The present invention pertains to the fields of cell culture, immunology, and T lymphocytes. More specifically, the invention relates to in vitro methods directed to promoting differentiation and proliferation of human Th-17+ cells and to in vitro screening methods directed to identifying agents capable of modulating human Th-17+ cells differentiation. Homogenous populations of Th-17+ cells generated using the methods of the invention are also described herein.
Several publications and patent documents are referenced in this application in order to more fully describe the state of the art to which this invention pertains. The disclosure of each of these publications and documents is incorporated by reference herein.
Th17 cells, the T helper cells that produce IL-17 and other pro-inflammatory cytokines, have been shown to have key functions in a wide variety of autoimmune disease models in mice and are thought to be similarly involved in human disease (reviewed1-3). In healthy humans, IL-17-secreting cells are present in the CD45RO+CCR6+ populations of T cells from peripheral blood4,5 and gut5. Th17 cells or their products have been associated with the pathology of multiple inflammatory or autoimmune disorders in humans. IL-17 protein and Th17 CD4+ T cells are found in lesions from multiple sclerosis patients6-8 where they are thought to contribute to the disruption of the blood-brain barrier9. IL-17 is produced by CD4+ T cells of rheumatoid synovium10 and is thought to contribute to inflammation in rheumatoid arthritis11,12. In psoriasis, products associated with Th17 cells, including IL-17, IL-17F, IL-22, and CCR6 are induced13-15. IL-17 is induced in the gut mucosa from Crohn's disease and ulcerative colitis patients and Th17 cells are detected13,16. IL-23, which is produced by dendritic cells in the intestine17, contributes significantly to Th17 cell differentiation18. Strikingly, polymorphisms in the IL23R gene are associated with Crohn's disease, further implicating the Th17 cell pathway in the pathogenesis of this disease19.
The mechanisms leading to differentiation of Th17 cells have been well established in mice but they are still poorly understood in humans. In mice, differentiation of Th17 cells that secrete IL-17 (also referred to as IL-17A) and IL-17F requires the expression of the transcription factors Rorγt, an orphan nuclear hormone receptor, STAT3 and IRF4 (reviewed in20). Rorγt is sufficient to direct expression of IL-17 in activated mouse T cells21 and is thus considered to be the effector transcription factor that establishes the Th17 differentiation lineage. Conditions that induce Th17 cell differentiation from naive murine T cells, including expression of Rorγt, have been established. Combinations of TGF-β and IL-622-24 or TGF-β and IL-2125-27 are sufficient to initiate IL-17 and IL-17F expression. Expression of IL-22, considered to be another Th17 cytokine, is induced by IL-6 and inhibited by high concentrations of TGF-β14. IL-23 is required in vivo for the generation of pathogenic Th17 cells, but it is not required in vitro for the induction of IL-17, IL-17F or IL-2218.
In contrast to murine T cells, human T cells with a naive surface phenotype fail to produce IL-17 in the presence of TGF-β and IL-628-31. Increased expression of IL-17 was, however, observed by some groups in response to IL-1β alone29 or with IL-2315. Others have failed to observe such a response30. These disparate findings reveal that the identities of the exogenous factors required to induce the differentiation of human Th17 cells remain unknown. The difference between the requirements for mouse and human Th17 cell differentiation have been ascribed to divergent differentiation processes, although it remains possible that T cells purified from adult peripheral blood on the basis of CD45RA expression alone are not equivalent to naive murine T cells32-34.
Th17 cells are IL-17-secreting CD4+ T cells involved in autoimmune disease and mucosal immunity. In naive CD4+ T cells from mice, IL-17 is expressed in response to a combination of IL-6 or IL-21 and TGF-β and requires induction of the transcription factor Rorγt. It has been suggested that human Th17 cell differentiation is independent of TGF-β and thus differs fundamentally from mouse. The present inventors demonstrate here that, in serum-free conditions, a combination of TGF-β with IL-1β and any one of IL-6, IL-21 or IL-23 is necessary and sufficient to induce IL-17 expression in naive human CD4+ T cells isolated from cord blood.
In one aspect, the present invention is directed to a method for promoting differentiation and proliferation of human T helper lymphocytes that express IL17 (Th-IL17+ cells) in vitro, the method comprising the steps of: isolating a population of naive CD4+ T cells from a human; and incubating the population of naive CD4+ T cells in serum-free culture medium comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23, wherein the incubating promotes differentiation of human Th-IL17+ cells. Detecting an increase in expression of any cellular marker of human Th-IL17+ differentiation, such as IL17, IL17F, IL23R, RORC or IL26, after incubating in human Th-IL17+ promoting conditions may be used as a positive indicator of Th-IL17+ cell differentiation.
In another aspect, the invention is directed to a method for generating a population of human T helper lymphocytes that express IL17 (Th-IL17+ cells) in vitro, the method comprising the steps of: isolating a population of naive CD4+ T cells from a human; and incubating the population of naive CD4+ T cells in serum-free culture medium comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23, wherein the incubating promotes differentiation and proliferation of human Th-IL17+ cells and thereby generates a population of human Th-IL17+ cells.
The naive CD4+ T cells used in the present method may be isolated from cord blood, buffy coats of adult humans, cell cultures comprising cells that express CD34 (CD34+ cells), or human embryonic stem cells. CD34+ cells may be isolated from fetal liver, cord blood, or mobilized adult blood and further expanded in vitro to generate cell cultures comprising CD34+ cells.
In an embodiment of the invention, the concentration of TGF-β in the serum-free culture medium is at least 0.1 ng/ml. In a more particular embodiment, the concentration of TGF-β in the serum-free culture medium is about 10 ng/ml or is 10 ng/ml.
In an embodiment of the invention, the concentration of IL-1β in the serum-free culture medium is at least 0.1 ng/ml. In a more particular embodiment, the concentration of IL-1β in the serum-free culture medium is about 10 ng/ml or is 10 ng/ml.
In an embodiment of the invention, the concentration of IL-6 in the serum-free culture medium is at least 0.1 ng/ml. In a more particular embodiment, the concentration of IL-6 in the serum-free culture medium is about 10 ng/ml or is 10 ng/ml.
In an embodiment of the invention, the concentration of IL-21 in the serum-free culture medium is at least 0.1 ng/ml. In a more particular embodiment, the concentration of IL-21 in the serum-free culture medium is about 10 ng/ml or is 10 ng/ml.
In an embodiment of the invention, the concentration of IL-23 in the serum-free culture medium is at least 0.1 ng/ml. In a more particular embodiment, the concentration of IL-23 in the serum-free culture medium is about 10 ng/ml or is 10 ng/ml.
In yet another embodiment of the invention, the serum-free culture medium further comprises IL-2. More particularly, the concentration of IL-2 in the serum-free culture medium is at least 1 U/ml. Even more particularly, the concentration of IL-2 in the serum-free culture medium is about 10 U/ml or is 10 U/ml.
In an aspect of the invention, the population of CD4+ T cells is activated with anti-CD3 and anti-CD28 antibodies prior to or concomitant with the incubating step.
In another aspect of the invention, the incubating step is at least three days. More particularly, the incubating step is about six days or is six days.
The invention also encompasses a method wherein the population of CD4+ T cells is transduced with a lentiviral vector comprising a nucleic acid sequence encoding an exogenous polypeptide RORγT before or during the incubating step. More particularly, the lentiviral vector comprises a nucleic acid sequence encoding RORγT or RORγ. The nucleic and amino acid sequences of human and mouse RORγT and RORγ are presented herein. As understood in the art, the gene RORC encodes RORγ and RORγT, which are isoform a and b, respectively, of RORC. In another embodiment of the invention, the lentiviral vector comprises a nucleic acid sequence encoding human RORα or human RORβ, which can also drive IL-17 expression in human CD4+ cells. Nucleic acid sequences encoding human RORα or human RORβ are presented herein.
The invention also encompasses a method wherein the population of CD4+ T cells is isolated based on positive cell surface staining for cell surface antigens or receptors. Exemplary cell surface antigens or receptors include putative homing receptors: CCR7, CCR6, CCR5, CXCR4, CD62L, CD44, CD11a, CD27, CD57, and CD49f.
The invention also encompasses a method wherein the population of CD4+ T cells is isolated based on positive cell surface staining for a particular T cell receptor. In an embodiment of the invention, the T cell receptor is specific for a particular tumor cell antigen.
The method of the present invention may further comprise an enrichment step, whereby post-incubation cells (i.e., cells that have been incubated in accordance with the invention) are selected for expression of a cell surface marker or cell surface antigen expressed on human Th-IL17+ cells. More particularly, the cell surface marker or cell surface antigen expressed on human Th-IL17+ cells is CCR6, CCR7, CCR5, and CXCR4.
The present invention also encompasses a method for screening to identify an agent that modulates human Th-IL17+ cell differentiation in vitro, the method comprising the steps of:
a) isolating a population of CD4+ T cells from a human and dividing the population into at least a first and second sub-population of CD4+ T cells;
b) incubating a first sub-population of CD4+ T cells in serum-free culture medium comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23, wherein the incubating promotes differentiation of human Th-IL17+ cells;
c) incubating a second sub-population of CD4+ T cells in serum-free culture medium comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23, and an agent;
d) detecting expression of IL17, IL17F, IL23R, RORC or IL26 in each of said first and second sub-populations of CD4+ T cells incubated without or with the agent;
e) comparing the expression of IL17, IL17F, IL23R, RORC, IL26, or FOXP3 in each of said first and second sub-populations of CD4+ T cells generated following incubation without or with the agent, wherein a change in expression of IL17, IL17F, IL23R, RORC, IL26, or FOXP3 following incubation with the agent relative to the expression of IL17, IL17F, IL23R, RORC, IL26, or FOXP3 following incubation without the agent indicates that the agent is a modulator of human Th-IL17+ cell differentiation in vitro.
In another embodiment of the invention, the serum-free culture medium of the screening method further comprises IL-2. More particularly, the concentration of IL-2 in the serum-free culture medium is at least 1 U/ml. Even more particularly, the concentration of IL-2 in the serum-free culture medium is about 10 U/ml or is 10 U/ml.
In an aspect of the screening method, the change in expression of IL17, IL17F, IL23R, RORC or IL26 is a decrease in expression of IL17, IL17F, IL23R, RORC or IL26 following incubation with the agent, wherein the decrease indicates that the agent is an inhibitor of human Th-IL17+ cell differentiation in vitro.
In another aspect of the screening method, the change in expression of IL17, IL17F, IL23R, RORC or IL26 is an increase in expression of IL17, IL17F, IL23R, RORC or IL26 following incubation with the agent, wherein the increase indicates that the agent is a promoter or inducer of human Th-IL17+ cell differentiation in vitro.
In yet another aspect of the invention, expression of FOXP3 is used as a target for readout of the methods described herein. FOXP3 is a negative regulator of human Th-IL17+ cell differentiation. Thus, in a screening method of the invention, a practitioner could screen for an inhibitor of Th17 that could increase FOXP3 expression and an inducer of Th17 that could inhibit FOXP3 expression. Given the role of FOXP3 in autoimmunity, the identification of such inhibitors and inducers would provide promising therapeutics.
With respect to the screening method, therefore, a decrease in expression of FOXP3 following incubation with an agent indicates that the agent is a promoter of human Th-IL17+ cell differentiation in vitro. In contrast, an increase in expression of FOXP3 following incubation with an agent indicates that the agent is an inhibitor of human Th-IL17+ cell differentiation in vitro.
As described herein, the agent used in the screening method of the invention may be a small molecule; polypeptide; azole-containing compounds; cholesterol derivative compounds; retinoid derivative compounds; shRNA/siRNA; neutralizing/blocking antibodies; tryptophan derivative compounds; Vitamin D derivatives; or molecules known to inhibit of fever, inflammation, or regulatory T (Treg) cell differentiation.
An agent tested in a screening method of the invention may be added to the culture medium before, during, or after addition of TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23.
In an aspect of the screening method, expression of IL17, IL17F, IL23R, RORC or IL26 is determined by polymerase chain reaction amplification using primer pairs specific for IL17, IL17F, IL23R, RORC or IL26.
The present invention further encompasses an isolated homogeneous population of human Th-IL17+ cells, wherein the isolated homogeneous population comprises at least 1×109 human Th-IL17+ cells, wherein the human Th-IL17+ cells do not express cellular markers of other differentiated Th cells. In accordance with the present invention, the isolated homogeneous population of human Th-IL 17+ cells generated from naive CD4+ cells do not express cellular markers characteristic of Th1 (e.g., IFNγ), Th2 (e.g., IL4 or IL13), or Treg cells (e.g., FoxP3). It is understood that cellular markers characteristic of Th1, Th2, or Treg cells would be present in any population of Th-IL17+ cells generated from memory Th cells. The isolated population of human Th-IL17+ cells generated from naive CD4+ cells as described herein is, therefore, homogeneous with respect to the expression of only those cellular markers characteristic of Th17+ cells. Exemplary markers of human Th-IL17 cells are IL-17, IL-17F, IL-26, and IL23R.
Other features and advantages of the invention will be apparent from the following description of the particular embodiments thereof, and from the claims.
a-f: RORγT is Necessary and Sufficient for the Expression of IL-17 in Human CD4+ T Cells.
(a) Sorted CD45RO− and CD45RO+CCR6+ were activated and expanded in the presence of IL-2 with or without IL-1β. IL-17 and IFNγ production was analyzed at day 6. (b, c) Sorted CD45RO+CCR6+ were transduced with an empty vector or vector encoding RORγT-specific shRNA (shRNA-1 and shRNA-2). Cells were selected in puromycin at day 2. RORC and 13-actin mRNA expression (b) and IL-17 and IFNγ production (c) were analyzed at day 6 (representative experiment, n=4). (d) Naive cord blood CD4+ T cells were activated, transduced by vectors encoding IRES-HSA or RORγT-IRES-HSA and expanded for 6 days in the presence of IL-2. IL-17 and IFNγ production was analyzed at day 6. (e) Naive cord blood CD4+ T cells were transduced with vectors encoding IRES-GFP or RORγT-IRES-GFP. GFP+ cells were sorted at day 6 and mRNA levels of β-actin, IL-17, IL-17F and IL-26 were analyzed. (f) Naive cord blood CD4+ T cells were transduced with vectors encoding IRES-HSA, RORγT-IRES-HSA, GATA-3-IRES-HSA or T-bet-IRES-HSA. CCR6 cell surface expression was measured at day 12.
a-d: TGF-β Induces RORγT but Inhibits its Activity and this Inhibition is Relieved by Inflammatory Cytokines.
(a) Naive cord blood CD4+ T cells were transduced with a vector encoding RORγT-IRES-HSA alone or with a combination of IL-1β, IL-6, IL-21 and increasing concentrations of TGF-β, and IL-17 intracellular staining was performed at day 6. (b) RORC and β-actin expression was measured in freshly sorted CCR4−/+CCR6−/+ adult memory CD4+ T cells and in naive CD4+ T cells cultivated for 3 days in the presence of various cytokines. (c) RORC and β-actin expression was analyzed in naive cord blood CD4+ T cells that were cultivated in various concentrations of TGF-β. (d) Naive cord blood CD4+ T cells were transduced with a vector encoding RORγT-IRES-HSA in either RPMI-10% FBS, RPMI-10% with an anti-TGF-β antibody or serum-free media. IL-17 and FOXP3 expression were analyzed at day 6. A representative donor with low IL-17 expression following RORγT transduction in the presence of serum is shown.
a-f: TGF-β, IL-1β and Either IL-6, IL-21 or IL-23 are Required for Human Th17 Cell Polarization in Serum Free Conditions.
(a) Naive cord blood CD4+ T cells were activated without cytokines or with IL-1β, IL-6 or IL-21 with or without IL-23, alone or with increasing concentrations of TGF-β. IL-2 was added at day 3 and IL-17 expression was analyzed at day 14. (b) Naive cord blood CD4+ T cells were activated with no cytokine or with a combination of IL-1β+IL-23+TGF-β (1 ng/ml), with or without 10 U/ml IL-2. IL-17 expression was analyzed at day 6. (c) Naive cord blood CD4+ T cells were cultivated with IL-23+IL-2 alone or together with IL-1β, IL-21 or IL-23 and increasing concentrations of TGF-β. IL-17 and IFNγ expression was analyzed at day 6. (d) Time-course of IL-17 and IFNγ production in naive cord blood CD4+ T cells polarized in the presence of IL-2+IL-1β+IL-23+TGF-β (0.1, 1 or 10 ng/ml). (e) Summary of IL-17 expression in day 6 cultures of naive cord blood CD4+ T cells from different donors (n=11) in the presence of IL-2+IL-1β+IL-23+10 ng/ml TGF-β. (f) Naive cord blood CD4+ T cells were cultivated in IL-2 alone or IL-23+IL-1β+IL-2 with increasing concentrations of TGF-β. IL-17 and IL-22 expression was analyzed at day 6. Each panel is representative of at least three independent donors.
a-e: Induction of IL26, IL17F, IL17A, RORC and IL23R mRNA During Human Th17 Cell Differentiation.
(a, b, c) Naive cord blood CD4+ T cells were cultivated with IL-2 alone or with IL-1β+IL-2, IL-23+IL-2, or IL-23+IL-1β+IL-2 with increasing concentrations of TGF-β. mRNA levels of β-actin, IL17 (a), IL26 (b) and IL17F (c) were analyzed on day 6 following restimulation with PMA and ionomycin. (d, e) Naive cord blood CD4+ T cells were cultivated with IL-2 alone or with IL-1β+IL-2, IL-23+IL-2 or IL-23+IL-1β+IL-2 with increasing concentrations of TGF-β. mRNA levels of β-actin, RORC (d) and IL23R (e) were analyzed on day 6. Each panel is representative of three independent donors.
a-c: Expression of CCR6 and FOXP3 During Human Th17 Cell Differentiation.
(a) Naive cord blood CD4+ T cells were cultivated with IL-2 alone or with IL-1β+IL-2, IL-23+IL-2, or IL-23+IL-1β+IL-2 with increasing concentrations of TGF-β. CCR6 expression was analyzed by surface staining at day 6. (b) Naive cord blood CD4+ T cells were cultivated for 6 days in IL-2+IL-23+IL-1β+IL-2+10 ng/ml TGF-β. CCR6+ and CCR6− cells were sorted and IL-17 was analyzed. (c) Naive cord blood CD4+ T cells were cultivated with IL-2 alone or with IL-1β+IL-2, IL-23+IL-2, or IL-23+IL-1β+IL-2 with increasing concentrations of TGF-β. FOXP3 and IL-17 expression were analyzed at day 6.
Naive cord blood CD4+ T cells were transduced with RORγT, RORαd and RORβ in RPMI-10% FBS alone. IL-17 was analyzed at day 6.
a-b: IL26 Gene has been Lost in Mice and Rats.
(a) Genomic organization of the IL22 locus based on UCSC genome browser. In humans, IL22 is followed by IL26 and IFNG in the same locus. In the mouse, Il22 is followed by Iltifb (a duplication of Il22) and Ifng, and Il26 is absent. (b) Among species, IL26 can be detected in pre-placental vertebrates, but cannot be found in the mouse or rat genome. GenBank accession numbers and amino acid identity to human IL-26 are indicated. Human IL-22 is shown for comparison.
Naive cord blood CD4+ T cells were transduced with RORγT in RPMI-10% FBS alone, with recombinant TGF-β or with an anti-TGF-β antibody. IL-17 and IFNγ expression was analyzed at day 6 in GFPhi cells.
a-c: Expression and Neutralization of IL-6 and IL-21.
(a, b) Naive cord blood CD4+ T cells were cultivated in IL-2 alone or, IL-1β+IL-2, IL-23+IL-2, or IL-23+IL-1β+IL-2 with increasing concentrations of TGF-β. mRNA levels of β-actin, IL6 (a) and IL21 (b) was analyzed on day 6 following restimulation with PMA and ionomycin. (c) Naive cord blood CD4+ T cells were cultivated in IL-2 alone or, IL-23+IL-1β+IL-2 with increasing concentrations of TGF-β. Increasing concentrations of neutralizing anti-IL-6 antibody and soluble IL-21 receptor were also added. IL-17 expression was analyzed at day 6.
Naive cord blood CD4+ T cells were activated with a combination of IL-2+IL-1β+IL-23+TGF-β (0.1, 1 and 10 ng/ml), with or without retinoic acid (10 and 100 nM). IL-17 and IFNγ expression was analyzed at day 6.
a-b: Expression of RORA.
(a) Naive cord blood CD4+ T cells were cultivated in IL-2 alone or, IL-1β+IL-2, IL-23+IL-2, or IL-23+IL-1β+IL-2 with increasing concentrations of TGF-β. mRNA levels of β-actin and RORA were analyzed on day 6. (b) RORA and β-actin expression was measured in freshly sorted CCR4−/+CCR6−/+ adult memory CD4+ T cells.
In order to more clearly set forth the parameters of the present invention, the following definitions are used:
As used in this specification and the appended claims, the singular forms “a”, “an”, and “the” include plural references unless the context clearly dictates otherwise. Thus for example, reference to “the method” includes one or more methods, and/or steps of the type described herein and/or which will become apparent to those persons skilled in the art upon reading this disclosure.
The term “complementary” refers to two DNA strands that exhibit substantial normal base pairing characteristics. Complementary DNA may, however, contain one or more mismatches.
The term “hybridization” refers to the hydrogen bonding that occurs between two complementary DNA strands.
“Nucleic acid” or a “nucleic acid molecule” as used herein refers to any DNA or RNA molecule, either single or double stranded and, if single stranded, the molecule of its complementary sequence in either linear or circular form. In discussing nucleic acid molecules, a sequence or structure of a particular nucleic acid molecule may be described herein according to the normal convention of providing the sequence in the 5′ to 3′ direction.
With reference to nucleic acids of the invention, the term “isolated nucleic acid” is sometimes used. This term, when applied to DNA, refers to a DNA molecule that is separated from sequences with which it is immediately contiguous in the naturally occurring genome of the organism in which it originated. For example, an “isolated nucleic acid” may comprise a DNA molecule inserted into a vector, such as a plasmid or virus vector, or integrated into the genomic DNA of a prokaryotic or eukaryotic cell or host organism.
When applied to RNA, the term “isolated nucleic acid” refers primarily to an RNA molecule encoded by an isolated DNA molecule as defined above. Alternatively, the term may refer to an RNA molecule that has been sufficiently separated from other nucleic acids with which it is generally associated in its natural state (i.e., in cells or tissues). An isolated nucleic acid (either DNA or RNA) may further represent a molecule produced directly by biological or synthetic means and separated from other components present during its production.
The term “functional” as used herein implies that the nucleic or amino acid sequence is functional for the recited assay or purpose.
The phrase “consisting essentially of” when referring to a particular nucleotide or amino acid means a sequence having the properties of a given SEQ ID No:. For example, when used in reference to an amino acid sequence, the phrase includes the sequence per se and molecular modifications that would not affect the basic and novel characteristics of the sequence.
A “replicon” is any genetic element, for example, a plasmid, cosmid, bacmid, phage or virus, that is capable of replication largely under its own control. A replicon may be either RNA or DNA and may be single or double stranded.
A “vector” is a replicon, such as a plasmid, cosmid, bacmid, phage or virus, to which another genetic sequence or element (either DNA or RNA) may be attached so as to bring about the replication of the attached sequence or element.
An “expression vector” or “expression operon” refers to a nucleic acid segment that may possess transcriptional and translational control sequences, such as promoters, enhancers, translational start signals (e.g., ATG or AUG codons), polyadenylation signals, terminators, and the like, and which facilitate the expression of a polypeptide coding sequence in a host cell or organism.
As used herein, the term “operably linked” refers to a regulatory sequence capable of mediating the expression of a coding sequence and which is placed in a DNA molecule (e.g., an expression vector) in an appropriate position relative to the coding sequence so as to effect expression of the coding sequence. This same definition is sometimes applied to the arrangement of coding sequences and transcription control elements (e.g. promoters, enhancers, and termination elements) in an expression vector. This definition is also sometimes applied to the arrangement of nucleic acid sequences of a first and a second nucleic acid molecule wherein a hybrid nucleic acid molecule is generated.
The term “oligonucleotide,” as used herein refers to primers and probes of the present invention, and is defined as a nucleic acid molecule comprised of two or more ribo- or deoxyribonucleotides, preferably more than three. The exact size of the oligonucleotide will depend on various factors and on the particular application and use of the oligonucleotide.
The term “probe” as used herein refers to an oligonucleotide, polynucleotide or nucleic acid, either RNA or DNA, whether occurring naturally as in a purified restriction enzyme digest or produced synthetically, which is capable of annealing with or specifically hybridizing to a nucleic acid with sequences complementary to the probe. A probe may be either single-stranded or double-stranded. The exact length of the probe will depend upon many factors, including temperature, source of probe and use of the method. For example, for diagnostic applications, depending on the complexity of the target sequence, the oligonucleotide probe typically contains 15-25 or more nucleotides, although it may contain fewer nucleotides. The probes herein are selected to be “substantially” complementary to different strands of a particular target nucleic acid sequence. This means that the probes must be sufficiently complementary so as to be able to “specifically hybridize” or anneal with their respective target strands under a set of pre-determined conditions. Therefore, the probe sequence need not reflect the exact complementary sequence of the target. For example, a non-complementary nucleotide fragment may be attached to the 5′ or 3′ end of the probe, with the remainder of the probe sequence being complementary to the target strand. Alternatively, non-complementary bases or longer sequences can be interspersed into the probe, provided that the probe sequence has sufficient complementarity with the sequence of the target nucleic acid to anneal therewith specifically.
The term “specifically hybridize” refers to the association between two single-stranded nucleic acid molecules of sufficiently complementary sequence to permit such hybridization under pre-determined conditions generally used in the art (sometimes termed “substantially complementary”). In particular, the term refers to hybridization of an oligonucleotide with a substantially complementary sequence contained within a single-stranded DNA or RNA molecule of the invention, to the substantial exclusion of hybridization of the oligonucleotide with single-stranded nucleic acids of non-complementary sequence.
The term “primer” as used herein refers to an oligonucleotide, either RNA or DNA, either single-stranded or double-stranded, either derived from a biological system, generated by restriction enzyme digestion, or produced synthetically which, when placed in the proper environment, is able to functionally act as an initiator of template-dependent nucleic acid synthesis. When presented with an appropriate nucleic acid template, suitable nucleoside triphosphate precursors of nucleic acids, a polymerase enzyme, suitable cofactors and conditions such as a suitable temperature and pH, the primer may be extended at its 3′ terminus by the addition of nucleotides by the action of a polymerase or similar activity to yield a primer extension product. The primer may vary in length depending on the particular conditions and requirement of the application. For example, in diagnostic applications, the oligonucleotide primer is typically 15-25 or more nucleotides in length. The primer must be of sufficient complementarity to the desired template to prime the synthesis of the desired extension product, that is, to be able anneal with the desired template strand in a manner sufficient to provide the 3′ hydroxyl moiety of the primer in appropriate juxtaposition for use in the initiation of synthesis by a polymerase or similar enzyme. It is not required that the primer sequence represent an exact complement of the desired template. For example, a non-complementary nucleotide sequence may be attached to the 5′ end of an otherwise complementary primer. Alternatively, non-complementary bases may be interspersed within the oligonucleotide primer sequence, provided that the primer sequence has sufficient complementarity with the sequence of the desired template strand to functionally provide a template-primer complex for the synthesis of the extension product.
Primers may be labeled fluorescently with 6-carboxyfluorescein (6-FAM). Alternatively primers may be labeled with 4,7,2′,7′-Tetrachloro-6-carboxyfluorescein (TET). Other alternative DNA labeling methods are known in the art and are contemplated to be within the scope of the invention.
The term “isolated protein” or “isolated and purified protein” is sometimes used herein. This term refers primarily to a protein produced by expression of an isolated nucleic acid molecule of the invention. Alternatively, this term may refer to a protein that has been sufficiently separated from other proteins with which it would naturally be associated, so as to exist in “substantially pure” form. “Isolated” is not meant to exclude artificial or synthetic mixtures with other compounds or materials, or the presence of impurities that do not interfere with the fundamental activity, and that may be present, for example, due to incomplete purification, addition of stabilizers, or compounding into, for example, immunogenic preparations or pharmaceutically acceptable preparations.
The term “substantially pure” refers to a preparation comprising at least 50-60% by weight of a given material (e.g., nucleic acid, oligonucleotide, protein, etc.). More particularly, the preparation comprises at least 75% by weight, and most particularly 90-95% by weight of the given compound. Purity is measured by methods appropriate for the given compound (e.g. chromatographic methods, agarose or polyacrylamide gel electrophoresis, HPLC analysis, and the like). “Mature protein” or “mature polypeptide” shall mean a polypeptide possessing the sequence of the polypeptide after any processing events that normally occur to the polypeptide during the course of its genesis, such as proteolytic processing from a polypeptide precursor. In designating the sequence or boundaries of a mature protein, the first amino acid of the mature protein sequence is designated as amino acid residue 1.
The term “tag”, “tag sequence” or “protein tag” refers to a chemical moiety, either a nucleotide, oligonucleotide, polynucleotide or an amino acid, peptide or protein or other chemical, that when added to another sequence, provides additional utility or confers useful properties to the sequence, particularly with regard to methods relating to the detection or isolation of the sequence. Thus, for example, a homopolymer nucleic acid sequence or a nucleic acid sequence complementary to a capture oligonucleotide may be added to a primer or probe sequence to facilitate the subsequent isolation of an extension product or hybridized product. In the case of protein tags, histidine residues (e.g., 4 to 8 consecutive histidine residues) may be added to either the amino- or carboxy-terminus of a protein to facilitate protein isolation by chelating metal chromatography. Alternatively, amino acid sequences, peptides, proteins or fusion partners representing epitopes or binding determinants reactive with specific antibody molecules or other molecules (e.g., flag epitope, c-myc epitope, transmembrane epitope of the influenza A virus hemaglutinin protein, protein A, cellulose binding domain, calmodulin binding protein, maltose binding protein, chitin binding domain, glutathione S-transferase, and the like) may be added to proteins to facilitate protein isolation by procedures such as affinity or immunoaffinity chromatography. Chemical tag moieties include such molecules as biotin, which may be added to either nucleic acids or proteins and facilitates isolation or detection by interaction with avidin reagents, and the like. Numerous other tag moieties are known to, and can be envisioned by, the trained artisan, and are contemplated to be within the scope of this definition.
The terms “transform”, “transfect”, “transduce”, shall refer to any method or means by which a nucleic acid is introduced into a cell or host organism and may be used interchangeably to convey the same meaning. Such methods include, but are not limited to, viral transduction, transfection, electroporation, microinjection, PEG-fusion and the like.
The introduced nucleic acid may or may not be integrated (covalently linked) into nucleic acid of the recipient cell or organism. In bacterial, yeast, plant and mammalian cells, for example, the introduced nucleic acid may be maintained as an episomal element or independent replicon such as a plasmid. Alternatively, the introduced nucleic acid may become integrated into the nucleic acid of the recipient cell or organism and be stably maintained in that cell or organism and further passed on or inherited to progeny cells or organisms of the recipient cell or organism. In other applications, the introduced nucleic acid may exist in the recipient cell or host organism only transiently.
A “clone” or “clonal cell population” is a population of cells derived from a single cell or common ancestor by mitosis.
A “cell line” is a clone of a primary cell or cell population that is capable of stable growth in vitro for many generations.
An “immune response” signifies any reaction produced by an antigen, such as a protein antigen, in a host having a functioning immune system. Immune responses may be either humoral, involving production of immunoglobulins or antibodies, or cellular, involving various types of B and T lymphocytes, dendritic cells, macrophages, antigen presenting cells and the like, or both. Immune responses may also involve the production or elaboration of various effector molecules such as cytokines, lymphokines and the like. Immune responses may be measured both in in vitro and in various cellular or animal systems.
An “antibody” or “antibody molecule” is any immunoglobulin, including antibodies and fragments thereof, that binds to a specific antigen. The term includes polyclonal, monoclonal, chimeric, and bispecific antibodies. As used herein, antibody or antibody molecule contemplates both an intact immunoglobulin molecule and an immunologically active portion of an immunoglobulin molecule such as those portions known in the art as Fab, Fab′, F(ab′)2 and F(v).
The term “about” as used herein refers to a variation in a stated value or indicated amount of up to 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0.75%, 0.5%, 0.25% or 0.1%, wherein the variation can be either an increase or a decrease in the stated value or indicated amount. Use of the term may, therefore, be used to establish a range of values or amounts.
As used herein, the term “naive CD4+ T cells” refers to a CD4+ T cell that is functionally defined by the expression of cell surface markers of naivety that include CD45RA+CD25-HLA-DR−.
As used herein, the term “serum-free culture medium” is defined as serum-free cell culture medium that has a defined chemical composition and supports proliferation of human lymphocytes. A list of serum-free culture medium useful in the present invention would include, without limitation, LONZA XVIVO-5, XVIVO-10, XVIVO-20, Sigma StemLine I, StemLine II, Yssel's media and AimV media.
Exemplary serum-free medium is described in the Example section presented herein. An exemplary serum-free medium is serum-free XVIVO-20 (Lonza), which may optionally be supplemented with penicillin-streptomycin.
MEM and RPMI are protein-free basal media that do not contain growth factors required for lymphocytes. A skilled practitioner would appreciate that a protein-free basal media can, however, be converted to serum-free media capable of supporting lymphocyte proliferation following addition of required growth factors. Such serum-free media contain specific and defined growth factors (e.g., insulin) that are required for lymphocyte proliferation.
As described herein, the present invention is directed to a method for promoting differentiation and proliferation of human T helper lymphocytes that express IL17 (Th-IL17+ cells) in vitro, the method comprising the steps of: isolating a population of naive CD4+ T cells from a human; and incubating the population of naive CD4+ T cells in serum-free culture medium comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23, wherein the incubating promotes differentiation of human Th-IL17+ cells.
As also described herein, the invention is directed to a method for generating a population of human T helper lymphocytes that express IL17 (Th-IL17+ cells) in vitro, the method comprising the steps of: isolating a population of naive CD4+ T cells from a human; and incubating the population of naive CD4+ T cells in serum-free culture medium comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23, wherein the incubating promotes differentiation and proliferation of human Th-IL17+ cells and thereby generates a population of human Th-IL17+ cells.
The in vitro methods of the invention are based on the novel and surprising discoveries of the present inventors. In short, the present inventors have devised an in vitro method for promoting human Th-IL17+ cell differentiation and proliferation, which also provides a method for generating in vitro a population of human Th-IL17+ cells. The method calls for incubation of naive CD4+ T cells in serum-free media supplemented with TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23. As described herein, “serum-free media comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23”, refers to serum-free media comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23 in amounts effective for promoting human Th-IL17+ cell differentiation. Conditions wherein naive CD4+ cells are incubated in serum-free media comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23 may also be referred to herein as human Th-IL17+ cell promoting conditions. A negative control for human Th-IL17+ cell promoting conditions is a matched serum-free media without cytokine supplementation (i.e., without TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23). An exemplary negative control for human Th-IL17+ cell promoting conditions is a matched serum-free media alone. It is to be understood that supplementation with standard media additives for prevention of bacterial or fungal infection (such as, e.g., penicillin-streptomycin) is not precluded from the method of the present invention. Indeed, in a particular embodiment of the present invention, the method calls for serum-free media comprising TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23, which is supplemented with penicillin-streptomycin. It is to be further understood that human Th-IL17+ cell promoting conditions may also include additional cytokine supplementation as described herein.
As taught herein, in vitro differentiation of human Th-IL17+ cells may be evaluated or measured by detecting an increase in the expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26, in a population of CD4+ T cells incubated in accordance with the present method. Each of these cellular molecules (IL17, IL17F, IL23R, RORC or IL26) serves as a positive marker indicative of human Th-IL17+ cell differentiation. Indeed, expression of IL17, IL17F, IL23R, RORC or IL26 is induced by 10- to about 100-fold in CD4+ cells incubated in human Th-IL17+ cell promoting conditions relative to those treated under negative control conditions. Accordingly, a change in the expression of at least one of these markers reflects a differential in human Th-IL17+ cell differentiation. More particularly, a change in the expression of at least one of these markers reflects a differential in human Th-IL17+ cell differentiation in a population of CD4+ cells incubated in human Th-IL17+ cell promoting conditions. A change in expression of any of these markers may be determined using a variety of experimental protocols, including, but not limited to, real-time PCR using appropriate primers. Experimental protocols that can be used to determine expression of such markers and relative expression levels are described in detail herein and are understood in the art.
In serum-free conditions in the absence of TGF-β, IL-1β, and any one of IL-6, IL-21 or IL-23, Th17 markers do not increase. The present inventors were, however, the first to define intermediate conditions, such as, e.g., that TGFβ alone induces RORγT expression and CCR6 expression, but not IL-17. Such intermediate conditions represent those conditions necessary to achieve a partial progression along the pathway of Th-17+ cell differentiation.
As used herein, an “agent”, “candidate compound”, or “test compound” may be used to refer to, for example, nucleic acids (e.g., DNA and RNA), carbohydrates, lipids, proteins, peptides, peptidomimetics, small molecules and other drugs. More particularly an agent may refer to azole-containing compounds, cholesterol derivative compounds, retinoid derivative compounds, short hairpin RNA (shRNA), small interfering RNA (siRNA), neutralizing and/or blocking antibodies, tryptophan derivative compounds, Vitamin D derivatives, or molecules known to inhibit fever, inflammation, or regulatory T (Treg) cell differentiation.
A short hairpin RNA (shRNA) is a sequence of RNA that makes a tight hairpin turn that can be used to silence gene expression via RNA interference. shRNA is generally expressed using a vector introduced into cells, wherein the vector utilizes the U6 promoter to ensure that the shRNA is always expressed. This vector is usually passed on to daughter cells, allowing the gene silencing to be inherited. The shRNA hairpin structure is cleaved by the cellular machinery into siRNA, which is then bound to the RNA-induced silencing complex (RISC). This complex binds to and cleaves mRNAs that match the siRNA to which it is bound.
Small interfering RNA (siRNA), sometimes known as short interfering RNA or silencing RNA, are a class of 20-25 nucleotide-long double-stranded RNA molecules that play a variety of roles in biology. Most notably, siRNA is involved in the RNA interference (RNAi) pathway whereby the siRNA interferes with the expression of a specific gene.
Azole-containing compounds are chemical compounds that contain at least an azole group. Azole groups are five-membered nitrogen heterocyclic ring compounds containing at least one other noncarbon atom, nitrogen, sulfur or oxygen. Azole groups are aromatic and have two double bonds. Azole-containing compounds comprise the family of Imidazole and triazole antifungals (e.g. Clotrimazole).
Sterol derivative compounds are compounds that are, for instance, intermediate in the pathway of cholesterol synthesis (mevalonate pathway). That includes lanosterol, FF-MAS (follicular fluid-meiosis-activating sterol).
Retinoid derivatives are compounds structurally related to Vitamin A and include, without limitation, retinoic acid.
Tryptophan derivative compounds are compounds that are generated from the degradation of tryptophan, through the action of, for instance, metabolism (Action of the IDO enzyme) or UVB radiation.
Vitamin D derivatives are compounds that are structurally related to Vitamin D and that include 1-25VitaminD3.
As described herein, an agent identified using the method of the present invention that is a “modulator of human Th-IL17+ cell differentiation” is defined as an agent that is capable of modulating (e.g., increasing or decreasing) in vitro differentiation of human Th-IL17+ cells. Such an agent may be identified by its ability to effect a change in the expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26, in a population of CD4+ T cells incubated in human Th-IL17+ cell promoting conditions. As described herein, each of these cellular molecules (IL17, IL17F, IL23R, RORC or IL26) serves as a positive marker indicative of human Th-IL17+ cell differentiation. Expression of IL17, IL17F, IL23R, RORC or IL26 can be induced by 10- to 100-fold in CD4+ T cells treated to promote Th-IL17+ cell differentiation relative to those treated under negative control conditions in accordance with the method of the present invention. In contrast, FOXP3 expression is inversely correlated with human Th-IL17+ cell differentiation. FOXP3, therefore, serves as a negative marker of human Th-IL17+ cell differentiation. Accordingly, a change in the expression of at least one of these markers (positive or negative) responsive to the presence of an agent reflects a differential in human Th-IL17+ cell differentiation. More particularly, a change in the expression of at least one of these markers reflects a differential in human Th-IL17+ cell differentiation in a population of cells incubated in human Th-IL17+ cell promoting conditions, wherein the change is dependent on incubation in the presence of a particular agent. As detailed below, experimental protocols of utility in determining expression of such markers and relative expression levels are described in detail herein and are understood in the art. Such experimental protocols, include, but are not limited to, real-time PCR using appropriate primers.
As taught herein, the change effected by an agent that is a modulator of human Th-IL17+ cell differentiation is determined relative to that of a population of CD4+ T cells incubated in parallel in the absence of the agent or in the presence of a control agent (as described below), either of which is analogous to a negative control condition.
In accordance with the present invention, the method described herein may be used to achieve an increase in the number of human Th17+ cells in a cell population incubated in human Th-IL17+ cell promoting conditions, as described herein. An increase in the number of human Th17+ cells in such a cell population may be expressed as the percent (%) of human Th17+ cells present in such a cell population relative to the total number of cells. In accordance with the present invention, the method described herein typically achieves 1% to 15% human Th17+ cells in a cell population. It will be appreciated, however, that the present method may be used to achieve a higher relative percent human Th17+ cells in a cell population. Accordingly, the present invention is not in any way limited to achieving 1% to 15% human Th17+ cells in a treated cell population.
In light of the above, it will be appreciated that an agent identified using the method of the present invention that is a “modulator of human Th-IL17+ cell differentiation” may be identified by its ability to effect a change in the percent of human Th17+ cells in a population of CD4+ T cells incubated in human Th-IL17+ cell promoting conditions. As taught herein, a change in the percent of human Th17+ cells in a population of CD4+ T cells incubated in the presence of an agent is determined relative to the percent of human Th17+ cells in a population of CD4+ T cells incubated in the absence of the agent or in the presence of a control agent (negative control condition).
The term “control substance”, “control agent”, or “control compound” as used herein refers a molecule that is inert or has no activity relating to an ability to modulate a biological activity. With respect to the present invention, such control substances are inert with respect to an ability to modulate human Th-IL17+ cell differentiation in vitro. Exemplary controls include, but are not limited to, solutions comprising physiological salt concentrations.
In accordance with the present invention, incubation in the presence of an agent that results in a decrease in expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26, indicates that the agent is an inhibitor of human Th-IL17+ cell differentiation in vitro. An agent that results in a decrease in expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26, is referred to herein as an inhibitor of human Th-IL17+ cell differentiation. An inhibitor of human Th-IL17+ cell differentiation is an agent that effects at least a 2-fold decrease in the expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26. More particularly, an inhibitor of human Th-IL17+ cell differentiation is an agent that effects at least a 3-fold decrease in the expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26. The above fold decreases may be determined relative to human Th-IL17+ cell marker expression levels induced by incubation in human Th-IL17+ cell promoting conditions in the absence of the agent.
In accordance with the present invention, incubation in the presence of an agent that results in an increase in expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26, indicates that the agent is a promoter of human Th-IL17+ cell differentiation in vitro. An agent that results in an increase in expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26, is referred to herein as a promoter of human Th-IL17+ cell differentiation. A promoter of human Th-IL17+ cell differentiation is an agent that effects at least a 2-fold increase in the expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26. More particularly, a promoter of human Th-IL17+ cell differentiation is an agent that effects at least a 3-fold increase in the expression of a human Th-IL17+ cell marker, such as IL17, IL17F, IL23R, RORC or IL26. The above fold increases may be determined relative to human Th-IL17+ cell marker expression levels induced by incubation in human Th-IL17+ cell promoting conditions in the absence of the agent.
Also in accordance with the present invention, incubation in the presence of an agent that results in a decrease in expression of FOXP3 (expression of which is inversely correlated with human Th-IL17+ cell differentiation) indicates that the agent is a promoter or inducer of human Th-IL17+ cell differentiation in vitro. An agent that results in a decrease in expression of FOXP3 is, therefore, referred to herein as a promoter or inducer of human Th-IL17+ cell differentiation. A promoter or inducer of human Th-IL17+ cell differentiation is an agent that effects at least a 2-fold decrease in the expression of FOXP3. More particularly, a promoter or inducer of human Th-IL17+ cell differentiation is an agent that effects at least a 3-fold decrease in the expression of FOXP3. The above fold decreases are determined relative to FOXP3 expression levels observed under matched control conditions, but in the absence of the agent.
Also in accordance with the present invention, incubation in the presence of an agent that results in an increase in expression of FOXP3 (expression of which is inversely correlated with human Th-IL17+ cell differentiation) indicates that the agent is an inhibitor of human Th-IL17+ cell differentiation in vitro. An agent that results in an increase in expression of FOXP3 is, therefore, referred to herein as an inhibitor of human Th-IL17+ cell differentiation. An inhibitor of human Th-IL17+ cell differentiation is an agent that effects at least a 2-fold increase in the expression of FOXP3. More particularly, an inhibitor of human Th-IL17+ cell differentiation is an agent that effects at least a 3-fold increase in the expression of FOXP3. The above fold increases are determined relative to FOXP3 expression levels observed under matched control conditions, but in the absence of the agent.
In accordance with the present invention, incubation in the presence of an agent that results in a decrease in the percent of human Th17+ cells generated indicates that the agent inhibits human Th-IL17+ cell differentiation in vitro. Such an agent is referred to herein as an inhibitor of human Th-IL17+ cell differentiation. An inhibitor of human Th-IL17+ cell differentiation is an agent that effects at least a 2-fold decrease in the percent of human Th17+ cells generated. More particularly, an inhibitor of human Th-IL17+ cell differentiation is an agent that effects at least a 3-fold decrease in the percent of human Th17+ cells generated. The above fold decreases may be determined relative to the percent of human Th17+ cells generated by incubation in human Th-IL17+ cell promoting conditions in the absence of the agent.
In accordance with the present invention, incubation in the presence of an agent that results in an increase in the percent of human Th17+ cells generated indicates that the agent promotes human Th-IL17+ cell differentiation in vitro. Such an agent is referred to herein as a promoter/inducer of human Th-IL17+ cell differentiation. A promoter or inducer of human Th-IL17+ cell differentiation is an agent that effects at least a 2-fold increase in the percent of human Th17+ cells generated. More particularly, a promoter/inducer of human Th-IL17+ cell differentiation is an agent that effects at least a 3-fold increase in the percent of human Th17+ cells generated. The above fold increases may be determined relative to the percent of human Th17+ cells generated by incubation in human Th-IL17+ cell promoting conditions in the absence of the agent.
It is to be understood that agents capable of modulating human Th-IL17+ cell differentiation, as determined using the in vitro method described herein, are likely to exhibit similar modulatory capacity in applications in vivo.
Modulatory agents identified using the screening methods of the present invention and compositions thereof can thus be administered for therapeutic treatments. In therapeutic applications, modulatory agents that inhibit Th17+ T cell differentiation (i.e., inhibitors of Th17+ T cell differentiation) and compositions thereof are administered to a patient suffering from an inflammatory or autoimmune disorder in an amount sufficient to at least partially arrest a symptom or symptoms of the disease and its complications. An amount adequate to accomplish this is defined as a “therapeutically effective amount or dose.” Amounts effective for this use will depend on the severity of the disease and the weight and general state of the patient.
Examples of inflammatory or autoimmune disorders that may be treated using inhibitors of Th17+ T cell differentiation include, without limitation, multiple sclerosis, rheumatoid arthritis, Crohn's disease, and ulcerative colitis.
Based on the guidance presented herein and knowledge in the relevant scientific fields, the expression level of a cellular marker of human Th-IL17+ cells can be determined using a variety of techniques. Exemplary markers of human Th-IL17+ cell differentiation include, but are not limited to, IL17, IL17F, IL23R, RORC and IL26. Expression of FOXP3, on the other hand, is negatively correlated with human Th-IL17+ cell differentiation. FOXP3 is, therefore, a negative marker of human Th-IL17+ cell differentiation. Expression levels of such markers (either a positive or a negative marker) may be assessed with respect to expressed nucleic acid corresponding to a cell marker (e.g., mRNA, total RNA) or with respect to polypeptides encoded by same. A variety of standard protocols may be used to determine, for example, RNA level, including, but not limited to: polymerase chain amplification and detection of amplified products therefrom, ribonuclease protection (RNase protection) assay, and Northern blot analysis. The principles and general procedures of each of these methods are described in, for example, Dvorak et al. (Biomed Papers 147:131, 2003), which is incorporated herein in its entirety. The principles and general procedures of each of these methods are, moreover, known in the art. In a particular embodiment of the invention, real-time PCR is used to detect gene expression of human Th-IL17+ cell markers.
As taught herein, detection of IL-17, IL17F, IL23R, RORC or IL26 gene expression may be used as a means to assess human Th-IL17+ differentiation. Detection of these markers of human Th-IL17+ differentiation, therefore, provides positive indicators or readouts for the present method for promoting differentiation and proliferation of human Th-IL17+ differentiation. The induction of these genes in Th17 promoting conditions is at least 10-fold, and can achieve about 100-fold relative to the levels of these genes in non-promoting conditions. Particulars relating to real-time PCR analysis are presented in the Examples, as are primers for amplification of the above-indicated Th-IL17 markers. See Table 2.
In non-Th17 promoting conditions, there are detectable levels of the Th-IL17 marker genes at the level of RNA, but there is no detectable protein. The absence of detectable protein, therefore, presents a relevant baseline against which to compare Th-IL17 marker protein levels.
Detection of FOXP3 gene expression may also be used as a means to assess human Th-IL17+ differentiation. Detection of this negative marker of human Th-IL17+ differentiation provides a negative indicator or readout for the present method for promoting differentiation and proliferation of human Th-IL17+ differentiation. A reduction in FOXP3 gene expression, however, provides a positive indicator or readout for the present method for promoting differentiation and proliferation of human Th-IL17+ differentiation. The reduction of FOXP3 expression in Th17 promoting conditions is at least two-fold, and can achieve about ten-fold relative to the levels of this gene in non-promoting conditions.
A variety of protocols are available for measuring and/or detecting expression levels of polypeptides. Protocols for detecting polypeptide expression, such as, for example, immunohistochemistry and immunoblotting, are known in the art. These protocols are generally applicable to detecting IL17, IL17F, IL23R, RORC, IL26, or FOXP3 polypeptides. Particular methods for detecting IL17, IL17F, IL23R, RORC, IL26, or FOXP3 polypeptides are described in the Examples presented herein, as are reagents for performing such methods.
In general, immunoassays for polypeptides typically comprise contacting a sample, such as a population of cells (e.g., incubated in Th17 promoting conditions or lysates thereof) in the presence of an antibody that specifically or selectively binds to a polypeptide in question, e.g., a detectably labeled antibody capable of identifying, the particular polypeptide (e.g., IL-17), and detecting the bound antibody by any of a number of techniques well-known in the art (e.g., Western blot, ELISA, FACS).
The biological sample may be brought in contact with and immobilized onto a solid phase support or carrier such as nitrocellulose, or other solid support that is capable of immobilizing cells, cell particles or soluble proteins. The support may then be washed with suitable buffers followed by treatment with the detectably labeled antibody that selectively or specifically binds to the particular polypeptide (e.g., a Th17 cell marker). The solid phase support may then be washed with the buffer a second time to remove unbound antibody. The amount of bound label on a solid support may then be detected by conventional means.
More particularly, Th-IL17 marker protein levels can be assessed by cell surface staining for CCR6 and IL23R; ELISA for IL-17, IL-17F, and IL-26; intracellular staining for IL17, IL17F, IL26, FOXP3 (negative marker), and RORC; and Western Blot for IL-17, IL-17F, IL23R, RORC, IL26, FOXP3 (negative marker).
By “solid phase support or carrier” is intended any support capable of binding an antigen or an antibody. Well-known supports or carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, gabbros, and magnetite. The nature of the carrier can be either soluble to some extent or insoluble for the purposes of the present invention. The support material may have virtually any possible structural configuration so long as the coupled molecule is capable of binding to an antigen or antibody. Thus, the support configuration may be spherical, as in a bead, or cylindrical, as in the inside surface of a test tube, or the external surface of a rod. Alternatively, the surface may be flat such as a sheet, test strip, etc. Particular supports include polystyrene beads. Those skilled in the art will know many other suitable carriers for binding antibody or antigen, or will be able to ascertain the same by use of routine experimentation.
An antibody can be detectably labeled by linking same to an enzyme and using the labeled antibody in an enzyme immunoassay (EIA) (Voller, A., “The Enzyme Linked Immunosorbent Assay (ELISA)”, 1978, Diagnostic Horizons 2:1, Microbiological Associates Quarterly Publication, Walkersville, Md.); Voller, A. et al., 1978, J. Clin. Pathol. 31: 507-520; Butler, J. E., 1981, Meth. Enzymol. 73:482; Maggio, E. (ed.), 1980, Enzyme Immunoassay, CRC Press, Boca Raton, Fla.; Ishikawa, E. et al., (eds.), 1981, Enzyme Immunoassay, Kgaku Shoin, Tokyo). The enzyme that is bound to the antibody reacts with an appropriate substrate, particularly a chromogenic substrate, in such a manner as to produce a chemical moiety detectable, for example, by spectrophotometric, fluorimetric or by visual means. Enzymes which can be used to detectably label the antibody include, but are not limited to, malate dehydrogenase, staphylococcal nuclease, delta-5-steroid isomerase, yeast alcohol dehydrogenase, alpha-glycerophosphate, dehydrogenase, triose phosphate isomerase, horseradish peroxidase, alkaline phosphatase, asparaginase, glucose oxidase, beta-galactosidase, ribonuclease, urease, catalase, glucose-6-phosphate dehydrogenase, glucoamylase and acetylcholinesterase. The detection can be accomplished by colorimetric methods that employ a chromogenic substrate for the enzyme. Detection may also be accomplished by visual comparison of the extent of enzymatic reaction of a substrate in comparison with similarly prepared standards.
Detection may also be accomplished using any of a variety of other immunoassays. For example, by radioactively labeling the antibodies or antibody fragments, it is possible to detect a polypeptide through the use of a radioimmunoassay (MA). The radioactive isotope can be detected by such means as the use of a gamma counter or a scintillation counter or by autoradiography.
An antibody may also be labeled with a fluorescent compound. When the fluorescently labeled antibody is exposed to light of the proper wavelength, its presence can be detected due to fluorescence emission. Among the most commonly used fluorescent labeling compounds are fluorescein isothiocyanate, rhodamine, phycoerythrin, phycocyanin, allophycocyanin, o-phthaldehyde and fluorescamine.
An antibody can also be detectably labeled using fluorescence emitting metals such as152Eu, or others of the lanthanide series. These metals can be attached to the antibody using such metal chelating groups as diethylenetriaminepentacetic acid (DTPA) or ethylenediaminetetraacetic acid (EDTA).
An antibody can also be detectably labeled by coupling it to a chemiluminescent compound. The presence of the chemiluminescent-tagged antibody is determined by detecting the presence of luminescence that arises during the course of a chemical reaction. Examples of particularly useful chemiluminescent labeling compounds are luminol, isoluminol, theromatic acridinium ester, imidazole, acridinium salt and oxalate ester.
Likewise, a bioluminescent compound may be used to label an antibody. Bioluminescence is a type of chemiluminescence found in biological systems in which a catalytic protein increases the efficiency of the chemiluminescent reaction. The presence of a bioluminescent protein is determined by detecting the presence of luminescence. Important bioluminescent compounds for purposes of labeling are luciferin, luciferase and aequorin.
The basic molecular biology techniques used to practice the methods of the invention are well known in the art, and are described for example in Sambrook et al., 1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York; Ausubel et al., 1988, Current Protocols in Molecular Biology, John Wiley & Sons, New York; and Ausubel et al., 2002, Short Protocols in Molecular Biology, John Wiley & Sons, New York).
The invention provides methods for identifying agents (e.g., candidate compounds or test compounds) that modulate (inhibit or promote) human Th-IL17+ differentiation. Agents that are capable of inhibiting human Th-IL17+ differentiation, as identified by the screening method of the invention, are useful as candidate anti-inflammatory or anti-autoimmune disorder therapeutics.
A list of inflammatory or anti-autoimmune disorders that may be treated using an agent identified using a method of the invention includes, without limitation: arthritis, diabetes, multiple sclerosis, uveitis, rheumatoid arthritis, psoriasis, osteoporosis, asthma, bronchitis, allergic rhinitis, chronic obstructive pulmonary disease, atherosclerosis, H. pylori infections and ulcers resulting from such infection, graft versus host disease following bone marrow transplantation, and inflammatory bowel diseases. Inflammatory bowel diseases treatable using agents identified by the present methods include Crohn's disease, ulcerative colitis, sprue and food allergies. An inflammatory disease or condition may involve any organ or tissue in which the presence of TH17 cells has been demonstrated and/or implicated in disease etiology. Other diseases known to produce immunopathological damage in the host, which may benefit from treatment with an agent identified using a method of the invention, may be selected from the group consisting of Hepatitis C virus, Influenza, SARS, and respiratory syncytial virus. The involvement of TH17 related genes autotoxin and maspin also suggests that prostate and breast cancers may be treated using an agent identified using a method of the invention. Evidence that the balance of TH17 and Treg cells is specifically altered in human immunodeficiency virus (HIV) infections also suggests that immunodeficiencies and HIV infection may be treated using an agent identified using a method of the invention.
Examples of agents, candidate compounds or test compounds include, but are not limited to, nucleic acids (e.g., DNA and RNA), carbohydrates, lipids, proteins, peptides, peptidomimetics, small molecules and other drugs. Agents can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the “one-bead one-compound” library method; and synthetic library methods using affinity chromatography selection. The biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds (Lam (1997) Anticancer Drug Des. 12:145; U.S. Pat. No. 5,738,996; and U.S. Pat. No. 5,807,683, each of which is incorporated herein in its entirety by reference).
Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt et al. (1993) Proc. Natl. Acad. Sci. USA 90:6909; Erb et al. (1994) Proc. Natl. Acad. Sci. USA 91:11422; Zuckermann et al. (1994) J. Med. Chem. 37:2678; Cho et al. (1993) Science 261:1303; Carrell et al. (1994) Angew. Chem. Int. Ed. Engl. 33:2059; Carell et al. (1994) Angew. Chem. Int. Ed. Engl. 33:2061; and Gallop et al. (1994) J. Med. Chem. 37:1233, each of which is incorporated herein in its entirety by reference.
Libraries of compounds may be presented, e.g., presented in solution (e.g., Houghten (1992) Bio/Techniques 13:412-421), or on beads (Lam (1991) Nature 354:82-84), chips (Fodor (1993) Nature 364:555-556), bacteria (U.S. Pat. No. 5,223,409), spores (U.S. Pat. Nos. 5,571,698; 5,403,484; and 5,223,409), plasmids (Cull et al. (1992) Proc. Natl. Acad. Sci. USA 89:1865-1869) or phage (Scott and Smith (19900 Science 249:386-390; Devlin (1990) Science 249:404-406; Cwirla et al. (1990) Proc. Natl. Acad. Sci. USA 87:6378-6382; and Felici (1991) J. Mol. Biol. 222:301-310), each of which is incorporated herein in its entirety by reference.
The invention provides for treatment of inflammatory and/or autoimmune disorders by administration of a therapeutic agent identified using the above-described methods. Such agents include, but are not limited to proteins, peptides, protein or peptide derivatives or analogs, antibodies, nucleic acids, and small molecules.
The invention provides methods for treating patients afflicted with an inflammatory and/or autoimmune disorder comprising administering to a subject an effective amount of a compound identified by the method of the invention. In a particular aspect, the compound is substantially purified (e.g., substantially free from substances that limit its effect or produce undesired side-effects). The subject is particularly an animal, including but not limited to animals such as cows, pigs, horses, chickens, cats, dogs, etc., and is more particularly a mammal, and most particularly a human. In a specific embodiment, a non-human mammal is the subject.
Formulations and methods of administration that can be employed when the compound comprises a nucleic acid are described above; additional appropriate formulations and routes of administration are described below.
Various delivery systems are known and can be used to administer a compound of the invention, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the compound, receptor-mediated endocytosis (see, e.g., Wu and Wu (1987) J. Biol. Chem. 262:4429-4432), and construction of a nucleic acid as part of a retroviral or other vector. Methods of introduction can be enteral or parenteral and include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The compounds may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local. In addition, it may be desirable to introduce the pharmaceutical compositions of the invention into the central nervous system by any suitable route, including intraventricular and intrathecal injection; intraventricular injection may be facilitated by an intraventricular catheter, for example, attached to a reservoir, such as an Ommaya reservoir. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.
In a specific embodiment, it may be desirable to administer the pharmaceutical compositions of the invention locally, e.g., by local infusion during surgery, topical application, e.g., by injection, by means of a catheter, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers.
In another embodiment, the compound can be delivered in a vesicle, in particular a liposome (see Langer (1990) Science 249:1527-1533; Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid.)
In yet another embodiment, the compound can be delivered in a controlled release system. In one embodiment, a pump may be used (see Langer, supra; Sefton (1987) CRC Crit. Ref. Biomed. Eng. 14:201; Buchwald et al. (1980) Surgery 88:507; Saudek et al., 1989, N. Engl. J. Med. 321:574). In another embodiment, polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Fla. (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, New York (1984); Ranger and Peppas, J., 1983, Macromol. Sci. Rev. Macromol. Chem. 23:61; see also Levy et al. (1985) Science 228:190; During et al. (1989) Ann. Neurol. 25:351; Howard et al. (1989) J. Neurosurg. 71:105). In yet another embodiment, a controlled release system can be placed in proximity of the therapeutic target, e.g., an inflammatory site, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)). Other controlled release systems are discussed in the review by Langer (1990, Science 249:1527-1533).
The present invention also provides pharmaceutical compositions. Such compositions comprise a therapeutically effective amount of an agent and a pharmaceutically acceptable carrier. In a particular embodiment, the term “pharmaceutically acceptable” means approved by a regulatory agency of the federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in “Remington's Pharmaceutical Sciences” by E. W. Martin, incorporated in its entirety by reference herein. Such compositions will contain a therapeutically effective amount of the compound, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the subject. The formulation should suit the mode of administration.
In a particular embodiment, the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lidocaine to ease pain at the site of the injection. Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
The compounds of the invention can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
The amount of the compound of the invention which will be effective in the treatment of an inflammatory or autoimmune disorder (e.g., Crohn's disease) can be determined by standard clinical techniques based on the present description. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each subject's circumstances. However, suitable dosage ranges for intravenous administration are generally about 20-500 micrograms of active compound per kilogram body weight. Suitable dosage ranges for intranasal administration are generally about 0.01 pg/kg body weight to 1 mg/kg body weight. Suppositories generally contain active ingredient in the range of 0.5% to 10% by weight; oral formulations preferably contain 10% to 95% active ingredient. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.
The invention provides methods of identifying agents capable of modulating human Th-IL17+ cell differentiation. Accordingly, the invention encompasses administration of a nucleic acid encoding a peptide or protein capable of modulating human Th-IL17+ cell differentiation, as well as antisense sequences or catalytic RNAs capable of interfering with human Th-IL17+ cell differentiation.
Any suitable methods for administering a nucleic acid sequence available in the art can be used according to the present invention.
Methods for administering and expressing a nucleic acid sequence are generally known in the area of gene therapy. For general reviews of the methods of gene therapy, see Goldspiel et al. (1993) Clinical Pharmacy 12:488-505; Wu and Wu (1991) Biotherapy 3:87-95; Tolstoshev (1993) Ann. Rev. Pharmacol. Toxicol. 32:573-596; Mulligan (1993) Science 260:926-932; and Morgan and Anderson (1993) Ann. Rev. Biochem. 62:191-217; May (1993) TIBTECH 11(5): 155-215. Methods commonly known in the art of recombinant DNA technology which can be used in the present invention are described in Ausubel et al. (eds.), 1993, Current Protocols in Molecular Biology, John Wiley & Sons, NY; and Kriegler (1990) Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY.
In a particular aspect, the compound comprises a nucleic acid encoding a peptide or protein capable of modulating human Th-IL17+ cell differentiation, such nucleic acid being part of an expression vector that expresses the peptide or protein in a suitable host. In particular, such a nucleic acid has a promoter operably linked to the coding region, said promoter being inducible or constitutive (and, optionally, tissue-specific). In another particular embodiment, a nucleic acid molecule is used in which the coding sequences and any other desired sequences are flanked by regions that promote homologous recombination at a desired site in the genome, thus providing for intrachromosomal expression of the nucleic acid (Koller and Smithies (1989) Proc. Natl. Acad. Sci. USA 86:8932-8935; Zijlstra et al. (1989) Nature 342:435-438).
Delivery of the nucleic acid into a subject may be direct, in which case the subject is directly exposed to the nucleic acid or nucleic acid-carrying vector; this approach is known as in vivo gene therapy. Alternatively, delivery of the nucleic acid into the subject may be indirect, in which case cells are first transformed with the nucleic acid in vitro and then transplanted into the subject, known as “ex vivo gene therapy”.
In another embodiment, the nucleic acid is directly administered in vivo, where it is expressed to produce the encoded product. This can be accomplished by any of numerous methods known in the art, e.g., by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by infection using a defective or attenuated retroviral or other viral vector (see U.S. Pat. No. 4,980,286); by direct injection of naked DNA; by use of microparticle bombardment (e.g., a gene gun; Biolistic, Dupont); by coating with lipids, cell-surface receptors or transfecting agents; by encapsulation in liposomes, microparticles or microcapsules; by administering it in linkage to a peptide which is known to enter the nucleus; or by administering it in linkage to a ligand subject to receptor-mediated endocytosis (see, e.g., Wu and Wu, 1987, J. Biol. Chem. 262:4429-4432), which can be used to target cell types specifically expressing the receptors.
In another embodiment, a nucleic acid-ligand complex can be formed in which the ligand comprises a fusogenic viral peptide to disrupt endosomes, allowing the nucleic acid to avoid lysosomal degradation. In yet another embodiment, the nucleic acid can be targeted in vivo for cell specific uptake and expression, by targeting a specific receptor (see, e.g., PCT Publications WO 92/06180 dated Apr. 16, 1992 (Wu et al.); WO 92/22635 dated Dec. 23, 1992 (Wilson et al.); WO92/20316 dated Nov. 26, 1992 (Findeis et al.); WO93/14188 dated Jul. 22, 1993 (Clarke et al.), WO 93/20221 dated Oct. 14, 1993 (Young)). Alternatively, the nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination (Koller and Smithies, 1989, Proc. Natl. Acad. Sci. USA 86:8932-8935; Zijlstra et al. (1989) Nature 342:435-438).
In a further embodiment, a retroviral vector can be used (see Miller et al. (1993) Meth. Enzymol. 217:581-599). These retroviral vectors have been modified to delete retroviral sequences that are not necessary for packaging of the viral genome and integration into host cell DNA. The nucleic acid encoding a desired polypeptide to be used in gene therapy is cloned into the vector, which facilitates delivery of the gene into a subject. More detail about retroviral vectors can be found in Boesen et al. (1994) Biotherapy 6:291-302, which describes the use of a retroviral vector to deliver the mdr1 gene to hematopoietic stem cells in order to make the stem cells more resistant to chemotherapy. Other references illustrating the use of retroviral vectors in gene therapy are: Clowes et al. (1994) J. Clin. Invest. 93:644-651; Kiem et al. (1994) Blood 83:1467-1473; Salmons and Gunzberg (1993) Human Gene Therapy 4:129-141; and Grossman and Wilson (1993) Curr. Opin. in Genetics and Devel. 3:110-114.
Adenoviruses may also be used effectively in gene therapy. Adenoviruses are especially attractive vehicles for delivering genes to respiratory epithelia. Adenoviruses naturally infect respiratory epithelia where they cause a mild disease. Other targets for adenovirus-based delivery systems are liver, the central nervous system, endothelial cells, and muscle. Adenoviruses have the advantage of being capable of infecting non-dividing cells. Kozarsky and Wilson (1993) Current Opinion in Genetics and Development 3:499-503 present a review of adenovirus-based gene therapy. Bout et al. (1994) Human Gene Therapy 5:3-10 demonstrated the use of adenovirus vectors to transfer genes to the respiratory epithelia of rhesus monkeys. Other instances of the use of adenoviruses in gene therapy can be found in Rosenfeld et al. (1991) Science 252:431-434; Rosenfeld et al. (1992) Cell 68:143-155; Mastrangeli et al. (1993) J. Clin. Invest. 91:225-234; PCT Publication WO94/12649; and Wang, et al. (1995) Gene Therapy 2:775-783. Adeno-associated virus (AAV) has also been proposed for use in gene therapy (Walsh et al. (1993) Proc. Soc. Exp. Biol. Med. 204:289-300; U.S. Pat. No. 5,436,146).
Another suitable approach to gene therapy involves transferring a gene to cells in tissue culture by such methods as electroporation, lipofection, calcium phosphate mediated transfection, or viral infection. Usually, the method of transfer includes the transfer of a selectable marker to the cells. The cells are then placed under selection to isolate those cells that have taken up and are expressing the transferred gene. Those cells are then delivered to a subject.
In this embodiment, the nucleic acid is introduced into a cell prior to administration in vivo of the resulting recombinant cell. Such introduction can be carried out by any method known in the art, including but not limited to transfection, electroporation, microinjection, infection with a viral or bacteriophage vector containing the nucleic acid sequences, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, spheroplast fusion, etc. Numerous techniques are known in the art for the introduction of foreign genes into cells (see, e.g., Loeffler and Behr (1993) Meth. Enzymol. 217:599-618; Cohen et al. (1993) Meth. Enzymol. 217:618-644; Cline (1985) Pharmac. Ther. 29:69-92) and may be used in accordance with the present invention, provided that the necessary developmental and physiological functions of the recipient cells are not disrupted. The technique should provide for the stable transfer of the nucleic acid to the cell, so that the nucleic acid is expressible by the cell and preferably heritable and expressible by its cell progeny.
The resulting recombinant cells can be delivered to a subject by various methods known in the art. In a particular embodiment, epithelial cells are injected, e.g., subcutaneously. In another embodiment, recombinant skin cells may be applied as a skin graft onto the subject; recombinant blood cells (e.g., hematopoietic stem or progenitor cells) are preferably administered intravenously. The amount of cells envisioned for use depends on the desired effect, the condition of the subject, etc., and can be determined by one skilled in the art.
Cells into which a nucleic acid can be introduced for purposes of gene therapy encompass any desired, available cell type, and include but are not limited to neuronal cells, glial cells (e.g., oligodendrocytes or astrocytes), epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes; blood cells such as T lymphocytes, B lymphocytes, monocytes, macrophages, neutrophils, eosinophils, megakaryocytes, granulocytes; various stem or progenitor cells, in particular hematopoietic stem or progenitor cells, e.g., as obtained from bone marrow, umbilical cord blood, peripheral blood or fetal liver. In a particular embodiment, the cell used for gene therapy is autologous to the subject that is treated.
In another embodiment, the nucleic acid to be introduced for purposes of gene therapy may comprise an inducible promoter operably linked to the coding region, such that expression of the nucleic acid is controllable by adjusting the concentration of an appropriate inducer of transcription.
Direct injection of a DNA coding for a peptide or protein capable of modulating human Th-IL17+ cell differentiation may also be performed according to, for example, the techniques described in U.S. Pat. No. 5,589,466. These techniques involve the injection of “naked DNA”, i.e., isolated DNA molecules in the absence of liposomes, cells, or any other material besides a suitable carrier. The injection of DNA encoding a protein and operably linked to a suitable promoter results in the production of the protein in cells near the site of injection.
The novel methods of the present invention facilitate the generation of a homogeneous population of human Th-IL17+ cells comprising about or at least 109 homogeneous human Th-IL17+ cells, wherein the human Th-IL17+ cells do not express cellular markers of other differentiated Th (non-Th-IL17+) cells. More specifically, the isolated homogeneous population of human Th-IL17+ cells generated from naive CD4+ cells do not express cellular markers characteristic of Th1, Th2, or Treg cells. It is understood that cellular markers characteristic of Th1, Th2, or Treg cells would be present in any population of Th-IL17+ cells generated from memory Th cells. Cellular markers characteristic of Th1 cells include, for example, IFN-γ; cellular markers of Th2 cells include, for example, IL4 or IL13; and cellular markers of Treg cells include, for example, FoxP3. Accordingly, a homogeneous population of human Th-IL17+ cells of the present invention does not include cells that express IFN-γ, IL4, IL13 or FoxP3.
The isolated population of about or at least 109 human Th-IL17+ cells generated from naive CD4+ cells as described herein is, therefore, homogeneous with respect to the expression of only those cellular markers characteristic of Th-IL17+ cells. Exemplary markers of human Th-IL17 cells are IL-17, IL-17F, IL-26, and IL23R.
Prior to the present method, an isolated, homogeneous population of about or at least about 109 human Th-IL17+ cells, wherein the human Th-IL17+ cells do not express cellular markers of other differentiated Th (non-Th-IL17+) cells, had not been generated.
It is noteworthy in this regard that Th-IL17+ cells generated from memory T cells are not homogenous because they also contain Th1/Th2/Treg cells, as well as cells expressing various combinations of the cytokines, including Th1/Th17 combinations
As used herein and understood in the art, a human T helper type 1 (Th1) cell is a human cell of the CD4 T cell lineage (CD3+CD4+) that expresses at least one marker of differentiation into a Th1 cell, such as IFNγ.
As used herein and understood in the art, a human T helper type 2 (Th2) cell is a human cell of the CD4 T cell lineage (CD3+CD4+) that expresses at least one marker of differentiation into a Th2 cell, such as IL-4 or IL-13.
As used herein and understood in the art, a human T regulatory (Treg) cell is a human cell of the CD4 T cell lineage (CD3+CD4+) that expresses at least one marker of differentiation into a Treg cell, such as FoxP3.
Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs.
It is to be understood that this invention is not limited to particular assay methods, or test agents and experimental conditions described, as such methods and agents may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only the appended claims.
To avoid having antigen-experienced cells and serum-derived TGF-β in the Th17 differentiation cultures, the present inventors used human cord blood CD4+ T cells and serum-free medium. Under these conditions, induction of IL-17 and other Th17 gene products was observed only if TGF-β was added to the culture medium. In contrast to requirements in mouse T cell cultures, human Th17 cell differentiation was not observed when IL-6 or IL-21 was combined with TGF-β. Instead, IL-1β and any one of IL-6, IL-21 or IL-23 were required in combination with TGF-β for induction of IL-17 expression. As in mouse, RORγT was induced by TGF-β and was required and sufficient for expression of Th17 cell products, suggesting that the basic mechanism of Th17 cell differentiation is evolutionarily conserved.
In accordance with the novel and surprising results presented herein, the present inventors have developed a new method for promoting differentiation and proliferation of human T helper lymphocytes that express IL17 (Th-IL17+ cells) in vitro. The instant method is also well suited to screening methods whereby modulators (inhibitors or promoters/inducers) of human Th-IL17+ cell differentiation are identified. The present method is also useful for generating homogeneous populations of human Th-IL17+ cells.
Blood samples were obtained from the New York Blood Center. Mononuclear cells were prepared from buffy coats of healthy adult donors or from cord blood on FicollPAQUE gradients. CD4+ T cells were isolated on an autoMACS Pro using Miltenyi bead depletion of CD14+ and CD25+ cells followed by positive selection of CD4+ cells. Cord blood CD4+ T cells were >97% pure and 100% CD45RA+ and were used as such for initial transduction experiments. Adult CD4+ T cell subsets and naive cord blood CD4+ T cells were further purified respectively as CD3+CD4+CD25−CD45RO−/+ and CD3+CD4+CD25−HLA-DR−CD45RA+ by cell sorting on a FACSAria.
Cells were cultivated in either RPMI1640 (Invitrogen) supplemented with 10% fetal bovine serum (Hyclone), penicillin-streptomycin, 2 mM glutamine, 10 mM HEPES, 1 mM pyruvate and 0.1 mM non-essential amino acids or serum-free XVIVO-20 (Lonza) supplemented with penicillin-streptomycin in a 37° C. 5% CO2 incubator. CD4+ T cells were stimulated by addition of anti-mouse IgG magnetic beads (Pierce) previously coated with purified anti-CD3 and anti-CD28 at final concentrations of 1 bead/cell and 1 μg/ml of each antibody. For transduction experiments, cells were seeded at a concentration of 106 cells/ml in 24 well plates with anti-CD3/CD28 coated beads, 10 μg/ml polybrene and 10 U/ml IL-2 at day 0. Lentiviral supernatants were added at an MOI ranging from 1 to 10. Cells were washed at day 1 and split as needed in the presence of IL-2. For the shRNA experiment, puromycin was added at day 2 at 2 μg/ml. For polarization experiments, cells were seeded at a concentration of 5×105 to 106 cells/ml in U-bottom 96 well plates with anti-CD3/CD28 coated beads. IL-2 at 10 U/ml was either added at day 0 or day 3. Media was replaced at day 3 and cells were split in the presence of IL-2. For long-term experiments, cells were split as needed. In some cases, 10 ng/ml IL-1β (eBioscience), 10 ng/ml IL-6 (eBioscience), 10 ng/ml IL-21 (Cell Sciences), 10 ng/ml IL-23 (eBioscience), various concentrations of TGF-β1 (PeproTech), neutralizing soluble IL-21R (R&D) and neutralizing antibodies against IL-2, IL-4, IL-6, IFNγ or TGF-β (1 μg/ml except noted otherwise; see Table 1 for details) were added at day 0 and maintained throughout the experiment. Cells were harvested at day 6 for intracellular staining and real-time PCR analysis except where specified otherwise.
For intracellular cytokine staining, cells were incubated for 5 hours with 50 ng/ml PMA (Sigma), 500 ng/ml Ionomycin (Sigma), and GolgiStop (BD). Surface staining was performed by incubation with the corresponding fluorescently labeled antibodies for 15 min on ice. Intracellular staining was performed using the Cytofix/Cytoperm buffer set (BD). Briefly, cells were fixed and permeabilized for 30 min at room temperature and stained in permeabilization buffer for 30 min at room temperature. Flow cytometric measures were performed on a LSR II (BD Biosciences) instrument and analyzed using FlowJo software (Tree Star Inc.). Antibodies are detailed in Table 1. FOXP3 was stained using FOXP3 staining buffers (eBioscience). The present inventors used the FJK-16s antibody, which was originally reported as an anti-mouse/rat FoxP3 antibody. Indeed, the present inventors have observed that, unlike most anti-human FOXP3 antibodies available, this antibody robustly stains endogenous and over-expressed human full-length FOXP3.
Human RORγT was cloned from human thymus. A double FLAG tag (DFTC) was added at the N-terminus. Human RORα isoform d was cloned from peripheral CD4+ T cells. Human RORβ was cloned from U937 cells. cDNAs were cloned in an HIV-derived vector HDV-IRES-HSA or HDV-IRES-GFP65. Human GATA-3 and T-bet lentiviral vectors have been previously described57. shRNA vectors were obtained from OpenBiosystem. shRNA-1 is TRCN33657 (target sequence TCTGCAAGACTCATCGCCAAA; SEQ ID NO: 1) and shRNA-2 is TRCN33658 (target sequence CGAGGATGAGATTGCCCTCTA; SEQ ID NO: 2), and pLKO.1puro was used as control. Viral supernatants were produced by transient transfection of 293T cells with vector DNA, a VSV-G expression plasmid and the pCMVΔR8.9 GagPol expression vectors for the shRNA vectors. Viral particles were concentrated by ultracentrifugation at 25,000 rpm for 2 h at 4° C., resuspended in PBS containing 1% BSA, aliquoted and frozen.
RNA was extracted by TRIZOL (Invitrogen) and cDNA was synthesized with Superscript II (Invitrogen) and random primers. cDNA was analyzed by real-time quantitative PCR in triplicates by using iQ CYBR Green Supermix (Bio-Rad) or QuantiTect Multiplex PCR mix (Qiagen) in the iCycler Sequence Detection System (Bio-Rad). The starting quantity (SQ) of the initial cDNA sample was calculated from primer-specific standard curves by using the iCycler Data Analysis Software. The expression level of each gene was normalized to beta-actin expression level using the standard curve method. Fold changes were calculated by normalizing to the first sample of each set. Error bars were calculated based on triplicate measurements of each gene. The primer sets for real-time PCR are detailed in Table 2.
RORγt-Dependent IL-17 Expression in Human Memory CD4+ T Cells
To evaluate the effect of IL-1β on IL-17 production, the present inventors sorted naive CD45RO−CD25−CCR7+ and Th17-containing memory CD45RO+CD25−CCR6+CD4+ T cells from adult peripheral blood and cultured them in serum-containing media in the presence or absence of IL-1β. IL-1β induced a two-fold increase of IL-17 production in CCR6+ memory cells, but had no effect on CD45RO− cells (
The present inventors next asked whether overexpression of RORγT, that would bypass any requirement of its induction by cytokines, would be sufficient to obtain IL-17 expression in naive CD4+ human T cells. CD4+ T cells were isolated from human cord blood to ensure a naive phenotype, activated with anti-CD3 and anti-CD28, and transduced with control or human RORγT-encoding lentivirus. IL-17 expression was readily detected, peaking at 6 days in cells transduced with the RORγT vector (
The present inventors did not detect IL-22 protein induction with RORγT overexpression. This was unexpected because IL-22 mRNA is strongly up-regulated by Rorγt in murine CD4+ T cells (L. Zhou et al., unpublished observations). This apparent discrepancy between mouse and human led us to investigate the IL22 gene of various species (
Human Th17 cells are exclusively found in the CD45RO+CCR6+ compartment in adult blood. However, this compartment also contains IFNγ+IL-17− and IFNγ+IL-17+ cells. In order to determine which transcription factor could induce CCR6 expression in CD4+ T cells, the present inventors transduced cord blood CD4+ T cells with vectors encoding RORγT or the transcription factors involved in specification of the Th1 and Th2 cell lineages, T-bet and GATA-3, respectively, as well as a control empty vector. CCR6 was induced in RORγT-expressing cells, but not in cells transduced with GATA-3 or T-bet, and it was not induced in trans in cultures of RORγT expressing cells (
The present inventors next sought to determine how cytokines known to affect Th17 cells in mouse or human would affect IL-17 expression following RORγT overexpression, circumventing the potential effect of those cytokines on RORγT expression per se. Cord blood CD4+ T cells were transduced with RORγT alone or in the presence of IL-1β, IL-6, or IL-21 in combination with various concentrations of TGF-β (
The observation that cultures containing IL-1β, IL-6 and IL-21 had increased IL-17 expression following RORγT transduction (
These observations indicated that TGF-β present in serum inhibits to some extent IL-17 expression induced by RORγT and that other unidentified compounds contained in fetal bovine serum possibly also counteract Th17 cell differentiation. These findings prompted the present inventors to evaluate whether TGF-β, IL-1β, IL-6 and IL-21 would induce IL-17 production in serum-free media.
Naive cord blood CD4+ T cells were activated with anti-CD3/CD28 beads in serum-free media in the presence of anti-IL-4 and anti-IFNγ alone or with various combinations of cytokines. These combinations included increasing concentrations of TGF-β with no added cytokine or with IL-1β, IL-6 or IL-21, with or without IL-23 (
In light of the above findings, the present inventors adopted a combination of cytokines containing TGF-β, IL-1β, IL-23, and IL-2 for Th17 cell polarization of human cord blood naive CD4+ T cells. IL-17+ cells were clearly detected as early as day 3 and increased up to day 6 in culture (
Since it was observed that RORγT induces expression of IL-26, the present inventors asked whether IL-26 could similarly be induced in human cord blood cells cultured under Th17 cell differentiation conditions. When naive CD4+ T cells were stimulated in the presence of IL-2 in serum free medium, IL-17 mRNA expression detected by real-time PCR at day 6 was maximal following induction by the combination IL-1β, IL-23, and TGF-β, consistent with the intracellular staining (
Based on recent studies employing both in vitro culture systems and genetic approaches, it is now clear that TGF-β acts in concert with the pro-inflammatory cytokines IL-6, IL-21, and IL-23 to induce the differentiation of Th17 cells in mice20. Phosphorylation of Stat3 upon engagement of the inflammatory cytokine receptors27,44 and induction of Rorγt expression are essential for murine Th17 cell differentiation21. The requirement for TGF-β in Th17 cell differentiation was initially surprising, since it was known to act as an anti-inflammatory cytokine, at least in part through its induction and maintenance of regulatory T cells22. The function of TGF-β may be dependent on context and thresholds, favoring Th17 cell differentiation at low concentrations in the presence of inflammatory cytokines and Treg cell differentiation at high concentrations43.
In light of its pivotal role in controlling the Th17 vs. Treg balance in mice, it was unclear why TGF-β was found to be inhibitory in the induction of IL-17 in human CD4+ T cells with a naive surface phenotype15,29. As described herein, the present inventors have used serum-free medium to reveal that TGF-β indeed has an essential role in the differentiation of naive human CD4+ T cells towards the Th17 cell lineage, similar to what has been observed in mice. In human T cells, TGF-β induced RORγT expression yet paradoxically inhibited its transcriptional activity, thus preventing expression of IL-17. A combination of IL-1β and any one of IL-6, IL-21 or IL-23 relieved this inhibition and also contributed to RORγT expression, leading to induction of IL-17. Thus, similarly to the mouse, TGF-β is required for IL-17 expression in human T cells and additional transcription factors induced by IL-1β and IL-6, IL-21 or IL-23 may be involved in inducing IL-17 expression.
The present inventors have demonstrated a requirement for IL-23 for in vitro human Th17 cell differentiation, which contrasts with what has been observed in the mouse, where IL-23 is required only in vivo18. However, with low concentrations of TGF-β in mouse T cell culture, a positive effect of IL-23 on production of IL-17 was found43. Therefore, the discrepancy between the mouse and human systems with regards to IL-23 may be due to different culture conditions or different sensitivities to TGF-β. The inflammatory cytokines IL-6, IL-21 and IL-23 share signaling pathways by activating both STAT1 and STAT345-49, while IL-1β is thought to activate IRAK1/2 through recruitment of Myd8850,51. Thus, STAT3 is likely to be a common denominator in the induction of RORγT and IL-17 expression in both species20. The IL-1 pathway is important for the in vivo induction of Th17 cells in the mouse, but it does not appear to be required for polarization in vitro in the presence of serum52,53. It remains to be determined whether an unrecognized requirement downstream of the IL-1 receptor is also needed during murine Th17 cell differentiation in vitro.
Previous observations showing inhibitory activity of TGF-β in human Th17 cell differentiation were probably confounded by the use of serum and non-optimal naive cell purification28,29. Indeed, TGF-β has long been recognized to be a “switch” cytokine highly context- and concentration-dependent54. The present inventors revealed an essential effect of exogenous TGF-β in Th17 cell differentiation by using serum-free media, suggesting that TGF-β present in serum might have masked this effect. However, neutralization of TGF-β did not strongly abolish the inhibitory effect of serum on RORγT-directed IL-17 expression, and TGF-β was not able to completely inhibit IL-17 expression following RORγT over-expression in serum-free conditions. This indicates that the presence of unidentified inhibitory factors in the serum synergize with TGF-β to counteract Th17 cell differentiation.
In addition to IL-17, the present inventors have shown that IL-17F and IL-26 are induced by RORγT overexpression and cytokine polarization. IL-26 has been shown to target epithelial cells and has been suggested to play a role in mucosal immunity55, which is consistent with its induction in Th17 cells. Rearrangements of the Il22/Ifng locus seem to have occurred in the mouse/rat lineage leading to a loss of Il26, but this cytokine may have a major role in host defense and inflammation in humans. Expression of IL-22 in human T cells was inhibited by TGF-β, in accordance with observations in mouse systems14.
While all IL-17+ cells were CCR6+ following Th17 cell differentiation, CCR6 expression was induced by TGF-β. This is in agreement with the observation that FOXP3+ cells can also express CCR656. As expected, FOXP3 expression was gradually induced by TGF-β alone in serum-free conditions. IL-6, IL-21 and IL-23 alone were able to suppress FOXP3 expression, similar to the mouse20. However, addition of IL-1β was required for the induction of IL-17 through a currently undefined mechanism.
In human memory cells, expression of both IL-17 and IFNγ is clearly detected, posing the question of their ontogeny. The polarization conditions described here for naive cells lead only to the generation of IL-17+IFNγ− cells. It is likely that the high concentration of TGF-β required for Th17 polarization inhibits IFNγ expression. It remains to be determined whether IL-17 and IFNγ can be expressed simultaneously following T cell differentiation from naive cells. Functional plasticity in T helper cell differentiation has been observed57. Thus, it is possible that IL-17 or IFNγ is expressed only subsequently from a pool of differentiated Th1 or Th17 memory cells, respectively.
The present inventors previously demonstrated that the orphan nuclear receptor Rorγt is uniquely expressed in mouse T cells that produce IL-17 and is required for up-regulation of this cytokine in T cells both in vivo and in vitro21. The present inventors show herein that RORγT also has a central role in human Th17 cell differentiation. shRNA knockdown of RORγT in memory CCR6+ cells resulted in a marked reduction of IL-17 expression, indicating that the nuclear receptor is required for maintenance of cytokine production in Th17 cells. This result does not rule out a small contribution in directing IL-17 expression by the closely related paralogue RORα, which was shown to have a similar role in mouse58. A strong enrichment of RORα mRNA in CCR6+ cells compared to CCR6− cells was not, however, observed. Furthermore, RORα mRNA was not strongly induced by a combination of IL-1β, IL-23 and TGFβ that otherwise induced a 50-fold increase of RORγT mRNA. At least four differentially spliced isoforms of RORα have, however, been described and their respective transcriptional regulation has not been determined. Furthermore, the data herein do not exclude potential post-transcriptional regulation of RORα. Finally, the ability of RORβ to induce IL-17 expression needs to be evaluated in relevant cell types, since RORβ expression has not been detected in peripheral CD4+ T cells.
The IL-23/Th17 axis has recently been implicated in multiple human diseases59. The present demonstration of a requirement for IL-23 in the differentiation of Th17 cells is relevant in light of multiple polymorphisms in the human IL23R gene that have been reported to be associated with Crohn's disease and psoriasis19,60-64. It will be important to elucidate the roles of IL-1β, IL-6, IL-21 and IL-23 and TGF-β in the pathogenesis of human diseases involving Th17 cells. Importantly, the participation of TGF-β in the induction of Th17 and Treg cells will likely be critical in maintenance of immune system homeostasis, particularly at mucosal surfaces, and imbalance in this system may result in autoimmunity. In this context, the present results offer a working model for the study of human Th17 cell differentiation and provide new opportunities for manipulating these cells in inflammatory diseases.
Mononuclear cells were prepared from human cord blood on FicollPAQUE gradients. CD4+ T cells were isolated on an autoMACS Pro using Miltenyi bead depletion of CD14+ and CD25+ cells followed by positive selection of CD4+ cells. Cord blood CD4+ T cells were >97% pure and 100% CD45RA+ and were used as such for initial transduction experiments. Naive cord blood CD4+ T cells were further purified respectively as CD3+CD4+CD25−HLA-DR−CD45RA+ by cell sorting on a FACSAria.
CD4+ T cells were stimulated by addition of anti-mouse IgG magnetic beads (Pierce) previously coated with purified anti-CD3 and anti-CD28 at final concentrations of 1 bead/cell and 1 pg/ml of each antibody. Cells were seeded at a concentration of 5×105 to 106 cells/ml in U-bottom 96 well plates with anti-CD3/CD28 coated beads. IL-2 at 10 U/ml was added at day 0. For Th17 differentiation, 10 ng/ml IL-1β (eBioscience), 10 ng/ml IL-23 (eBioscience), and 10 ng/ml TGF-β1 (PeproTech) were added at day 0 and maintained throughout the experiment.
Cells were harvested at day 6. Total RNA was isolated using Trizol following the manufacturer's procedure. RNA was labeled using the standard 1-cycle procedure from Affymetrix. RNA was hybridized and analyzed on Affymetrix HGU133plus2 chips. Data was analyzed using the R package.
The present inventors generated the expression profile of human cord blood naive CD4+ T cells cultured for 6 days in IL-2 (neutral conditions) or IL-2+IL-1β+IL-23+TGFβ (Th17 conditions). The relative expression fold change in the expression of each gene was determined by comparing the expression level of each gene in Th17 conditions versus neutral conditions. The present inventors have thus identified a list of genes that are either up-regulated or down-regulated by at least 2 fold. See Tables 3 and 4.
In accordance with the present invention, therefore, novel cellular markers characteristic of human Th-IL17+ cells are identified. Such cellular markers may contribute to functional properties of human Th-IL17+ cells. Accordingly, the identification of such cellular markers of human Th-IL17+ cells provides novel targets for therapeutic agents and intervention designed to modulate human Th-IL17+ cell differentiation and/or activity.
IL17A
460.3
interleukin 17A
IL17F
50.0
interleukin 17F
IL23R
22.2
interleukin 23 receptor
CCL20
10.3
chemokine (C-C motif) ligand 20
CCR6
9.8
chemokine (C-C motif) receptor 6
RORA
8.5
RAR-related orphan receptor A
IL26
5.3
interleukin 26
RORC
4.5
RAR-related orphan receptor C
IL4
−96.2
interleukin 4
GATA3
−21.8
GATA binding protein 3
IFNG
−10.3
interferon, gamma
Drosophila)
While certain of the particular embodiments of the present invention have been described and specifically exemplified above, it is not intended that the invention be limited to such embodiments. Various modifications may be made thereto without departing from the scope and spirit of the present invention, as set forth in the following claims.
Genbank Accession No.: NM—005060 The following is the human RORgamma mRNA sequence. The nucleotides unique for RORgamma are underlined.
ATGGACAGGGCCCCACAGAGACAGCACCGAGCCTCACGGGAGCTGCTGGCTGCAAAGAA
GACCCACACCTCACAAATTGAAGTGATCCCTTGCAAAATCTGTGGGGACAAGTCGTCTG
Genbank Accession No.: NP—005051 The following is the human RORgamma protein sequence. The amino acids unique for RORgamma are underlined. The AF2 domain is indicated using underlining and bold font.
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQ
Genbank Accession No.: NM—001001523 The following is the human RORgammat mRNA sequence. The nucleotides unique for RORgamma are underlined.
ATGAGAACACAAATTGAAGTGATCCCTTGCAAAATCTGTGGGGACAAGTCGTCTGGGAT
Genbank Accession No.: NP—001001523 The following is the human RORgammat protein sequence. The amino acids unique for RORgammat are underlined. The AF2 domain is indicated using underlining and bold font.
MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSR
Genbank Accession No.: NM—011281 The following is the mRNA sequence for mouse RORgamma. The underlined sequences are specific for mouse RORgamma.
ATGGACAGGGCCCCACAGAGACACCACCGGACATCTCGGGAGCTGCTGGC
TGCAAAGAAGACCCACACCTCACAAATTGAAGTGATCCCTTGCAAGATCT
Genbank Accession No.: NP—035411 The following is the amino acid sequence for mouse RORgamma. The underlined amino acids are specific for mouse RORgamma. The AF2 domain is indicated using underlining and bold font.
MDRAPQRHHRTSRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQ
Genbank Accession No.: AF163668 The following is the mRNA sequence for mouse RORgammat. The underlined nucleotides are specific for mouse RORgammat
ATGAGAACACAAATTGAAGTGATCCCTTGCAAGATCTGTGGGGACAAGTC
Genbank Accession No.: AAD46913 The following is the amino acid sequence for mouse RORgammat. The underlined amino acids are specific for mouse RORgammat. The AF2 domain is indicated using underlining and bold font.
musculus]
MRTQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQCNVAYSCTRQQNCPIDRTSR
Genbank Accession No.: NM—134262.1 The following is the mRNA sequence for human RORalpha isoform d.
Genbank Accession No.: NP—599024.1 The following is the amino acid sequence for human RORalpha isoform d.
Genbank Accession No.: NM—006914.3 The following is the mRNA sequence for human RORbeta.
Genbank Accession No.: NP—008845.2 The following is the amino acid sequence for human RORbeta.
sapiens]
This application claims priority under 35 USC §119(e) from U.S. Provisional Application Ser. No. 61/124,242, filed Apr. 15, 2008, which application is herein specifically incorporated by reference in its entirety.
The research leading to the present invention was funded in part by NIH grants 5 R37 AI033303 and R01 AI065303. The United States government may have certain rights in the invention.
| Number | Date | Country | |
|---|---|---|---|
| Parent | 13473980 | May 2012 | US |
| Child | 13850497 | US | |
| Parent | 12386355 | Apr 2009 | US |
| Child | 13473980 | US |