domain from SEQ ID NO: 18
79: QLQ domain from SEQ ID NO: 19
80: QLQ domain from SEQ ID NO: 20
81: QLQ domain from SEQ ID NO: 21
82: QLQ domain from SEQ ID NO: 22
83: QLQ domain from SEQ ID NO: 23
84: WRC domain from SEQ ID NO: 9
85: WRC domain from SEQ ID NO: 10
86: WRC domain from SEQ ID NO: 11
87: WRC domain from SEQ ID NO: 12
88: WRC domain from SEQ ID NO: 13
89: WRC domain from SEQ ID NO: 15
90: WRC domain from SEQ ID NO: 16
91: WRC domain from SEQ ID NO: 19
92: WRC domain from SEQ ID NO: 20
93: WRC domain from SEQ ID NO: 21
94: WRC domain from SEQ ID NO: 22
95: WRC domain from SEQ ID NO: 23
96: A concatenated QLQ-WRC domain for wheat TaGRF4 (for which the complete protein sequence is SEQ ID NO:12):
97: SNH domain from SEQ ID NO: 24
98: SNH domain from SEQ ID NO: 25
99: SNH domain from SEQ ID NO: 26
100: SNH domain from SEQ ID NO: 27
101: SNH domain from SEQ ID NO: 28
102: SNH domain from SEQ ID NO: 29
103: SNH domain from SEQ ID NO: 30
104: Primer Fw-GRF4b
105: Primer Rev-GIF1c
106-118: Table 6 primers
119: Primer Fw_HindIII
120: Primer Rev-HindIII
121: Primer Fw-GRF
122: Primer rGRF-Rev
123: Primer rGRF-Fw
124: Primer Rev-GIF
125: QLQ-WRC from TraesCS6A01G335900 TaGRF1
126: QLQ-WRC from TraesCS7A01G165600 TaGRF2
127: QLQ-WRC from TraesCS6A01G269600 TaGRF4
128: QLQ-WRC from TraesCS2A01G435100 TaGRF3
129: QLQ-WRC from TraesCS7A01G049100 TaGRF5
130: QLQ-WRC from TraesCS4A01G291500 TaGRF9
131: QLQ-WRC from TraesCS4A01G255000 TaGRF6
132: QLQ-WRC from TraesCS6A01G257600 TaGRF12
133: Os11g40100 (GIF2)
134: Os12g31350 (GIF3)
135: Os03g52320 (GIF1)
136: OsGIF3 SNH Domain
137: OsGIF1 SNH Domain
138: Capsicum GRF4 (LOC107869915)
139 Capsicum GIF1 (LOC107870303)
140 Capsicum GRF4-GIF1 chimera.
All references cited in this disclosure are incorporated by reference in their entirety.
This application claims priority to PCT/US2020/041135, filed Jul. 8, 2020, which claims priority to provisional application U.S. Ser. No. 62/873,123, filed Jul. 11, 2019, all of which are incorporated herein by reference in their entirety.
This invention was made with government support under Grant No. 2017-67007-25939 awarded by the United States Department of Agriculture, National Institute of Food and Agriculture. The government has certain rights in the invention.
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/US20/41135 | 7/8/2020 | WO |
Number | Date | Country | |
---|---|---|---|
62873123 | Jul 2019 | US |