MICA BINDING AGENTS

Information

  • Patent Application
  • 20150191542
  • Publication Number
    20150191542
  • Date Filed
    February 07, 2013
    13 years ago
  • Date Published
    July 09, 2015
    11 years ago
Abstract
The present invention relates to methods for the treatment of disorders mediated by MICA-expressing cells using antibodies, antibody fragments, and derivatives thereof that specifically bind MICA. The invention also relates to antibodies; cells producing such antibodies; methods of making such antibodies; fragments, variants, and derivatives of the antibodies; and pharmaceutical compositions comprising the same.
Description
FIELD OF THE INVENTION

The present invention provides antigen-binding proteins capable of binding to MICA polypeptides. The antibodies have increased activity in the treatment of disorders characterized by MICA-expressing cells, particularly tumor cells.


BACKGROUND

The immunoreceptor NKG2D is normally expressed on human T cells (e.g. CD8+ T cells, γδ T cells) and NK cells. On pre-activated CD8+ cells, NKG2D functions as a synergistic co-stimulator of CD28 and TCR signalling via DAP10 association, whereas in NK cells it functions as a direct activator. Upon ligand engagement, NKG2D therefore conveys directly activating or costimulatory signals via the paired DAP10 adaptor protein, thereby promoting cancer and infectious disease immunity.


Various ligands for human NKG2D (hNKG2D) have been identified and characterized, including the major histocompatibility complex class I-related chain A and B polypeptides (MICA and MICB), the UL16-binding protein (ULBP) family, and the retinoic acid early transcript-1 (RAET1) family. MICA is frequently associated with epithelial tumors, induced by microbial infections, and aberrantly expressed in certain autoimmune disease lesions. The structure of MICA is similar to the protein fold of MHC class I, with an α 1α2 platform domain and a membrane-proximal Ig-like α3 domain (Li et al 2001 Nat. Immunol. 2:443). MICA and its close relative MICB, which also serves as a ligand for NKG2D, are both polymorphic and the polymorphism has been shown to affect the affinity for NKG2D (Steinle et al. 2001 Immunogenetics 53:279).


In the mouse, which lacks MHC class I chain (MIC) genes, a family of proteins structurally related to ULBP, the retinoic acid early (RAE-1) molecules function as ligands for NKG2D. RAE-1 expression has been shown to be induced by carcinogens and to stimulate antitumor activities of T cells. Murine NKG2D, however, recognizes human MICA polypeptides (Wiemann (2005) J. Immunol. 175:820-829).


The role MICA in cancer biology has been complicated by the fact that MICA is released as a soluble form from the cell surface of tumor cells (e.g., *019 allele) and on the surface of exosomes (*08 allele) (Ashiru et al (2010) Cancer Res. 70(2):481-489)). Soluble MICA (sMICA) can be detected for example at high levels in sera of patients with gastrointestinal malignancies (Salih et al, 2002 J. Immunol. 169: 4098). ADAM10 and ADAM17 enzymes, Erp5 and MMPs, have been reported to have a role in cleavage and shedding of MICA (Waldhauer (2008) Cancer Research 68 (15) 6368-76; Kaiser et al (2007) Nature; and Salih (2002) J. Immunol 169: 4098-4102). Membrane bound MICA has been reported to downmodulate the expression of NKG2D on NK and/or T cells (Von Lilienfeld-Toal et al. (2010) Cancer Immunol. Immunother.). Notably, Wiemann (2005), supra, examined MICA Tg mice and concluded that down-regulation of surface NKG2D on nontransgenic splenocytes was most pronounced after cocultivation with splenocytes from MICA transgenic mice in vitro, and only marginally following treatment with sera from H2Kb-MICA mice, whereas incubation with control cells and sera from nontgLM, respectively, had no effect and that overall data suggest that reduced surface NKG2D on H2-K-MICA NK cells results in NKG2D dysfunction and that NKG2D downregulation is primarily caused by a persistent exposure to cellbound MICA in vivo.


Reports have also emerged that NKG2D on NK cells is downregulated by sMICA (Groh et al. (2002) Nature; Arreygue-Garcia (2008) BMC; Jinushi et al. (2005) J. Hepatol.), leading to less reactive NK cells. This rationale may have emerged because similar systems have been observed among other protein families such as the Ig-like and the TNF superfamily have been shown to be released as a soluble form and that release of the molecules affects cell-cell interactions by reduction of ligand densities and modulates NK cells bearing the respective receptor (Salih 2002). Consequently, approaches to using anti-MICA antibodies against MICA-expressing tumors have focused on development of antibodies that inhibit MICA shedding.


SUMMARY OF THE INVENTION

In one aspect, the invention results, inter alia, from the discovery of binding regions on MICA (including on glycosylated MICA, notably MICA with glycosylation expressed preferentially by human tumor cells) that can be recognized by antibodies with high affinity across human MICA alleles. (as well as on non-human primate MICA). The antibodies notably bind one or more MICA alleles from each of two major MICA groups that are determined to represent the main families of MICA: group 1 alleles that bind NKG2D strongly (including MICA*001, *002, *007, *012, *017 and *018) and group 2 that bind NKG2D weakly (MICA*004, *006, *008, *009 and *019). By binding to an epitope present on the subset MICA *001, *004, *007, *008 and *019, the antibodies cover the alleles of both groups that are present in almost all individuals. High affinity binding is necessary for an antibody to effectively mediate CDC and ADCC.


In another embodiment, the present invention results, inter alia, from the discovery of antibodies that are effective in vitro and in vivo in inducing effector cell lysis (e.g. NK cells and/or T cells) of MICA-expressing tumor cells without substantially blocking shedding of MICA from tumor cells and without substantially blocking the interaction of MICA with NKG2D.


In another embodiment, the present invention results from the discovery of antibodies that bind the α1 and/or α2 domain of MICA without substantially blocking the interaction of MICA with NKG2D. Such an antibody can optionally be characterized as not competing with hNKG2D in binding to MICA and/or not decreasing or blocking the ability of a NKG2D-expressing effector cell to lyse a MICA-expressing target cell. Insofar as these antibodies bind the α1 and/or α2 domain of MICA, they also will not substantially block shedding of MICA from tumor cells.


In another embodiment, the present invention results, inter alia, from the discovery of antibodies that bind the α3 domain of MICA without substantially blocking shedding of MICA from tumor cells. Insofar as these antibodies bind the α3 domain of MICA, they also will not substantially block the interaction of MICA with NKG2D.


Without wishing to be bound by theory, it is believed that despite the scientific literature which assumes a causal relationship between MICA (e.g., sMICA or membrane-bound MICA) and NKG2D downregulation and impairment of effector cells, MICA does not itself in tumor settings actually cause the impairment of effector cells. Rather, in tumor settings (e.g. established or advanced disease), the patient is generally in an immunosuppressed state via a number of non-MICA components (e.g. TGF-beta) that have the potential, among other effects, to cause the downmodulation of NKG2D. Consequently, agents that do not block NKG2D-MICA interactions and/or do not inhibit MICA shedding may be efficacious in treatment of cancers so long as they are capable of inducing CDC and/or ADCC, and in particular they may be advantageous because MICA-expressing tumor cells remain recognizable by those immunocompetent effector cells that are present (e.g. as immunocompetence re-establishes in a patient during or subsequent to a treatment, for treatments having a long duration, repeated administration or administered at high doses).


In one embodiment, the present invention provides a MICA binding compound, preferably an antibody that specifically binds to a MICA polypeptide (an anti-MICA antibody), without detectably reducing binding between MICA and NKG2D (e.g., the interaction of surface MICA on tumor cells with surface NKG2D on effector cells), e.g., without substantially blocking the interaction of MICA and NKG2D. In one embodiment, the present invention provides a MICA binding compound (e.g. a MICA-binding polypeptide) that binds to a MICA polypeptide without substantially blocking shedding of MICA from tumor cells. In one embodiment, the present invention provides an MICA binding compound that binds to a MICA polypeptide without substantially blocking the interaction of MICA with NKG2D and without substantially blocking shedding of MICA from tumor cells.


In another embodiment, the present invention results, inter alia, from the discovery of antibodies bind human MICA (particularly in the α1 and/or α2 domains) that recognize major MICA alleles MICA*001, MICA*004, MICA*008 and optionally further MICA*007 and/or MICA*019, and optionally further recognize MICA of a non-human primate specie (e.g. cynomolgus monkey). In one embodiment, the antibodies further recognize a MICB polypeptide comprising the amino acid sequence of SEQ ID NO 6. Optionally, in another embodiment, these antibodies further do not recognize MICB. Optionally the antibodies furthermore do not substantially blocking shedding of MICA from tumor cells.


In one embodiment, the present invention provides an antibody that specifically binds to a glycosylated MICA polypeptide expressed by a human tumor cell.


In one embodiment, the present invention provides an antibody that specifically binds to a MICA polypeptide expressed by a non-human primate cell.


In one embodiment, the present invention provides an antibody that specifically binds to a MICA polypeptide (an anti-MICA antibody), wherein the antibody binds a polypeptide of SEQ ID NO 2 (MICA*004) and/or a polypeptide of SEQ ID NO 4 (MICA*008). In one embodiment, the antibody further binds a polypeptide of SEQ ID NO 1 (MICA*001). In one embodiment, the present invention provides an antibody that specifically binds to a MICA polypeptide, wherein the antibody binds a polypeptide of SEQ ID NO 5 (MICA*019). In one embodiment, the antibody further binds a polypeptide of SEQ ID NO 3 (MICA*007). In one embodiment, the present invention provides an antibody that specifically binds to a MICA polypeptide, wherein the antibody binds a polypeptide of SEQ ID NO 2 (MICA*004), a polypeptide of SEQ ID NO 4 (MICA*008) and a polypeptide of SEQ ID NO 5 (MICA*019). In one embodiment, the present invention provides an antibody that specifically binds to a MICA polypeptide, wherein the antibody binds a polypeptide of SEQ ID NO 1 (MICA*001), a polypeptide of SEQ ID NO 2 (MICA*004), a polypeptide of SEQ ID NO 4 (MICA*008), and a polypeptide of SEQ ID NO 5 (MICA*019), optionally further wherein the antibody binds a polypeptide of SEQ ID NO 3 (MICA*007). By binding to alleles MICA*001, -*004, and *008, (and advantageously further *007 and *019) across both Group 1 and Group 2 of MICA alleles, virtually the entire human population will be suitable for treatment with such an anti-MICA agent of the invention. In any embodiment, a polypeptide of SEQ ID NOS 1-5 may comprise an O-glycan (N-acetyllactosamine linked to serine or threonine). In any embodiment, a polypeptide of SEQ ID NOS 1-5 may comprise a core2 O-glycan (an O-glycan comprising an N-acetylglucosamine branch connected to N-acetylgalactosamine). In one embodiment, the antibody binds to a MICA polypeptide without substantially blocking the interaction of MICA with NKG2D and/or without substantially blocking shedding of MICA from tumor cells. In one embodiment, the antibody binds the α1 and/or α2 domain of MICA. In one embodiment, the antibody binds the α3 domain of MICA.


Preferably the compound is an antibody, optionally a tetrameric antibody comprising two Ig heavy chains and two Ig light chains. Preferably the antibody has binding affinity (KD), optionally wherein binding affinity is bivalent, for a human MICA polypeptide at of less than 10−9 M, preferably less than 10−10 M, or preferably less than 10−11M. Preferably the antibody is a depleting antibody, optionally wherein the antibody induces ADCC and/or CDC toward a MICA-expressing tumor cell.


In a specific embodiment, the present invention provides an antibody that mediates depletion of MICA-expressing tumor cells by an NK or T cell (e.g., in vivo or in vitro) without substantially inhibiting NKG2D-mediated cytotoxicity of a hNKG2D-expressing NK or T cell.


In a specific embodiment, an antibody of the invention does not compete with hNKG2D in binding to MICA.


In a specific embodiment, when an antibody of the invention is bound to MICA on a MICA-expressing cell, the MICA-expressing cell does not substantially reduce the amount of cell-surface hNKG2D upon binding via, e.g., stimulating down-modulation and/or internalization of hNKG2D, has a high affinity and slow off-rate, cross-reacts with cynomolgus and/or rhesus MICA, and is of a depleting isotype such as, e.g., human IgG1.


In one embodiment, the present invention provides a MICA binding compound, preferably an anti-MICA antibody, that binds at least partly within the α1 and/or α2 domain of MICA polypeptides. The α1 and α2 domains are located within amino acid residues 1 to 88 and 89 to 181, respectively, with reference to the MICA polypeptide of SEQ ID NO 1. Preferably, in any of the embodiments herein, the antibody binds to an amino acid residue within the α1 domain of a MICA polypeptide (residues amino acid residues 1 to 88 of SEQ ID NO 1). Optionally, such anti-α1 domain antibody may bind to an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues, wherein at least one of said residues is N56 or E85. Preferably, in any of the embodiments herein, the antibody binds to an amino acid residue within the α2 domain of a MICA polypeptide (residues 89 to 181 of SEQ ID NO 1) of a MICA polypeptide. Optionally, such anti-α2 domain antibody may bind to an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues, wherein at least one of said residues is selected from the group consisting of: N102, W127, R143, R169, V177 and L178. Optionally, an anti-MICA antibody binds to an epitope spanning the α1 and α2 domain, optionally such antibody may bind to an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues, wherein is the residues comprise E85 and/or N102. Optionally, binding of the antibody to a MICA polypeptide having a mutation at such a residue within the α1 and/or α2 domain is substantially reduced, in comparison to binding to a wild-type MICA polypeptide of SEQ ID NO: 1.


In one embodiment, the present invention provides a MICA binding compound, preferably an anti-MICA antibody, that binds at least partly within the α3 domain of MICA polypeptides. The α3 domain is located within amino acid residues 182 to 274, respectively, with reference to the MICA polypeptide of SEQ ID NO 1. Preferably, in any of the embodiments herein, the antibody binds to an amino acid residue within the α3 domain (residues 182 to 274 of SEQ ID NO 1). Optionally, binding of the antibody to a MICA polypeptide having a mutation at a residue within the α3 domain is substantially reduced, in comparison to binding to a wild-type MICA polypeptide of SEQ ID NO: 1.


The present invention provides that the use of an anti-MICA antibody can be useful for the treatment of cancers, e.g. in human subjects. This antibody can be used with or without coupling to a toxic or other agent, depending on the desired effect or use made of the antibodies. In one embodiment, the anti-MICA antibody is a “naked antibody” and is not coupled to a toxic agent, optionally the naked antibody comprises an Fc region modified to increase binding to an Fcγ receptor, e.g., CD16. In one embodiment, a naked or coupled antibody comprises a heavy chain comprising a human Fc region (e.g. IgG1) that binds Fcγ receptors (e.g. CD16). Optionally wherein such antibody induces complement dependent cytoxicity (CDC) and/or antibody dependent cellular cytoxicity (ADCC) toward a cell that expresses MICA on its surface.


Optionally, in any embodiment, the antibody (e.g. IgG1, antibody fragment, etc.) further comprises a toxic agent (e.g. a chemotherapeutic agent) that is toxic to a cell.


The present disclosure further provides antibodies, antibody fragments, and derivatives that specifically bind human MICA. The invention provides such antibody compositions, as well their use in any of the methods of the invention of treating, preventing and diagnosing cancer.


In one embodiment, the antibodies have binding affinity (KD) for a human MICA polypeptide (e.g., a polypeptide of one, two, three or all of the MICA*001, *004, *007, *008, and *019 alleles of SEQ ID NOS 1-5, preferably to each of MICA*001, *004 and *008) of less than 10−8 M, preferably less than 10−9 M, or preferably less than 10−10M.


In one aspect of any of the embodiments of the invention, the antibody may have a heavy and/or light chain having one, two or three CDRs of the respective heavy and/or light chain of an antibody selected from the group consisting of antibody 9C10, 20C6 and 16A8.


In one aspect of any of the embodiments of the invention, the antibody competes for binding to a MICA polypeptide with any one or any combination of monoclonal antibodies 9C10, 20C6 and 16A8. In one embodiment, an antibody of the invention competes for binding to a MICA polypeptide, with an antibody selected from the group consisting of:

    • (a) an antibody having respectively a VH and VL region of SEQ ID NOS: 7 and 8 (9C10);
    • (b) (a) an antibody having respectively a VH and VL region of SEQ ID NOS: 20 and 21 (20C6); and;
    • (c) an antibody having respectively a VH and VL region of SEQ ID NOS:33 and 34 (16A8).


In one aspect, the invention provides an antibody that specifically binds MICA, wherein the antibody has one or more (including any combination thereof, or all of) of the following properties:


(a) has a Kd of less than 10−8 M, preferably less than 10−9 M, or preferably less than 10−10M for binding to a MICA polypeptide;


(b) binds to at least one residue in the segment corresponding to residues of a domain selected from the group consisting of 1-88, 89-181 and 182-274 of the MICA polypeptide of SEQ ID NO: 1;


(c) binds to two, three, four or five of the MICA*001, *004, *007, *008, and *019 polypeptides, respectively comprising a sequence of SEQ ID NOS: 1-5;


(d) does not substantially block shedding of MICA from tumor cells;


(e) does not substantially block the interaction of MICA with NKG2D (e.g., the interaction of surface MICA on tumor cells with surface NKG2D on effector cells), preferably wherein the antibodies does not cause a substantial decrease in lysis of MICA-expressing cells by effector cells (e.g., NKG2D+ CD16− NK cells);


(f) induces complement dependent cytoxicity (CDC) and/or antibody dependent cellular cytoxicity (ADCC) toward a cell that expresses MICA on its surface; and


(g) competes for binding to a MICA polypeptide with antibody 9C10, 20C6 or 16A8.


In any of the embodiments herein, an antibody of the invention may be characterized by any one or more features of (a)-(g), above.


In one embodiment, the antibody is human-suitable. In one embodiment the antibody is chimeric, e.g. contains a non-murine, optionally a human, constant region. In one embodiment, the antibody is human or humanized. In another embodiment, the antibody is a mouse antibody.


In one aspect of any of the embodiments of the invention, the isotype of the antibody is a human IgG, optionally human IgG1, IgG2, IgG3 or IgG4. In one embodiment the antibody comprises a human Fc domain or is of an isotype that is bound by FcγR (e.g. FcγRIIIA), e.g. an antibody of IgG1 or IgG3 isotype.


In one aspect of any of the embodiments of the invention, the antibody is an antibody fragment selected from Fab, Fab′, Fab′-SH, F(ab′)2, Fv, diabodies, single-chain antibody fragment, or a multispecific antibody comprising multiple different antibody fragments. In one aspect of any of the embodiments of the invention, the antibody does not comprise an Fc domain or is of an isotype that is not substantially bound by FcγR.


Optionally antibodies of the invention are furthermore tetrameric (two heavy and two light chains) and are thus bivalent (e.g. IgG antibodies).


In one embodiment, the antibodies are able to induce CDC and/or ADCC of cells expressing MICA. In one embodiment, the antibodies are capable of inducing at least 20%, 30, 40 or 50% cell lysis, in a cytoxicity assay, of MICA-expressing cells (e.g. of NKG2D+CD16− cells). In one embodiment, the invention provides a bivalent antibody comprised of two heavy chains and two light chains, wherein the heavy chains comprise an IgG heavy chain constant region capable of binding to an FcγRIIIA polypeptide, and wherein the antibody: (a) is capable of directing CDC and/or ADCC toward cells expressing MICA; (b) does not substantially block shedding of MICA from tumor cells; and (c) does not substantially block the interaction of MICA with NKG2D. Optionally, the antibodies further (i) competes for binding with antibody 9C10, 20C6 or 16A8 to a MICA polypeptide and/or (ii) binds to an epitope (e.g., at least one amino acid residue) in the segment corresponding to residues 1-88, residues 89-181 or residues 182-274 of the MICA polypeptide of SEQ ID NO: 1.


In certain embodiments, the antibodies of the invention further comprise a toxic agent. In one embodiment, the antibodies comprising a toxic agent are able to directly cause the death of cells expressing MICA. In one embodiment, the antibodies are capable of directly inducing (e.g. in the absence of immune effector cells) at least 20%, 30%, 40% or 50% cell death, e.g. in an in vitro assay, of MICA-expressing cells.


In one embodiment, provided is a method of testing an anti-MICA antibody, said method comprising: (i) assessing whether the antibody blocks shedding of MICA from MICA-expressing cells and/or (ii) assessing whether the antibody blocks the interaction of MICA with NKG2D. Step (i) may optionally comprise bringing the antibody that binds a MICA polypeptide into contact with a cell expressing a MICA polypeptide. Step (II) may optionally comprise bringing the antibody that binds a MICA polypeptide into contact with a MICA polypeptide (e.g. an isolated polypeptide or a polypeptide expressed on the surface of a cell), in the presence of an NKG2D polypeptide (e.g. an isolated polypeptide or a polypeptide expressed on the surface of a cell).


In another embodiment, provided is a method of producing an antibody that binds a MICA polypeptide in a mammalian subject, optionally for the treatment of a cancer, said method comprising the steps of: a) providing a plurality of antibodies, optionally immunizing a non-human mammal with an immunogen comprising a MICA polypeptide; and b) selecting an antibody from said plurality that:

    • (i) binds to a human MICA polypeptide, optionally one, two, three or all of the polypeptides of SEQ ID NOS 1-5; and/or
    • (ii) does not block shedding of MICA from MICA-expressing cells; and/or
    • (iii) does not block the interaction of MICA (e.g. surface MICA) with NKG2D, preferably wherein the antibody does not cause a substantial decrease in lysis of MICA-expressing cells by effector cells (e.g., NKG2D+ CD16− NK cells.


In one aspect, the invention provides methods of treatment using the anti-MICA antibodies of the invention. The antibodies can be used as prophylactic or therapeutic treatment; in any of the embodiments herein, a therapeutically effective amount of the antibody can be interchanged with a prophylactically effective amount of an antibody. In one aspect, the invention provides a method of treating a patient with a cancer, the method comprising administering to the patient a pharmaceutically effective amount of an antigen-binding compound according to the invention that specifically binds to a MICA polypeptide.


The methods of treatment of the invention and the anti-MICA antibody according to the invention can be used to a treat an individual in combination with a second therapeutic agent, including an anti-cancer agent (e.g. chemotherapeutic drugs, tumor vaccines, antibodies that bind to tumor-specific antigens on tumor cells, antibodies that induce ADCC toward tumors cells, antibodies that potentiate immune responses, etc.). In one embodiment, the second therapeutic agent is an agent (e.g. an antibody) that binds to and activates an activatory receptor or that binds to and blocks an inhibitory receptor on an effector cell (e.g. an NK cell, a T cell). In one embodiment, the second therapeutic agent is an agent (e.g. a chemotherapeutic agent) that upregulates the expression of an NKG2D ligand on tumor cells. For example, histone deacetylase inhibitors can be used. For example, valproate and hydralazine augment MICA/B expression and decrease shedding. (Chavez-Blanco 2011 Int J Oncol 39(6): 1491-1499).


The present invention further concerns a method for selecting subjects having a cancer that responds to a treatment using an anti-MICA agent of the invention (e.g. an antibody that binds to a MICA polypeptide), the method comprising determining whether tumor cells in said subject shed a MICA polypeptide (e.g. as assessed by levels of sMIC in circulation), the presence of shedding of MICA polypeptide from tumor cells being indicative of a responder subject.


The present invention further concerns a method for selecting subjects having a cancer that responds to a treatment using an anti-MICA agent of the invention (e.g. an antibody that binds to a MICA polypeptide), the method comprising determining whether tumor cells in said subject express a MICA polypeptide, the expression of a MICA polypeptide being indicative of a responder subject. In one embodiment, the method comprises determining whether tumor cells in said subject express a MICA polypeptide selected from the group consisting of SEQ ID NOS 1-5. In one embodiment, the method comprises determining whether tumor cells in said subject express a MICA polypeptide selected from the group consisting of MICA*001, *004, *007, *008, and *019 polypeptides, respectively comprising a sequence of SEQ ID NOS: 1-5, wherein the expression of a MICA polypeptide is indicative of a responder subject. In one embodiment, the step of determining whether tumor cells in said subject express a MICA polypeptide comprising bringing a biological sample from the subject (e.g. by performing a biopsy and/or obtaining a sample of cancer cells, a blood or any tissue sample, etc.) into contact with an anti-MICA antibody of the invention (e.g. an antibody that bind a one, two, three, four or all of the MICA*001, *004, *007, *008, and *019 polypeptides). In one embodiment, the method comprises determining whether said subject comprises shed MICA (e.g. detecting sMICA in circulation or detecting the presence of MICA on the surface of exosomes (*008 allele).


Optionally, in any of the methods, the method further comprises administering to a responder subject an antibody (e.g. an anti-MICA antibody of the invention) that binds to a MICA polypeptide.


In a preferred embodiment, the expression of a MICA polypeptide in a disease-related cell is determined using a MICA-specific ligand. Preferably, the ligand is an antibody, or a fragment or derivative thereof.


In another aspect, the invention comprises a method (e.g., a method of conducting a diagnostic assay, a responder assay, etc.), comprising assessing whether a patient has disease-related cells (e.g., tumor cells) expressing a MICA polypeptide, e.g. a MICA polypeptide (one or more MICA alleles) bound by an antibody of the invention. Said method may comprise, for example, obtaining a biological sample from a patient comprising disease-related cells, bringing said disease-related cells into contact with such antibody and assessing whether the antibody binds to disease-related cells. A finding that MICA is expressed by disease-related cells indicates that the patient has a condition characterized by MICA-expressing cells and/or is suitable for treatment with an anti-MICA antibody of the invention. The patient can further be treated with a treatment suitable for the particular disease characterized by MICA-expressing cells. Optionally the patient is treated with the anti-MICA antibody. In one embodiment, the method is used for selecting subjects having a cancer, and the disease-related cells are cancer cells.


The present invention also provides a method of treating a patient, the method comprising:

    • a) determining whether the patient has pathogenic MICA-expressing cells, and


b) if the patient is determined to patient have pathogenic MICA-expressing cells, administering an antigen-binding compound (e.g., antibody) of the invention.


These and additional, advantageous aspects and features of the invention may be further described elsewhere herein.





BRIEF DESCRIPTION OF THE DRAWINGS


FIG. 1 shows results of binding of 9C10, 20C6 and 16A8 to either recombinant human MICA extracellular domain recombinant-Fc protein monomers or dimers (MICA*019 allele) as well as other NKG2D ligands MICB and ULBP1-2 as analyzed by SPR using a Biacore T100 apparatus. Results are shown in 1A, 1B, 1C and 1D for MICA, MICB, ULBP1 and ULPB2 respectively. 9C10 and 20C6 bind solely to MICA while 16A8 binds MICA and MICB.



FIG. 2 shows results from an ELISA assay assessing binding of antibodies to MICA extracellular domain recombinant proteins; 16A8 is specific for the α3 domain of MICA. BAMO1 is a commercially available anti-MICA specific for α1α2 domain and BAMO3 is a commercially available anti-MICA specific for α3 domain.



FIGS. 3A, 3B and 3C show anti-MICA antibody 9C10, 20C6 and 16A8, respectively, bound to each of the C1R-MICA*001, C1R-MICA*004, C1R-MICA*007 and C1R-MICA*008 cells, as assessed by flow cytometry.



FIG. 4 shows the results of a functional assay for MICA-NKG2A blockade, showing the ability of anti-MICA antibodies to reduce or inhibit the NKG2D+ CD16− NK92 cell-mediated killing of MICA*019-transfected BaF/3 as determined by measuring target cell release of 51Cr. 20C6, 16A8 and 9C10 do not block NKG2D-mediated killing.



FIG. 5 shows results from a CDC assay; the figure shows viability of indicated RMA-MICA cells, in the presence of complement. 9C10 and 16A8 cause a decrease in cell viability compared to 20C6 (murine IgG1 are not capable of mediating complement dependent cytotoxicity.) and the positive control (complement only) and thereby mediate CDC.



FIG. 6 shows results from an ADCC assay in which 9C10 and 16A8 each induced specific lysis of RMA-MICA*001 cells by human NK cells compared to negative controls (either no antibody or 20C6 (the second bar from left) anti-MICA antibody of mIgG1 isotype).



FIG. 7 shows inhibition of the MICA shedding mediated by the anti-α3 domain BAMO3 but not by 16A8, in an assay for capacity to block MICA shedding as assessed by measuring soluble MICA concentration in the supernatant after overnight incubation of MICA-expressing cells with anti-MICA antibodies.



FIG. 8 shows that anti-MICA antibodies can increase elimination of MICA-expressing tumor cells in vivo; percentage of RMA-MICA*07 within liver cells were analyzed by flow cytometry and mice treated with antibody 9C10 showed a lower percentage of RMA-MICA*07 within liver cells compared to vehicle or isotype control.





DETAILED DESCRIPTION OF THE INVENTION
Introduction

The antibodies of the invention are able to directly and specifically target MICA-expressing cells, notably tumor cells and are capable of mediating the depletion of such cells in vivo and in vitro. The invention provides a number of antibodies having such properties, and which all do not compete with NKG2D for binding to MICA and do not inhibit shedding of MICA from MICA-expressing tumor cell.


MICA (PERB11.1) refer to MHC class I polypeptide-related sequence A (See, e.g., UniProtKB/Swiss-Prot Q29983), its gene and cDNA and its gene product, or naturally occurring variants thereof. Nomenclature of MICA genes and proteins, together with reference to accession number of sequence for different alleles are described in Frigoul A. and Lefranc, M-P. Recent Res. Devel. Human Genet., 3(2005): 95-145 ISBN: 81-7736-244-5, the disclosure of which is incorporated herein by reference. MICA genes and protein sequence, including polymorphisms at the protein and DNA level, are also available from http://mhc-x.u-strasbg.fr/human.htm maintained by the laboratory of Dr. Bahram.


The amino acid sequences of MICA were first described in Bahram et al (1994) Proc. Nat. Acad. Sci. 91: 6259-6263 and Bahram et al. (1996) Immunogenetics 44:80-81, the disclosures of which are incorporated herein by reference. The MICA gene is polymorphic, displaying an unusual distribution of a number of variant amino acids in their extracellular α1, α2, and α3 domains. To further define the polymorphism of MICA, Petersdorf et al. (1999) examined its alleles among 275 individuals with common and rare HLA genotypes. The amino acid sequence of the extracellular α1, α2, and α3 domains of human MICA are shown in SEQ ID NOS 1-5. The full MICA sequence further comprises a leader sequence of 23 amino acids, as well as a transmembrane domain and a cytoplasmic domain. The amino acid sequence of extracellular α1, α2, and α3 domains of selected human MICA alleles are shown in SEQ ID NOS 1-5. The amino acid sequence of MICA*001 is shown in SEQ ID NO 1, corresponding to Genbank accession no. AAB41060. The amino acid sequence of human MICA allele MICA*004 is shown in SEQ ID NO 2, corresponding to Genbank accession no. AAB41063. The amino acid sequence of human MICA allele MICA*007 is shown in SEQ ID NO 3, corresponding to Genbank accession no. AAB41066. The amino acid sequence of human MICA allele MICA*008 is shown in SEQ ID NO 4, corresponding to Genbank accession no. AAB41067. The amino acid sequence of human MICA allele MICA*019 is shown in SEQ ID NO 5, corresponding to Genbank accession no. AAD27008. The amino acid sequence of human MICB is shown in SEQ ID NO 6, corresponding to Genbank accession no. CAI18747.


The MICA gene encodes a protein that belongs to the MhcSF and to the IgSF. This protein is a transmembrane MHC-I-alpha-like (I-alpha-like) chain, which comprises three extracellular domains, two distal G-like domains, G-alpha1-like (also referred to as “D1” or “α1”) and G-alpha2-like (also referred to as “D2” or “α2”), and a C-like-domain (also referred to as “D3” or “α3”) proximal to the cell membrane, and three regions, a connecting-region, a transmembrane-region and a cytoplasmic-region (labels according to the IMGT Scientific Chart of the IMGT (international ImMunoGeneTics information System®), http://imgt.org and LeFranc et al. In Silico Biology, 2005; 5:45-60). The MICA mature protein including leader, ECD, TM and CY domains, is made up of 360 to 366 amino acids, the difference arising from a microsatellite polymorphism in the transmembrane region. The α1, α2 and α3 can be defined according to any suitable numbering system (e.g., the IMGT numbering system). In one embodiment, the α1 domain comprises residue positions 0.1 to 88 of the MICA polypeptide of SEQ ID NO 1; the α2 domain comprises residue positions 89 to 181 of the MICA polypeptide of SEQ ID NO 1; and the α3 domain comprises residue positions 182 to 274 of the MICA polypeptide of SEQ ID NO 1. The α1 and α2 domains each comprise A, B, C and D strands, AB, BC and CD turns, and a helix. The α3 domain comprises A, B, C, D, E, F and G strands, a BC loop, a CD strand, a DE-turn and an FG loop. The MICA protein is highly glycosylated with eight potential glycosylation sites, two in α1, one in α2 and five in the α3 domain, including O-glycans (N-acetyllactosamine linked to serine or threonine). While MICA is expressed constitutively in certain cells, low levels of MICA expression do not usually give rise to host immune cell attach. However, on MICA is upregulated on rapidly proliferating cells such as tumor cells. MICA is the most highly expressed of all NKG2D ligands, and it has been found across a wide range of tumor types (e.g. carcinomas in general, bladder cancer, melanoma, lung cancer, hepatocellular cancer, glioblastoma, prostate cancer, hematological malignancies in general, acute myeloid leukemia, acute lymphatic leukemia, chronic myeloid leukemia and chronic lymphatic leukemia. Recently, Tsuboi et al. (2011) (EMBO J: 1-13) reported that the O-glycan branching enzyme, core2 β-1,6-N-acetylglucosaminyltransferase (C2GnT) is active in MICA-expressing tumor cells and that MICA from tumor cells contains core2 O-glycan (an O-glycan comprising an N-acetylglucosamine branch connected to N-acetylgalactosamine).


Bauer et al Science 285: 727-729, 1999 provided a role for MICA as a stress-inducible ligand for NKG2D. As used herein, “MICA” refers to any MICA polypeptide, including any variant, derivative, or isoform of the MICA gene or encoded protein(s) to which they refer. The MICA gene is polymorphic, displaying an unusual distribution of a number of variant amino acids in their extracellular alpha-1, alpha-2, and alpha-3 domains. Various allelic variants have been reported for MICA polypeptides (e.g. MICA), each of these are encompassed by the respective terms, including, e.g., human MICA polypeptides MICA*001, MICA*002, MICA*004, MICA*005, MICA*006, MICA*007, MICA*008, MICA*009, MICA*010, MICA*011, MICA*012, MICA*013, MICA*014, MICA*015, MICA*016, MICA*017, MICA*018, MICA*019, MICA*020, MICA*022, MICA*023, MICA*024, MICA*025, MICA*026, MICA*027, MICA*028, MICA*029, MICA*030, MICA*031, MICA*032, MICA*033, MICA*034, MICA*035, MICA*036, MICA*037, MICA*038, MICA*039, MICA*040, MICA*041, MICA*042, MICA*043, MICA*044, MICA*045, MICA*046, MICA*047, MICA*048, MICA*049, MICA*050, MICA*051, MICA*052, MICA*053, MICA*054, MICA*055 and MICA*056. Also encompassed are any nucleic acid or protein sequences sharing one or more biological properties or functions with wild type, full length MICA, respectively, and sharing at least 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99%, or higher nucleotide or amino acid identity.


As used herein, “hNKG2D” and, unless otherwise stated or contradicted by context, the terms “NKG2D,” “NKG2-D,” “CD314,” “D12S2489E,” “KLRK1,” “killer cell lectin-like receptor subfamily K, member 1,” or “KLRK1,” refer to a human killer cell activating receptor gene, its cDNA (e.g., GenBank Accession No. NM007360), and its gene product (GenBank Accession No. NP031386), or naturally occurring variants thereof. In NK and T cells, hNKG2D can form heterodimers or higher order complexes with proteins such as DAP10 (GenBank Accession No. AAG29425, AAD50293). Any activity attributed herein to hNKG2D, e.g., cell activation, antibody recognition, etc., can also be attributed to hNKG2D in the form of a heterodimer such as hNKG2D-DAP10, or higher order complexes with these two (and/or other) components.


The 3D structure of MICA in complex with NKG2D has been determined (see, e.g., Li et al., Nat. Immunol. 2001: 2:443-451; code 1hyr, and in IMGT/3D structure-DB (Kaas et al. Nucl. Acids Res. 2004; 32:D208-D210)). When MICA is in complex with a NKG2D homodimer, the residues 63 to 73 (IGMT numbering) of MICA α2 are ordered, adding almost two turns of helix. The two monomers of NKG2D equally contribute to interactions with MICA, and seven positions in each NKG2D monomer interact with one of the MICA α1 or α2 helix domains.


The invention provides methods of using the antigen-binding compounds of the invention; for example, the invention provides a method for inhibiting cell proliferation or activity, for delivering a molecule to a cell (e.g. a toxic molecule, a detectable marker, etc.), for targeting, identifying or purifying a cell, for depleting, killing or eliminating a cell, for reducing cell proliferation, the method comprising exposing a cell, such as a tumor cell which expresses a MICA polypeptide, to an antigen-binding compound of the invention that binds a MICA polypeptide. It will be appreciated that for the purposes of the present invention, “cell proliferation” can refer to any aspect of the growth or proliferation of cells, e.g., cell growth, cell division, or any aspect of the cell cycle. The cell may be in cell culture (in vitro) or in a mammal (in vivo), e.g. a mammal suffering from a MICA-expressing pathology. The invention also provides a method for inducing the death of a cell or inhibiting the proliferation or activity of a cell which expresses a MICA polypeptide, comprising exposing the cell to an antigen-binding compound that binds a MICA polypeptide linked to a toxic agent, in an amount effective to induce death and/or inhibit the proliferation of the cell. Thus, the invention provides a method for treating a mammal suffering from a proliferative disease, and any condition characterized by a pathogenic expansion of cells expressing of a MICA polypeptide, the method comprising administering a pharmaceutically effective amount of an antigen-binding compound disclosed herein to the mammal, e.g. for the treatment of a cancer.


DEFINITIONS

As used in the specification, “a” or “an” may mean one or more. As used in the claim(s), when used in conjunction with the word “comprising”, the words “a” or “an” may mean one or more than one. As used herein “another” may mean at least a second or more.


Where “comprising” is used, this can preferably be replaced by “consisting essentially of”, more preferably by “consisting of”.


Whenever within this whole specification “treatment of a proliferative disease” or “treatment of a tumor”, or “treatment of cancer” or the like is mentioned with reference to anti-MICA binding agent (e.g. antibody), there is meant: (a) method of treatment of a proliferative disease, said method comprising the step of administering (for at least one treatment) an anti-MICA binding agent, (preferably in a pharmaceutically acceptable carrier material) to a warm-blooded animal, especially a human, in need of such treatment, in a dose that allows for the treatment of said disease (a therapeutically effective amount), preferably in a dose (amount) as specified to be preferred hereinabove and herein below; (b) the use of an anti-MICA binding agent for the treatment of a proliferative disease, or an anti-MICA binding agent, for use in said treatment (especially in a human); (c) the use of an anti-MICA binding agent, for the manufacture of a pharmaceutical preparation for the treatment of a proliferative disease, a method of using an anti-MICA binding agent for the manufacture of a pharmaceutical preparation for the treatment of a proliferative disease, comprising admixing an anti-MICA binding agent with a pharmaceutically acceptable carrier, or a pharmaceutical preparation comprising an effective dose of an anti-MICA binding agent that is appropriate for the treatment of a proliferative disease; or (d) any combination of a), b), and c), in accordance with the subject matter allowable for patenting in a country where this application is filed.


The terms “cancer” and “tumor” as used herein are defined as a new growth of cells or tissue comprising uncontrolled and progressive multiplication. In a specific embodiment, upon a natural course the cancer is fatal. In specific embodiments, a cancer is invasive, metastatic, and/or anaplastic (loss of differentiation and of orientation to one another and to their axial framework).


The term “biopsy” as used herein is defined as removal of a tissue from an organ for the purpose of examination, such as to establish diagnosis. Examples of types of biopsies include by application of suction, such as through a needle attached to a syringe; by instrumental removal of a fragment of tissue; by removal with appropriate instruments through an endoscope; by surgical excision, such as of the whole lesion; and the like.


The term “antibody,” as used herein, refers to polyclonal and monoclonal antibodies. Depending on the type of constant domain in the heavy chains, antibodies are assigned to one of five major classes: IgA, IgD, IgE, IgG, and IgM. Several of these are further divided into subclasses or isotypes, such as IgG1, IgG2, IgG3, IgG4, and the like. An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one “light” (about 25 kDa) and one “heavy” chain (about 50-70 kDa). The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids that is primarily responsible for antigen recognition. The terms variable light chain (VL) and variable heavy chain (VH) refer to these light and heavy chains respectively. The heavy-chain constant domains that correspond to the different classes of immunoglobulins are termed “alpha,” “delta,” “epsilon,” “gamma” and “mu,” respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known. IgG and/or IgM are the preferred classes of antibodies employed in this invention, with IgG being particularly preferred, because they are the most common antibodies in the physiological situation and because they are most easily made in a laboratory setting. Preferably the antibody of this invention is a monoclonal antibody. Particularly preferred are humanized, chimeric, human, or otherwise-human-suitable antibodies. “Antibodies” also includes any fragment or derivative of any of the herein described antibodies.


The term “specifically binds to” means that an antibody can bind preferably in a competitive binding assay to the binding partner, e.g. MICA, as assessed using either recombinant forms of the proteins, epitopes therein, or native proteins present on the surface of isolated target cells. Competitive binding assays and other methods for determining specific binding are further described below and are well known in the art.


When an antibody is said to “compete with” a particular monoclonal antibody (e.g. 9C10, 20C6 or 16A8), it means that the antibody competes with the monoclonal antibody in a binding assay using either recombinant MICA molecules or surface expressed MICA molecules. For example, if a test antibody reduces the binding of 9C10, 20C6 or 16A8 to a MICA polypeptide or MICA-expressing cell in a binding assay, the antibody is said to “compete” respectively with 9C10, 20C6 or 16A8.


The term “affinity”, as used herein, means the strength of the binding of an antibody to an epitope. The affinity of an antibody is given by the dissociation constant KD, defined as [Ab]×[Ag]/[Ab−Ag], where [Ab−Ag] is the molar concentration of the antibody-antigen complex, [Ab] is the molar concentration of the unbound antibody and [Ag] is the molar concentration of the unbound antigen. The affinity constant Ka is defined by 1/Kd. Preferred methods for determining the affinity of mAbs can be found in Harlow, et al., Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1988), Coligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1992, 1993), and Muller, Meth. Enzymol. 92:589-601 (1983), which references are entirely incorporated herein by reference. One preferred and standard method well known in the art for determining the affinity of mAbs is the use of surface plasmon resonance (SPR) screening (such as by analysis with a BIAcore™ SPR analytical device).


Within the context of this invention a “determinant” designates a site of interaction or binding on a polypeptide.


The term “epitope” refers to an antigenic determinant, and is the area or region on an antigen to which an antibody binds. A protein epitope may comprise amino acid residues directly involved in the binding as well as amino acid residues which are effectively blocked by the specific antigen binding antibody or peptide, i.e., amino acid residues within the “footprint” of the antibody. It is the simplest form or smallest structural area on a complex antigen molecule that can combine with e.g., an antibody or a receptor. Epitopes can be linear or conformational/structural. The term “linear epitope” is defined as an epitope composed of amino acid residues that are contiguous on the linear sequence of amino acids (primary structure). The term “conformational or structural epitope” is defined as an epitope composed of amino acid residues that are not all contiguous and thus represent separated parts of the linear sequence of amino acids that are brought into proximity to one another by folding of the molecule (secondary, tertiary and/or quaternary structures). A conformational epitope is dependent on the 3-dimensional structure. The term ‘conformational’ is therefore often used interchangeably with ‘structural’.


The term “depleting”, with respect to MICA-expressing cells means a process, method, or compound that can kill, eliminate, lyse or induce such killing, elimination or lysis, so as to negatively affect the number of MICA-expressing cells present in a sample or in a subject.


An “agent” or “compound” according to the present invention comprises small molecules, polypeptides, proteins, antibodies or antibody fragments. Small molecules, in the context of the present invention, mean in one embodiment chemicals with molecular weight smaller than 1000 Daltons, particularly smaller than 800 Daltons, more particularly smaller than 500 Daltons. The term “therapeutic agent” refers to an agent that has biological activity. The term “anti-cancer agent” refers to an agent that has biological activity against cancer cells.


The term “human-suitable”, with respect to an antibody, refers to any antibody, derivatized antibody, or antibody fragment that can be safely used in humans for, e.g. the therapeutic methods described herein. Human-suitable antibodies include all types of humanized, chimeric, or fully human antibodies, or any antibodies in which at least a portion of the antibodies is derived from humans or otherwise modified so as to avoid the immune response that is generally provoked when native non-human antibodies are used.


For the purposes of the present invention, a “humanized” or “human” antibody refers to an antibody in which the constant and variable framework region of one or more human immunoglobulins is fused with the binding region, e.g. the CDR, of an animal immunoglobulin. Such antibodies are designed to maintain the binding specificity of the non-human antibody from which the binding regions are derived, but to avoid an immune reaction against the non-human antibody. Such antibodies can be obtained from transgenic mice or other animals that have been “engineered” to produce specific human antibodies in response to antigenic challenge (see, e.g., Green et al. (1994) Nature Genet 7:13; Lonberg et al. (1994) Nature 368:856; Taylor et al. (1994) Int Immun 6:579, the entire teachings of which are herein incorporated by reference). A fully human antibody also can be constructed by genetic or chromosomal transfection methods, as well as phage display technology, all of which are known in the art (see, e.g., McCafferty et al. (1990) Nature 348:552-553). Human antibodies may also be generated by in vitro activated B cells (see, e.g., U.S. Pat. Nos. 5,567,610 and 5,229,275, which are incorporated in their entirety by reference).


A “chimeric antibody” is an antibody molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function and/or species, or an entirely different molecule which confers new properties to the chimeric antibody, e.g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity.


The terms “Fc domain,” “Fc portion,” and “Fc region” refer to a C-terminal fragment of an antibody heavy chain, e.g., from about amino acid (aa) 230 to about aa 450 of human γ (gamma) heavy chain or its counterpart sequence in other types of antibody heavy chains (e.g., α, δ, ε and μ for human antibodies), or a naturally occurring allotype thereof. Unless otherwise specified, the commonly accepted Kabat amino acid numbering for immunoglobulins is used throughout this disclosure (see Kabat et al. (1991) Sequences of Protein of Immunological Interest, 5th ed., United States Public Health Service, National Institute of Health, Bethesda, Md., also referred to as “Kabat EU”).


The term “antibody-dependent cell-mediated cytotoxicity” or “ADCC” is a term well understood in the art, and refers to a cell-mediated reaction in which non-specific cytotoxic cells that express Fc receptors (FcRs) recognize bound antibody on a target cell and subsequently cause lysis of the target cell. Non-specific cytotoxic cells that mediate ADCC include natural killer (NK) cells, macrophages, monocytes, neutrophils, and eosinophils.


The term “complement-dependent cytotoxicity” or “CDC” is a term well understood in the art, and refers to the ability of a molecule to lyse a target in the presence of complement. The complement activation pathway is initiated by the binding of the first component of the complement system (C1q) to a molecule (e.g. an antibody) complexed with a cognate antigen.


The term “shedding”, when referring to MICA, refers to release of a soluble extracellular domain (ECD) fragment of MICA from the cell surface of a cell which expresses MICA. Such shedding may be caused by proteolytic cleavage (e.g. through the action of matrix metalloproteinases (MMPs), e.g. ADAM10 and/or ADAM17) of cell surface MICA resulting in release of an ECD fragment from the cell surface, or the soluble ECD or fragment thereof may be encoded by an alternate transcript.


The terms “isolated”, “purified” or “biologically pure” refer to material that is substantially or essentially free from components which normally accompany it as found in its native state. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified.


The terms “polypeptide,” “peptide” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymer.


The term “recombinant” when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found within the native (nonrecombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.


As used herein, “NK cells” refers to a sub-population of lymphocytes that is involved in non-conventional immunity. NK cells can be identified by virtue of certain characteristics and biological properties, such as the expression of specific surface antigens including CD56 and/or CD16 for human NK cells, the absence of the alpha/beta or gamma/delta TCR complex on the cell surface, the ability to bind to and kill cells that fail to express “self” MHC/HLA antigens by the activation of specific cytolytic machinery, the ability to kill tumor cells or other diseased cells that express a ligand for NK activating receptors, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response. Any of these characteristics and activities can be used to identify NK cells, using methods well known in the art. Any subpopulation of NK cells will also be encompassed by the term NK cells. Within the context of this invention “active” NK cells designate biologically active NK cells, including NK cells having the capacity of lysing target cells or enhancing the immune function of other cells. For instance, an “active” NK cell can be able to kill cells that express a ligand for an activating NK receptor and/or fail to express MHC/HLA antigens recognized by a KIR on the NK cell. NK cells can be obtained by various techniques known in the art, such as isolation from blood samples, cytapheresis, tissue or cell collections, etc. Useful protocols for assays involving NK cells can be found in Natural Killer Cells Protocols (edited by Campbell K S and Colonna M). Human Press. pp. 219-238 (2000).


As used herein, “T cells” refers to a sub-population of lymphocytes that mature in the thymus, and which display, among other molecules T cell receptors on their surface. T cells can be identified by virtue of certain characteristics and biological properties, such as the expression of specific surface antigens including the TCR, CD4 or CD8, the ability of certain T cells to kill tumor or infected cells, the ability of certain T cells to activate other cells of the immune system, and the ability to release protein molecules called cytokines that stimulate or inhibit the immune response. Any of these characteristics and activities can be used to identify T cells, using methods well known in the art. Within the context of this invention, “active” or “activated” T or NK cells designate biologically active T or NK cells, more particularly T or NK cells having the capacity of cytolysis or of stimulating an immune response by, e.g., secreting cytokines. Active cells can be detected in any of a number of well known methods, including functional assays and expression-based assays such as the expression of cytokines.


Within the context of this invention, the term antibody that “binds” a polypeptide or epitope designates an antibody that binds said determinant with specificity and/or affinity.


Antibodies

The antibodies of the present invention are antibodies that bind human MICA. In an embodiment, the antibodies bind to a MICA polypeptide (an anti-MICA antibody) without substantially blocking the interaction of MICA with NKG2D (e.g., the interaction of surface MICA on tumor cells with surface NKG2D on effector cells). In one embodiment, the antibodies bind to a MICA polypeptide on the surface of a cell without substantially blocking shedding of MICA from the cell surface (e.g. of tumor cells). In one embodiment, the antibodies bind a 1 and/or α2 domains of MICA. In one embodiment, the antibodies bind the α3 domain of MICA. In one embodiment, the antibodies have an affinity for human MICA alleles *001, *004 and *008, optionally further *007 and/or *019, optionally characterized by a Kd of less than 10−9 M, preferably less than 10−10 M.


In one embodiment, the antibody competes for binding to the MICA polypeptide with any one or more of antibodies 9C10, 20C6 or 16A8. Preferably the antibody recognizes, binds to, or has immunospecificity for substantially or essentially the same, or the same, epitope or “epitopic site” on a MICA polypeptide.


Antibody Epitopes

In another embodiment, the antibodies bind substantially the same epitope as antibody 9C10, 20C6 or 16A8. In another embodiment, the antibodies at least partially overlaps, or includes at least one residue in the segment corresponding to residues 1-88, residues 89-181, or residues 182-274 of a MICA polypeptide comprising an amino acid sequence of SEQ ID NOS: 1 to 5. In one embodiment, all key residues of the epitope is in a segment corresponding to residues 1-88, residues 89-181, or residues 182-274 of a MICA polypeptide comprising an amino acid sequence of SEQ ID NOS: 1 to 5. In one embodiment, an antibody binds an epitope spanning the junction of (a) the α1 and/or α2 domain and (b) the α3 domain, wherein all key residues of the epitope is in a segment corresponding to residues 1-181 (e.g., residues 1-88 or 89-181) and residues 182-274 of a MICA polypeptide comprising an amino acid sequence of SEQ ID NOS: 1 to 5. In one embodiment, the antibodies bind an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues in the segment corresponding to residues 1-88, residues 89-181, and/or residues 182-274 of a MICA polypeptide comprising an amino acid sequence of SEQ ID NOS: 1 to 5. Preferably the residues bound by the antibody are present on the surface of the of the MICA polypeptide, e.g. in a MICA polypeptide expressed on the surface of a cell.


In one embodiment, the antibodies bind one or more amino acids present on the surface of the MICA polypeptide alleles *001, *004 and *008 (and optionally further *007 and *019). In one such embodiment, the antibodies bind an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues (with reference to a MICA of any of SEQ ID NOS 1-5), wherein one (or more) of said residues is selected from the group consisting of H3, S4, R6, NB, T10, L12, W14, Q19, G21, F22, L23, E25, H27, G30, P32, R35, D37, Q39, K40, R42, A43, K44, P45, Q48, W49, A50, E51, D52, V53, L54, G55, N56, K57, T58, D82, Q83, K84 and E85. In one such embodiment, the antibodies bind an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues, wherein one (or more) of said residues is selected from the group consisting of G86, L87, S89, Q91, 193, V95, E97, H99, E100, D101, N102, S103, 1104, R105, S107, H109, Y111, D113, G114, E115, L116, S119, N121, E123, E126, W127, T128, P130, Q131, S132, S133, R134, Q136, T137, L138, M140, N141, R143, N144, K147, E148, K154, R169, L172, S174, V177, L178, R179 and T180. In one such embodiment, the antibodies bind an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues wherein one (or more) of said residues is selected from the group consisting of V182, P183, P184, M185, V186, N187, V188, T189, R190, S191, E192, A193, S194, E195, G196, N197, T199, T201, R203, S205, N211, 1212, R217, Q218, D219, G220, V221, S222, L223, S224, H225, D226, T227, Q229, W230, D232, V233, L234, P235, D236, G237, N238, Y241, Q242, W244, R248, C250, G252, E253, E254, Q255, R256, T258, Y260, E262, S264, G265, N266, H267, S268, T269, H270, P271, P273 and S274.


Optionally, in any embodiment, the antibodies can optionally further be characterized by not substantially binding to an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues wherein one (or more) of said residues is selected from the group consisting of T124, K125, M129, K173, G175, T181, G206, W210, T213 and Q251 of a MICA polypeptide. Optionally, further, the antibodies can be characterized as not substantially binding to the α3 domain region required for MICA shedding (e.g. the 6 amino acid motif comprising N238 to T243).


In one embodiment, the antibodies bind one or more amino acids present on the surface of the MICA polypeptide alleles *001, *004 and *008 (and optionally further *007 and *019) but do not bind MICB. In one such embodiment, the antibodies bind an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues wherein one (or more) of said residues is selected from the group consisting of N56, E85, N102, W127, R143, R169, V177 and L178.


In one embodiment, the antibody binds to MICA at least partially within an α1 domain of MICA and binds an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues wherein one (or more) of said residues is selected from the group consisting of N56 and E85. Said epitope may be entirely within the α1 domain of MICA or may include residues in the α2 and/or α3 domains of MICA.


In one embodiment, the antibody binds to MICA at least partially within an α2 domain of MICA and binds an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues wherein one (or more) of said residues is selected from the group consisting of N102, W127, R143, R169, V177 and L178. Said epitope may be entirely within the α2 domain of MICA or may include residues in the α1 and/or α3 domains of MICA.


In one embodiment, the antibody binds to MICA at least partially within an α3 domain of MICA and binds an epitope comprising 1, 2, 3, 4, 5, 6, 7 or more residues wherein one (or more) of said residues is selected from the group consisting of R190, A193, D226, C250 and S268. Said epitope may be entirely within the α3 domain of MICA or may include residues in the α1 and/or α2 domains of MICA.


Binding of anti-MICA antibody to cells transfected with the MICA mutants can be measured and compared to the ability of anti-MICA antibody to bind wild-type MICA polypeptide (e.g., any one or more of SEQ ID NOS: 1 to 5). A reduction in binding between an anti-MICA antibody and a mutant MICA polypeptide means that there is a reduction in binding affinity (e.g., as measured by known methods such FACS testing of cells expressing a particular mutant, or by Biacore testing of binding to mutant polypeptides) and/or a reduction in the total binding capacity of the anti-MICA antibody (e.g., as evidenced by a decrease in Bmax in a plot of anti-MICA antibody concentration versus polypeptide concentration). A significant reduction in binding indicates that the mutated residue is directly involved in binding to the anti-MICA antibody or is in close proximity to the binding protein when the anti-MICA antibody is bound to MICA.


In some embodiments, a significant reduction in binding means that the binding affinity and/or capacity between an anti-MICA antibody and a mutant MICA polypeptide is reduced by greater than 40%, greater than 50%, greater than 55%, greater than 60%, greater than 65%, greater than 70%, greater than 75%, greater than 80%, greater than 85%, greater than 90% or greater than 95% relative to binding between the antibody and a wild type MICA polypeptide. In certain embodiments, binding is reduced below detectable limits. In some embodiments, a significant reduction in binding is evidenced when binding of an anti-MICA antibody to a mutant MICA polypeptide is less than 50% (e.g., less than 45%, 40%, 35%, 30%, 25%, 20%, 15% or 10%) of the binding observed between the anti-MICA antibody and a wild-type MICA polypeptide.


In some embodiments, anti-MICA antibodies are provided that exhibit significantly lower binding for a mutant MICA polypeptide in which a residue in a segment corresponding to residues 1-88, residues 89-181, or residues 182-274 (or a subsequence thereof) in a wild-type MICA polypeptide (e.g., comprising a sequence of SEQ ID NOS: 1 to 5) is substituted with a different amino acid. In some embodiments, anti-MICA antibodies are provided that exhibit significantly lower binding for a mutant MICA polypeptide in which a residue in a segment corresponding to residues 1-88, residues 89-181, or residues 182-274 (or a subsequence thereof) in a wild-type MICA polypeptide (e.g., comprising a sequence of SEQ ID NOS: 1 to 5) is substituted with a different amino acid.


In some embodiments, anti-MICA antibodies are provided that exhibit significantly lower binding for a mutant MICA polypeptide in which a residue H3, S4, R6, N8, T10, L12, W14, Q19, G21, F22, L23, E25, H27, G30, P32, R35, D37, Q39, K40, R42, A43, K44, P45, Q48, W49, A50, E51, D52, V53, L54, G55, N56, K57, T58, D82, Q83, K84 or E85, or a residue G86, L87, S89, Q91, 193, V95, E97, H99, E100, D101, N102, S103, T104, R105, S107, H109, Y111, D113, G114, E115, L116, S119, N121, E123, E126, W127, T128, P130, Q131, S132, S133, R134, Q136, T137, L138, M140, N141, R143, N144, K147, E148, K154, R169, L172, S174, V177, L178, R179 or T180 or a residue V182, P183, P184, M185, V186, N187, V188, T189, R190, S191, E192, A193, S194, E195, G196, N197, T199, T201, R203, S205, N211, 1212, R217, Q218, D219, G220, V221, S222, L223, S224, H225, D226, T227, Q229, W230, D232, V233, L234, P235, D236, G237, N238, Y241, Q242, W244, R248, C250, G252, E253, E254, Q255, R256, T258, Y260, E262; S264, G265, N266, H267, S268, T269, H270, P271, P273 or S274 is substituted with a different amino acid, compared to a wild-type MICA polypeptide.


In some embodiments, anti-MICA antibodies are provided that do not exhibit significantly lower binding for a mutant MICA polypeptide in which a residue T124, K125, M129, K173, G175, T181, G206, W210, T213 or Q251 is substituted with a different amino acid, compared to a wild-type MICA polypeptide.


In some embodiments, anti-MICA antibodies are provided that exhibit significantly lower binding for a mutant MICA polypeptide in which a residue N56, E85, N102, W127, R143, R169, V177, L178, R190, A193, D226, C250 and/or S268 is substituted with a different amino acid, compared to a wild-type MICA polypeptide.


Producing Anti-MICA Antibodies

The antibodies of this invention may be produced by a variety of techniques known in the art. Typically, they are produced by immunization of a non-human animal, preferably a mouse, with an immunogen comprising a MICA polypeptide, preferably a human MICA polypeptide. The MICA polypeptide may comprise the full length sequence of a human MICA polypeptide, or a fragment or derivative thereof, typically an immunogenic fragment, i.e., a portion of the polypeptide comprising an epitope exposed on the surface of cells expressing a MICA polypeptide, preferably the epitope recognized by the 9C10, 20C6 or 16A8 antibody. Such fragments typically contain at least about 7 consecutive amino acids of the mature polypeptide sequence, even more preferably at least about 10 consecutive amino acids thereof. Fragments typically are essentially derived from the extra-cellular domain of the receptor. In a preferred embodiment, the immunogen comprises a wild-type human MICA polypeptide in a lipid membrane, typically at the surface of a cell. In a specific embodiment, the immunogen comprises intact cells, particularly intact human cells, optionally treated or lysed. In another preferred embodiment, the polypeptide is a recombinant MICA polypeptide. In a specific embodiment, the immunogen comprises intact tumor cells.


The step of immunizing a non-human mammal with an antigen may be carried out in any manner well known in the art for stimulating the production of antibodies in a mouse (see, for example, E. Harlow and D. Lane, Antibodies: A Laboratory Manual., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1988), the entire disclosure of which is herein incorporated by reference). The immunogen is suspended or dissolved in a buffer, optionally with an adjuvant, such as complete or incomplete Freund's adjuvant. Methods for determining the amount of immunogen, types of buffers and amounts of adjuvant are well known to those of skill in the art and are not limiting in any way on the present invention. These parameters may be different for different immunogens, but are easily elucidated.


Similarly, the location and frequency of immunization sufficient to stimulate the production of antibodies is also well known in the art. In a typical immunization protocol, the non-human animals are injected intraperitoneally with antigen on day 1 and again about a week later. This is followed by recall injections of the antigen around day 20, optionally with an adjuvant such as incomplete Freund's adjuvant. The recall injections are performed intravenously and may be repeated for several consecutive days. This is followed by a booster injection at day 40, either intravenously or intraperitoneally, typically without adjuvant. This protocol results in the production of antigen-specific antibody-producing B cells after about 40 days. Other protocols may also be used as long as they result in the production of B cells expressing an antibody directed to the antigen used in immunization.


For polyclonal antibody preparation, serum is obtained from an immunized non-human animal and the antibodies present therein isolated by well-known techniques. The serum may be affinity purified using any of the immunogens set forth above linked to a solid support so as to obtain antibodies that react with MICA polypeptides.


In an alternate embodiment, lymphocytes from a non-immunized non-human mammal are isolated, grown in vitro, and then exposed to the immunogen in cell culture. The lymphocytes are then harvested and the fusion step described below is carried out.


For preferred monoclonal antibodies, the next step is the isolation of splenocytes from the immunized non-human mammal and the subsequent fusion of those splenocytes with an immortalized cell in order to form an antibody-producing hybridoma. The isolation of splenocytes from a non-human mammal is well-known in the art and typically involves removing the spleen from an anesthetized non-human mammal, cutting it into small pieces and squeezing the splenocytes from the splenic capsule through a nylon mesh of a cell strainer into an appropriate buffer so as to produce a single cell suspension. The cells are washed, centrifuged and resuspended in a buffer that lyses any red blood cells. The solution is again centrifuged and remaining lymphocytes in the pellet are finally resuspended in fresh buffer.


Once isolated and present in single cell suspension, the lymphocytes can be fused to an immortal cell line. This is typically a mouse myeloma cell line, although many other immortal cell lines useful for creating hybridomas are known in the art. Preferred murine myeloma lines include, but are not limited to, those derived from MOPC-21 and MPC-11 mouse tumors available from the Salk Institute Cell Distribution Center, San Diego, U.S.A., X63 Ag8653 and SP-2 cells available from the American Type Culture Collection, Rockville, Md. U.S.A. The fusion is effected using polyethylene glycol or the like. The resulting hybridomas are then grown in selective media that contains one or more substances that inhibit the growth or survival of the unfused, parental myeloma cells. For example, if the parental myeloma cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (HAT medium), which substances prevent the growth of HGPRT-deficient cells.


Hybridomas are typically grown on a feeder layer of macrophages. The macrophages are preferably from littermates of the non-human mammal used to isolate splenocytes and are typically primed with incomplete Freund's adjuvant or the like several days before plating the hybridomas. Fusion methods are described in Goding, “Monoclonal Antibodies: Principles and Practice,” pp. 59-103 (Academic Press, 1986), the disclosure of which is herein incorporated by reference.


The cells are allowed to grow in the selection media for sufficient time for colony formation and antibody production. This is usually between about 7 and about 14 days.


The hybridoma colonies are then assayed for the production of antibodies that specifically bind to MICA polypeptide gene products, optionally the epitope specifically recognized by antibody 9C10, 20C6 or 16A8. The assay is typically a colorimetric ELISA-type assay, although any assay may be employed that can be adapted to the wells that the hybridomas are grown in. Other assays include radioimmunoassays or fluorescence activated cell sorting. The wells positive for the desired antibody production are examined to determine if one or more distinct colonies are present. If more than one colony is present, the cells may be re-cloned and grown to ensure that only a single cell has given rise to the colony producing the desired antibody.


Hybridomas that are confirmed to produce a monoclonal antibody of this invention can be grown up in larger amounts in an appropriate medium, such as DMEM or RPMI-1640. Alternatively, the hybridoma cells can be grown in vivo as ascites tumors in an animal.


After sufficient growth to produce the desired monoclonal antibody, the growth media containing monoclonal antibody (or the ascites fluid) is separated away from the cells and the monoclonal antibody present therein is purified. Purification is typically achieved by gel electrophoresis, dialysis, chromatography using protein A or protein G-Sepharose, or an anti-mouse Ig linked to a solid support such as agarose or Sepharose beads (all described, for example, in the Antibody Purification Handbook, Biosciences, publication No. 18-1037-46, Edition AC, the disclosure of which is hereby incorporated by reference). The bound antibody is typically eluted from protein A/protein G columns by using low pH buffers (glycine or acetate buffers of pH 3.0 or less) with immediate neutralization of antibody-containing fractions. These fractions are pooled, dialyzed, and concentrated as needed.


Positive wells with a single apparent colony are typically re-cloned and re-assayed to insure only one monoclonal antibody is being detected and produced.


Antibodies may also be produced by selection of combinatorial libraries of immunoglobulins, as disclosed for instance in (Ward et al. Nature, 341 (1989) p. 544, the entire disclosure of which is herein incorporated by reference).


The identification of one or more antibodies that bind(s) to MICA, particularly substantially or essentially the same epitope as monoclonal antibody 9C10, 20C6 or 16A8, can be readily determined using any one of a variety of immunological screening assays in which antibody competition can be assessed. Many such assays are routinely practiced and are well known in the art (see, e. g., U.S. Pat. No. 5,660,827, issued Aug. 26, 1997, which is specifically incorporated herein by reference). It will be understood that actually determining the epitope to which an antibody described herein binds is not in any way required to identify an antibody that binds to the same or substantially the same epitope as the monoclonal antibody described herein.


For example, where the test antibodies to be examined are obtained from different source animals, or are even of a different Ig isotype, a simple competition assay may be employed in which the control (9C10, 20C6 or 16A8, for example) and test antibodies are admixed (or pre-adsorbed) and applied to a sample containing MICA polypeptides. Protocols based upon western blotting and the use of BIACORE analysis are suitable for use in such competition studies.


In certain embodiments, one pre-mixes the control antibodies (9C10, 20C6 or 16A8, for example) with varying amounts of the test antibodies (e.g., about 1:10 or about 1:100) for a period of time prior to applying to the MICA antigen sample. In other embodiments, the control and varying amounts of test antibodies can simply be admixed during exposure to the MICA antigen sample. As long as one can distinguish bound from free antibodies (e. g., by using separation or washing techniques to eliminate unbound antibodies) and 9C10, 20C6 or 16A8 from the test antibodies (e. g., by using species-specific or isotype-specific secondary antibodies or by specifically labeling 9C10, 20C6 or 16A8 with a detectable label) one can determine if the test antibodies reduce the binding of 9C10, 20C6 or 16A8 to the antigens, indicating that the test antibody recognizes substantially the same epitope as 9C10, 20C6 or 16A8. The binding of the (labeled) control antibodies in the absence of a completely irrelevant antibody can serve as the control high value. The control low value can be obtained by incubating the labeled (9C10, 20C6 or 16A8) antibodies with unlabelled antibodies of exactly the same type (9C10, 20C6 or 16A8), where competition would occur and reduce binding of the labeled antibodies. In a test assay, a significant reduction in labeled antibody reactivity in the presence of a test antibody is indicative of a test antibody that recognizes substantially the same epitope, i.e., one that “cross-reacts” or competes with the labeled (9C10, 20C6 or 16A8) antibody. Any test antibody that reduces the binding of 9C10, 20C6 or 16A8 to MICA antigens by at least about 50%, such as at least about 60%, or more preferably at least about 80% or 90% (e. g., about 65-100%), at any ratio of 9C10, 20C6 or 16A8:test antibody between about 1:10 and about 1:100 is considered to be an antibody that binds to substantially the same epitope or determinant as 9C10, 20C6 or 16A8. Preferably, such test antibody will reduce the binding of 9C10, 20C6 or 16A8 to the MICA antigen by at least about 90% (e.g., about 95%).


Competition can also be assessed by, for example, a flow cytometry test. In such a test, cells bearing a given MICA polypeptide can be incubated first with 9C10, 20C6 or 16A8, for example, and then with the test antibody labeled with a fluorochrome or biotin. The antibody is said to compete with 9C10, 20C6 or 16A8 if the binding obtained upon preincubation with a saturating amount of 9C10, 20C6 or 16A8 is about 80%, preferably about 50%, about 40% or less (e.g., about 30%, 20% or 10%) of the binding (as measured by mean of fluorescence) obtained by the antibody without preincubation with 9C10, 20C6 or 16A8. Alternatively, an antibody is said to compete with 9C10, 20C6 or 16A8 if the binding obtained with a labeled 9C10, 20C6 or 16A8 antibody (by a fluorochrome or biotin) on cells preincubated with a saturating amount of test antibody is about 80%, preferably about 50%, about 40%, or less (e. g., about 30%, 20% or 10%) of the binding obtained without preincubation with the test antibody.


A simple competition assay in which a test antibody is pre-adsorbed and applied at saturating concentration to a surface onto which a MICA antigen is immobilized may also be employed. The surface in the simple competition assay is preferably a BIACORE chip (or other media suitable for surface plasmon resonance analysis). The control antibody (e.g., 9C10, 20C6 or 16A8) is then brought into contact with the surface at a MICA-saturating concentration and the MICA and surface binding of the control antibody is measured. This binding of the control antibody is compared with the binding of the control antibody to the MICA-containing surface in the absence of test antibody. In a test assay, a significant reduction in binding of the MICA-containing surface by the control antibody in the presence of a test antibody indicates that the test antibody recognizes substantially the same epitope as the control antibody such that the test antibody “cross-reacts” with the control antibody. Any test antibody that reduces the binding of control (such as 9C10, 20C6 or 16A8) antibody to a MICA antigen by at least about 30% or more, preferably about 40%, can be considered to be an antibody that binds to substantially the same epitope or determinant as a control (e.g., 9C10, 20C6 or 16A8). Preferably, such a test antibody will reduce the binding of the control antibody (e.g., 9C10, 20C6 or 16A8) to the MICA antigen by at least about 50% (e. g., at least about 60%, at least about 70%, or more). It will be appreciated that the order of control and test antibodies can be reversed: that is, the control antibody can be first bound to the surface and the test antibody is brought into contact with the surface thereafter in a competition assay. Preferably, the antibody having higher affinity for the MICA antigen is bound to the surface first, as it will be expected that the decrease in binding seen for the second antibody (assuming the antibodies are cross-reacting) will be of greater magnitude. Further examples of such assays are provided in, e.g., Saunal (1995) J. Immunol. Methods 183: 33-41, the disclosure of which is incorporated herein by reference.


Preferably, monoclonal antibodies that recognize a MICA epitope will react with an epitope that is present on a substantial percentage of or even all relevant MICA alleles. In one aspect, the anti-MICA antibodies of the invention bind MICA*004 and *008, optionally further MICA *001, *007 and/or *0019.


In preferred embodiments, the antibodies will bind to MICA-expressing cells from an individual or individuals with a disease characterized by expression of MICA-positive cells, i.e. an individual that is a candidate for treatment with one of the herein-described methods using an anti-MICA antibody of the invention. Accordingly, once an antibody that specifically recognizes MICA on cells is obtained, it can be tested for its ability to bind to MICA-positive cells (e.g. cancer cells). In particular, prior to treating a patient with one of the present antibodies, it will be beneficial to test the ability of the antibody to bind malignant cells taken from the patient, e.g. in a blood sample or tumor biopsy, to maximize the likelihood that the therapy will be beneficial in the patient.


In one embodiment, the antibodies of the invention are validated in an immunoassay to test their ability to bind to MICA-expressing cells, e.g. malignant cells. For example, a tumor biopsy is performed and tumor cells are collected. The ability of a given antibody to bind to the cells is then assessed using standard methods well known to those in the art. Antibodies that are found to bind to a substantial proportion (e.g., 20%, 30%, 40%, 50%, 60%, 70%, 80% or more) of cells known to express MICA, e.g. tumor cells, from a significant percentage of individuals or patients (e.g., 5%, 10%, 20%, 30%, 40%, 50% or more) are suitable for use in the present invention, both for diagnostic purposes to determine the presence or level of malignant cells in a patient or for use in the herein-described therapeutic methods, e.g., for use to increase or decrease malignant cell number or activity. To assess the binding of the antibodies to the cells, the antibodies can either be directly or indirectly labeled. When indirectly labeled, a secondary, labeled antibody is typically added.


Determination of whether an antibody binds within an epitope region can be carried out in ways known to the person skilled in the art. As one example of such mapping/characterization methods, an epitope region for an anti-MICA antibody may be determined by epitope “foot-printing” using chemical modification of the exposed amines/carboxyls in the MICA protein. One specific example of such a foot-printing technique is the use of HXMS (hydrogen-deuterium exchange detected by mass spectrometry) wherein a hydrogen/deuterium exchange of receptor and ligand protein amide protons, binding, and back exchange occurs, wherein the backbone amide groups participating in protein binding are protected from back exchange and therefore will remain deuterated. Relevant regions can be identified at this point by peptic proteolysis, fast microbore high-performance liquid chromatography separation, and/or electrospray ionization mass spectrometry. See, e. g., Ehring H, Analytical Biochemistry, Vol. 267 (2) pp. 252-259 (1999) Engen, J. R. and Smith, D. L. (2001) Anal. Chem. 73, 256A-265A. Another example of a suitable epitope identification technique is nuclear magnetic resonance epitope mapping (NMR), where typically the position of the signals in two-dimensional NMR spectra of the free antigen and the antigen complexed with the antigen binding peptide, such as an antibody, are compared. The antigen typically is selectively isotopically labeled with 15N so that only signals corresponding to the antigen and no signals from the antigen binding peptide are seen in the NMR-spectrum. Antigen signals originating from amino acids involved in the interaction with the antigen binding peptide typically will shift position in the spectrum of the complex compared to the spectrum of the free antigen, and the amino acids involved in the binding can be identified that way. See, e. g., Ernst Schering Res Found Workshop. 2004; (44): 149-67; Huang et al. Journal of Molecular Biology, Vol. 281 (1) pp. 61-67 (1998); and Saito and Patterson, Methods. 1996 June; 9 (3): 516-24.


Epitope mapping/characterization also can be performed using mass spectrometry methods. See, e.g., Downward, J Mass Spectrom. 2000 April; 35 (4): 493-503 and Kiselar and Downard, Anal Chem. 1999 May 1; 71 (9): 1792-801. Protease digestion techniques also can be useful in the context of epitope mapping and identification. Antigenic determinant-relevant regions/sequences can be determined by protease digestion, e.g. by using trypsin in a ratio of about 1:50 to MICA or o/n digestion at and pH 7-8, followed by mass spectrometry (MS) analysis for peptide identification. The peptides protected from trypsin cleavage by the anti-MICA binder can subsequently be identified by comparison of samples subjected to trypsin digestion and samples incubated with antibody and then subjected to digestion by e.g. trypsin (thereby revealing a footprint for the binder). Other enzymes like chymotrypsin, pepsin, etc., also or alternatively can be used in similar epitope characterization methods. Moreover, enzymatic digestion can provide a quick method for analyzing whether a potential antigenic determinant sequence is within a region of the MICA polypeptide that is not surface exposed and, accordingly, most likely not relevant in terms of immunogenicity/antigenicity. See, e. g., Manca, Ann 1st Super Sanita. 1991; 27: 15-9 for a discussion of similar techniques.


Site-directed mutagenesis is another technique useful for elucidation of a binding epitope. For example, in “alanine-scanning”, each residue within a protein segment is replaced with an alanine residue, and the consequences for binding affinity measured. If the mutation leads to a significant reduction in binding affinity, it is most likely involved in binding. Monoclonal antibodies specific for structural epitopes (i.e., antibodies which do not bind the unfolded protein) can be used to verify that the alanine-replacement does not influence over-all fold of the protein. See, e.g., Clackson and Wells, Science 1995; 267:383-386; and Wells, Proc Natl Acad Sci USA 1996; 93:1-6.


Electron microscopy can also be used for epitope “foot-printing”. For example, Wang et al., Nature 1992; 355:275-278 used coordinated application of cryoelectron micros-copy, three-dimensional image reconstruction, and X-ray crystallography to determine the physical footprint of a Fab-fragment on the capsid surface of native cowpea mosaic virus.


Other forms of “label-free” assay for epitope evaluation include surface plasmon resonance (SPR, BIACORE) and reflectometric interference spectroscopy (RifS). See, e.g., Fagerstam et al., Journal Of Molecular Recognition 1990; 3:208-14; Nice et al., J. Chromatogr. 1993; 646:159-168; Leipert et al., Angew. Chem. Int. Ed. 1998; 37:3308-3311; Kroger et al., Biosensors and Bioelectronics 2002; 17:937-944.


It should also be noted that an antibody binding the same or substantially the same epitope as an antibody of the invention can be identified in one or more of the exemplary competition assays described herein.


Upon immunization and production of antibodies in a vertebrate or cell, particular selection steps may be performed to isolate antibodies as claimed. In this regard, in a specific embodiment, the invention also relates to methods of producing such antibodies, comprising: (a) immunizing a non-human mammal with an immunogen comprising , a MICA polypeptide; and (b) preparing antibodies from said immunized animal; and (c) selecting antibodies from step (b) that are capable of binding MICA.


Typically, an anti-MICA antibody provided by the invention has an affinity for a MICA polypeptide in the range of about 104 to about 1011 M−1 (e.g., about 108 to about 1010 M−1). For example, in a particular aspect the invention provides Anti-MICA antibody that have an average disassociation constant (KD) of less than 1×10−8 M with respect to MICA, as determined by, e.g., surface plasmon resonance (SPR) screening (such as by analysis with a BIAcore™ SPR analytical device). In a more particular exemplary aspect, the invention provides Anti-MICA antibodies that have a KD of about 1×10−8 M to about 1×10−10 M, or about 1×10−9 M to about 1×10−11 M, for MICA.


Antibodies can be characterized for example by a mean KD of no more than about (i.e. better affinity than) 100, 60, 10, 5, or 1 nanomolar, preferably sub-nanomolar or optionally no more than about 500, 200, 100 or 10 picomolar. KD can be determined for example for example by immobilizing recombinantly produced human MICA proteins on a chip surface, followed by application of the antibody to be tested in solution. In one embodiment, the method further comprises a step (d), selecting antibodies from (b) that are capable of competing for binding to MICA with antibody 9C10, 20C6 or 16A8.


In one aspect of any of the embodiments, the antibodies prepared according to the present methods are monoclonal antibodies. In another aspect, the non-human animal used to produce antibodies according to the methods of the invention is a mammal, such as a rodent, bovine, porcine, fowl, horse, rabbit, goat, or sheep. The antibodies of the present invention encompass 9C10, 20C6 or 16A8. Additionally; antibodies of the invention can optionally be specified to be antibodies other than any of antibodies BAMO1 or BAMO3 described in Salih et al. (2003) (Blood 102(4): 1389-1396), antibody 2C10, 3H5, 6D4 or 6G6 described in Groh et al. (1996) Proc. Natl. Acad. Sci USA 93:12445-12450, Groh et al. (1998) Science 279:1737-1740 or WO2008/131406, the disclosures of each of which are incorporated herein by reference, or derivatives of the foregoing, e.g. that comprise the CDRs or the antigen binding region in whole or in part.


According to an alternate embodiment, the DNA encoding an antibody that binds an epitope present on MICA polypeptides is isolated from the hybridoma of this invention and placed in an appropriate expression vector for transfection into an appropriate host. The host is then used for the recombinant production of the antibody, or variants thereof, such as a humanized version of that monoclonal antibody, active fragments of the antibody, chimeric antibodies comprising the antigen recognition portion of the antibody, or versions comprising a detectable moiety.


DNA encoding the monoclonal antibodies of the invention, e.g., antibody 9C10, 20C6 or 16A8, can be readily isolated and sequenced using conventional procedures (e. g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). Once isolated, the DNA can be placed into expression vectors, which are then transfected into host cells such as E. coli cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. As described elsewhere in the present specification, such DNA sequences can be modified for any of a large number of purposes, e.g., for humanizing antibodies, producing fragments or derivatives, or for modifying the sequence of the antibody, e.g., in the antigen binding site in order to optimize the binding specificity of the antibody.


Recombinant expression in bacteria of DNA encoding the antibody is well known in the art (see, for example, Skerra et al., Curr. Opinion in Immunol., 5, pp. 256 (1993); and Pluckthun, Immunol. 130, p. 151 (1992).


Assessing Activity

Once an antigen-binding compound is obtained it will generally be assessed for its ability to block shedding of MICA from a cell, to block an interaction between NKG2D and MICA (e.g. sMICA or membrane bound MICA), to cause the death of a MICA-expressing cell, to induce ADCC or CDC towards, to inhibit the proliferation of and/or cause the elimination of MICA-expressing target cells.


Assessing the antigen-binding compound's ability to reduce binding or block an interaction between MICA and NKG2D can be carried out at any suitable stage of the method, e.g. as in the examples are provided herein. For example, tumor cells expressing MICA on their surface can be brought into contact with cells (e.g. effector cells) expressing NKG2D on their surface, with or without the addition of a candidate anti-MICA antibody. Binding between the MICA- and NKG2D-expressing cells can be assessed, and an antibody that does not reduce binding is selected. Another possibility involves contacting an isolated MICA polypeptide with an isolated NKG2D polypeptide, or a cell expressing an NKG2D polypeptide at its surface, and assessing binding between MICA and NKG2D polypeptide or cells expressing NKG2D. Another possibility involves contacting an isolated NKG2D polypeptide with a cell expressing a MICA polypeptide at its surface, and assessing binding between MICA polypeptide or a cell expressing MICA.


For example, to determine whether an agent blocks MICA interactions with NKG2D, the following test is performed: The cell line C1R or RMA transfected with MICA is incubated with a soluble NKG2D-Fc fusion protein, in the presence or absence of increasing concentrations of a test anti-MICA mAb. The cells are washed, and then incubated with a secondary antibody that recognizes the Fc part of the NKG2D-Fc fusion protein, washed again, and analyzed on a flow cytometer (FACScalibur, Beckton Dickinson), by standard methods. In the absence of anti-MICA mAbs, the NKG2D-Fc protein binds well to C1R or RMA cells. In the presence of an anti-MICA mAb that blocks MICA binding to NKG2D, there is a reduction of binding of NKG2D-Fc to the cells, and such mAbs are designated “blocking mAbs”. If the anti-MICA mAb does not lead to a reduction (e.g. no reduction, or a reduction of less than 5%, 10%, 20% or 30%) in binding of the NKG2D-Fc protein to cells, then the anti-MICA mAb is designated a “non-blocking” mAb.


Assessing the antigen-binding compound's ability to reduce binding or block an interaction between MICA and NKG2D can also be carried out by assessing the effect of the anti-MICA antibody on the function of NKG2D-expressing cells (e.g. NK or T cells). Preferably NK or T cells are used that express NKG2D but not CD16 so as to avoid any contribution of a CD16-mediated ADCC effect. If an anti-MICA antibody reduces or blocks MICA-NKG2D interactions it will be expected to dampen NKG2D-mediated activation of NK or T cells. An antibody that does not reduce binding or block an interaction between MICA and NKG2D will therefore not substantially reduce or block NKG2D-mediated activation of NK or T cells. This can be evaluated by a typical cytotoxicity assay, examples of which are described herein. Any of a number of cell-based assays can be used to assess NKG2D activity, including gene expression-based activities, cytotoxicity-based assays, and proliferation assays. In one aspect, in vitro assays will use NK cells or T cells from human patients, or, e.g., T cell lines transfected with an NKG2D-encoding transgene, so long that the expression of the receptor alters the activity of the cells in a detectable way, e.g., renders them activatable by NKG2D ligand. Any suitable, physiological change that reflects NKG2D activity can be used to assess the utility of a test compound or antibody. For example, one can measure a variety of effects, such as changes in gene expression, cytokine production, cell growth, cell proliferation, pH, intracellular second messengers, e.g., Ca2+, IP3, cGMP, or cAMP, or activity such as cytotoxic activity or ability to activate other T cells. In one embodiment, the activity of the receptor is assessed by detecting the expression of NKG2D-responsive genes, e.g., CD25, IFN-gamma, or TNF-alpha (see, e.g., Groh et al. (2003) PNAS 100: 9452-9457; André et al. (2004) Eur. J. Immunol 34: 1-11). In one embodiment, NKG2D activity is assessed by incubating NKG2D+ T or NK cells in the presence of MICA-expressing cells and an anti-MICA antibody, and assessing the ability of the compound or test antibody to inhibit the release of TNF-alpha or IFN-gamma by the T or NK cells.


Exemplary cytotoxicity assays are also described in the examples herein where NKG2D-mediated killing of target cells is assessed. Here, the ability of anti-MICA antibodies to reduce or inhibit the NKG2D+ CD16− NK92 cell are used to assess NK cell-mediated killing of MICA*019-transfected BaF/3 by measuring target cell release of 51Cr. The in vitro cytotoxicity assay is carried out by standard methods that are well known in the art, as described for example in Coligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1992, 0.1993). The MICA-expressing target cells are labeled with 51Cr prior to addition of NK cells, and then the killing is estimated as proportional to the release of 51Cr from the cells to the medium, as a result of killing. Addition of an agent that reduces binding or blocks an interaction between MICA and NKG2D results in prevention of the initiation and propagation of activatory signaling via NKG2D. Therefore addition of such agents results in decreases in NK-mediated killing of the target cells.


An antigen-binding compound that does not reduce or block (e.g. no reduction, or a reduction of less than 5%, 10%, 20% or 30%) the activation of cells by NKG2D (e.g. cytokine production, cell growth, cell proliferation, pH, intracellular second messengers, NK-mediated killing of MICA-expressing cells) is designated a “non-blocking” mAb and will be a compound that does not reduce binding or block an interaction between MICA and NKG2D.


Assessing the antigen-binding compound's ability to block shedding of MICA from a MICA-expressing cell can be carried out at any suitable stage of the method, e.g. as in the examples are provided herein. In one example, a sample of cells is provided and soluble extracellular MICA is detected using ELISA methods. In one example, an antigen-binding compound of the invention is administered to a mammal and the presence or absence, or levels of, circulating sMICA is measured. Examples of in vitro detection assays are described in Nolting et al. (2010) Virology 406(1):12-20. Briefly, a commercially available MICA Elisa kit (Bamomab, Munich, Germany) can be used. Plates are coated overnight with the capture anti-MICA mAb BAMO-1 at 2 μg/ml in PBS, then blocked by addition of 100 μl of 15% BSA for 2 h at 37° C. and washed. Standards and samples are added and the plates and incubated for 2 h at 37° C. Plates are washed and the detection mAb BAMO-3 at 5 μg/ml in 7.5% BSA-PBS was added for 2 h at 37° C. Plates were then washed and anti-mouse IgG2a-HRP (1:8000 in 7.5% BSA-PBS) is added for 1 h at 37° C. Plates are then washed and developed using the Tetramethylbenzidine Peroxidase Substrate System (KPL, Gaithersburg, Md.). The absorbance is measured at 450 nm


Assessing the antigen-binding compound's ability to induce ADCC, CDC or otherwise (e.g. by delivery of a toxic agent) lead to the elimination or inhibition of activity of MICA-expressing target cells, can be carried out at any suitable stage of the method, e.g. as in the examples are provided herein. This assessment can be useful at one or more of the various steps involved in the identification, production and/or development of an antibody (or other compound) destined for therapeutic use. For example, activity may be assessed in the context of a screening method to identify candidate antigen-binding compounds, or in methods where an antigen-binding compound is selected and made human suitable (e.g. made chimeric or humanized in the case of an antibody), where a cell expressing the antigen-binding compound (e.g. a host cell expressing a recombinant antigen-binding compound) has been obtained and is assessed for its ability to produce functional antibodies (or other compounds), and/or where a quantity of antigen-binding compound has been produced and is to be assessed for activity (e.g. to test batches or lots of product). Generally the antigen-binding compound will be known to specifically bind to a MICA polypeptide. The step may involve testing a plurality (e.g., a very large number using high throughput screening methods or a smaller number) of antigen-binding compounds.


Testing CDC and ADCC can be carried out can be determined by various assays including those described in the experimental examples herein. Testing ADCC typically involves assessing cell-mediated cytotoxicity in which a MICA-expressing target cell (e.g. a cancer or other MICA-expressing cell) with bound anti-MICA antibody is recognized by an effector cell (e.g. a leukocyte bearing Fc receptors), without the involvement of complement. A cell which does not express a MICA antigen can optionally be used as a control. Activation of NK cell cytotoxicity is assessed by measuring an increase in cytokine production (e.g. IFN-γ production) or cytotoxicity markers (e.g. CD107 mobilization). Preferably the antibody of the invention will induce an increase in cytokine production, expression of cytoxicity markers, or target cell lysis of at least 20%, 50%, 80%, 100%, 200% or 500% in the presence of target (MICA-expressing) cells, compared to a control antibody (e.g. an antibody not binding to MICA, a MICA antibody having murine constant regions). In another example, lysis of target cells is detected, e.g. in a chromium release assay, preferably the antibody of the invention will induce lysis of at least 10%, 20%, 30%, 40% or 50% of target cells.


Antibody CDR Sequences
Antibody 9C10

The amino acid sequence of the heavy chain variable region of antibody 9C10 is listed as SEQ ID NO: 7, the amino acid sequence of the light chain variable region is listed as SEQ ID NO: 8. The amino acid sequences of heavy and light chain variable region of antibody 9C10 fused to a human chain constant region (heavy and light, respectively) are listed as SEQ ID NOS: 9 and 10, respectively. In a specific embodiment, the invention provides an antibody that binds essentially the same epitope or determinant as monoclonal antibodies 9C10; optionally the antibody comprises an antigen binding region of antibody 9C10. In any of the embodiments herein, antibody 9C10 can be characterized by its amino acid sequence and/or nucleic acid sequence encoding it. In one preferred embodiment, the monoclonal antibody comprises the Fab or F(ab′)2 portion of 9C10. Also provided is a monoclonal antibody that comprises the heavy chain variable region of 9C10. According to one embodiment, the monoclonal antibody comprises the three CDRs of the heavy chain variable region of 9C10 Also provided is a monoclonal antibody that further comprises the variable light chain variable region of 9C10 or one, two or three of the CDRs of the light chain variable region of 9C10. Optionally any one or more of said light or heavy chain CDRs may contain one, two, three, four or five or more amino acid modifications (e.g. substitutions, insertions or deletions). Optionally, provided is an antibody where any of the light and/or heavy chain variable regions comprising part or all of an antigen binding region of antibody 9C10 are fused to an immunoglobulin constant region of the human IgG type, optionally a human constant region, optionally a human IgG1 or IgG3 isotype. Optionally, the antibody comprises a heavy chain sequence comprising SEQ ID NOS: 7 and a light chain sequence comprising SEQ ID NO: 8, or a heavy chain sequence comprising SEQ ID NOS: 9 and a light chain sequence comprising SEQ ID NO: 10, or a variant of any of the foregoing sequences which is at least 60%, 70%, 80%, 85%, 90% or 95% identical thereto.


In another aspect, the invention provides a purified polypeptide which encodes an antibody, wherein the antibody comprises: a HCDR1 region comprising an amino acid sequence RYWMN, GYSFTR or GYSFTRYWMN as set forth in SEQ ID NOS: 11-13, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR2 region comprising an amino acid sequence MIHPSDSETRLNQKFKD or MIHPSDSETR as set forth in SEQ ID NOS: 14-15, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR3 region comprising an amino acid sequence GNFFYVMDY as set forth in SEQ ID NO: 16, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR1 region comprising an amino acid sequence RASQSIGTSIH as set forth in SEQ ID NO: 17, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR2 region comprising an amino acid sequence ASESISG as set forth in SEQ ID NO: 18, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR3 region comprising an amino acid sequence QQSNFWPFT as set forth in SEQ ID NO: 19, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be deleted or substituted by a different amino acid.


In another aspect, the invention provides an antibody that binds human MICA, comprising:


(a) the heavy chain variable region of SEQ ID NO: 7, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(b) the light chain variable region of SEQ ID NO: 8, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(c) the heavy chain variable region of SEQ ID NO: 7, wherein one or more of these amino acids may be substituted by a different amino acid; and the light chain variable region of SEQ ID NO: 8, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(d) the heavy chain CDR 1, 2 and 3 (HCDR1, HCDR2) amino acid sequences as shown in SEQ ID NO: 11 to 16, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(e) the light chain CDR 1, 2. and 3 (LCDR1, LCDR2, LCDR3) amino acid sequences as shown in SEQ ID NOS: 17, 18 and 19, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(f) the heavy chain CDR 1, 2 and 3 (HCDR1, HCDR2, HCDR3) amino acid sequences as shown in SEQ ID NOS: 11 to 16, wherein one or more of these amino acids may be substituted by a different amino acid; and the light chain CDRs 1, 2 and 3 (LCDR1, LCDR2, LCDR3) amino acid sequences as shown in SEQ ID NOS: 17, 18 and 19, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(g) the heavy chain variable region which is at least 60%, 70%, 80%, 85%, 90% or 95% identical to the variable region having an amino acid sequence of SEQ ID NO: 7, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(h) the light chain variable region which is at least 60%, 70%, 80%, 85%, 90% or 95% identical to the variable region having an amino acid sequence of SEQ ID NO: 8, wherein one, two, three or more of these amino acids may be substituted by a different amino acid.


In another aspect of any of the embodiments herein, any of the CDRs 1, 2 and 3 of the heavy and light chains may be characterized by a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, and/or as having an amino acid sequence that shares at least 50%, 60%, 70%, 80%, 85%, 90% or 95% sequence identity with the particular CDR or set of CDRs listed in the corresponding SEQ ID NO.


In another aspect, the invention provides an antibody that competes for MICA binding with a monoclonal antibody of (a) to (h), above.


Antibody 20C6

The amino acid sequence of the heavy chain variable region of antibody 20C6 is listed in SEQ ID NO: 20, the amino acid sequence of the light chain variable region is listed as SEQ ID NO: 21. The amino acid sequences of the heavy and light chain variable regions of antibody 20C6 fused to a heavy chain constant region (heavy and light, respectively, are listed as SEQ ID NOS: 22 and 23, respectively. In one embodiment, the invention provides an antibody that binds essentially the same epitope or determinant as monoclonal antibodies 20C6; optionally the antibody comprises an antigen binding region of antibody 20C6. In any of the embodiments herein, antibody 16A8 can be characterized by its amino acid sequence and/or nucleic acid sequence encoding it. In one preferred embodiment, the monoclonal antibody comprises the Fab or F(ab′)2 portion of 20C6. Also provided is a monoclonal antibody that comprises the heavy chain variable region of 20C6.


According to one embodiment, the monoclonal antibody comprises the three CDRs of the heavy chain variable region of 20C6. Also provided is a monoclonal antibody that further comprises the variable light chain variable region of 20C6 or one, two or three of the CDRs of the light chain variable region of 20C6. Optionally any one or more of said light or heavy chain CDRs may contain one, two, three, four or five amino acid modifications (e.g. substitutions, insertions or deletions). Optionally, provided is an antibody where any of the light and/or heavy chain variable regions comprising part or all of an antigen binding region of antibody 16A8 are fused to an immunoglobulin constant region of the IgG type, optionally a human constant region, optionally an IgG1 or IgG3 isotype. Optionally, the antibody comprises a heavy chain sequence comprising SEQ ID NOS: 20 and a light chain sequence comprising SEQ ID NO: 21, or a heavy chain sequence comprising SEQ ID NOS: 22 and a light chain sequence comprising SEQ ID NO: 23, or a variant of any of the foregoing sequences which is at least 60%, 70%, 80%, 85%, 90% or 95% identical thereto.


In another aspect, the invention provides a purified polypeptide which encodes an antibody, wherein the antibody comprises: a HCDR1 region comprising an amino acid sequence TSGMGVG, GFSLSTSG or GFSLSTSGMGVG as set forth in SEQ ID NOS: 24-26, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR2 region comprising an amino acid sequence HIWWDDDKYYNPSLK or HIWWDDDK as set forth in SEQ ID NOS: 27-28, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR3 region comprising an amino acid sequence RTQGYFDY as set forth in SEQ ID NO: 29, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR1 region comprising an amino acid sequence RASQSISDYLH as set forth in SEQ ID NO: 30, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR2 region comprising an amino acid sequence YASQSIS as set forth in SEQ ID NO: 31, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; and/or a LCDR3 region comprising an amino acid sequence QNGHSFPVVT as set forth in SEQ ID NO: 32, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these′ amino acids may be deleted or substituted by a different amino acid, or where the sequence may comprise an insertion of one or more amino acids.


In another aspect, the invention provides an antibody that binds human MICA, comprising:


(a) the heavy chain variable region of SEQ ID NO: 20, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(b) the light chain variable region of SEQ ID NO: 21, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(c) the heavy chain variable region of SEQ ID NO: 20, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and the light chain variable region of SEQ ID NO: 21, wherein one or more of these amino acids may be substituted by a different amino acid; and/or


(d) the heavy chain CDR 1, 2 and 3 (HCDR1, HCDR2, HCDR3) amino acid sequences as shown in SEQ ID NO: 24-29, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(e) the light chain CDR 1, 2 and 3 (LCDR1, LCDR2, LCDR3) amino acid sequences as shown in SEQ ID NO: 30, 31 and 32, respectively, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(f) the heavy chain CDR 1, 2 and 3 (HCDR1, HCDR2, HCDR3) amino acid sequences as shown in SEQ ID NO: 24 to 29, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and the light chain CDR 1, 2 and 3 (LCDR1, LCDR2, LCDR3) amino acid sequences as shown in SEQ ID NO: 30, 31 and 32, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(g) the heavy chain variable region which is at least 60%, 70%, 80%, 85%, 90% or 95% identical to the variable region having an amino acid sequence of SEQ ID NO: 20, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(h) the light chain variable region which is at least 60%, 70%, 80%, 85%, 90% or 95% identical to the variable region having an amino acid sequence of SEQ ID NO: 21, wherein one, two, three or more of these amino acids may be substituted by a different amino acid.


In another aspect of any of the embodiments herein, any of the CDRs 1, 2 and 3 of the heavy and light chains may be characterized by a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, and/or as having an amino acid sequence that shares at least 50%, 60%, 70%, 80%, 85%, 90% or 95% sequence identity with the particular CDR or set of CDRs listed in the corresponding SEQ ID NO.


In another aspect, the invention provides an antibody that competes for MICA binding with a monoclonal antibody of (a) to (h), above.


Antibody 16A8

The amino acid sequence of the heavy chain variable region of antibody 16A8 is listed in SEQ ID NO: 33, the amino acid sequence of the light chain variable region is listed as SEQ ID NO: 34. The amino acid sequences of the heavy and light chain variable regions of antibody 16A8 fused to a heavy chain constant region (heavy and light, respectively, are listed as SEQ ID NOS: 35 and 36, respectively. In one embodiment, the invention provides an antibody that binds essentially the same epitope or determinant as monoclonal antibodies 16A8; optionally the antibody comprises an antigen binding region of antibody 16A8. In any of the embodiments herein, antibody 16A8 can be characterized by its amino acid sequence and/or nucleic acid sequence encoding it. In one preferred embodiment, the monoclonal antibody comprises the Fab or F(ab′)2 portion of 16A8. Also provided is a monoclonal antibody that comprises the heavy chain variable region of 16A8. According to one embodiment, the monoclonal antibody comprises the three CDRs of the heavy chain variable region of 16A8. Also provided is a monoclonal antibody that further comprises the variable light chain variable region of 16A8 or one, two or three of the CDRs of the light chain variable region of 16A8. Optionally any one or more of said light or heavy chain CDRs may contain one, two, three, four or five amino acid modifications (e.g. substitutions, insertions or deletions). Optionally, provided is an antibody where any of the light and/or heavy chain variable regions comprising part or all of an antigen binding region of antibody 16A8 are fused to an immunoglobulin constant region of the IgG type, optionally a human constant region, optionally an IgG1 or IgG3 isotype. Optionally, the antibody comprises a heavy chain sequence comprising SEQ ID NOS: 33 and a light chain sequence comprising SEQ ID NO: 34, or a heavy chain sequence comprising SEQ ID NOS: 35 and a light chain sequence comprising SEQ ID NO: 36, or a variant of any of the foregoing sequences which is at least 60%, 70%, 80%, 85%, 90% or 95% identical thereto.


In another aspect, the invention provides a purified polypeptide which encodes an antibody, wherein the antibody comprises: a HCDR1 region comprising an amino acid sequence RYAMS, GFTFSR or GFTFSRYAMS as set forth in SEQ ID NOS: 37-39, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR2 region comprising an amino acid sequence TIFSGGSYTYYPDSV or TIFSGGSY as set forth in SEQ ID NOS: 40-41, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a HCDR3 region comprising an amino acid sequence PNWERTFDY as set forth in SEQ ID NO: 42, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR1 region comprising an amino acid sequence KSSQSLLNSSNQKNYL as set forth in SEQ ID NO: 43, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; a LCDR2 region comprising an amino acid sequence FASTRES as set forth in SEQ ID NO: 44, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be substituted by a different amino acid; and/or a LCDR3 region comprising an amino acid sequence QQHYSTPPT as set forth in SEQ ID NO: 45, or a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, wherein one or more of these amino acids may be deleted or substituted by a different amino acid, or where the sequence may comprise an insertion of one or more amino acids.


In another aspect, the invention provides an antibody that binds human MICA, comprising:


(a) the heavy chain variable region of SEQ ID NO: 33, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(b) the light chain variable region of SEQ ID NO: 34, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(c) the heavy chain variable region of SEQ ID NO: 33, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and the light chain variable region of SEQ ID NO: 34, wherein one or more of these amino acids may be substituted by a different amino acid; and/or


(d) the heavy chain CDR 1, 2 and 3 (HCDR1, HCDR2, HCDR3) amino acid sequences as shown in SEQ ID NOS: 37-42, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(e) the light chain CDR 1, 2 and 3 (LCDR1, LCDR2, LCDR3) amino acid sequences as shown in SEQ ID NOS: 43, 44 and 45, respectively, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(f) the heavy chain CDR 1, 2 and a (HCDR1, HCDR2, HCDR3) amino acid sequences as shown in SEQ ID NOS: 37-42, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and the light chain CDR 1, 2 and 3 (LCDR1, LCDR2, LCDR3) amino acid sequences as shown in SEQ ID NOS: 43, 44 and 45, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(g) the heavy chain variable region which is at least 60%, 70%, 80%, 85%, 90% or 95% identical to the variable region having an amino acid sequence of SEQ ID NO: 33, wherein one, two, three or more of these amino acids may be substituted by a different amino acid; and/or


(h) the light chain variable region which is at least 60%, 70%, 80%, 85%, 90% or 95% identical to the variable region having an amino acid sequence of SEQ ID NO: 34, wherein one, two, three or more of these amino acids may be substituted by a different amino acid.


In another aspect of any of the embodiments herein, any of the CDRs 1, 2 and 3 of the heavy and light chains may be characterized by a sequence of at least 4, 5, 6, 7, 8, 9 or 10 contiguous amino acids thereof, and/or as having an amino acid sequence that shares at least 50%, 60%, 70%, 80%, 85%, 90% or 95% sequence identity with the particular CDR or set of CDRs listed in the corresponding SEQ ID NO.


In another aspect, the invention provides an antibody that competes for MICA binding with a monoclonal antibody of (a) to (h), above.


In any of the antibodies of the invention, e.g., 9C10, 20C6 or 16A8, the specified variable region and CDR sequences may comprise conservative sequence modifications. A conservative sequence modification refers to an amino acid modification that does not significantly affect or alter the binding characteristics of the antibody containing the amino acid sequence. Such conservative modifications include amino acid substitutions, additions and deletions. Modifications can be introduced into an antibody of the invention by standard techniques known in the art, such as site-directed mutagenesis and PCR-mediated mutagenesis. Conservative amino acid substitutions are typically those in which an amino acid residue is replaced with an amino acid residue having a side chain with similar physicochemical properties. Specified variable region and CDR sequences may comprise one, two, three, four or more amino acid insertions, deletions or substitutions. Where substitutions are made, preferred substitutions will be conservative modifications. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g. glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine, tryptophan), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine), beta-branched side chains (e.g. threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, one or more amino acid residues within the CDR regions of an antibody of the invention can be replaced with other amino acid residues from the same side chain family and the altered antibody can be tested for retained function (i.e., the properties set forth herein) using the assays described herein.


The term “identity” or “identical”, when used in a relationship between the sequences of two or more polypeptides, refers to the degree of sequence relatedness between polypeptides, as determined by the number of matches between strings of two or more amino acid residues. “Identity” measures the percent of identical matches between the smaller of two or more sequences with gap alignments (if any) addressed by a particular mathematical model or computer program (i.e., “algorithms”). Identity of related polypeptides can be readily calculated by known methods. Such methods include, but are not limited to, those described in Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press, New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje; G., Academic Press, 1987; Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M. Stockton Press, New York, 1991; and Carillo et al., SIAM J. Applied Math. 48, 1073 (1988).


Preferred methods for determining identity are designed to give the largest match between the sequences tested. Methods of determining identity are described in publicly available computer programs. Preferred computer program methods for determining identity between two sequences include the GCG program package, including GAP (Devereux et al., Nucl. Acid. Res. 12, 387 (1984); Genetics Computer Group, University of Wisconsin, Madison, Wis.), BLASTP, BLASTN, and FASTA (Altschul et al., J. Mol. Biol. 215, 403-410 (1990)). The BLASTX program is publicly available from the National Center for Biotechnology Information (NCBI) and other sources (BLAST Manual, Altschul et al. NCB/NLM/NIH Bethesda, Md. 20894; Altschul et al., supra). The well known Smith Waterman algorithm may also be used to determine identity.


The sequences of the CDRs, according to AbM (Oxford Molecular's AbM antibody modelling software definition), Kabat and Chothia definitions systems, have been summarized in Table A below. While any suitable numbering system may be used to designated CDR regions, in the absence of any other indication, the numbering used herein is Abm. Such numbering has been established using the following indications: CDR-L1: Start: approx residue 24, residue before: always a Cys, residue after: always a Trp (typically Trp-Tyr-Gln, but also, Trp-Leu-Gln, Trp-Phe-Gln, Trp-Tyr-Leu), length: 10 to 17 residues; CDR-L2: Start: always 16 residues after the end of L1, Residues before: generally Ile-Tyr (but also, Val-Tyr, Ile-Lys, Ile-Phe), Length: always 7 residues; CDR-L3, Start: always 33 residues after end of L2, Residue before: always Cys, Residues after: always Phe-Gly-Xaa-Gly, Length: 7 to 11 residues; CDR-H1, Start: approx residue 26 (always 4 after a Cys) (Chothia/AbM definition, the Kabat definition starts 5 residues later), Residues before: always Cys-Xaa-Xaa-Xaa, Residues after: always a Trp (typically Trp-Val, but also, Trp-Ile, Trp-Ala), Length: 10 to 12 residues (AbM definition, Chothia definition excludes the last 4 residues); CDR-H2, Start: always 15 residues after the end of Kabat/AbM definition of CDR-H1, Residues before: typically Leu-Glu-Trp-Ile-Gly (but a number of variations, Residues after Lys/Arg-Leu/Ile/Val/Phe/Thr/Ala-Thr/Ser/Ile/Ala), Length: Kabat definition 16 to 19 residues; AbM (and Chothia) definition ends 7 residues earlier; CDR-H3, Start: always 33 residues after end of CDR-H2 (always 2 after a Cys), Residues before: always Cys-Xaa-Xaa (typically Cys-Ala-Arg), Residues after: always Trp-Gly-Xaa-Gly, Length: 3 to 25 residues.


The sequences of the variable chains of the antibodies according to the invention are listed in Table B below, with the leader sequence underlined at the beginning of each sequence (any antibody chain can be specified to start at the amino acid position immediately following the end of the leader sequence), and each CDRs underlined. In any embodiment herein, a VL or VH sequence can be specified or numbered so as to contain or lack a signal peptide or any part thereof.


In one embodiment, the antibodies of the invention are of the human IgG1 or IgG3 isotype. In one embodiment, the antibodies of the invention are antibody fragments that retain their binding and/or functional properties.













TABLE A









HCDR1
HCDR2
HCDR3















CDR
SEQ

SEQ

SEQ



mAb
definition
ID
Sequence
ID
Sequence
ID
Sequence





9C10
Kabat
11
RYWMN
14
MIHPSDSETRLNQKFKD
16
GNFFYVMDY



Chotia
12
GYSFTR
15
MIHPSDSETR

GNFFYVMDY



Abm
13
GYSFTRYWMN

MIHPSDSETR

GNFFYVMDY


20C6
Kabat
24
TSGMGVG
27
HIWWDDDKYYNPSLK
29
RTQGYFDY



Chotia
25
GFSLSTSG
28
HIWWDDDK

RTQGYFDY



Abm
26
GFSLSTSGMGVG

HIWWDDDK

RTQGYFDY


16A8
Kabat
37
RYAMS
40
TIFSGGSYTYYPDSV
42
PNWERTFDY



Chotia
38
GFTFSR
41
TIFSGGSY

PNWERTFDY



Abm
39
GFTFSRYAMS

TIFSGGSY

PNWERTFDY
















LCDR1
LCDR2
LCDR3















CDR
SEQ

SEQ

SEQ



mAb
definition
ID
Sequence
ID
Sequence
ID
Sequence





9C10
Kabat
17
RASQSIGTSIH
18
ASESISG
19
QQSNFWPFT



Chotia

RASQSIGTSIH

ASESISG

QQSNFWPFT



Abm

RASQSIGTSIH

ASESISG

QQSNFWPFT


20C6
Kabat
30
RASQSISDYLH
31
YASQSIS
32
QNGHSFPWT



Chotia

RASQSISDYLH

YASQSIS

QNGHSFPWT



Abm

RASQSISDYLH

YASQSIS

QNGHSFPWT


16A8
Kabat
43
KSSQSLLNSSNQ
44
FASTRES
45
QQHYSTPPT





KNYL







Chotia

KSSQSLLNSSNQ

FASTRES

QQHYSTPPT





KNYL







Abm

KSSQSLLNSSNQ

FASTRES

QQHYSTPPT





KNYL


















TABLE B






SEQ



Antibody
ID



portion
NO
Sequence

















9C10
7

M G W S S I I L F L V A T S T G V H S Q V Q L Q Q P G A E L V R P G T S



VH

V N L S C K A S G Y S F T R Y W M N W V K Q R P G Q G L E V V I G M I H





P S D S E T R L N Q K F K D K A T L T V D K S S S T A Y M Q L S S P T S





E D S A V Y Y C G Y G N F F Y V M D Y W G Q G T S V T V S S





9C10VL
8

M V S T P Q F L V F L L F W I P A S R G D I L L T Q S P A I L S V S P G E





R V S F S C R A S Q S I G T S I H W Y Q Q R T N G S P R L L I K F A S E





S I S G I P S R F S G S G S G T D F T L N I N S V E S E D I A D Y Y C Q Q






S N F W P F T F G S G T K L E V K






20C6
20

M D R L T S S F L L L I V P A Y V L S Q I T L K E S G P G I L K P S Q T L



VH

S L T C S F S G F S L S T S G M G V G W I R Q P S G K G L E W L A H I





W W D D D K Y Y N P S L K S Q L T I S K D T S R N Q V F L R I T S V D T





A D T A T Y Y C A R R T Q G Y F D Y W G Q G T T L T V S S





20C6 VL
21

M V S T S Q L L G L L L F W T S A S R C D I V M T Q S P A T L S V T P G





D R V S L S C R A S Q S I S D Y L H W Y Q Q K S H E S P R L L I K Y A S





Q S I S G I P S R F S G S G S G S D F T L S I N S V E P E D V G V Y Y C






Q N G H S F P W T F G G G T K L E I K






16A8
33

M N F V L S L I F L A L I L K G V R C E V Q L V E S G G G L V K P G G S L



VH

K L S C A A S G F T F S R Y A M S W V R Q T P E K R L E W V A T I F S





G G S Y T Y Y P D S V K G R F T I S R D N A N N T L Y L Q M S S L K A E





D T A M Y F C A R P N W E R T F D Y W G Q G T T L T V S S





16A8VL
34

M E S Q T Q V L M F L L L W V S G A C T D I V M T Q S P S S L A M S V





G Q K V I M S C K S S Q S L L N S S N Q K N Y L A W Y Q Q K P G Q S P




K L L V Y F A S T R E S G V P D R F M G S G S G T D F T L T I S S V Q A




E D L A D Y F C Q Q H Y S T P P T F G G G T K L E I K









Fragments and Derivatives

Fragments and derivatives of antibodies of this invention (which are encompassed by the term “antibody” or “antibodies” as used in this application, unless otherwise stated or clearly contradicted by context), preferably a 9C10, 20C6 or 16A8-like antibody, can be produced by techniques that are known in the art. “Fragments” comprise a portion of the intact antibody, generally the antigen binding site or variable region. Examples of antibody fragments include Fab, Fab′, Fab′-SH, F (ab′) 2, and Fv fragments; diabodies; any antibody fragment that is a polypeptide having a primary structure consisting of one uninterrupted sequence of contiguous amino acid residues (referred to herein as a “single-chain antibody fragment” or “single chain polypeptide”), including without limitation (1) single-chain Fv molecules (2) single chain polypeptides containing only one light chain variable domain, or a fragment thereof that contains the three CDRs of the light chain variable domain, without an associated heavy chain moiety and (3) single chain polypeptides containing only one heavy chain variable region, or a fragment thereof containing the three CDRs of the heavy chain variable region, without an associated light chain moiety; and multispecific antibodies formed from antibody fragments. Included, inter alia, are a nanobody, domain antibody, single domain antibody or a “dAb”.


Fragments of the present antibodies can be obtained using standard methods. For instance, Fab or F (ab′) 2 fragments may be produced by protease digestion of the isolated antibodies, according to conventional techniques. It will be appreciated that immunoreactive fragments can be modified using known methods, for example to slow clearance in vivo and obtain a more desirable pharmacokinetic profile the fragment may be modified with polyethylene glycol (PEG).


Alternatively, the DNA of a hybridoma producing an antibody of the invention, preferably a 9C10, 20C6 or 16A8-like antibody, may be modified so as to encode a fragment of the invention. The modified DNA is then inserted into an expression vector and used to transform or transfect an appropriate cell, which then expresses the desired fragment.


In certain embodiments, the DNA of a hybridoma producing an antibody of this invention, preferably a 9C10, 20C6 or 16A8-like antibody, can be modified prior to insertion into an expression vector, for example, by substituting the coding sequence for human heavy- and light-chain constant domains in place of the homologous non-human sequences, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. In that manner, “chimeric” or “hybrid” antibodies are prepared that have the binding specificity of the original antibody. Typically, such non-immunoglobulin polypeptides are substituted for the constant domains of an antibody of the invention.


Thus, according to another embodiment, the antibody of this invention, preferably a 9C10, 20C6 or 16A8-like antibody, is humanized. “Humanized” forms of antibodies according to this invention are specific chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab′, F (ab′) 2, or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from the murine immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient are replaced by residues from a CDR of the original antibody (donor antibody) while maintaining the desired specificity, affinity, and capacity of the original antibody.


In some instances, Fv framework residues of the human immunoglobulin may be replaced by corresponding non-human residues. Furthermore, humanized antibodies can comprise residues that are not found in either the recipient antibody or in the imported CDR or framework sequences. These modifications are made to further refine and optimize antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of the original antibody and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details see Jones et al., Nature, 321, pp. 522 (1986); Reichmann et al, Nature, 332, pp. 323 (1988); Presta, Curr. Op. Struct. Biol., 2, pp. 593 (1992); Verhoeyen et Science, 239, 0.15 pp. 1534; and U.S. Pat. No. 4,816,567, the entire disclosures of which are herein incorporated by reference.)


The choice of human variable domains, both light and heavy, to be used in making the humanized antibodies is very important to reduce antigenicity. According to the so-called “best-fit” method, the sequence of the variable domain of an antibody of this invention is screened against the entire library of known human variable-domain sequences. The human sequence which is closest to that of the mouse is then accepted as the human framework (FR) for the humanized antibody (Sims et al., J. Immunol. 151, pp. 2296 (1993); Chothia and Lesk, J. Mol. 196, 1987, pp. 901). Another method uses a particular framework from the consensus sequence of all human antibodies of a particular subgroup of light or heavy chains. The same framework can be used for several different humanized antibodies (Carter et al., PNAS 89, pp. 4285 (1992); Presta et al., J. Immunol., 151, p. 2623 (1993)).


It is further important that antibodies be humanized with retention of high affinity for MICA receptors and other favorable biological properties. To achieve this goal, according to a preferred method, humanized antibodies are prepared by a process of analysis of the parental sequences and various conceptual humanized products using three-dimensional models of the parental and humanized sequences. Three-dimensional immunoglobulin models are commonly available and are familiar to those skilled in the art. Computer programs are available which illustrate and display probable three-dimensional structures of selected candidate immunoglobulin sequences. Inspection of these displays permits analysis of the likely role of the residues in the functioning of the candidate immunoglobulin sequence, i.e., the analysis of residues that influence the ability of the candidate immunoglobulin to bind its antigen. In this way, FR residues can be selected and combined from the consensus and import sequences so that the desired antibody characteristic, such as increased affinity for the target antigen (s), is achieved. In general, the CDR residues are directly and most substantially involved in influencing antigen binding.


Another method of making “humanized” monoclonal antibodies is to use a XenoMouse (Abgenix, Fremont, Calif.) as the mouse used for immunization. A XenoMouse is a murine host according to this invention that has had its immunoglobulin genes replaced by functional human immunoglobulin genes. Thus, antibodies produced by this mouse or in hybridomas made from the B cells of this mouse, are already humanized. The XenoMouse is described in U.S. Pat. No. 6,162,963, which is herein incorporated in its entirety by reference.


Human antibodies may also be produced according to various other techniques, such as by using, for immunization, other transgenic animals that have been engineered to express a human antibody repertoire (Jakobovitz et al., Nature 362 (1993) 255), or by selection of antibody repertoires using phage display methods. Such techniques are known to the skilled person and can be implemented starting from monoclonal antibodies as disclosed in the present application.


The antibodies of the present invention, preferably a 9C10, 20C6 or 16A8-like antibody, may also be derivatized to “chimeric” antibodies (immunoglobulins) in which a portion of the heavy/light chain(s) is identical with or homologous to corresponding sequences in the original antibody, while the remainder of the chain (s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity and binding specificity (Cabilly et al., supra; Morrison et al., Proc. Natl. Acad. Sci. U.S.A., pp. 6851 (1984)).


The invention provides anti-MICA antibody molecules which are directed to and, in embodiments, are internalized into cells. They are capable of delivering therapeutic agents or detectable agents to or into cells expressing MICA, but not to or into cells where MICA polypeptides are not expressed. Thus, the invention also provides anti-MICA immunoconjugates comprising an anti-MICA antibody as described herein, which is conjugated to a therapeutic agent or a detectable agent (or any other moiety that serves as a payload of interest to be delivered to a MICA-expressing cell. In embodiments, the affinity for MICA of an anti-MICA immunoconjugate is at least 10, 25, 50, 75, 80, 90, or 95% of that for the unconjugated antibody. This can be determined using cell surface MICA or isolated MICA.


Useful detectable agents with which an antibody or an antibody portion of the invention may be derivatized (or labeled) include fluorescent compounds, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, fluorescent emitting metal atoms, e.g., europium (Eu), and other anthanides, and radioactive materials (described above). Exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, 5-dimethylamine-I-napthalenesulfonyl chloride, phycoerythrin and the like. An antibody may also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, β-galactosidase, acetylcholinesterase, glucose oxidase and the like. When an antibody is derivatized with a detectable enzyme, it is detected by adding additional reagents that the enzyme uses to produce a detectable reaction product. For example, when the detectable agent horseradish peroxidase is present, the addition of hydrogen peroxide and diaminobenzidine leads to a colored reaction product, which is detectable. An antibody may also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin). For example, an antibody may be derivatized with biotin, and detected through indirect measurement of avidin or streptavidin binding. Examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; and examples of bioluminescent materials include luciferase, luciferin, and aequorin. Alternatively, the anti-MICA antibody may be associated with a second antibody that binds to the anti-MICA antibody, wherein the second antibody is derivatized with a detectable label; binding said second antibody into contact with the anti-MICA antibody, in vitro or in vivo, will allow the anti-MICA to serve as a labeled antibody.


Conjugation to a detectable moiety is useful, inter alia, when an antibody of the invention is used for diagnostic purposes. Such purposes include, but are not limited to, assaying biological samples, e.g., a blood sample or tissue biopsy, for the presence of MICA-expressing cells, and detecting the presence, level, or activity of MICA-expressing cells in an individual. Such assay and detection methods can be used in the diagnostic/therapeutic methods of the invention, e.g., involving detecting MICA expression in cells of a patient and if the patient's cells are determined to express MICA, subsequently administering a MICA modulating antibody of the invention.


In certain embodiments, the present antibodies are used to purify MICA-expressing cells from a biological sample. Biological samples can be obtained from a patient, e.g. for diagnostic or ex vivo therapeutic purposes, or from individuals or non-human primates to obtain a source of such cells for research purposes.


In one such embodiment, labeled antibodies of the invention can be used in FACS sorting to purify or isolate MICA-expressing cells from a biological sample. Alternatively, in some embodiments conjugation of an antibody of this invention to a solid support can be useful as a tool for affinity purification of cells bearing a MICA receptor on their cell surface from a biological sample, such as a blood sample or cells from a tissue biopsy from an individual. This method of purification is another alternate embodiment of the present invention, as is the resulting purified population of cells.


Regardless of the method used to isolate or purify the MICA-expressing cells, the ability to do so is useful for numerous purposes, e.g. to diagnose a MICA-associated disorder by assessing the number or activity of MICA-expressing cells, e.g., prior to administration of anti-MICA antibodies as described herein. Further, purified MICA-expressing cells are useful in a research context, e.g., to better characterize the cells and their various properties and behaviors, as well as to identify compounds or methods that can be used to modulate their behavior, activity, survival, or proliferation.


Modified Constant Regions

In view of the ability of the anti-MICA antibodies of the invention to induce ADCC and CDC, the antibodies of the invention can also be made with modifications that increase their ability to bind Fc receptors which can affect effector functions such as antibody-dependent cytotoxicity, mast cell degranulation, and phagocytosis, as well as immunomodulatory signals such as regulation of lymphocyte proliferation and antibody secretion. Typical modifications include modified human IgG1 constant regions comprising at least one amino acid modification (e.g. substitution, deletions, insertions), and/or altered types of glycosylation, e.g., hypofucosylation. Such modifications can affect interaction with Fc receptors: FcγRI (CD64), FcγRII (CD32), and FcγRIII (CD 16). FcγRI (CD64), FcγRIIA (CD32A) and FcγRIII (CD 16) are activating (i.e. , immune system enhancing) receptors while FcγRIIB (CD32B) is an inhibiting (i.e., immune system dampening) receptor. A modification may, for example, increase binding of the Fc domain to FcγRIIIa on effector (e.g. NK) cells.


Anti-MICA antibodies preferably comprise an Fc domain (or portion thereof) of human IgG1 or IgG3 isotype, optionally modified. The amino acid sequence of positions 230 to 447 sequence of a human IgG1 Fc region (GenBank accession #: J00228) is shown as follows:









(SEQ ID NO: 46)


PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYV





DGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALP





APIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAV





EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH





EALHNHYTQKSLSLSPGK;






Residues 230-341 (Kabat EU) are the Fc CH2 region. Residues 342-447 (Kabat EU) are the Fc CH3 region. Anti-MICA antibodies may comprise a variant Fc region having one or more amino acid modifications (e.g., substitutions, deletions, insertions) in one or more portions, which modifications increase the affinity and avidity of the variant Fc region for an FcγR (including activating and inhibitory FcγRs). In some embodiments, said one or more amino acid modifications increase the affinity of the variant Fc region for FcγRIIIA and/or FcγRIIA. In another embodiment, the variant Fc region further specifically binds FcγRIIB with a lower affinity than does the Fc region of the comparable parent antibody (i.e., an antibody having the same amino acid sequence as the antibody of the invention except for the one or more amino acid modifications in the Fc region). For example, the one or both of the histidine residues at amino acid positions 310 and 435 may be substituted, for example by lysine, alanine, glycine, valine, leucine, isoleucine, proline, methionine, tryptophan, phenylalanine, serine or threonine (see, e.g. PCT publication no. WO 2007/080277); such substituted constant regions provide decreased binding to the inhibitory FcγRIIB without decreasing binding to the activatory FcγRIIIA. In some embodiments, such modifications increase the affinity of the variant Fc region for FcγRIIIA and/or FcγRIIA and also enhance the affinity of the variant Fc region for FcyγRIIB relative to the parent antibody. In other embodiments, said one or more amino acid modifications increase the affinity of the variant Fc region for FcγRIIIA and/or FcγRIIA but do not alter the affinity of the variant Fc regions for FcγRIIB relative to the Fc region of the parent antibody. In another embodiment, said one or more amino acid modifications enhance the affinity of the variant Fc region for FcγRIIIA and FcγRIIA but reduce the affinity for FcγRIIB relative to the parent antibody. Increased affinity and/or avidity results in detectable binding to the FcγR or FcγR-related activity in cells that express low levels of the FcγR when binding activity of the parent molecule (without the modified Fc region) cannot be detected in the cells.


In one embodiment, said one or more modifications to the amino acids of the Fc region reduce the affinity and avidity of the antibody for one or more FcγR receptors. In a specific embodiment, the invention encompasses antibodies comprising a variant Fc region, wherein said variant Fc region comprises at least one amino acid modification relative to a wild type Fc region, which variant Fc region only binds one FcγR, wherein said FcγR is FcγRIIIA or FcγRIIA.


The affinities and binding properties of the molecules, e.g., antibodies, of the invention for an FcγR can be determined using in vitro assays (biochemical or immunological based assays) known in the art for determining antibody-antigen or Fc-FcγR interactions, i.e., specific binding of an antigen to an antibody or specific binding of an Fc region to an FcγR, respectively, including but not limited to ELISA assay, surface plasmon resonance assay, immunoprecipitation assays.


In some embodiments, the molecules of the invention comprising a variant Fc region comprise at least one amino acid modification (for example, possessing 1, 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications) in the CH3 domain of the Fc region. In other embodiments, the molecules of the invention comprising a variant Fc region comprise at least one amino acid modification (for example, possessing 1, 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications) in the CH2 domain of the Fc region, which is defined as extending from amino acids 231-341. In some embodiments, the molecules of the invention comprise at least two amino acid modifications (for example, possessing 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications), wherein at least one such modification is in the CH3 region and at least one such modification is in the CH2 region. The invention further encompasses amino acid modification in the hinge region. In a particular embodiment, the invention encompasses amino acid modification in the CH1 domain of the Fc region, which is defined as extending from amino acids 216-230.


Any combination of Fc modifications can be made, for example any combination of different modifications disclosed in U.S. Pat. Nos. 7,632,497; 7,521,542; 7,425,619; 7,416,727; 7,371,826; 7,355,008; 7,335,742; 7,332,581; 7,183,387; 7,122,637; 6,821,505 and 6,737,056; in PCT Publications Nos. WO2011/109400; WO 2008/105886; WO 2008/002933; WO 2007/021841; WO 2007/106707; WO 06/088494; WO 05/1 15452; WO 05/110474; WO 04/1032269; WO 00/42072; WO 06/088494; WO 07/024249; WO 05/047327; WO 04/099249 and WO 04/063351; and in Presta, L. G. et al. (2002) Biochem. Soc. Trans. 30(4):487-490; Shields, R. L. et al. (2002) J. Biol. Chem. 26; 277(30):26733-26740 and Shields, R. L. et al. (2001) J. Biol. Chem. 276(9):6591-6604).


The invention encompasses anti-MICA antibodies a which comprise a variant Fc region, wherein the variant Fc region comprises at least one amino acid modification (for example, possessing 1, 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications) relative to a wild-type Fc region, such that the molecule has an enhanced effector function relative to a molecule comprising a wild-type Fc region, optionally wherein the variant Fc region comprises a substitution at any one or more of positions 221, 243, 247, 255, 256, 258, 267, 268, 269, 270, 272, 276, 278, 280, 283, 285, 286, 289, 290, 292, 293, 294, 295, 296, 298, 300, 301, 303, 305, 307, 308, 309, 310, 311, 312, 316, 320, 322, 326, 329, 330, 332, 331, 333, 334, 335, 337, 338, 339, 340, 359, 360, 370, 373, 376, 378, 392, 396, 399, 402, 404, 416, 419, 421, 430, 434, 435, 437, 438 and/or 439.


The invention encompasses anti-MICA antibodies a which comprise a variant Fc region, wherein the variant Fc region comprises at least one amino acid modification (for example, possessing 1, 2, 3, 4, 5, 6, 7, 8, 9, or more amino acid modifications) relative to a wild-type Fc region, such that the molecule has an enhanced effector function relative to a molecule comprising a wild-type Fc region, optionally wherein the variant Fc region comprises a substitution at any one or more of positions 329, 298, 330, 332, 333 and/or 334 (e.g. S239D, S298A, A330L, 1332E, E333A and/or K334A substitutions).


In one embodiment, antibodies having variant or wild-type Fc regions may have altered glycosylation patterns that increase Fc receptor binding ability of antibodies. Such carbohydrate modifications can be accomplished by, for example, expressing the antibody in a host cell with altered glycosylation machinery. Cells with altered glycosylation machinery have been described in the art and can be used as host cells in which to express recombinant antibodies of the invention to thereby produce an antibody with altered glycosylation. See, for example, Shields, R. L. et al. (2002) J. Biol. Chem. 277:26733-26740; Umana et al. (1999) Nat. Biotech. 17:176-1, as well as, European Patent No: EP 1,176,195; PCT Publications WO 06/133148; WO 03/035835; WO 99/54342, each of which is incorporated herein by reference in its entirety.


Generally, such antibodies with altered glycosylation are “glyco-optimized” such that the antibody has a particular N-glycan structure that produces certain desirable properties, including but not limited to, enhanced ADCC and effector cell receptor binding activity when compared to non-modified antibodies or antibodies having a naturally occurring constant region and produced by murine myeloma NSO and Chinese Hamster Ovary (CHO) cells (Chu and Robinson, Current Opinion Biotechnol. 2001, 12: 180-7), HEK293T-expressed antibodies as produced herein in the Examples section, or other mammalian host cell lines commonly used to produce recombinant therapeutic antibodies.


Monoclonal antibodies produced in mammalian host cells contain an N-linked glycosylation site at Asn297 of each heavy chain. Glycans on antibodies are typically complex biatennary structures with very low or no bisecting N-acetylglucosamine (bisecting GlcNAc) and high levels of core fucosylation. Glycan temini contain very low or no terminal sialic acid and variable amounts of galactose. For a review of effects of glycosylation on antibody function, see, e.g., Wright & Morrison, Trend Biotechnol. 15:26-31(1997). Considerable work shows that changes to the sugar Composition of the antibody glycan structure can alter Fc effector functions. The important carbohydrate structures contributing to antibody activity are believed to be the fucose residues attached via alpha-1,6 linkage to the innermost N-acetylglucosamine (GlacNAc) residues of the Fc region N-linked oligosaccharides (Shields et al., 2002).


FcγR binding requires the presence of oligosaccharides covalently attached at the conserved Asn297 in the Fc region of human IgGI, IgG2 or IgG3 type. Non-fucosylated oligosaccharides structures have recently been associated with dramatically increased in vitro ADCC activity. “Asn 297” according to the invention means amino acid asparagine located at about position 297 in the Fc region; based on minor sequence variations of antibodies, Asn297 can also be located some amino acids (usually not more than +3 amino acids) upstream or downstream.


Historically, antibodies produced in CHO cells contain about 2 to 6% in the population that are nonfucosylated. YB2/0 (rat myeloma) and Lecl3 cell line (a lectin mutant of CHO line which has a deficient GDP-mannose 4,6-dehydratase leading to the deficiency of GDP-fucose or GDP sugar intermediates that are the substrate of alpha6-fucosyltransferase have been reported to produce antibodies with 78 to 98% non-fucosylated species. In other examples, RNA interference (RNAi) or knock-out techniques can be employed to engineer cells to either decrease the FUT8 mRNA transcript levels or knock out gene expression entirely, and such antibodies have been reported to contain up to 70% non-fucosylated glycan.


The invention comprises an antibody binding to MICA being glycosylated with a sugar chain at Asn297, said antibody showing increased binding affinity via its Fc portion to FcγRIII. In one embodiment of the invention, an antibody will comprise a constant region comprising at least one amino acid alteration in the Fc region that improves antibody binding to FcγRIIIa and/or ADCC.


In one aspect, the antibodies of the invention are hypofucosylated in their constant region. Such antibodies may comprise an amino acid alteration or may not comprise an amino acid alteration but be produced or treated under conditions so as to yield such hypofucosylation. In one aspect, an antibody composition of the invention comprises a chimeric, human or humanized antibody described herein, wherein at least 20, 30, 40, 50, 60, 75, 85, 90, 95% or substantially all of the antibody species, in the composition have a constant region comprising a core carbohydrate structure (e.g. complex, hybrid and high mannose structures) which lacks fucose. In one embodiment, provided is an antibody composition which is free of antibodies comprising a core carbohydrate structure having fucose. The core carbohydrate will preferably be a sugar chain at Asn297.


In one embodiment, the invention comprises an antibody composition of the invention, e.g. a composition comprising antibodies which bind to MICA, are glycosylated with a sugar chain at Asn297, wherein the antibodies are partially fucosylated. Partially fucosylated antibodies are characterized in that the proportion of anti-MICA antibodies in the composition that lack fucose within the sugar chain at Asn297 is between 20% and 90%, preferably between 20% and 80%, preferably between 20% and 50%, 55%, 60%, 70% or 75%, between 35% and 50%, 55%, 60%, 70% or 75%, or between 45% and 50%, 55%, 60%; 70% or 75%. Preferably the antibody is of human IgGI or IgG3 type.


The sugar chain show can further show any characteristics (e.g. presence and proportion of complex, hybrid and high mannose structures), including the characteristics of N-linked glycans attached to Asn297 of an antibody from a human cell, or of an antibody recombinantly expressed in a rodent cell, murine cell (e.g. CHO cell) or in an avian cell.


In one embodiment, the antibody is expressed in a cell that is lacking in a fucosyltransferase enzyme such that the cell line produces proteins lacking fucose in their core carbohydrates. For example, the cell lines Ms704, Ms705, and Ms709 lack the fucosyltransferase gene, FUT8 (alpha (1,6) fucosyltransferase), such that antibodies expressed in the Ms704, Ms705, and Ms709 cell lines lack fucose on their core carbohydrates. These cell lines were created by the targeted disruption of the FUT8 gene in CHO/DG44 cells using two replacement vectors (see U.S. Patent Publication No. 20040110704 by Yamane et al.; and Yamane-Ohnuki et al. (2004) Biotechnol Bioeng 87:614-22, the disclosures of which are incorporated herein by reference). Other examples have included use of antisense suppression, double-stranded RNA (dsRNA) interference, hairpin RNA (hpRNA) interference or intron-containing hairpin RNA (ihpRNA) interference to functionally disrupt the FUT8 gene. In one embodiment, the antibody is expressed in a cell line with a functionally disrupted FUT8 gene, which encodes a fucosyl transferase, such that antibodies expressed in such a cell line exhibit hypofucosylation by reducing or eliminating the alpha 1,6 bond-related enzyme.


In one embodiment, the antibody is expressed in cell lines engineered to express glycoprotem-modifying glycosyl transferases (e.g., beta(1,4)-N-acetylglucosaminyl-transferase III (GnTHI)) such that antibodies expressed in the engineered cell lines exhibit increased bisecting GlcNac structures which results in increased ADCC activity of the antibodies (PCT Publication WO 99/54342 by Umana et al.; and Umana et al. (1999) Nat. Biotech. 17:176-180, the disclosures of which are incorporated herein by reference).


In another embodiment, the antibody is expressed and the fucosyl residue(s) is cleaved using a fucosidase enzyme. For example, the fucosidase alpha-L-fucosidase removes fucosyl residues from antibodies (Tarentino, et al. (1975) Biochem. 14:5516-5523). In other examples, a cell line producing an antibody can be treated with a glycosylation inhibitor; Zhou et al. Biotech. and Bioengin. 99: 652-665 (2008) described treatment of CHO cells with the alpha-mannosidase I inhibitor, kifunensine, resulting in the production of antibodies with non-fucosylated oligomannose-type N-glucans.


In one embodiment, the antibody is expressed in a cell line which naturally has a low enzyme activity for adding fucosyl to the N-acetylglucosamine that binds to the Fc region of the antibody or does not have the enzyme activity, for example the rat myeloma cell line YB2/0 (ATCC CRL 1662). Other example of cell lines include a variant CHO cell line, Led 3 cells, with reduced ability to attach fucosyl to Asn(297)-linked carbohydrates, also resulting in hypofucosylation of antibodies expressed in that host cell (WO 03/035835 (Presta et al); and Shields, R X. et al. (2002) J. Biol. Chem. 277:26733-26740, the disclosures of which are incorporated herein by reference). In another embodiment, the antibody is expressed in an avian cell, preferably a EBx® cell (Vivalis, France) which naturally yields antibodies with low fucose content e.g WO2008/142124. Hypofucosylated glycans can also be produced in cell lines of plant origin, e.g. WO 07/084926A2 (Biolex Inc.), WO 08/006554 (Greenovation Biotech GMBH), the disclosures of which are incorporated herein by reference.


Uses in Diagnostics and Therapy

In certain embodiments, the present antibodies are used to purify or identify MICA positive cells from a biological sample. Biological samples can be obtained from a patient, e.g. for diagnostic or ex vivo therapeutic purposes, or from individuals or non-human primates to obtain a source of such cells for research purposes.


MICA positive cells can be purified or identified using the present antibodies with any of a number of standard methods. For example, peripheral blood cells can be sorted using a FACS scanner using labeled antibodies specific for MICA, and optionally to other cell surface molecules typically present on cells.


In addition, the antibodies of the invention can be conjugated or covalently linked to a solid support and used to purify or identify MICA positive cells or any cells expressing MICA from a biological sample, e.g., from a blood sample or tissue biopsy from a patient or other individual. Specifically, the biological sample is placed into contact with the antibodies under conditions that allow cells within the sample to bind to the antibody, and then the cells are eluted from the solid-support-bound antibody.


Regardless of the method used to isolate, purify or identify the MICA positive cells, the ability to do so is useful for numerous purposes, e.g. to diagnose a disorder characterized by a pathogenic expansion of MICA-expressing cells, by assessing the number or activity or other characteristics of MICA positive cells obtained from a patient, or to evaluate the ability of the antibodies of the invention, or fragments or derivatives thereof, to modulate the activity or behavior of the cells of a patient prior, e.g., to one of the herein-described treatments using the antibodies. Further, purified MICA positive cells are useful in a research context, e.g., to better characterize the cells and their various properties and behaviors, as well as to identify compounds or methods that can be used to modulate their behavior, activity, or proliferation. The antibodies of the invention can also be useful in diagnostic methods, for example in methods of detecting MICA polypeptides on cells, e.g. disease cells from a patient.


The present invention also provides pharmaceutical compositions that comprise an antigen-binding agent (e.g. an antibody) according to the invention which specifically binds to MICA polypeptides on the surface of cells. The antibody preferably inhibits the growth or activity of the cells and/or leads to the elimination of the MICA positive cells, preferably or by delivery of a toxic agent, Put optionally additionally via induction of CDC and/or ADCC. The composition further comprises a pharmaceutically acceptable carrier.


The invention further provides a method of inhibiting the growth or activity of, and/or depleting, MICA-positive cells, in a patient in need thereof, comprising the step of administering to said patient a composition according to the invention. Such treatment methods can be used for a number of disorders, including, but not limited to the treatment of cancers.


As demonstrated herein, non-blocking anti-MICA antibodies are particularly effective at inducing lysis of MICA-expressing cells by effector cells. The antibodies have a dual mode of action, by binding MICA and engaging activating Fcγ receptors on effector cells they induce lysis by effector cells, and by not blocking NKG2D signaling they prevent a neutralization of NKG2D-mediated activation of NK cell reactivity. The antibodies preferably comprise human heavy chain constant regions sequences that lead to the depletion of MICA-expression cells (e.g. tumor cells) to which they are bound and preferably comprise an Fc portion that induces CDC and/or ADCC. The composition further comprises a pharmaceutically acceptable carrier. Such compositions are also referred to as “antibody compositions” of the invention. In one embodiment, antibody compositions of this invention comprise an antibody disclosed in the antibody embodiments above.


In one aspect, the methods of treatment of the invention comprise administering to an individual a composition comprising an antigen-binding compound that binds MICA in a therapeutically effective amount. A therapeutically effective amount may be for example an sufficient to cause an increase in the depletion of MICA cells in vivo, or an increase in the frequency of activated, reactive, cytotoxic and/or IFNγ-production of NKG2D+ effector cells (e.g. NK cells) towards MICA-expressing tumor cells.


The methods of the present invention are utilized advantageously for the treatment of cancers and other proliferative diseases including, but not limited to, carcinoma, including that of the bladder, breast, colon, kidney, liver, lung, ovary, prostate, pancreas, stomach, cervix, thyroid and skin, including squamous cell carcinoma; hematopoietic tumors of lymphoid lineage, including leukemia, acute lymphocytic leukemia, acute lymphoblastic leukemia, B-cell lymphoma, T-cell lymphoma, Hodgkins lymphoma, non-Hodgkins lymphoma, hairy cell lymphoma and Burketts lymphoma; hematopoietic tumors of myeloid lineage, including acute and chronic myelogenous leukemias and promyelocytic leukemia; tumors of mesenchymal origin, including fibrosarcoma and rhabdomyoscarcoma; other tumors, including neuroblastoma and glioma; tumors of the central and peripheral nervous system, including astrocytoma, neuroblastoma, glioma, and schwannomas; tumors of mesenchymal origin, including fibrosarcoma, rhabdomyosarcoma, and osteosarcoma; and other tumors, including melanoma, xeroderma pigmentosum, keratoacanthoma, seminoma, thyroid follicular cancer and teratocarcinoma. Other exemplary disorders that can be treated according to the invention include hematopoietic tumors of lymphoid lineage, for example T-cell and B-cell tumors, including but not limited to T-cell disorders such as T-prolymphocytic leukemia (T-PLL), including of the small cell and cerebriform cell type; large granular lymphocyte leukemia (LGL) preferably of the T-cell type; Sezary syndrome (SS); Adult T-cell leukemia lymphoma (ATLL); a/d T-NHL hepatosplenic lymphoma; peripheral/post-thymic T cell lymphoma (pleomorphic and immunoblastic subtypes); angio immunoblastic T-cell lymphoma; angiocentric (nasal) T-cell lymphoma; anaplastic (Ki 1+) large cell lymphoma; intestinal T-cell lymphoma; T-lymphoblastic; and lymphoma/leukaemia (T-Lbly/T-ALL).


In some embodiments, prior to the administration of the anti-MICA antibody or composition, the presence of MICA on cells (e.g. tumor cells) of the patient will be assessed, e.g., to determine the relative level and activity of MICA-positive cells in the patient as well as to confirm the binding efficacy of the antibodies to the cells of the patient. A patient whose tumor cells express MICA can then be treated with an anti-MICA antibody or composition. This can be accomplished by obtaining a sample of PBLs or tumor cells from the site of the disorder, and testing e.g., using immunoassays, to determine the relative prominence of MICA and optionally further other markers on the cells. Other methods can also be used to detect expression of MICA and other genes, such as RNA-based methods, e.g., RT-PCR or Northern blotting.


In one embodiment, where it is sought to inhibit the activity or growth of, or deplete, a patient's MICA-positive cells, the ability of the anti-MICA antibody to inhibit proliferation of or deplete a patient's MICA-positive cells is assessed. If the MICA-positive cells are depleted by the anti-MICA antibody or composition, the patient is determined to be responsive to therapy with an anti-MICA antibody or composition, and optionally the patient is treated with an anti-MICA antibody or composition.


The treatment may involve multiple rounds of antibody or compound administration. For example, following an initial round of administration, the level and/or activity of MICA-expressing cells (e.g., on malignant tumor cells), in the patient will generally be re-measured, and, if still elevated, an additional round of administration can be performed. In this way, multiple rounds of MICA detection and antibody or compound administration can be performed, e.g., until the disorder is brought under control.


In some embodiments, the method may comprise the additional step of administering to said patient an appropriate additional (second) therapeutic agent selected from an immunomodulatory agent, a hormonal agent, a chemotherapeutic agent, or a second antibody (e.g. a depleting antibody) that binds to a polypeptide present on a MICA-expressing cell. Such additional agents can be administered to said patient as a single dosage form together with said antibody, or as a separate dosage form. The dosage of the antibody (or antibody and the dosage of the additional therapeutic agent collectively) are sufficient to detectably induce, promote, and/or enhance a therapeutic response in the patient. Where administered separately, the antibody, fragment, or derivative and the additional therapeutic agent are desirably administered under conditions (e.g., with respect to timing, number of doses, etc.) that result in a detectable combined therapeutic benefit to the patient.


For tumor (e.g. solid tumor) treatment, for example, the administration of a composition of the present invention may be used in combination with classical approaches, such as surgery, radiotherapy, chemotherapy, and the like. The invention therefore provides combined therapies in which the present antibodies are used simultaneously with, before, or after surgery or radiation treatment; or are administered to patients with, before, or after conventional chemotherapeutic, radiotherapeutic or anti-angiogenic agents, or targeted immunotoxins or coaguligands.


Exemplary anti-cancer anti-angiogenic agents inhibit signaling by a receptor tyrosine kinase including but not limited to FGFR (fibroblast growth factor receptor, FGF-1,2), PDGFR (platelet derived growth factor receptor), angiopoietins receptors (Ang-1,2), HGFR (hepatocytary growth factor receptor), ephrines receptor (Eph), VEGFR1, VEGFR-2,3 PDGFR-α, PDGFR-β, CSF-1R, MET, Flt-3, c-Kit, bcr/abl, p38 alpha and FGFR-1. Further anti-angiogenic agents may include agents that inhibit one or more of the various regulators of VEGF expression and production, such as EGFR, fit-1, KDR, HER-2, COX-2, or HIF-1α. Another preferred class of agents includes IMiD (immunomodulatory drugs), analogs derived from thalidomide that have a wide range of effects, including both immune and non-immune related effects. Representatives of the IMiD class include CC-5013 (lenalidomide, Revlimid™), CC-4047 (Actimid™), and ENMD-0995. Another class of anti-angiogenic agent includes cilengitide (EMD 121974, integrin inhibitor), metalloproteinases (MPP) such as marinastat (BB-251). Another class of anti-angiogenic agents includes farnesylation inhibitors such as lonafamib (Sarasar™), tipifarnib (Zarnestra™). Other anti-angiogenic agents can also be suitable such as Bevacuzimab (mAb, inhibiting VEGF-A, Genentech); IMC-1121B (mAb, inhibiting VEGFR-2, ImClone Systems); CDP-791 (Pegylated DiFab, VEGFR-2, Celltech); 2C3 (mAb, VEGF-A, Peregrine Pharmaceuticals); VEGF-trap (Soluble hybrid receptor VEGF-A, PIGF (placenta growth factor) Aventis/Regeneron). Another preferred class of agents includes the tyrosine kinase inhibitor (TKI) class, including, e.g., PTK-787 (TKI, VEGFR-1, -2, Vatalanib, Novartis); AEE788 (TKI, VEGFR-2 and EGFR, Novartis); ZD6474 (TKI, VEGFR-1, -2, -3, EGFR, Zactima, AstraZeneca); AZD2171 (TKI, VEGFR-1, -2, AstraZeneca); SU11248 (TKI, VEGFR-1, -2, PDGFR, Sunitinib, Pfizer); AG13925 (TKI, VEGFR-1, -2, Pfizer); AG013736 (TKI, VEGFR-1, -2, Pfizer); CEP-7055 (TKI, VEGFR-1, -2, -3, Cephalon); CP-547,632 (TKI, VEGFR-1, -2, Pfizer); GW786024 (TKI, VEGFR-1, -2, -3, GlaxoSmithKline); GW786034 (TKI, VEGFR-1, -2, -3, GlaxoSmithKline); sorafenib (TKI, Bay 43-9006, VEGFR-1, -2, PDGFR Bayer/Onyx); SU4312 (TKI, VEGFR, PDGFR, Pfizer), AMG706 (TKI, VEGFR-1, -2, -3, Amgen), XL647 (TKI, EGFR, HER2, VEGFR, ErbB4, Exelixis), XL999 (TKI, FGFR, VEGFR, PDGFR, Flt-3, Exelixis), PKC412 (TKI, KIT, PDGFR, PKC, FLT3, VEGFR-2, Novartis), AEE788 (TKI, EGFR, HER2, VEGFR, Novartis), OSI-930 (TKI, c-kit, VEGFR, OSI Pharmaceuticals), OSI-817 (TKI, c-kit, VEGFR, OSI Pharmaceuticals), DMPQ (TKI, ERGF, PDGFR, erbB2, p56; pkA, pkC), MLN518 (TKI, FLT3, PDGFR, c-KIT, CT53518, Millennium Pharmaceuticals), lestaurinib (TKI, FLT3, CEP-701, Cephalon), ZD1839 (TKI, EGFR, gefitinib, Iressa, AstraZeneca), OSI-774 (TKI, EGFR, Erlotininb, Tarceva, OSI Pharmaceuticals), lapatinib (TKI, ErbB-2, EGFR, GD-2016, Tykerb, GlaxoSmithKline). Most preferred are tyrosine kinase inhibitors that inhibit one or more receptor tyrosine kinases selected from the group consisting of VEGFR-1, VEGFR-2, VEGFR-3, PDGFR-α, β, Flt-3, c-Kit, p38 alpha, MET, c-RAF, b-RAF, bcr/abl and FGFR-1.


In one embodiment, the second agent is a natural ligand of an effector cell (e.g. NK cell) activating receptor or an antibody that binds and activates an NK cell activating receptor other than NKG2D. In one embodiment the agent is an agent that increases the presence of a natural ligand of an NK cell activating receptor other than NKG2D on the surface of a target cell (e.g., infected cells, tumor cells, pro-inflammatory cells). NK cell activating receptors include, for example, natural cytotoxicity receptors such as NKp30, NKp46, NKp44 or activating KIR receptors (KIR2DS receptors, KIR2DS2, KIR2DS4). As used herein, the term “activating NK receptor” refers to any molecule on the surface of NK cells that, when stimulated, causes a measurable increase in any property or activity known in the art as associated with NK activity, such as cytokine (for example IFN-γ and TNF-α□□ production, increases in intracellular free calcium levels, the ability to target cells in a redirected killing assay as described, e.g. elsewhere in the present specification, or the ability to stimulate NK cell proliferation. The term “activating NK receptor” includes but is not limited to activating forms or KIR proteins (for example KIR2DS proteins), NKp30, NKp46, NKp44, NKG2D, IL-2R, IL-12R, IL-15R, IL-18R and IL-21R.


In one embodiment, the anti-cancer agent is a chemotherapeutic agent or radiation that upregulates expression of NKG2D ligands on the surface of tumor cells. This includes well known chemotherapies including ionizing and UV radiation, inhibitors of DNA replication, inhibitors of DNA polymerase, chromatin modifying treatments, as well as apoptosis inducing agents such as HDAC inhibitors trichostatin A and valproic acid. Preferred therapies are those that activate the DNA damage response pathway, more preferably those that activate the ATM (ataxia telangiectasia, mutated) or ATR (ATM- and Rad3-related) protein kinases, or CHK1, or yet further CHK2 or p53. Examples of the latter include ionizing radiation, inhibitors of DNA replication, DNA polymerase inhibitors and chromatic modifying agents or treatment including HDAC inhibitors. Compositions that upregulate NKG2D ligands are further described in Gasser et al (2005) Nature 436(7054):1186-90. NKG2D is an activating receptor that interacts with the MHC class I-related MICA and MICB glycoproteins, among other ligands. MICA and MICB (Bauer et al. (1999) Science 285:727-729; the disclosure of which is incorporated herein by reference) have no role in antigen presentation, are generally only found in intestinal epithelium, and can be stress-induced in permissive types of cells by viral and bacterial infections, malignant transformation, and proliferation. NKG2D is a C-type lectin-like activating receptor that signals through the associated DAP10 adaptor protein, which is similar to CD28. It is expressed on most natural killer (NK) cells, NKT cells, γδ T cells CD8 T cells, and T cells, but not, in general, on CD4 T cells. Other NKG2D ligands include ULBP proteins, e.g., ULBP-1, -2, and -3, originally identified as ligands for the human cytomegalovirus glycoprotein UL16 (Cosman et el, (2001) Immunity 14: 123-133, the disclosure of which is incorporated herein by reference). Further NKG2D ligands include RAE1TG, a member of the ULBP-like family of proteins (Bacon at al (2004) J. Immunol. 173:1078-1084).


Further anti-cancer agents include alkylating agents, cytotoxic antibiotics such as topoisomerase I inhibitors, topoisomerase II inhibitors, plant derivatives, RNA/DNA antimetabolites, and antimitotic agents. Preferred examples may include, for example, cisplatin (CDDP), carboplatin, procarbazine, mechlorethamine, cyclophosphamide, camptothecin, ifosfamide, melphalan, chlorambucil, busulfan, nitrosurea, dactinomycin, daunorubicin, doxorubicin, bleomycin, plicomycin, mitomycin, etoposide (VP16), tamoxifen, raloxifene, taxol, gemcitabine, navelbine, transplatinum, 5-fluorouracil, vincristin, vinblastin and methotrexate, or any analog or derivative variant of the foregoing.


Alkylating agents are substances that form compounds that are highly chemically reactive and rapidly form covalent bonds with suitable substances. One such target is DNA, not in its normal state but when the double helix has been unpaired by helicases. This exposes the ‘inside’ of the DNA, which is susceptible to alkylation. Most alkylating agents are bipolar, i.e., they contain two groups capable of reacting with DNA. They can thus form ‘bridges’ between two parts of a single strand of DNA or two separate strands; either way, this interferes with the actions of the enzymes involved with the replication process, which are unable to complete their effects. The cell then either dies because it is physically unable to divide or because the abnormal DNA stimulates apoptosis. Examples include nitrogen mustards (e.g. chlorambucil, cyclophosphamide), nitrosureas (e.g. carmustine, lomustine), metal salts (e.g. cisplatin, carboplatin, oxaliplatin), ethylenamine derivatives (e.g. thiotepa), alkyl sulphonates (e.g. busulphan) and triazenes (e.g. dacarbazine).


Antimetabolites are a group of chemicals that are similar in structure or function to naturally occurring metabolites required for the synthesis of nucleic acids. Antimetabolite molecules mimic these normal metabolites and either block the enzymes responsible for nucleic acid synthesis or become incorporated into DNA, which produces an incorrect genetic code and leads to apoptosis. There are three main classes of antimetabolites. Folate is a substance that is necessary for the synthesis of purine molecules. Folate analogues (e.g. methotrexate, raltritrexed) are similar to the folate molecule—substances such as methotrexate can be used to inhibit the enzyme dihydrofolate reductase, resulting in insufficient production of the purine thymine. Pyrimidine analogues (e.g. cytarabine, fluoroacil (5-FU), gemcitabine) resemble pyrimidine molecules and work by either inhibiting the synthesis of nucleic acids (e.g. fluorouracil) or by becoming incorporated into DNA (e.g. cytarabine). Purine analogues (e.g. mercaptopurine, thioguanine, cladribine, fludarabine) work in similar ways to pyrimidine analogues, but may have additional (and ill-characterized) mechanisms of action.


Cytotoxic antibiotics are so called because they are all derived from a natural source, the Streptomyces group of bacteria. They affect the function and synthesis of nucleic acids in different ways. The anthracycline group includes doxorubicin, daunorubicin and idarubicin. They intercalate with DNA and affect the topoisomerase II enzyme. This DNA gyrase splits the DNA double helix and reconnects it once torsional forces have been relieved; the anthracyclines stabilize the DNA-topoisomerase II complex and thus prevent reconnection of the strands. Dactinomycin and mitoxantrone have a similar mechanism of action. Bleomycin causes fragmentation of DNA chains. Mitomycin functions similar to the alkylating agents, causing DNA cross-linkage.


Plant derivatives include the vinca alkaloids such as vincristine and vinblastine bind to precursors of microtubules, Preventing their formation. This inhibits the process of mitosis. The taxanes (paclitaxel and docetaxel) also act on microtubules. They stabilize them in their polymerized state, which also causes the arrest of mitosis. Podophyllyum derivatives such as etoposide and teniposide are thought to inhibit topoisomerase II, while irinotecan and topotecan inhibit topoisomerase I.


When infectious diseases are treated, the treatment may employ a composition according to the invention, either alone or in combination with other treatments and/or therapeutic agents known for treating such diseases, including anti-viral agents, anti-fungal agents, antibacterial agents, antibiotics, anti-parasitic agents and anti-protozoal agents. When these methods involve additional treatments with additional therapeutic agents, those agents may be administered together with the antibodies of this invention as either a single dosage form or as separate, multiple dosage forms. When administered as a separate dosage form, the additional agent may be administered prior to, simultaneously with, of following administration of the antibody of this invention.


In the treatment methods of the invention, the antigen-binding compound of the invention and the second therapeutic agent can be administered separately, together or sequentially, or in a cocktail. In some embodiments, the antigen-binding compound of the invention is administered prior to the administration of the second therapeutic agent. For example, the antigen-binding compound of the invention can be administered approximately 0 to 30 days prior to the administration of the second therapeutic agent. In some embodiments, an antigen-binding compound of the invention is administered from about 30 minutes to about 2 weeks, from about 30 minutes to about 1 week, from about 1 hour to about 2 hours, from about 2 hours to about 4 hours, from about 4 hours to about 6 hours, from about 6 hours to about 8 hours, from about 8 hours to 1 day, or from about 1 to 5 days prior to the administration of the second therapeutic agent. In some embodiments, an antigen-binding compound of the invention is administered concurrently with the administration of the therapeutic agents. In some embodiments, an antigen-binding compound of the invention is administered after the administration of the second therapeutic agent. For example, an antigen-binding compound of the invention can be administered approximately 0 to 30 days after the administration of the second therapeutic agent. In some embodiments, an antigen-binding compound of the invention is administered from about 30 minutes to about 2 weeks, from about 30 minutes to about 1 week, from about 1 hour to about 2 hours, from about 2 hours to about 4 hours, from about 4 hours to about 6 hours, from about 6 hours to about 8 hours, from about 8 hours to 1 day, or from about 1 to 5 days after the administration of the second therapeutic agent.


The antigen-binding compounds of the invention can be included in kits. The kits may optionally further contain any number of antibodies and/or other compounds, e.g., 1, 2, 3, 4, or any other number of anti-MICA antibodies and/or other compounds. It will be appreciated that this description of the contents of the kits is not limiting in any way. For example, the kit may contain other types of therapeutic or diagnostic agents. Preferably, the kits also include instructions for using the antibodies and/or agents, e.g., detailing the herein-described methods.


Pharmaceutical Formulations

Pharmaceutically acceptable carriers that may be used in these compositions include; but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat. The antibodies of this invention may be employed in a method of modulating, e.g. inhibiting, the activity of MICA-expressing cells in a patient. This method comprises the step of contacting said composition with said patient. Such method will be useful for both prophylaxis and therapeutic purposes.


For use in administration to a patient, the composition will be formulated for administration to the patient. The compositions of the present invention may be administered orally, parenterally, by inhalation spray, topically, rectally, nasally, buccally, vaginally or via an implanted reservoir. The used herein includes subcutaneous, intravenous, intramuscular, intra-articular, Intra-synovial, intrasternal, intrathecal, intrahepatic, intralesional and intracranial injection or infusion techniques. The antibody can be present in a single dose in an amount, for example, of between about 25 mg and 500 mg.


Sterile injectable forms of the compositions of this invention may be aqueous or an oleaginous suspension. These suspensions may be formulated according to techniques known in the art using suitable dispersing or wetting agents and suspending agents. The sterile injectable preparation may also be a sterile injectable solution or suspension in a non-toxic parenterally acceptable diluent or solvent, for example as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that may be employed are water, Ringer's solution and isotonic sodium chloride solution. In addition, sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose, any bland fixed oil may be employed including synthetic mono- or diglycerides. Fatty acids, such as oleic acid and its glyceride derivatives are useful in the preparation of injectables, as are natural pharmaceutically-acceptable oils, such as olive oil or castor oil, especially in their polyoxyethylated versions. These oil solutions or suspensions may also contain a long-chain alcohol diluent or dispersant, such as carboxymethyl cellulose or similar dispersing agents that are commonly used in the formulation of pharmaceutically acceptable dosage forms including emulsions and suspensions. Other commonly used surfactants, such as Tweens, Spans and other emulsifying agents or bioavailability enhancers which are commonly used in the manufacture of pharmaceutically acceptable solid, liquid, or other dosage forms may also be used for the purposes of formulation.


The compositions of this invention may be orally administered in any orally acceptable dosage form including, but not limited to, capsules, tablets, aqueous suspensions or solutions. In the case of tablets for oral use, carriers commonly used include lactose and corn starch. Lubricating agents, such as magnesium stearate, are also typically added. For oral administration in a capsule form, useful diluents include, e.g., lactose. When aqueous suspensions are required for oral use, the active ingredient is combined with emulsifying and suspending agents. If desired, certain sweetening, flavoring or coloring agents may also be added.


Alternatively, the compositions of this invention may be administered in the form of suppositories for rectal administration. These can be prepared by mixing the agent with a suitable non-irritating excipient that is solid at room temperature but liquid at rectal temperature and therefore will melt in the rectum to release the drug. Such materials include cocoa butter, beeswax and polyethylene glycols.


The compositions of this invention may also be administered topically, especially when the target of treatment includes areas or organs readily accessible by topical application, including diseases of the eye, the skin, or the lower intestinal tract. Suitable topical formulations are readily prepared for each of these areas or organs. For topical applications, the compositions may be formulated in a suitable ointment containing the active component suspended or dissolved in one or more carriers. Carriers for topical administration of the compounds of this invention include, but are not limited to, mineral oil, liquid petrolatum, white petrolatum, propylene glycol, polyoxyethylene, polyoxypropylene compound, emulsifying wax and water. Alternatively, the compositions can be formulated in a suitable lotion or cream containing the active components suspended or dissolved in one or more pharmaceutically acceptable carriers. Suitable carriers include, but are not limited to, mineral oil, sorbitan monostearate, polysorbate 60, cetyl esters wax, cetearyl alcohol, 2-octyldodecanol, benzyl alcohol and water.


The present antibodies can be included in kits. The kits may optionally further contain any number of antibodies and/or other compounds, e.g., 1, 2, 3, 4, or any other number of therapeutic antibodies and/or compounds. It will be appreciated that this description of the contents of the kits is not limiting in any way. For example, the kit may contain other types of therapeutic compounds. Preferably, the kits also include instructions for using the antibodies, e.g., detailing the herein-described methods.


Dosage Forms

Therapeutic formulations of the antagonists used in accordance with the present invention are prepared for storage by mixing the antagonist having the desired degree of purity with optional pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formulations or aqueous solutions. For general information concerning formulations, see, e.g., Gilman et al. (eds.), The Pharmacological Bases of Therapeutics, 8th Ed. (Pergamon Press, 1990); Gennaro (ed.), Remington's Pharmaceutical Sciences, 18th Edition (Mack Publishing Co., Easton, Pa., 1990); Avis et al. (eds.), Pharmaceutical Dosage Forms: Parenteral Medications (Dekker, New York, 1993); Lieberman et al. (eds.), Pharmaceutical Dosage Forms: Tablets (Dekker, New York, 1990); Lieberman et al. (eds.) Pharmaceutical Dosage Forms: Disperse Systems (Dekker, New York, 1990); and Walters (ed.), Dermatological and Transdermal Formulations (Drugs and the Pharmaceutical Sciences), Vol 119 (Dekker, New York, 2002).


Acceptable carriers, excipients, or stabilizers are non-toxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low-molecular-weight (less than about 10 residues) polypeptides; proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as ethylenediaminetetraacetic acid (EDTA); sugars such as sucrose, mannitol, trehalose, or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™, or PEG.


Exemplary antibody formulations are described for instance in WO 1998/56418, which describes a liquid multidose formulation for an anti-CD20 antibody, comprising 40 mg/mL rituximab, 25 mM acetate, 150 mM trehalose, 0.9% benzyl alcohol, and 0.02% polysorbate20™ at pH 5.0 that has a minimum shelf life of two years storage at 2-8° C. Another anti-CD20 formulation of interest comprises 10 mg/mL rituximab in 9.0 mg/mL sodium chloride, 7.35 mg/mL sodium citrate dihydrate, 0.7 mg/mL polysorbat80™, and Sterile Water for Injection, pH 6.5.


Lyophilized formulations adapted for subcutaneous administration are described, for example, in U.S. Pat. No. 6,267,958 (Andya et al.). Such lyophilized formulations may be reconstituted with a suitable diluent to a high protein concentration and the reconstituted formulation may be administered subcutaneously to the mammal to be treated herein.


The formulation herein may also contain more than one active compound (a second medicament as noted above), preferably those with complementary activities that do not adversely affect each other. The type and effective amounts of such medicaments depend, for example, on the amount and type of B-cell antagonist present in the formulation, and clinical parameters of the subjects. The preferred such second medicaments are noted above.


The active ingredients may also be entrapped in microcapsules prepared, e.g., by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences, supra, for example.


Sustained-release formulations may be prepared. Suitable examples of sustained-release preparations include semi-permeable matrices of solid hydrophobic polymers containing the antagonist, which matrices are in the form of shaped articles, e.g. films, or microcapsules. Examples of sustained-release matrices include, polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and γ ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the Lupron Depot™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(−)-3-hydroxybutyric acid.


The formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes. Pharmaceutically acceptable carriers that may be used in these compositions include, but are not limited to, ion exchangers, alumina, aluminum stearate, lecithin, serum proteins, such as human serum albumin, buffer substances such as phosphates, glycine, sorbic acid, potassium sorbate, partial glyceride mixtures of saturated vegetable fatty acids, water, salts or electrolytes, such as protamine sulfate, disodium hydrogen phosphate, potassium hydrogen phosphate, sodium chloride, zinc salts, colloidal silica, magnesium trisilicate, polyvinyl pyrrolidone, cellulose-based substances, polyethylene glycol, sodium carboxymethylcellulose, polyacrylates, waxes, polyethylene-polyoxypropylene-block polymers, polyethylene glycol and wool fat.


Further aspects and advantages of this invention will be disclosed in the following experimental section, which should be regarded as illustrative and not limiting the scope of this application.


EXAMPLES
Example 1
Generation of Anti-MICA Antibodies
Immunization #1

To obtain anti-human MICA antibodies, Balb/c mice were immunized with a recombinant human MICA extracellular domain recombinant-Fc protein (MICA*019 allele, available from R&D Systems). Mice received one primo-immunization with an emulsion of 50 μg MICA protein and Complete Freund Adjuvant, intraperitoneally, a 2nd immunization with an emulsion of 50 μg MICA protein and Incomplete Freund Adjuvant, intraperitoneally, and finally a boost with 10 μg MICA protein, intravenously. Immune spleen cells were fused 3 days after the boost with X63.Ag8.653 immortalized B cells, and cultured in the presence of irradiated spleen cells.


Primary screen: Supernatant (SN) of growing clones were tested in a primary screen by flow cytometry using Baf/3 cell line transfected with a MICA*019 construct. Positive supernatants were selected and tested for lack of binding by flow cytometry to untransfected Baf/3 cell line. Briefly, for FACS screening, the presence of reacting antibodies in supernanants was revealed by Goat anti-mouse polyclonal antibody (pAb) labeled with PE.


Secondary screen: Supernatants of the clones were also tested using an ELISA assay to assess the capacity to block the interaction between MICA extracellular domain recombinant-Fc protein (R&D Systems) and NKG2D extracellular domain recombinant-Fc protein. Potentially interesting hybridomas selected from the initial screening were cloned by limiting dilution techniques in 96-wells plates. The resulting antibodies supernatant 9C10 of IgG2b isotype and 20C6 of IgG1 isotype.


Immunization #2

To obtain anti-human MICA antibodies, Balb/c mice were immunized with a recombinant human MICA extracellular domain recombinant-His protein (MICA*001 allele). Mice received one primo-immunization with an emulsion of 50 μg MICA protein and Complete Freund Adjuvant, intraperitoneally, a 2nd immunization with an emulsion of 50 μg MICA protein and Incomplete Freund Adjuvant, intraperitoneally, and one boost with 10 μg MICA protein, intravenously. Immune spleen cells were fused with X63.Ag8.653 immortalized B cells, and cultured in the presence of irradiated spleen cells.


Primary screen: Supernatant (SN) of growing clones were tested in a primary screen by flow cytometry using a mixture of cells of different C1R-based cell lines, wherein each cell line was transfected with a different construct (either MICA*001, MICA*004, MICA*007 or MICA*008). Briefly, for FACS screening, the presence of reacting antibodies in supernanants was revealed by Goat anti-mouse polyclonal antibody (pAb) labeled with PE.


Secondary screen: Supernatants of the clones were also tested using an ELISA assay to assess the capacity to bind MICA extracellular domain α3 recombinant protein without binding to recombinant human MICA full extracellular domain recombinant-His protein (MICA*001 allele). Potentially interesting hybridomas selected from the initial screening were cloned by limiting dilution techniques in 96-wells plates.


MICA extracellular domain α3 antibodies were obtained, including clone 16A8 of IgG2a isotype.


Example 2
Binding to Immobilized MICA Proteins

The binding of 9C10, 20C6 and 16A8 to either recombinant human MICA extracellular domain recombinant protein monomers or dimers (MICA*019 allele-Fc protein or MICA*001-His protein) as well as other NKG2D ligands MICB and ULBP1-2 was analyzed by Surface Plasmon Resonance (SPR) using a Biacore T100 apparatus to obtain monovalent and bivalent affinity, respectively. Biotinylated anti-MICA antibodies were injected at a constant rate of 10 μl/min over the Sensor Chip CAP flow-cells comprising Biotin CAPture Reagent. MICA-Fc or MICA-His protein, MICB-Fc, ULBP1-Fc or ULBP2-Fc protein is then injected successively (range of concentrations between 0.01-100 nM), with regeneration between injections, and in increasing order over two flowcells simultaneously. Curves are fitted using Biacore T100 Evaluation software.


The bivalent mean KD (M) at pH 7.4 for MICA binding for antibody 9C10 (on MICA*019-Fc) was 0.6 pM (6.2*10−13 M). The bivalent mean KD (M) at pH 7.4 for antibody 20C6 (on MICA*001-His) was 3.3*10−10 M. Both antibodies and 20C6 were specific for MICA and did not bind MICB, ULPB1 or ULBP2. Antibody 16A8 bound MICA and MICB but not ULBP1 or ULBP2. Results are shown in FIGS. 1A, 1B, 1C and 1D for MICA, MICB, ULBP1 and ULPB2 respectively.


Example 3
Binding to MICA Domains

Various antibodies from immunizations 1 and 2 were tested for binding to MICA*001 extracellular domain recombinant protein (full extracellular domain with a BirA or a Poly-His Tag), or to MICA*01 extracellular domain α1α2, but not MICA*001 extracellular domain α3 recombinant protein in order to assess whether the antibodies bind the α1, α2 or α3 domains.


ELISA.


3 μg/ml of the indicated MICA recombinant proteins were coated overnight in 96-well plates in PBS 1× at 4° C. All subsequent steps were performed at room temperature. After washes with PBS 1×/Tween 0.05%, plates were saturated for an additional 2 hours in PBS 1×/BSA 1%. Two additional washes were performed prior adding the tested anti-MICA mAb in PBS 1×/BSA 1% for 2 hours. Antibodies were washed and a horseradish peroxidase conjugated goat polyclonal anti-mouse IgG (GAM-HRP) in PBS 1×/BSA 1% was added for 1 hour. Final washing steps were performed and TMB substrate was added to reveal the ELISA (5 to 20 min in the dark) and 1M HCl was added to stop the enzymatic reaction. O.D. was measured at 450 nm.


Results.


9C10 binds to MICA extracellular domain recombinant-protein but not MICA extracellular domain α3 recombinant protein. Antibody 16A8, however, bound to both MICA extracellular domain recombinant protein but not MICA extracellular domain α3 recombinant protein. Therefore, it can be concluded from this ELISA experiment that the binding site on MICA of 9C10 antibodies includes the α1 and/or α2 domains while antibody 16A8 binds to MICA within the α3 domain. A representative example in FIG. 2 shows that 16A8 is specific for the α3 domain of MICA. BAMO1 is a commercially available anti-MICA specific for α1α2 domain and BAMO3 is a commercially available anti-MICA specific for α3 domain.


The three-dimensional structure of MICA was analyzed as a molecular surface map generated by computer modelling using SwissPdb Viewer 4.0 (Guex and Peitsch (2007) Electrophoresis 18: 2714-2723) based on data publicly available, and combined with amino acid sequence comparison of MICA alleles *001, *004, *007, *008 and *019 and MICB (allele 001) to identify potential epitopes for binding by antibodies 9C10 and 20C6 that are present on the surface of MICA alleles but not on MICB, and that are outside of the NKG2D binding sites. Epitopes within the α1 domain include N56 and E85, epitopes within the α2 domain include N102, W127, R143, R169, V177 and L178 and epitopes within the α3 domain include R190, A193, D226, C250 and S268 (reference to SEQ ID NO: 1).


Example 4
Binding to MICA Alleles

The binding of antibodies obtained from the first and second immunization series (including 9C10, 20C6 and 16A8) were tested for binding to MICA-expressing CR1 transfectant cells C1R-MICA*001, C1R-MICA*004, C1R-MICA*007 and C1R-MICA*008 (Pr. A. Steinle, Eberhard-Karls University Tuebingen, Germany) described in Salih et al. (2003) Blood 102(4): 1389-91396. Binding was analyzed by flow cytometry.


Flow Cytometry.


Cells were harvested and stained in PBS 1×/BSA 0,2%/EDTA 2 mM buffer during 30 minutes at 4° C. using a dose-range of the anti-MICA mAbs. After two washes in staining buffer, cells were stained for 30 min at 4° C. with goat anti-mouse (H+L)-PE polyclonal antibodies (1/200). After two washes, stainings were acquired on a BD FACS Canto II and analyzed using the FlowJo software.


Results.


Antibodies 9C10, 20C6 and 16A8 bound to each of the C1R-MICA*001, C1R-MICA*004, C1R-MICA*007 and C1R-MICA*008 cells (see FIGS. 3A, 3B and 3C for antibodies 9C10, 20C6 and 16A8 respectively). However other antibodies tested were allele specific and did not recognize all of MICA*001,*004, *007 and *008. EC50 values are shown in Table C in μg/ml (calculated using a 3-parameter logistic fit).














TABLE C







C1R-MICA*01
C1R-MICA*04
C1R-MICA*07
C1R-MICA*08




















16A8
1.18
0.31
0.74
0.33


9C10
3.15
0.20
7.93
0.15


20C6
0.30
0.08
1.58
0.17









Example 5
Epitope Mapping

Binding of antibodies to epitopes on MICA was assessed using Surface Plasmon resonance (SPR).


Methods

(a) General Biacore T100 methods. SPR measurements were performed on a Biacore T100 apparatus (Biacore GE Healthcare) at 25° C. In all Biacore experiments HBS-EP+ buffer (Biacore GE Healthcare) or 10 mM sodium acetate pH 7.4, 150 mM NaCl, 0.05% P20 served as running buffer and sensorgrams were analyzed with Biaevaluation 4.1 and Biacore T100 Evaluation software. Recombinant human and mouse TLR3 were purchased from R&D Systems.


(b) Protein immobilization. Recombinant MICA-His protein (allele *001) or MICA-Fc (allele *019) was immobilized covalently to carboxyl groups in the dextran layer of a Biacore Series 5 Sensor Chip CM5 (chip). The chip surface was activated with EDC/NHS (0,2M N-ethyl-N′-(3-dimethylaminopropyl) carbodiimidehydrochloride, 0,05M N-hydroxysuccinimide (Biacore GE Healthcare)). Proteins were diluted to 10 μg/ml in coupling buffer (10 mM sodium acetate, pH 7.4) and injected until the appropriate immobilization level was reached (i.e. approximately 2000 RU for binding experiments and 600 RU for affinity experiments). Deactivation of the remaining activated groups was performed using 100 mM ethanolamine pH 8 (Biacore GE Healthcare).


(c) Antibody binding analysis was run using HBS-EP+(neutral pH). Antibodies at a concentration of 10 μg/ml were injected for 2 min at a constant flow rate of 10 μl/min over the immobilized proteins and allowed to dissociate for 3 min before regeneration by a ten second injection of 10 mM NaOH, 500 mM NaCl regeneration buffer. Blank correction was performed on line by co-injecting the soluble antibodies onto the reference dextran flow cell.


(d) Competition assay. Flow rate was set to 10 μl/min, the first antibody (biotin-tagged) at a concentration of 50 μg/ml was injected for 2 min, 3 times successively in order to saturate the MICA-Fc or MICA-His surface. The second antibody (naked) was then injected for 2 min also at 50 μg/ml and allowed to dissociate for 3 min before regeneration by a 15 second injection of 10 mM NaOH, 500 mM NaCl regeneration buffer. Blank correction was also performed on line and the curve using the saturating antibody (or nucleic acid) followed by an injection of buffer subtracted to remove the signal due to the dissociation of the first complex. The resulting signal was compared to that obtained by the injection of the second antibody directly onto the MICA surface.


Results.


Antibodies 9C10, 16A8, BAMO1 and BAMO3, as well as various other antibodies from immunizations 1 and 2, were used to shift 9C10-Biot, 16A8-Biot or other biotinylated antibodies from immunizations 1 and 2 bound on MICA-Fc or MICA-His proteins. It was observed that while various epitopes on MICA were identified by the different antibodies, 9C10, 20C6 and 16A8 appear to recognize regions on MICA that are distinct from those recognized by BAMO1 and BAMO3.


Example 6
9C10, 20C6 and 16A8 Maintain CD16-Independent NKG2D-Mediated Killing of Target Cells

The ability of anti-MICA antibodies to block the NKG2D-MICA interaction was assessed. Antibodies were tested for the ability to reduce or inhibit the NKG2D+ CD16-NK92 cell-mediated killing of MICA*019-transfected BaF/3 by measuring target cell release of 51Cr. The in vitro cytotoxicity assay was carried out by standard methods that are well known in the art, as described for example in Coligan et al., eds., Current Protocols in Immunology, Greene Publishing Assoc. and Wiley Interscience, N.Y., (1992, 1993). The MICA-expressing target cells were labeled with 51Cr prior to addition of NK cell line, and then the killing was estimated as proportional to the release of 51Cr from the cells to the medium, as a result of killing. Addition of an agent that reduces binding or blocks an interaction between MICA and NKG2D resulted in prevention of the initiation and propagation of activatory signalling via NKG2D. Therefore addition of such agents results in decreases in NK-mediated killing of the target cells. Results are shown in FIG. 4. 20C6, 16A8 and 9C10 do not block NKG2D-mediated killing.


Example 7
9C10, 20C6 and 16A8 are Able to Kill MICA Expressing Targets Via CDC

Antibodies 20C6, 9C10, and 16A8, murine IgG1, IgG2b and IgG2a isotypes, respectively, were tested for its ability to mediate CDC towards RMA tumor cells transfected with various MICA constructs. MICA constructs transfected as indicated in RMA cells were described in Waldhauer et al (2008, Cancer Research 68(15):6368-6376). Briefly, complete alleles of MICA*01 or MICA*08 as well as a MICA*01 MUT2D mutant resistant to shedding were transfected into RMA cells. These three transfectants express MICA at their cell surface. MICA*01 extracellular domain only (MICA*01 soluble) was also transfected; in such RMA transfectants there is no cell surface MICA expression but detectable soluble MICA in the cell culture supernatants.


50 μl of 20 μg/ml antibodies (2× concentrated) diluted were provided in standard medium a White clear bottom P96 wells (Ref 655098—Greiner), to which were added 50 μl of a cell suspension at 2 million per ml (100,000 cells per well) in standard medium, and incubated for 30 min at 4° C. 5 μl per well of freshly reconstituted complement (Ref CL3441—Cedarlan) was added, followed by incubation 1H at 37° C. 100 μl per well of Cell Titer Glo (Ref G7572—Promega) was added followed by incubation 10 min at room temperature protect from light. Results were read using a luminometer (VICTOR).


Results are shown in FIG. 5. The results show viability of indicated RMA-MICA cells, in the presence of complement. The results show that 9C10 and 16A8 cause a decrease in cell viability compared to 20C6 (murine IgG1 are not capable of mediating complement dependent cytotoxicity.) and the positive control (complement only) and thereby mediate CDC.


Example 8
9C10, 20C6 and 16A8 are Able to Kill MICA Expressing Targets Via ADCC

Antibodies 9C10, 20C6 and 16A8 were tested for its ability to mediate ADCC towards RMA tumor cells transfected with MICA*001 (RMA-MICA*001).


Briefly, the cytolytic activity of human NK cell line KHYG-1 was assessed in a classical 4-h 31Cr-release assay in 96 well plates V from (Greiner). Briefly, RMA-MICA*001 cells were labelled with 51Cr (100 μCi (3.7 MBq)/1×106 cells), then mixed with KHYG-transfected with mFcγRIV (to bind murine IgG) at an effector/target ratio equal to 10, in the presence of antibody at a concentration of 10 μg/mL). After brief centrifugation and 4 hours of incubation at 37° C., 50 μL supernatant were removed, and the 51Cr release was measured with a TopCount NXT beta detector (PerkinElmer Life Sciences, Boston, Mass.). All experimental groups were analyzed in triplicate, and the percentage of specific lysis was determined as follows: 100×(mean cpm experimental release−mean cpm spontaneous release)/(mean cpm total release−mean cpm spontaneous release). Percentage of total release obtained by lysis of target cells with 2% Triton X100 (Sigma).


Results are shown in FIG. 6. 9C10 and 16A8 each induced specific lysis of RMA-MICA*001 cells by human NK cells compared to negative controls (either no antibody or 20C6 (the second bar from left in FIG. 6) anti-MICA antibody of mIgG1 isotype)), thereby showing that these antibodies induce ADCC toward MICA-expressing target cells.


Example 9
Inhibition of MICA Shedding

Anti-α3 domain 16A8 antibody was compared to commercially available BAMO3 (see Salih et at (2003), supra) for its capacity to block MICA shedding. A mix of C1R-MICA*01 and C1R-MICA*04 cells were washed in PBS 1× to remove soluble MICA present in the culture and then cultured overnight in complete medium in the presence or absence of a dose range (0/1/3/10/30 μg/ml) of 16A8 or BAM03. Then cell culture supernatants were harvested and tested in ELISA for the presence of soluble MICA. Neither 16A8 nor BAMO3 are interfering with the anti-MICA antibodies used in the ELISA (data not shown). Overnight incubation of the cells with BAMO3 results in a decrease of the soluble MICA concentration in the supernatant whereas 16A8 does not induce a decrease of the soluble MICA. Results are shown in FIG. 7, showing an inhibition of the MICA shedding mediated by BAMO3 but not by 16A8.


Example 10
9C10, 20C6 and 16A8 Show Efficacy in Mice Receiving RMA-MICA Xenografts

Antibodies were tested in a mouse short-term RMA rejection tumor model in which RMA-MICA cells are controlled through NKG2D on effector cells. C57BI/6 mice (Ly5.2+) were pooled in groups and treated either with vehicle (PBS) or antibody 9C10 or mlgG2b isotype control (500 μg/mouse, IP) 3 hours before injection of RMA-MICA*07 cells on day 0. RMA-MICA*07 were cultured in complete RPMI 1640 culture medium containing supplemented with 10% of Fetal Bovine Serum Heat Inactivated, 1% L-glutamine and without antibodies. All cells were counted in Malassez with trypan blue. Each mouse received an injection of a 1:4 mixture of cells (4 million Ly5.1 splenocytes and 16 million RMA-MICA PKH26 cells) in 100 μl/PBS 1×/IV with a needle 30 G. Mice were sacrificed at 48 hours and cell survival was analyzed in the liver and lungs on day 2. The percentage of RMA-MICA*07 was recorded in each individual mouse to assess whether RMA-MICA cells are preferentially eliminated upon antibody treatment.


Results in Liver were assessed, shown in FIG. 8, where percentage of RMA-MICA*07 within liver cells were analyzed by flow cytometry. Mice treated with antibody 9C10 showed a lower percentage of RMA-MICA*07 within liver cells compared to vehicle or isotype control. Three independent experiments were pooled after elimination of outliers with a Grubb's test, each dot represents one mouse. A 1-way ANOVA was performed to compare the three treatments.


All headings and sub-headings are used herein for convenience only and should not be construed as limiting the invention in any way. Any combination of the above-described elements in all possible variations thereof is encompassed by the invention unless otherwise indicated herein or otherwise clearly contradicted by context. Recitation of ranges of values herein are merely intended to serve as a shorthand method of referring individually to each separate value falling within the range, unless otherwise indicated herein, and each separate, value is incorporated into the specification as if it were individually recited herein. Unless otherwise stated, all exact values provided herein are representative of corresponding approximate values (e. g., all exact exemplary values provided with respect to a particular factor or measurement can be considered to also provide a corresponding approximate measurement, modified by “about,” where appropriate).


All methods described herein can be performed in any suitable order unless otherwise indicated herein or otherwise clearly contradicted by context.


The use of any and all examples, or exemplary language (e.g., “such as”) provided herein is intended merely to better illuminate the invention and does not pose a limitation on the scope of the invention unless otherwise indicated. No language in the specification should be construed as indicating any element is essential to the practice of the invention unless as much is explicitly stated.


The citation and incorporation of patent documents herein is done for convenience only and does not reflect any view of the validity, patentability and/or enforceability of such patent documents, The description herein of any aspect or embodiment of the invention using terms such as reference to an element or elements is intended to provide support for a similar aspect or embodiment of the invention that “consists of”, “consists essentially of” or “substantially comprises” that particular element or elements, unless otherwise stated or clearly contradicted by context (e. g. , a composition described herein as comprising a particular element should be understood as also describing a composition consisting of that element, unless otherwise stated or clearly contradicted by context).


This invention includes all modifications and equivalents of the subject matter recited in the aspects or claims presented herein to the maximum extent permitted by applicable law.


All publications and patent applications cited in this specification are herein incorporated by reference in their entireties as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.


Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to one of ordinary skill in the art in light of the teachings of this invention that certain changes and modifications may be made thereto without departing from the spirit or scope of the appended claims.

Claims
  • 1-47. (canceled)
  • 48. A monoclonal antibody that binds to a cell surface bound MICA polypeptide comprising an amino acid sequence of SEQ ID NO: 1, a cell surface bound MICA polypeptide comprising an amino acid sequence of SEQ ID NO: 2, and a cell surface bound MICA polypeptide comprising an amino acid sequence of SEQ ID NO: 4.
  • 49. The antibody of claim 48, wherein said antibody is characterized by an EC50, as determined by flow cytometry, of no more than 5 μg/ml, for binding to cells made to express at their surface a MICA polypeptide comprising an amino acid sequence of SEQ ID NO: 1, cells made to express at their surface a MICA polypeptide comprising an amino acid sequence of SEQ ID NO: 2, and cells made to express at their surface a MICA polypeptide comprising an amino acid sequence of SEQ ID NO: 4.
  • 50. The antibody of claim 48, wherein said antibody further binds to a MICA polypeptide comprising an amino acid sequence of SEQ ID NO: 3.
  • 51. The antibody of claim 48, wherein said antibody further binds to a MICB polypeptide comprising an amino acid sequence of SEQ ID NO: 6.
  • 52. The antibody of claim 48, wherein said antibody binds to an alpha 1 and/or alpha 2 domain of the MICA polypeptide of SEQ ID NO: 1.
  • 53. The antibody of claim 52, wherein said antibody does not inhibit the ability of MICA to induce NKG2D activity in a NKG2D-expressing cell.
  • 54. The antibody of claim 53, wherein said antibody has reduced binding to a mutant MICA polypeptide comprising a mutation at: (a) 1, 2, 3, 4 or more residues selected from the group consisting of Q48, W49, E51, D52, V53 and L54;(b) 1, 2, 3, 4 or more residues selected from the group consisting of K81, D82, Q83, K84, H109, Y111, D113, L116, S133, R134, T137, M140, N141, R143 and N144;(c) 1, 2, 3, 4 or more residues selected from the group consisting of K81, D82, Q83, K84, H109, Y111, D113, L116, Q131, S132, Q136, M140, N141, R143 and N144;(d) 1, 2, 3, 4 or more residues selected from the group consisting of R6, N8, E97, H99, E100, D101, N102, 5103, T104, R105, E115, L178, R179 and R180; or
  • 55. The antibody of claim 54, wherein said antibody competes for binding to a MICA polypeptide of SEQ ID NO 1 with an antibody selected from the group consisting of: (a) an antibody having respectively a VH and VL region of SEQ ID NOS: 7 and 8 (6E4);(b) (a) an antibody having respectively a VH and VL region of SEQ ID NOS: 20 and 21 (20C6);(c) an antibody having respectively a VH and VL region of SEQ ID NOS: 79 and 80 (10A7); and(d) an antibody having respectively a VH and VL region of SEQ ID NOS: 112 and 113 (15F9).
  • 56. The antibody of claim 52, wherein said antibody blocks the interaction of MICA with NKG2D.
  • 57. The antibody of claim 56, wherein said antibody has reduced binding to a mutant MICA polypeptide comprising a mutation at: (a) 1, 2, 3, 4 or more residues selected from the group consisting of N56, K57, T58, R61 and R64; or(b) 1, 2, 3, 4 or more residues selected from the group consisting of E100, D101, N102, S103, T104, R105, N121, E123, T124 and E126;
  • 58. The antibody of claim 57, wherein said antibody competes for binding to a MICA polypeptide of SEQ ID NO 1 with an antibody selected from the group consisting of: (a) an antibody having respectively a VH and VL region of SEQ ID NOS: 46 and 47 (19E9); or(b) an antibody having respectively a VH and VL region of SEQ ID NOS: 57 and 58 (9C10).
  • 59. The antibody of claim 48, wherein said antibody comprises a human heavy chain constant region that binds a human FcγIIIA receptor.
  • 60. The antibody of claim 48, wherein said antibody is conjugated or covalently bound to a toxic agent.
  • 61. A monoclonal antibody that binds a human MICA polypeptide of SEQ ID NO: 1, wherein said antibody does not block the interaction of MICA with NKG2D and does not block shedding of MICA from a MICA-expressing cell.
  • 62. A monoclonal antibody that binds a human MICA polypeptide of SEQ ID NO: 1, wherein said antibody inhibits sMICA-induced downmodulation of NKG2D expression on the surface of an immune effector cell without blocking shedding of MICA from a MICA-expressing cell.
  • 63. A monoclonal antibody that binds to an alpha 1 and/or alpha 2 domain of the MICA polypeptide of SEQ ID NO: 1, wherein said antibody does not block the interaction of MICA with NKG2D and/or does not inhibit the ability of MICA to induce NKG2D activity in a NKG2D-expressing cell.
  • 64. A monoclonal antibody that binds to an alpha 3 domain of the MICA polypeptide of SEQ ID NO: 1, wherein said antibody blocks the interaction of MICA with NKG2D.
  • 65. A monoclonal antibody selected from the group consisting of: (a) monoclonal antibody comprising (i) a heavy chain comprising CDR 1, 2 and 3 of the heavy chain variable region of SEQ ID NO: 7 and (ii) a light chain comprising CDR 1, 2 and 3 of the light chain variable region of SEQ ID NO: 8;(b) monoclonal antibody comprising (i) a heavy chain comprising CDR 1, 2 and 3 of the heavy chain variable region of SEQ ID NO: 20 and (ii) a light chain comprising CDR 1, 2 and 3 of the light chain variable region of SEQ ID NO: 21;(c) monoclonal antibody comprising (i) a heavy chain comprising CDR 1, 2 and 3 of the heavy chain variable region of SEQ ID NO: 46 and (ii) a light chain comprising CDR 1, 2 and 3 of the light chain variable region of SEQ ID NO: 47;(d) monoclonal antibody comprising (i) a heavy chain comprising CDR 1, 2 and 3 of the heavy chain variable region of SEQ ID NO: 57 and (ii) a light chain comprising CDR 1, 2 and 3 of the light chain variable region of SEQ ID NO: 58;(e) monoclonal antibody comprising (i) a heavy chain comprising CDR 1, 2 and 3 of the heavy chain variable region of SEQ ID NO: 79 and (ii) a light chain comprising CDR 1, 2 and 3 of the light chain variable region of SEQ ID NO: 80; and(f) monoclonal antibody comprising (i) a heavy chain comprising CDR 1, 2 and 3 of the heavy chain variable region of SEQ ID NO: 112 and (ii) a light chain comprising CDR 1, 2 and 3 of the light chain variable region of SEQ ID NO: 113.
  • 66. A pharmaceutical composition comprising an antibody of claim 48, and a pharmaceutically acceptable carrier.
  • 67. A hybridoma or recombinant host cell producing the antibody of claim 48.
  • 68. A method for the treatment or prevention of a cancer in a patient in need thereof, the method comprising administering to said patient an effective amount a composition of claim 66.
  • 69. A method for identifying a MICA-expressing cell in a subject, the method comprising obtaining a biological sample from a subject comprising cells, bringing said cells into contact with an antibody of claim 48 and assessing whether the antibody binds to the cells.
  • 70. The method of claim 69, wherein said method is free of an additional prior step of determining whether said subject, said disease-related cells or said tumor cells comprise a MICA allele selected from the group consisting of MICA*001, MICA*004, MICA*007 and MICA*008.
PCT Information
Filing Document Filing Date Country Kind
PCT/EP2013/052439 2/7/2013 WO 00
Provisional Applications (2)
Number Date Country
61595902 Feb 2012 US
61625841 Apr 2012 US