The present invention relates to polypeptides. In particular, the present invention relates to modified multabody constructs, compositions, and methods.
Therapeutics based on antibodies or antibody fragments are being developed for a variety of uses, e.g., for treating various diseases or conditions.
However, antibody-based therapeutics may need to be tuned so that they have desirable characteristics (for example, desirable biodistribution, half-lives, etc.) after administration to a subject. Some antibody-based therapeutics have a format that differs from that of a native immunoglobulin molecule. For example, in some therapeutics, an antibody or antibody fragment is fused to another polypeptide; in some, the antibody or antibody fragment(s) is in a configuration or has a valence not found in nature. These antibody-based therapeutics may also need to be tuned.
Thus, there remains a need for optimized antibody-based therapeutics.
In accordance with an aspect, there is provided a fusion protein comprising a nanocage monomer or subunit thereof linked to an Fc polypeptide,
In an aspect, the IgG4 Fc chain comprises a mutation at positions 234 and 235.
In an aspect, the IgG4 Fc chain comprises an F234A mutation and an L235A mutation.
In an aspect, the IgG4 Fc chain comprises a mutation at position 228.
In an aspect, the IgG4 Fc chain comprises an S228P mutation.
In an aspect, the IgG4 Fc chain comprises a mutation at positions 237 and 238.
In an aspect, the IgG4 Fc chain comprises a G237A mutation and a P238S mutation.
In an aspect, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, and an L235A mutation.
In an aspect, the IgG4 Fc chain does not comprise a mutation at G237 or at P238.
In an aspect, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation.
In an aspect, the IgG4 Fc chain comprises an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation.
In an aspect, the IgG4 Fc chain does not comprise a mutation at S228.
In an aspect, the nanocage monomer or subunit thereof is a ferritin monomer or subunit thereof.
In an aspect, the ferritin monomer or subunit thereof is a ferritin light chain or subunit thereof.
In an aspect, the ferritin monomer or subunit thereof is a human ferritin or subunit thereof.
In an aspect, the ferritin monomer or subunit thereof is a ferritin monomer subunit.
In an aspect, the ferritin monomer subunit is a C-half ferritin.
In an aspect, the Fc polypeptide is linked to the C-half ferritin's N-terminus.
In an aspect, the Fc polypeptide is linked to the C-half ferritin's N-terminus via an amino acid linker.
In an aspect, the amino acid linker comprises a (GnS)m linker.
In an aspect, the (GnS)m linker is a (GGGGS)m linker.
In an aspect, the Fc polypeptide comprises a single chain Fc (scFc) comprising two Fc chains, wherein the two Fc chains are linked via an amino acid linker.
In an aspect, the amino acid linker that links the two Fc chains comprises a (GnS)m linker.
In an aspect, the (GnS)m linker is a (GGGGS)m linker.
In accordance with an aspect, there is provided a self-assembled polypeptide complex comprising:
In an aspect, the nanocage monomer or subunit thereof of each second fusion polypeptide is a ferritin monomer or subunit thereof.
In an aspect, the ferritin monomer or subunit thereof is a ferritin light chain or subunit thereof.
In an aspect, the ferritin monomer or subunit thereof is a human ferritin or subunit thereof.
In an aspect, the self-assembled polypeptide complex does not comprise any ferritin heavy chains or subunits of ferritin heavy chains.
In an aspect, within each second fusion polypeptide, the antigen-binding moiety is linked to the nanocage monomer or subunit thereof via an amino acid linker.
In an aspect, the amino acid linker comprises a (GnS)m linker.
In an aspect, the (GnS)m linker is a (GGGGS)m linker.
In an aspect, the antigen-binding moiety of each second fusion polypeptide is linked to the N-terminus of nanocage monomer or subunit thereof.
In an aspect, the antigen-binding moiety of each second fusion polypeptide is an Fab fragment.
In an aspect, each second fusion polypeptide does not comprise any antibody CH2 or CH3 domains.
In an aspect, the self-assembled polypeptide complex further comprises a plurality of third fusion polypeptides, each third fusion polypeptide comprising an antigen-binding moiety linked to a nanocage monomer or a subunit thereof, wherein the third fusion polypeptide is different than the second fusion polypeptide.
In an aspect, the antigen-binding moiety of each third fusion polypeptide is an Fab fragment.
In an aspect, each third fusion polypeptide does not comprise any antibody CH2 or CH3 domains.
In an aspect, the nanocage monomer or subunit thereof of each first fusion polypeptide and each second fusion polypeptide is a ferritin monomer subunit, and
In an aspect, the self-assembled polypeptide complex is characterized by a 1:1 ratio of first fusion polypeptides to second fusion polypeptides.
In an aspect, the self-assembled polypeptide complex comprises a total of 24 to 48 fusion polypeptides.
In an aspect, the self-assembled polypeptide complex comprises a total of least 24 fusion polypeptides.
In an aspect, the self-assembled polypeptide complex comprises a total of at least 32 fusion polypeptides.
In an aspect, the self-assembled polypeptide complex has a total of about 32 fusion polypeptides.
In an aspect, the self-assembled polypeptide complex exhibits binding to hFcRn.
In an aspect, the self-assembled polypeptide complex exhibits binding to hFcRn that is substantially similar to IgG binding to hFcRn, such as IgG1 or IgG4.
In an aspect, the self-assembled polypeptide complex exhibits no binding to at least one human Fcγ receptor, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits no binding to one or more human Fcγ receptors selected from the group consisting of hFcγRI, hFcγRIIa, hFcγRIIb, hFcγRIIIa, hFcγRIIIb, and combinations thereof, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits no binding to hFcγRI, hFcγRIIa, and hFcγRIIb, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits substantially no IgG4 effector functions.
In an aspect, the self-assembled polypeptide complex exhibits binding to at least one human Fcγ receptor, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits binding to one or more human Fcγ receptors selected from the group consisting of hFcγRI, hFcγRIIa, hFcγRIIb, hFcγRIIIa, hFcγRIIIb, and combinations thereof, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits binding to hFcγRI, hFcγRIIa, and hFcγRIIb, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits antibody effector functions, such as IgG effector functions.
In an aspect, the self-assembled polypeptide complex exhibits IgG4 effector functions.
In accordance with an aspect, there is provided a composition comprising a plurality of the self-assembled polypeptide complexes described herein.
In an aspect, the composition comprises a mixture of different self-assembled polypeptide complexes.
In accordance with an aspect, there is provided a method comprising administering a composition comprising the self-assembled polypeptide complex described herein to a mammalian subject.
In an aspect, the subject is human.
In an aspect, the subject has or is at risk of developing cancer.
In an aspect, the subject has or is at risk of developing an autoimmune disorder.
In an aspect, the subject has or is at risk of developing an infectious disease.
In an aspect, the subject has or is at risk of developing a metabolic disorder.
In an aspect, the method comprises administration by a systemic route.
In an aspect, the systemic route comprises subcutaneous, intravenous, or intramuscular injection, inhalation, or intranasal administration.
In accordance with an aspect, there is provided a use of a composition comprising the self-assembled polypeptide complex described herein for administration to a mammalian subject.
In an aspect, the subject is human.
In an aspect, the subject has or is at risk of developing cancer.
In an aspect, the subject has or is at risk of developing an autoimmune disorder.
In an aspect, the subject has or is at risk of developing an infectious disease.
In an aspect, the use is for administration by a systemic route.
In an aspect, the systemic route comprises subcutaneous, intravenous, or intramuscular injection, inhalation, or intranasal administration.
In accordance with an aspect, there is provided a composition comprising the self-assembled polypeptide complex described herein for use in administration to a mammalian subject.
In an aspect, the subject is human.
In an aspect, the subject has or is at risk of developing cancer.
In an aspect, the subject has or is at risk of developing an autoimmune disorder.
In an aspect, the subject has or is at risk of developing an infectious disease.
In an aspect, the composition is for administration by a systemic route.
In an aspect, the systemic route comprises subcutaneous, intravenous, or intramuscular injection, inhalation, or intranasal administration.
In accordance with an aspect, there is provided a self-assembled polypeptide complex comprising:
In an aspect, the IgG4 Fc chain comprises a mutation at positions 234 and 235.
In an aspect, the IgG4 Fc chain comprises an F234A mutation and an L235A mutation.
In an aspect, the IgG4 Fc chain comprises a mutation at position 228.
In an aspect, the IgG4 Fc chain comprises an S228P mutation.
In an aspect, the IgG4 Fc chain comprises a mutation at positions 237 and 238.
In an aspect, the IgG4 Fc chain comprises a G237A mutation and a P238S mutation.
In an aspect, the IgG4 Fc chain does not comprise a mutation at G237 or at P238.
In an aspect, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, and an L235A mutation.
In an aspect, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation.
In an aspect, the IgG4 Fc chain comprises an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation.
In an aspect, the IgG4 Fc chain does not comprise a mutation at S228.
In an aspect, the nanocage monomer or subunit thereof is a ferritin monomer or subunit thereof.
In an aspect, the ferritin monomer or subunit thereof is a ferritin light chain or subunit thereof.
In an aspect, the ferritin monomer or subunit thereof is a human ferritin or subunit thereof.
In an aspect, the ferritin monomer or subunit thereof is a ferritin monomer subunit.
In an aspect, the ferritin monomer subunit is a C-half ferritin.
In an aspect, the Fc polypeptide is linked to the C-half ferritin's N-terminus.
In an aspect, the Fc polypeptide is linked to the C-half ferritin's N-terminus via an amino acid linker.
In an aspect, the amino acid linker comprises a (GnS)m linker.
In an aspect, the (GnS)m linker is a (GGGGS)m linker.
In an aspect, the Fc polypeptide comprises a single chain Fc (scFc) comprising two Fc chains, wherein the two Fc chains are linked via an amino acid linker.
In an aspect, the amino acid linker that links the two Fc chains comprises a (GnS)m linker.
In an aspect, the (GnS)m linker is a (GGGGS)m linker.
In an aspect, the SARS-CoV-2 binding moiety targets the SARS-CoV-2 S glycoprotein.
In an aspect, the SARS-CoV-2 binding moiety decorates the interior and/or exterior surface, preferably the exterior surface, of the assembled nanocage.
In an aspect, the SARS-CoV-2 binding moiety comprises an antibody or fragment thereof.
In an aspect, the antibody or fragment thereof comprises a Fab fragment.
In an aspect, the antibody or fragment thereof comprises a scFab fragment, a scFv fragment, a sdAb fragment, a VHH domains or a combination thereof.
In an aspect, the antibody or fragment thereof comprises a heavy and/or light chain of a Fab fragment.
In an aspect, the SARS-CoV-2 binding moiety comprises single chain variable domain VHH-72, BD23 and/or 4A8.
In an aspect, the SARS-CoV-2 binding moiety comprises an mAb listed in Table 4.
In an aspect, the SARS-CoV-2 binding moiety comprises mAb 298, 324, 46, 80, 52, 82, or 236 from Table 4, or variants thereof.
In an aspect, the SARS-CoV-2 binding moiety comprises mAb 298, 80, and 52 from Table 4, or variants thereof.
In an aspect, the SARS-CoV-2 binding moiety is linked at the N- or C-terminus of the nanocage monomer, or wherein there is a first SARS-CoV-2 binding moiety linked at the N-terminus and a second SARS-CoV-2 binding moiety linked at the C-terminus of the nanocage monomer, wherein the first and second SARS-CoV-2 binding moieties are the same or different.
In an aspect, the nanocage monomer comprises a first nanocage monomer subunit linked to the SARS-CoV-2 binding moiety; wherein the first nanocage monomer subunit self-assembles with a second nanocage monomer subunit to form the nanocage monomer.
In an aspect, the SARS-CoV-2 binding moiety is linked at the N- or C-terminus of the first nanocage monomer, or wherein there is a first SARS-CoV-2 binding moiety linked at the N-terminus and a second SARS-CoV-2 binding moiety linked at the C-terminus of the first nanocage monomer subunit, wherein the first and second SARS-CoV-2 binding moieties are the same or different.
In an aspect, the self-assembled polypeptide complex exhibits binding to hFcRn.
In an aspect, the self-assembled polypeptide complex exhibits binding to hFcRn that is substantially similar to IgG binding to hFcRn, such as IgG1 or IgG4.
In an aspect, the self-assembled polypeptide complex exhibits no binding to at least one human Fcγ receptor, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits no binding to one or more human Fcγ receptors selected from the group consisting of hFcγRI, hFcγRIIa, hFcγRIIb, hFcγRIIIa, hFcγRIIIb, and combinations thereof, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits no binding to hFcγRI, hFcγRIIa, and hFcγRIIb, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits substantially no IgG4 effector functions.
In an aspect, the self-assembled polypeptide complex exhibits binding to at least one human Fcγ receptor, as determined in an in vitro assay.
In an aspect, self-assembled polypeptide complex of claim 42, which exhibits binding to one or more human Fcγ receptors selected from the group consisting of hFcγRI, hFcγRIIa, hFcγRIIb, hFcγRIIIa, hFcγRIIIb, and combinations thereof, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits binding to hFcγRI, hFcγRIIa, and hFcγRIIb, as determined in an in vitro assay.
In an aspect, the self-assembled polypeptide complex exhibits antibody effector functions, such as IgG effector functions.
In an aspect, the self-assembled polypeptide complex exhibits IgG4 effector functions.
In accordance with an aspect, there is provided a composition comprising a plurality of the self-assembled polypeptide complexes described herein.
In an aspect, the composition comprises a mixture of different self-assembled polypeptide complexes.
In accordance with an aspect, there is provided a SARS-CoV-2 therapeutic or prophylactic composition comprising the self-assembled polypeptide complex described herein.
In accordance with an aspect, there is provided a method for treating and/or preventing SARS-CoV-2, the method comprising administering the self-assembled polypeptide complex described herein to a subject in need thereof.
In accordance with an aspect, there is provided a use of the self-assembled polypeptide complex described herein for treating and/or preventing SARS-CoV-2.
In an aspect, the self-assembled polypeptide complex is for use in treating and/or preventing SARS-CoV-2.
The novel features of the present invention will become apparent to those of skill in the art upon examination of the following detailed description of the invention. It should be understood, however, that the detailed description of the invention and the specific examples presented, while indicating certain aspects of the present invention, are provided for illustration purposes only because various changes and modifications within the spirit and scope of the invention will become apparent to those of skill in the art from the detailed description of the invention and claims that follow.
The present invention will be further understood from the following description with reference to the Figures, in which:
Unless otherwise explained, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Definitions of common terms in molecular biology may be found in Benjamin Lewin, Genes V, published by Oxford University Press, 1994 (ISBN 0-19-854287-9); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0-632-02182-9); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8). Although any methods and materials similar or equivalent to those described herein can be used in the practice for testing of the present invention, the typical materials and methods are described herein. In describing and claiming the present invention, the following terminology will be used.
It is also to be understood that the terminology used herein is for the purpose of describing particular aspects only, and is not intended to be limiting. Many patent applications, patents, and publications are referred to herein to assist in understanding the aspects described. Each of these references are incorporated herein by reference in their entirety.
In understanding the scope of the present application, the articles “a”, “an”, “the”, and “said” are intended to mean that there are one or more of the elements. Additionally, the term “comprising” and its derivatives, as used herein, are intended to be open ended terms that specify the presence of the stated features, elements, components, groups, integers, and/or steps, but do not exclude the presence of other unstated features, elements, components, groups, integers and/or steps. The foregoing also applies to words having similar meanings such as the terms, “including”, “having” and their derivatives.
It will be understood that any aspects described as “comprising” certain components may also “consist of” or “consist essentially of,” wherein “consisting of” has a closed-ended or restrictive meaning and “consisting essentially of” means including the components specified but excluding other components except for materials present as impurities, unavoidable materials present as a result of processes used to provide the components, and components added for a purpose other than achieving the technical effect of the invention. For example, a composition defined using the phrase “consisting essentially of” encompasses any known acceptable additive, excipient, diluent, carrier, and the like. Typically, a composition consisting essentially of a set of components will comprise less than 5% by weight, typically less than 3% by weight, more typically less than 1%, and even more typically less than 0.1% by weight of non-specified component(s).
It will be understood that any component defined herein as being included may be explicitly excluded from the claimed invention by way of proviso or negative limitation. For example, in some aspects the nanocages and/or fusion proteins described herein may exclude a ferritin heavy chain and/or may exclude an iron-binding component.
In addition, all ranges given herein include the end of the ranges and also any intermediate range points, whether explicitly stated or not.
Terms of degree such as “substantially”, “about” and “approximately” as used herein mean a reasonable amount of deviation of the modified term such that the end result is not significantly changed. These terms of degree should be construed as including a deviation of up to and including at least ±5% of the modified term if this deviation would not negate the meaning of the word it modifies. For example, the term “about” may encompass a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less of the referred value.”
The abbreviation, “e.g.” is derived from the Latin exempli gratia, and is used herein to indicate a non-limiting example. Thus, the abbreviation “e.g.” is synonymous with the terms “for example,” or “such as.” The word “or” is intended to include “and” unless the context clearly indicates otherwise.
The term “subject” as used herein refers to any member of the animal kingdom, typically a mammal. The term “mammal” refers to any animal classified as a mammal, including humans, other higher primates, domestic and farm animals, and zoo, sports, or pet animals, such as dogs, cats, cattle, horses, sheep, pigs, goats, rabbits, etc. Typically, the mammal is human.
The terms “protein nanoparticle,” “nanocage,” and “multabody” are used interchangeably herein and refer to a multi-subunit, protein-based polyhedron shaped structure. The subunits or nanocage monomers are each composed of proteins or polypeptides (for example a glycosylated polypeptide), and, optionally of single or multiple features of the following: nucleic acids, prosthetic groups, organic and inorganic compounds. Non-limiting examples of protein nanoparticles include ferritin nanoparticles (see, e.g., Zhang, Y. Int. J. Mol. Sci., 12:5406-5421, 2011, incorporated by reference herein), encapsulin nanoparticles (see, e.g., Sutter et al., Nature Struct, and Mol. Biol., 15:939-947, 2008, incorporated by reference herein), Sulfur Oxygenase Reductase (SOR) nanoparticles (see, e.g., Urich et al., Science, 311:996-1000, 2006, incorporated by reference herein), lumazine synthase nanoparticles (see, e.g., Zhang et al., J. Mol. Biol., 306: 1099-1114, 2001) or pyruvate dehydrogenase nanoparticles (see, e.g., Izard et al., PNAS 96: 1240-1245, 1999, incorporated by reference herein). Ferritin, apoferritin, encapsulin, SOR, lumazine synthase, and pyruvate dehydrogenase are monomeric proteins that self-assemble into a globular protein complexes that in some cases consists of 24, 60, 24, 60, and 60 protein subunits, respectively. Ferritin and apoferritin are generally referred to interchangeably herein and are understood to both be suitable for use in the fusion proteins, nanocages, and methods described herein. Carboxysome, vault proteins, GroEL, heat shock protein, E2P and MS2 coat protein also produce nanocages are contemplated for use herein. In addition, fully or partially synthetic self-assembling monomers are also contemplated for use herein.
It will be understood that each nanocage monomer may be divided into two or more subunits that will self-assemble into a functional nanocage monomer. For example, ferritin or apoferritin may be divided into an N- and C-subunit, e.g., an N- and C-subunit obtained by dividing full-length ferritin substantially in half, so that each subunit may be separately bound to a different binding moiety, such as an antigen binding moiety or bioactive moiety for subsequent self-assembly into a nanocage monomer and then a nanocage. Each subunit may, in aspects, bind a binding moiety and/or bioactive moiety at both termini, either the same or different By “functional nanocage monomer” it is intended that the nanocage monomer is capable of self-assembly with other such monomers into a nanocage as described herein.
The terms “ferritin” and “apoferritin” are used interchangeably herein and generally refer to a polypeptide (e.g., a ferritin chain) that is capable of assembling into a ferritin complex which typically comprises 24 protein subunits. It will be understood that the ferritin can be from any species. Typically, the ferritin is a human ferritin. In some embodiments, the ferritin is a wild-type ferritin. For example, the ferritin may be a wild-type human ferritin. In some embodiments, a ferritin light chain is used as a nanocage monomer, and/or a subunit of a ferritin light chain is used as a nanocage monomer subunit. In some embodiments, assembled nanocages do not include any ferritin heavy chains or other ferritin components capable of binding to iron.
The term “multispecific,” as used herein, refers to the characteristic of having at least two binding sites at which at least two different binding partners, e.g., an antigen or receptor (e.g., Fc receptor), can bind. For example, a nanocage that comprises at least two Fab fragments, wherein each of the two Fab fragments binds to a different antigen, is “multispecific.” As an additional example, a nanocage that comprises an Fc fragment (which is capable of binding to an Fc receptor) and an Fab fragment (which is capable of binding to an antigen) is “multispecific.”
The term “multivalent,” as used herein, refers to the characteristic of having at least two binding sites at which a binding partner, e.g., an antigen or receptor (e.g., Fc receptor), can bind. The binding partners that can bind to the at least two binding sites may be the same or different.
The term “antibody”, also referred to in the art as “immunoglobulin” (Ig), used herein refers to a protein constructed from paired heavy and light polypeptide chains; various Ig isotypes exist, including IgA, IgD, IgE, IgG, such as IgG1, IgG2, IgG3, and IgG4, and IgM. It will be understood that the antibody may be from any species, including human, mouse, rat, monkey, llama, or shark. When an antibody is correctly folded, each chain folds into a number of distinct globular domains joined by more linear polypeptide sequences. For example, in the case of IgGs, the immunoglobulin light chain folds into a variable (VL) and a constant (CL) domain, while the heavy chain folds into a variable (VH) and three constant (CH, CH2, CH3) domains. Interaction of the heavy and light chain variable domains (VH and VL) results in the formation of an antigen binding region (Fv). Each domain has a well-established structure familiar to those of skill in the art.
The light and heavy chain variable regions are responsible for binding the target antigen and can therefore show significant sequence diversity between antibodies. The constant regions show less sequence diversity, and are responsible for binding a number of natural proteins to elicit important immunological events. The variable region of an antibody contains the antigen binding determinants of the molecule, and thus determines the specificity of an antibody for its target antigen. The majority of sequence variability occurs in six hypervariable regions, three each per variable heavy and light chain; the hypervariable regions combine to form the antigen-binding site, and contribute to binding and recognition of an antigenic determinant. The specificity and affinity of an antibody for its antigen is determined by the structure of the hypervariable regions, as well as their size, shape and chemistry of the surface they present to the antigen.
An “antibody fragment” as referred to herein may include any suitable antigen-binding antibody fragment known in the art. The antibody fragment may be a naturally-occurring antibody fragment, or may be obtained by manipulation of a naturally-occurring antibody or by using recombinant methods. For example, an antibody fragment may include, but is not limited to a Fv, single-chain Fv (scFv; a molecule consisting of VL and VH connected with a peptide linker), Fc, single-chain Fc, Fab, single-chain Fab, F(ab′)2, single domain antibody (sdAb; a fragment composed of a single VL or VH), and multivalent presentations of any of these.
By the term “synthetic antibody” as used herein, is meant an antibody which is generated using recombinant DNA technology. The term should also be construed to mean an antibody which has been generated by the synthesis of a DNA molecule encoding the antibody and which DNA molecule expresses an antibody protein, or an amino acid sequence specifying the antibody, wherein the DNA or amino acid sequence has been obtained using synthetic DNA or amino acid sequence technology which is available and well known in the art.
The term “epitope” refers to an antigenic determinant. An epitope is the particular chemical groups or peptide sequences on a molecule that are antigenic, that is, that elicit a specific immune response. An antibody specifically binds a particular antigenic epitope, e.g., on a polypeptide. Epitopes can be formed both from contiguous amino acids or noncontiguous amino acids juxtaposed by tertiary folding of a protein. Epitopes formed from contiguous amino acids are typically retained on exposure to denaturing solvents whereas epitopes formed by tertiary folding are typically lost on treatment with denaturing solvents. An epitope typically includes at least 3, and more usually, at least 5, about 9, about 11, or about 8 to about 12 amino acids in a unique spatial conformation. Methods of determining spatial conformation of epitopes include, for example, x-ray crystallography and 2-dimensional nuclear magnetic resonance. See, e.g., “Epitope Mapping Protocols” in Methods in Molecular Biology, Vol. 66, Glenn E. Morris, Ed (1996).
The term “antigen” as used herein is defined as a molecule that provokes an immune response. This immune response may involve either antibody production, or the activation of specific immunologically-competent cells, or both. The skilled artisan will understand that any macromolecule, including virtually all proteins or peptides, can serve as an antigen. Furthermore, antigens can be derived from recombinant or genomic DNA. A skilled artisan will understand that any DNA, which comprises a nucleotide sequence or a partial nucleotide sequence encoding a protein that elicits an immune response therefore encodes an “antigen” as that term is used herein. Furthermore, one skilled in the art will understand that an antigen need not be encoded solely by a full length nucleotide sequence of a gene. It is readily apparent that the aspects described herein include, but are not limited to, the use of partial nucleotide sequences of more than one gene and that these nucleotide sequences could be arranged in various combinations to elicit the desired immune response. Moreover, a skilled artisan will understand that an antigen need not be encoded by a “gene” at all. It is readily apparent that an antigen can be synthesized or can be derived from a biological sample. Such a biological sample can include, but is not limited to a tissue sample, a cell, or a biological fluid.
“Encoding” refers to the inherent property of specific sequences of nucleotides in a polynucleotide, such as a gene, a cDNA, or an mRNA, to serve as templates for synthesis of other polymers and macromolecules in biological processes having either a defined sequence of nucleotides (e.g., rRNA, tRNA and mRNA) or a defined sequence of amino acids and the biological properties resulting therefrom. Thus, a gene encodes a protein if transcription and translation of mRNA corresponding to that gene produces the protein in a cell or other biological system. Both the coding strand, the nucleotide sequence of which is identical to the mRNA sequence and is usually provided in sequence listings, and the non-coding strand, used as the template for transcription of a gene or cDNA, can be referred to as encoding the protein or other product of that gene or cDNA.
The term “expression” as used herein is defined as the transcription and/or translation of a particular nucleotide sequence driven by its promoter.
“Isolated” means altered or removed from the natural state. For example, a nucleic acid or a peptide naturally present in a living animal is not “isolated,” but the same nucleic acid or peptide partially or completely separated from the coexisting materials of its natural state is “isolated.” An isolated nucleic acid or protein can exist in substantially purified form, or can exist in a non-native environment such as, for example, a host cell.
Unless otherwise specified, a “nucleotide sequence encoding an amino acid sequence” includes all nucleotide sequences that are degenerate versions of each other and that encode the same amino acid sequence. The phrase nucleotide sequence that encodes a protein or an RNA may also include introns to the extent that the nucleotide sequence encoding the protein may in some version contain an intron(s).
By the term “modulating,” as used herein, is meant mediating a detectable increase or decrease in the level of a response in a subject compared with the level of a response in the subject in the absence of a treatment or compound, and/or compared with the level of a response in an otherwise identical but untreated subject. The term encompasses perturbing and/or affecting a native signal or response thereby mediating a beneficial therapeutic response in a subject, typically, a human.
The term “operably linked” refers to functional linkage between a regulatory sequence and a heterologous nucleic acid sequence resulting in expression of the latter. For example, a first nucleic acid sequence is operably linked with a second nucleic acid sequence when the first nucleic acid sequence is placed in a functional relationship with the second nucleic acid sequence. For instance, a promoter is operably linked to a coding sequence if the promoter affects the transcription or expression of the coding sequence. Generally, operably linked DNA sequences are contiguous and, where necessary to join two protein coding regions, in the same reading frame.
“Parenteral” administration of composition includes, e.g., subcutaneous (s.c.), intravenous (i.v.), intramuscular (i.m.), or intrasternal injection, or infusion techniques. Also included are inhalation and intranasal administration.
The term “polynucleotide” as used herein is defined as a chain of nucleotides. Furthermore, nucleic acids are polymers of nucleotides. Thus, nucleic acids and polynucleotides as used herein are interchangeable. One skilled in the art has the general knowledge that nucleic acids are polynucleotides, which can be hydrolyzed into the monomeric “nucleotides.” The monomeric nucleotides can be hydrolyzed into nucleosides. As used herein polynucleotides include, but are not limited to, all nucleic acid sequences which are obtained by any means available in the art, including, without limitation, recombinant means, i.e., the cloning of nucleic acid sequences from a recombinant library or a cell genome, using ordinary cloning technology and PCR, and the like, and by synthetic means.
As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein's or peptide's sequence. Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. “Polypeptides” include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others. The polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
By the term “specifically binds,” as used herein with respect to an antibody, is meant an antibody which recognizes a specific antigen, but does not substantially recognize or bind other molecules in a sample. For example, an antibody that specifically binds to an antigen from one species may also bind to that antigen from one or more species. But, such cross-species reactivity does not itself alter the classification of an antibody as specific. In another example, an antibody that specifically binds to an antigen may also bind to different allelic forms of the antigen. However, such cross reactivity does not itself alter the classification of an antibody as specific. In some instances, the terms “specific binding” or “specifically binding,” can be used in reference to the interaction of an antibody, a protein, or a peptide with a second chemical species, to mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If an antibody is specific for epitope “A”, the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled “A” and the antibody, will reduce the amount of labeled A bound to the antibody.
As used herein, the phrases “does not bind,” “non-binding” or “no binding,” or similar phrases, between two entities refers to 1) a lack of detectable binding or 2) binding below a set threshold that corresponds to no binding in an appropriate assay, e.g., an in vitro binding assay such as biolayer interferometry. For example, in some embodiments, in an in vitro biolayer interferometry assay, a maximal association binding response of less than 0.1 nm after 180 seconds to a biosensor loaded with 0.8 nm of target when the test article is present at a concentration of 20 nM is classified as “non-binding.”
The terms “therapeutically effective amount”, “effective amount” or “sufficient amount” mean a quantity sufficient, when administered to a subject, including a mammal, for example a human, to achieve a desired result, for example an amount effective to cause a protective immune response. Effective amounts of the compounds described herein may vary according to factors such as the molecule, age, sex, species, and weight of the subject. Dosage or treatment regimens may be adjusted to provide the optimum therapeutic response, as is understood by a skilled person. For example, administration of a therapeutically effective amount of the fusion proteins described herein is, in aspects, sufficient to treat and/or prevent COVID-19.
Moreover, a treatment regime of a subject with a therapeutically effective amount may consist of a single administration, or alternatively comprise a series of applications. The frequency and length of the treatment period depends on a variety of factors, such as the molecule, the age of the subject, the concentration of the agent, the responsiveness of the patient to the agent, or a combination thereof. It will also be appreciated that the effective dosage of the agent used for the treatment may increase or decrease over the course of a particular treatment regime. Changes in dosage may result and become apparent by standard diagnostic assays known in the art. The fusion proteins described herein may, in aspects, be administered before, during or after treatment with conventional therapies for the disease or disorder in question. For example, the fusion proteins described herein may find particular use in combination with conventional treatments for viral infections.
The term “transfected” or “transformed” or “transduced” as used herein refers to a process by which exogenous nucleic acid is transferred or introduced into the host cell. A “transfected” or “transformed” or “transduced” cell is one which has been transfected, transformed or transduced with exogenous nucleic acid. The cell includes the primary subject cell and its progeny.
The phrase “under transcriptional control” or “operatively linked” as used herein means that the promoter is in the correct location and orientation in relation to a polynucleotide to control the initiation of transcription by RNA polymerase and expression of the polynucleotide.
A “vector” is a composition of matter which comprises an isolated nucleic acid and which can be used to deliver the isolated nucleic acid to the interior of a cell. Numerous vectors are known in the art including, but not limited to, linear polynucleotides, polynucleotides associated with ionic or amphiphilic compounds, plasmids, and viruses. Thus, the term “vector” includes an autonomously replicating plasmid or a virus. The term should also be construed to include non-plasmid and non-viral compounds which facilitate transfer of nucleic acid into cells, such as, for example, polylysine compounds, liposomes, and the like. Examples of viral vectors include, but are not limited to, adenoviral vectors, adeno-associated virus vectors, retroviral vectors, and the like.
Administration “in combination with” one or more further therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.
The term “pharmaceutically acceptable” means that the compound or combination of compounds is compatible with the remaining ingredients of a formulation for pharmaceutical use, and that it is generally safe for administering to humans according to established governmental standards, including those promulgated by the United States Food and Drug Administration.
The term “pharmaceutically acceptable carrier” includes, but is not limited to solvents, dispersion media, coatings, antibacterial agents, antifungal agents, isotonic and/or absorption delaying agents and the like. The use of pharmaceutically acceptable carriers is well known.
“Variants” are biologically active fusion proteins, antibodies, or fragments thereof having an amino acid sequence that differs from a comparator sequence by virtue of an insertion, deletion, modification and/or substitution of one or more amino acid residues within the comparative sequence.
Variants generally have less than 100% sequence identity with the comparative sequence. Ordinarily, however, a biologically active variant will have an amino acid sequence with at least about 70% amino acid sequence identity with the comparative sequence, such as at least about 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity. The variants include peptide fragments of at least 10 amino acids that retain some level of the biological activity of the comparator sequence. Variants also include polypeptides wherein one or more amino acid residues are added at the N- or C-terminus of, or within, the comparative sequence. Variants also include polypeptides where a number of amino acid residues are deleted and/or optionally substituted by one or more amino acid residues. Variants also may be covalently modified, for example by substitution with a moiety other than a naturally occurring amino acid or by modifying an amino acid residue to produce a non-naturally occurring amino acid.
“Percent amino acid sequence identity” is defined herein as the percentage of amino acid residues in the candidate sequence that are identical with the residues in the sequence of interest, such as the polypeptides of the invention, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. None of N-terminal, C-terminal, or internal extensions, deletions or insertions into the candidate sequence shall be construed as affecting sequence identity or homology. Methods and computer programs for the alignment are well known in the art, such as “BLAST”.
“Active” or “activity” for the purposes herein refers to a biological and/or an immunological activity of the fusion proteins described herein, wherein “biological” activity refers to a biological function (either inhibitory or stimulatory) caused by the fusion proteins.
The fusion proteins described herein may include modifications. Such modifications include, but are not limited to, conjugation to an effector molecule. Modifications further include, but are not limited to conjugation to detectable reporter moieties. Modifications that extend half-life (e.g., pegylation) are also included. Modifications for de-immunization are also included. Proteins and non-protein agents may be conjugated to the fusion proteins by methods that are known in the art. Conjugation methods include direct linkage, linkage via covalently attached linkers, and specific binding pair members (e.g., avidin-biotin). Such methods include, for example, that described by Greenfield et al., Cancer Research 50, 6600-6607 (1990), which is incorporated by reference herein and those described by Amon et al., Adv. Exp. Med. Biol. 303, 79-90 (1991) and by Kiseleva et al, Mol. Biol. (USSR)25, 508-514 (1991), both of which are incorporated by reference herein.
Described herein are fusion proteins. The fusion proteins comprise a nanocage monomer or subunit thereof linked to an Fc polypeptide. A plurality of the fusion proteins self-assemble to form a nanocage. In this way, the Fc polypeptide may decorate the interior surface of the assembled nanocage, the exterior surface of the assembled nanocage, or both. The Fc polypeptide typically comprises an IgG4 Fc chain with a mutation at one or more of positions 228, 234, 235, 237, and 238, according to EU numbering.
In certain aspects, the nanocage monomer described herein may be split into subunits, allowing for more Fc polypeptides or other moieties to be attached thereto in various ratios. For example, in aspects, the nanocage monomer comprises a first nanocage monomer subunit linked to the Fc polypeptide. In use, the first nanocage monomer subunit self-assembles with a second nanocage monomer subunit to form the nanocage monomer. As described above, a plurality of the nanocage monomers self-assemble to form a nanocage. The nanocage monomer subunits may be provided alone or in combination and may have the same or a different Fc polypeptides fused thereto.
A nanocage made from the nanocage monomers and/or nanocage monomer subunits described herein may have bioactive moieties, such as binding moieties, such as antigen-binding moieties included in addition to one or more Fc polypeptides. The bioactive moieties may be any moieties. Typically, they are antigen-binding moieties and thereby target particular diseases or conditions, such as cancer, an autoimmune disorder, an infectious disease, or a metabolic disorder for example. The subject may have the disease or condition in question or may be at risk of the disease or condition.
For example, the Fc polypeptide may comprise, for example, one or both chains of an Fc fragment. The Fc fragment may be derived from any type of antibody as will be understood but is, typically, an IgG4 Fc fragment. The Fc fragment may further comprise one or more mutations, such as a mutation at one or more of positions 228, 234, 235, 237, and 238, according to EU numbering, that modulate the half-life and/or effector functions of the fusion protein and/or the resulting assembled nanocage comprising the fusion protein. For example, the half-life may be in the scale of minutes, days, weeks, or even months.
Moreover, other substitutions in the fusion proteins and nanocages described herein are contemplated, including Fc sequence modifications and addition of other agents (e.g. human serum albumin peptide sequences), that allow changes in bioavailability and will be understood by a skilled person. Furthermore, the fusion proteins and nanocages described herein can be modulated in sequence or by addition of other agents to mute immunogenicity and anti-drug responses (therapeutic, e.g. matching sequence to host, or addition of immunosuppressive therapies [such as, for example, methotrexate when administering infliximab for treating rheumatoid arthritis or induction of neonatal tolerance, which is a primary strategy in reducing the incidence of inhibitors against FVIII (reviewed in: DiMichele D M, Hoots W K, Pipe S W, Rivard G E, Santagostino E. International workshop on immune tolerance induction: consensus recommendations. Haemophilia. 2007; 13:1-22, incorporated herein by reference in its entirety]).
For example, disclosed herein are fusion proteins comprising a nanocage monomer or subunit thereof linked to an Fc polypeptide. In some embodiments, the Fc polypeptide comprises one or more human IgG4 Fc chains that is, except for mutations noted herein, the Fc polypeptide comprises an Fc chain that is substantially similar to that of the Fc chains within a wild type human IgG4.
In some embodiments, the wild type IgG4 Fc is a human IgG4 Fc, in which each Fc chain has an amino acid sequence of SEQ ID NO:66.
For example, an Fc polypeptide may comprise an Fc chain with an amino acid sequence that is at least 85%, at least 87.5%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to that of an Fc chain within a wild-type IgG4 Fc. In some embodiments, an Fc polypeptide comprises an Fc chain that comprises the particular residue(s) at certain position(s) specifically described for that Fc chain, but has an amino acid sequence that is otherwise 100% identical to a corresponding Fc chain within a wild type Fc chain, e.g., wild type IgG4 Fc chain. In some embodiments, the Fc polypeptide comprises an Fc chain that has an amino acid sequence that differs by at least one, at least two, at least three, or at least four amino acid residues from the sequence of SEQ ID NO:66. In some embodiments, the Fc polypeptide comprises an Fc chain that has an amino acid sequence that differs by no more than ten, no more than nine, no more than eight, no more than seven, no more than six, no more than five, or no more than four amino acid residues from the sequence of SEQ ID NO:66. In some embodiments, the Fc polypeptide comprises an Fc chain that differs by three, four, or five amino acid residues from the sequence of SEQ ID NO:66.
In some embodiments, the Fc polypeptide is a single chain Fc (scFc), which comprises two Fc chains linked together by a covalent linker, e.g., via an amino acid linker.
In certain embodiments, fragment crystallizable (Fc) regions, such as IgG4 Fc chains, comprise a mutation at one or more of positions 228, 234, 235, 237, and 238, according to EU numbering. In some embodiments, the IgG4 Fc chain comprises a mutation at positions 234 and 235. In some embodiments, the IgG4 Fc chain comprises an F234A mutation and an L235A mutation. In some embodiments, the IgG4 Fc chain comprises a mutation at position 228. In some embodiments, the IgG4 Fc chain comprises an S228P mutation. In some embodiments, the IgG4 Fc chain comprises a mutation at positions 237 and 238. In some embodiments, the IgG4 Fc chain comprises a G237A mutation and a P238S mutation. In some embodiments, the IgG4 Fc chain does not comprise a mutation at G237 or at P238. In some embodiments, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, and an L235A mutation. In some embodiments, the IgG4 Fc chain comprises an S228P mutation, an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation. In some embodiments, the IgG4 Fc chain comprises an F234A mutation, an L235A mutation, a G237A mutation, and a P238S mutation. In some embodiments, the IgG4 Fc chain does not comprise a mutation at S228. Unless otherwise noted, numbering of mutations throughout this disclosure is according to the EU index.
In some embodiments, the Fc region is an IgG4 Fc region, (e.g., a human IgG4 Fc region), that is, except for mutations noted herein, the Fc region comprises a Fc chains that each have an amino acid sequence that is substantially similar to that of the chains within a wild type IgG4 Fc. In some embodiments, the wild type reference IgG4 Fc is a human IgG4 Fc, in which each Fc chain has an amino acid sequence of SEQ ID NO: 24.
For example, an IgG4 Fc region may comprise an Fc chain with an amino acid sequence that is at least 85%, at least 87.5%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to that of an Fc chain within a wild-type IgG4 Fc. In some embodiments, an IgG4 Fc region comprises an Fc chain that comprises the Fc mutations specifically described for that IgG4 Fc region, but has an amino acid sequence that is otherwise 100% identical to an Fc chain within a wild type IgG4 Fc.
In some embodiments, the Fc region is a single chain Fc (scFc), which comprises two Fc chains linked together by a covalent linker, e.g., via an amino acid linker. In some embodiments, the Fc region is an Fc monomer, which comprises a single Fc chain.
In cases where the antibody or fragment thereof comprises two chains, such as a first and second chain in the case of a Fc fragment, or a heavy and light chain, the two chains are optionally separated by a linker. The linker may be flexible or rigid, but it typically flexible to allow the chains to fold appropriately. The linker is generally long enough to impart some flexibility to the fusion protein, although it will be understood that linker length will vary depending upon the nanocage monomer and bioactive moiety sequences and the three-dimensional conformation of the fusion protein. Thus, the linker is typically from about 1 to about 130 amino acid residues, such as from about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, or 125 to about 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, or 130 amino acid residues, such as from about 50 to about 90 amino acid residues, such as 70 amino acid residues.
The linker may be of any amino acid sequence and, in one typical example, the linker comprises a GGS repeat and, more typically, the linker comprises about 2, 3, 4, 5, or 6 GGS repeats, such as about 4 GGS repeats. In specific aspects, the linker comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to:
In certain embodiments, linkers are used within fusion polypeptides and/or within single-chain molecules such as scFcs. In some embodiments, the linker is an amino acid linker. For example, a linker as employed herein may comprise from about 1 to about 100 amino acid residues, e.g., about 1 to about 70, about 2 to about 70, about 1 to about 30, or about 2 to about 30 amino acid residues. In some embodiments, the linker comprises at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, or at least 10 amino acid residues.
In certain embodiments, the linker comprises a glycine-serine sequence, e.g., a (GnS)m sequence (e.g., GGS, GGGS, or GGGGS sequence) that is present in at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, or at least 14 copies within the linker.
In typical aspects, the antibody or fragment thereof binds specifically to an antigen associated with SARS-CoV-2. Typically, the antigen is associated with SARS-CoV-2 and the antibody or fragment thereof comprises, for example, a binding domain from Table 4, such as binding domain 298, 52, 46, 80, 82, 236, 324 or combinations thereof.
In some embodiments, the binding moiety is an antigen-binding antibody fragment that comprises a heavy chain variable region (e.g., a VH or VHH). In certain embodiments, the antigen-binding antibody fragment comprises a heavy chain variable domain (e.g., VH) and a light chain variable domain (e.g., a VL or VK). In certain embodiments, the antigen-binding antibody fragment comprises an Fab which comprises a heavy chain variable domain (e.g., VH) and a light chain variable domain (e.g., a VL or VK).
In some embodiments, the antigen-binding antibody fragment comprises a VH heavy chain variable domain and a VK light chain variable domain. In some embodiments, the antigen-binding antibody fragment comprises an Fab which comprises a VH heavy chain variable domain and VK a light chain variable domain.
In a specific example, the antibody or fragment thereof comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to one or more of the following sequences:
or combinations thereof.
In further aspects, the antibody or fragment thereof is conjugated to or associated with a further moiety, such as a detectable moiety (e.g., a small molecule, fluorescent molecule, radioisotope, or magnetic particle), a pharmaceutical agent, a diagnostic agent, or combinations thereof and may comprise, for example, an antibody-drug conjugate.
In aspects wherein the bioactive moiety is a detectable moiety, the detectable moiety may comprise a fluorescent protein, such as GFP, EGFP, Ametrine, and/or a flavin-based fluorescent protein, such as a LOV-protein, such as iLOV.
In aspects wherein the bioactive moiety is a pharmaceutical agent, the pharmaceutical agent may comprise for example, a small molecule, peptide, lipid, carbohydrate, or toxin.
In typical aspects, the nanocage assembled from the fusion proteins described herein comprises from about 3 to about 100 nanocage monomers, such as from about 3, 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 55, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, or 98 to about 4, 5, 6, 7, 8, 9, 10, 12, 14, 16, 18, 20, 22, 24, 26, 28, 30, 32, 34, 36, 38, 40, 42, 44, 46, 48, 50, 52, 55, 56, 58, 60, 62, 64, 66, 68, 70, 72, 74, 76, 78, 80, 82, 84, 86, 88, 90, 92, 94, 96, 98, or 100 nanocage monomers, such as 24, 32, or 60 monomers. The nanocage monomer may be any known nanocage monomer, natural, synthetic, or partly synthetic and is, in aspects, selected from ferritin, apoferritin, encapsulin, SOR, lumazine synthase, pyruvate dehydrogenase, carboxysome, vault proteins, GroEL, heat shock protein, E2P, MS2 coat protein, fragments thereof, and variants thereof. Typically, the nanocage monomer is ferritin or apoferritin.
When apoferritin is chosen as the nanocage monomer, typically the first and second nanocage monomer subunits interchangeably comprise the “N” and “C” regions of apoferritin. It will be understood that other nanocage monomers can be divided into bipartite subunits much like apoferritin as described herein so that the subunits self-assemble and are each amenable to fusion with a bioactive moiety.
In some embodiments, the nanocage monomer is a ferritin monomer. The term “ferritin monomer,” is used herein to refer to a single chain of a ferritin that, in the presence of other ferritin chains, is capable of self-assembling into a polypeptide complex comprising a plurality of ferritin chains. In some embodiments, ferritin chains self-assembled into a polypeptide complex comprising 24 or more ferritin chains. In some embodiments, the ferritin monomer is a ferritin light chain. In some embodiments, the ferritin monomer does not include a ferritin heavy chain or other ferritin components capable of binding to iron.
In some embodiments, each fusion polypeptide within the self-assembled polypeptide complex comprises a ferritin light chain or a subunit of a ferritin light chain. In these embodiments, the self-assembled polypeptide complex does not comprise any ferritin heavy chains or subunits of ferritin heavy chains.
In some embodiments, the ferritin monomer is a human ferritin chain, e.g., a human ferritin light chain, e.g., a human ferritin light chain having the sequence of at least residues 2-175 of SEQ ID NO:1. In some embodiments, the ferritin monomer is a mouse ferritin chain.
A “subunit” of a ferritin monomer refers to a portion of a ferritin monomer that is capable of spontaneously associating with another, distinct subunit of a ferritin monomer, so that the subunits together form a ferritin monomer, which ferritin monomer, in turn, is capable of self-assembling with other ferritin monomers to form a polypeptide complex.
In some embodiments, the ferritin monomer subunit comprises approximately half of a ferritin monomer. As used herein, the term “N-half ferritin” refers to approximately half of a ferritin chain, which half comprises the N-terminus of the ferritin chain. As used herein, the term “C-half ferritin” refers to approximately half a ferritin chain, which half comprises the C-terminus of the ferritin chain. The exact point at which a ferritin chain may be divided to form the N-half ferritin and the C-half ferritin may vary depending on the embodiment. In the context of ferritin monomer subunits based on human ferritin light chain, for example, the halves may divided at a point that corresponds to a position between about position 75 to about position 100 of SEQ ID NO:1. For example, in some embodiments, an N-half ferritin based on a human ferritin light chain has an amino acid sequence corresponding to residues 1-95 of SEQ ID NO:1 (or a substantial portion thereof), and a C-half ferritin based on a human ferritin light chain has an amino acid sequence corresponding to residues 96-175 of SEQ ID NO:1 (or a substantial portion thereof).
In some embodiments, the halves are divided at a point that corresponds to a position between about position 85 to about position 92 of SEQ ID NO:1. For example, in some embodiments, an N-half ferritin based on a human ferritin light chain has an amino acid sequence corresponding to residues 1-90 of SEQ ID NO:1 (or a substantial portion thereof), and a C-half ferritin based on a human ferritin light chain has an amino acid sequence corresponding to residues 91-175 of SEQ ID NO:1 (or a substantial portion thereof).
Typically, the “N” region of apoferritin comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to:
Typically, the “C” region of apoferritin comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to:
In aspects, the fusion protein described herein, further comprises a linker between the nanocage monomer subunit and the bioactive moiety, much like the linker described above. Again, the linker may be flexible or rigid, but it typically flexible to allow the bioactive moiety to retain activity and to allow the pairs of nanocage monomer subunits to retain self-assembly properties. The linker is generally long enough to impart some flexibility to the fusion protein, although it will be understood that linker length will vary depending upon the nanocage monomer and bioactive moiety sequences and the three-dimensional conformation of the fusion protein. Thus, the linker is typically from about 1 to about 30 amino acid residues, such as from about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, or 29 to about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 amino acid residues, such as from about 8 to about 16 amino acid residues, such as 8, 10, or 12 amino acid residues.
The linker may be of any amino acid sequence and, in one typical example, the linker comprises a GGS repeat and, more typically, the linker comprises about 2, 3, 4, 5, or 6 GGS repeats, such as about 4 GGS repeats. In specific aspects, the linker comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to:
Similarly, the fusion protein may further comprising a C-terminal linker for improving one or more attributes of the fusion protein. In aspects, the comprises a GGS repeat and, more typically, the linker comprises about 2, 3, 4, 5, or 6 GGS repeats, such as about 4 GGS repeats. In specific aspects, the C-terminal linker comprises or consists of a sequence at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to:
Also described herein is a pair of the fusion proteins described above, wherein the pair self-assembles to form a nanocage monomer, wherein the first and second nanocage monomer subunits are fused to the same or different moieties, such as different antigen binding moieties or different Fc polypeptides, or different combinations thereof. This provides multivalency and/or multispecificity to a single nanocage monomer assembled from the pair of subunits.
A substantially identical sequence may comprise one or more conservative amino acid mutations. It is known in the art that one or more conservative amino acid mutations to a reference sequence may yield a mutant peptide with no substantial change in physiological, chemical, or functional properties compared to the reference sequence; in such a case, the reference and mutant sequences would be considered “substantially identical” polypeptides. Conservative amino acid mutation may include addition, deletion, or substitution of an amino acid; a conservative amino acid substitution is defined herein as the substitution of an amino acid residue for another amino acid residue with similar chemical properties (e.g. size, charge, or polarity).
In a non-limiting example, a conservative mutation may be an amino acid substitution. Such a conservative amino acid substitution may substitute a basic, neutral, hydrophobic, or acidic amino acid for another of the same group. By the term “basic amino acid” it is meant hydrophilic amino acids having a side chain pK value of greater than 7, which are typically positively charged at physiological pH. Basic amino acids include histidine (His or H), arginine (Arg or R), and lysine (Lys or K). By the term “neutral amino acid” (also “polar amino acid”), it is meant hydrophilic amino acids having a side chain that is uncharged at physiological pH, but which has at least one bond in which the pair of electrons shared in common by two atoms is held more closely by one of the atoms. Polar amino acids include serine (Ser or S), threonine (Thr or T), cysteine (Cys or C), tyrosine (Tyr or Y), asparagine (Asn or N), and glutamine (Gln or Q). The term “hydrophobic amino acid” (also “non-polar amino acid”) is meant to include amino acids exhibiting a hydrophobicity of greater than zero according to the normalized consensus hydrophobicity scale of Eisenberg (1984). Hydrophobic amino acids include proline (Pro or P), isoleucine (Ile or 1), phenylalanine (Phe or F), valine (Val or V), leucine (Leu or L), tryptophan (Trp or W), methionine (Met or M), alanine (Ala or A), and glycine (Gly or G).
“Acidic amino acid” refers to hydrophilic amino acids having a side chain pK value of less than 7, which are typically negatively charged at physiological pH. Acidic amino acids include glutamate (Glu or E), and aspartate (Asp or D).
Sequence identity is used to evaluate the similarity of two sequences; it is determined by calculating the percent of residues that are the same when the two sequences are aligned for maximum correspondence between residue positions. Any known method may be used to calculate sequence identity; for example, computer software is available to calculate sequence identity. Without wishing to be limiting, sequence identity can be calculated by software such as NCBI BLAST2 service maintained by the Swiss Institute of Bioinformatics (and as found at ca.expasy.org/tools/blast/), BLAST-P, Blast-N, or FASTA-N, or any other appropriate software that is known in the art.
The substantially identical sequences of the present invention may be at least 85% identical; in another example, the substantially identical sequences may be at least 70, 75, 80, 85, 90, 95, 96, 97, 98, 99, or 100% (or any percentage there between) identical at the amino acid level to sequences described herein. In specific aspects, the substantially identical sequences retain the activity and specificity of the reference sequence. In a non-limiting embodiment, the difference in sequence identity may be due to conservative amino acid mutation(s).
The polypeptides or fusion proteins of the present invention may also comprise additional sequences to aid in their expression, detection or purification. Any such sequences or tags known to those of skill in the art may be used. For example, and without wishing to be limiting, the fusion proteins may comprise a targeting or signal sequence (for example, but not limited to ompA), a detection tag, exemplary tag cassettes include Strep tag, or any variant thereof; see, e.g., U.S. Pat. No. 7,981,632, His tag, Flag tag having the sequence motif DYKDDDDK, Xpress tag, Avi tag, Calmodulin tag, Polyglutamate tag, HA tag, Myc tag, Nus tag, S tag, SBP tag, Softag 1, Softag 3, V5 tag, CREB-binding protein (CBP), glutathione S-transferase (GST), maltose binding protein (MBP), green fluorescent protein (GFP), Thioredoxin tag, or any combination thereof; a purification tag (for example, but not limited to a His5 or His6), or a combination thereof.
In another example, the additional sequence may be a biotin recognition site such as that described by Cronan et al in WO 95/04069 or Voges et al in WO/2004/076670. As is also known to those of skill in the art, linker sequences may be used in conjunction with the additional sequences or tags.
More specifically, a tag cassette may comprise an extracellular component that can specifically bind to an antibody with high affinity or avidity. Within a single chain fusion protein structure, a tag cassette may be located (a) immediately amino-terminal to a connector region, (b) interposed between and connecting linker modules, (c) immediately carboxy-terminal to a binding domain, (d) interposed between and connecting a binding domain (e.g., scFv or scFab) to an effector domain, (e) interposed between and connecting subunits of a binding domain, or (f) at the amino-terminus of a single chain fusion protein. In certain embodiments, one or more junction amino acids may be disposed between and connecting a tag cassette with a hydrophobic portion, or disposed between and connecting a tag cassette with a connector region, or disposed between and connecting a tag cassette with a linker module, or disposed between and connecting a tag cassette with a binding domain.
Also encompassed herein are isolated or purified fusion proteins, polypeptides, or fragments thereof immobilized onto a surface using various methodologies; for example, and without wishing to be limiting, the polypeptides may be linked or coupled to the surface via His-tag coupling, biotin binding, covalent binding, adsorption, and the like. The solid surface may be any suitable surface, for example, but not limited to the well surface of a microtiter plate, channels of surface plasmon resonance (SPR) sensorchips, membranes, beads (such as magnetic-based or sepharose-based beads or other chromatography resin), glass, a film, or any other useful surface.
In other aspects, the fusion proteins may be linked to a cargo molecule; the fusion proteins may deliver the cargo molecule to a desired site and may be linked to the cargo molecule using any method known in the art (recombinant technology, chemical conjugation, chelation, etc.). The cargo molecule may be any type of molecule, such as a therapeutic or diagnostic agent.
In some aspects, the cargo molecule is a protein and is fused to the fusion protein such that the cargo molecule is contained in the nanocage internally. In other aspects, the cargo molecule is not fused to the fusion protein and is contained in the nanocage internally. The cargo molecule is typically a protein, a small molecule, a radioisotope, or a magnetic particle.
The fusion proteins described herein specifically bind to their targets. Antibody specificity, which refers to selective recognition of an antibody for a particular epitope of an antigen, of the antibodies or fragments described herein can be determined based on affinity and/or avidity. Affinity, represented by the equilibrium constant for the dissociation of an antigen with an antibody (KD), measures the binding strength between an antigenic determinant (epitope) and an antibody binding site. Avidity is the measure of the strength of binding between an antibody with its antigen. Antibodies typically bind with a KD of 10−5 to 10−11 M. Any KD greater than 10−4 M is generally considered to indicate non-specific binding. The lesser the value of the KD, the stronger the binding strength between an antigenic determinant and the antibody binding site. In aspects, the antibodies described herein have a KD of less than 10−4 M, 10−5 M, 10−6 M, 10−7 M, 10−8 M, 10−9 M, 10−10 M, 10−11 M, 10−12 M, 10−13 M, 10−14 M, or 10−15 M.
Also described herein are nanocages comprising at least one fusion protein described herein and at least one second nanocage monomer subunit that self-assembles with the fusion protein to form a nanocage monomer. Further, pairs of the fusion proteins are described herein, wherein the pair self-assembles to form a nanocage monomer and wherein the first and second nanocage monomer subunits are fused to different bioactive moieties.
It will be understood that the nanocages may self-assemble from multiple identical fusion proteins, from multiple different fusion proteins (and therefore be multivalent and/or multispecific), from a combination of fusion proteins and wild-type proteins, and any combination thereof. For example, the nanocages may be decorated internally and/or externally with at least one of the fusion proteins described herein in combination with at least one binding moiety. In typical aspects, from about 20% to about 80% of the nanocage monomers comprise the fusion protein described herein. In view of the modular solution described herein, the nanocages could in theory comprise up to twice as many bioactive moieties as there are monomers in the nanocage, as each nanocage monomer may be divided into two subunits, each of which can independently bind to a different bioactive moiety. It will be understood that this modularity can be harnessed to achieve any desired ratio of bioactive moieties as described herein in specific example to a 4:2:1:1 ratio of four different bioactive moieties. For example, the nanocages described herein may comprise at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 different bioactive moieties. In this way, the nanocages can be multivalent and/or multispecific and the extent of this can be controlled with relative ease.
In aspects, the nanocages described herein may further comprise at least one whole nanocage monomer, optionally fused to a bioactive moiety that may be the same or different from the bioactive moiety described herein as being linked to a nanocage monomer subunit.
In typical aspects, the nanocages described herein comprise a first, second, and third fusion protein to a subunit or the monomer, and optionally at least one whole nanocage monomer, optionally fused to a bioactive moiety, wherein the bioactive moieties of the first, second, and third fusion proteins and of the whole nanocage monomer are all different from one another.
More typically, the first, second, and third fusion proteins each comprise an antibody or Fc fragment thereof fused to N- or C-half ferritin, wherein at least one of the first, second, and third fusion proteins is fused to N-half ferritin and at least one of the first, second, and third fusion proteins is fused to C-half ferritin. For example, the antibody or fragment thereof of the first fusion protein is typically an Fc fragment; the second and third fusion proteins typically each comprise an antibody or fragment thereof specific for a different antigen and the whole nanocage monomer is fused to a bioactive moiety that is specific for another different antigen.
In aspects, the antibody or fragment thereof of the second fusion protein is 46 or 52; and the antibody or fragment thereof of the third fusion protein is 324 or 80. In a typical aspect, the nanocage described herein comprises the following four fusion proteins, optionally in a 4:2:1:1: ratio:
In aspects, the nanocage described herein comprises or consists of sequences at least 70% (such as at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or 100%) identical to one or more of the following sequences, where ferritin subunits are in bold, linkers are underlined, light chains are italicized, and heavy chains are in lowercase:
GSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGGTFS
GGGGSGGGGSGGGGSGGGGSGG
MSSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDD
VALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKK
LNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTL
RHD
GSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGGTFS
GGGGSGGGGSGGGGSGGGGSGG
SSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDV
ALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKL
NQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLR
HD
GSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGSSVKVSCKASGYTFTSYGISW
SGGGGSGGGGSGG
GKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKL
IKKMGDHLTNLHRLGGPEAGLGEYLFERLTLRHD
SGGGGSGGGGSGGGGSGGGGSGGGGSEVQLLESGGGLVQPGRSLRLSCAASGFTFSSYAMSWV
SGGGGSGGGGSGG
GKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKL
IKKMGDHLTNLHRLGGPEAGLGEYLFERLTLRHD
SGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGGTFNNYGISWV
GGSGGGGSGGGGSGGGGSGG
GKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETH
FLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLRHD
GSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGSSVKVSCKASGGTFN
GGSGGGGSGGGGSGGGGSGGGGSGG
GKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLC
DFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLRHD
In one aspect, provided are self-assembled polypeptide complexes comprising a plurality of fusion polypeptides as disclosed herein. In many embodiments, self-assembled polypeptide complexes comprise (1) a plurality of first fusion polypeptides, each first fusion polypeptide comprising an Fc region linked to a nanocage monomer (e.g., ferritin monomer, e.g., human ferritin monomer, or subunit thereof), as disclosed herein; and (2) a plurality of second fusion polypeptides, each second fusion polypeptide comprising an antigen-binding antibody fragment (e.g., an Fab fragment of an antibody that is capable of binding to a protein), the antigen-binding antibody fragment being linked to a nanocage monomer (e.g., ferritin monomer, e.g., human ferritin monomer) or subunit thereof. In some embodiments, self-assembled polypeptide complex further comprises a plurality of third fusion polypeptides, each third fusion polypeptide being distinct from the second fusion polypeptide and each comprising (1) a nanocage monomer (e.g., ferritin monomer, e.g., human ferritin monomer) linked to (2) an antigen-binding antibody fragment (e.g., Fab fragment of an antibody that is capable of binding to a protein).
In some embodiments, one of the fusion polypeptides (e.g., the first fusion polypeptide or the second fusion polypeptide) comprises an N-half nanocage monomer (e.g., an N-half ferritin) (but not a full-length nanocage (e.g., ferritin) monomer), and one of the other fusion polypeptides comprises a C-half nanocage monomer (e.g., a C-half ferritin) (but not a full-length nanocage (e.g., ferritin) monomer). In many of these embodiments, the ratio of fusion polypeptides comprising the N-half nanocage monomer (e.g., N-half ferritin) to the fusion polypeptides comprising the C-half nanocage monomer (e.g., C-half ferritin) within the self-assembled polypeptide complex is about 1:1.
In some embodiments, the self-assembled polypeptide complex comprises 24 fusion polypeptides. In some embodiments, the self-assembled polypeptide complex comprises more than 24 fusion polypeptides, e.g., at least 26, at least 28, at least 30, at least 32 fusion polypeptides, at least 34 fusion polypeptides, at least 36 fusion polypeptides, at least 38 fusion polypeptides, at least 40 fusion polypeptides, at least 42 fusion polypeptides, at least 44 fusion polypeptides, at least 46 fusion polypeptides, or at least 48 fusion polypeptides. In some embodiments, the self-assembled polypeptide complex comprises 32 fusion polypeptides.
In some embodiments, the self-assembled polypeptide complex comprises at least 4, at least 5, least 6, at least 7, or at least 8 first fusion polypeptides.
In some embodiments, the self-assembled polypeptide complex comprises at least 4, at least 5, least 6, at least 7, or at least 8 second fusion polypeptides.
In some embodiments, the self-assembled polypeptide complex further comprises at least 4, at least 5, least 6, at least 7, at least 8, at least 9, at least 10, least 11, at least 12, at least 13, at least 14, at least 15, or at least 16 third fusion polypeptides.
In some embodiments, the self-assembled polypeptide complex comprises a ratio of approximately 1:1, 1:2, 1:3, or 1:4 of first fusion polypeptides to all other fusion polypeptides.
In some embodiments, each fusion polypeptide within the self-assembled polypeptide complex comprises a ferritin light chain or a subunit of a ferritin light chain. In these embodiments, the self-assembled polypeptide complex does not comprise any ferritin heavy chains, subunits of ferritin heavy chains, or other ferritin components capable of binding to iron.
Also described herein are compositions comprising the nanocage, such as therapeutic or prophylactic compositions. Related methods and uses for treating and/or preventing COVID-19 are also described, wherein the method or use comprises administering the nanocage or composition described herein to a subject in need thereof.
Also described herein are nucleic acid molecules encoding the fusion proteins and polypeptides described herein, as well as vectors comprising the nucleic acid molecules and host cells comprising the vectors.
Polynucleotides encoding the fusion proteins described herein include polynucleotides with nucleic acid sequences that are substantially the same as the nucleic acid sequences of the polynucleotides of the present invention. “Substantially the same” nucleic acid sequence is defined herein as a sequence with at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95% identity to another nucleic acid sequence when the two sequences are optimally aligned (with appropriate nucleotide insertions or deletions) and compared to determine exact matches of nucleotides between the two sequences.
Suitable sources of polynucleotides that encode fragments of antibodies include any cell, such as hybridomas and spleen cells, that express the full-length antibody. The fragments may be used by themselves as antibody equivalents, or may be recombined into equivalents, as described above. The DNA deletions and recombinations described in this section may be carried out by known methods, such as those described in the published patent applications listed above in the section entitled “Functional Equivalents of Antibodies” and/or other standard recombinant DNA techniques, such as those described below. Another source of DNAs are single chain antibodies produced from a phage display library, as is known in the art.
Additionally, expression vectors are provided containing the polynucleotide sequences previously described operably linked to an expression sequence, a promoter and an enhancer sequence. A variety of expression vectors for the efficient synthesis of antibody polypeptide in prokaryotic, such as bacteria and eukaryotic systems, including but not limited to yeast and mammalian cell culture systems have been developed. The vectors of the present invention can comprise segments of chromosomal, non-chromosomal and synthetic DNA sequences.
Any suitable expression vector can be used. For example, prokaryotic cloning vectors include plasmids from E. coli, such as colEI, pCRI, pBR322, pMB9, pUC, pKSM, and RP4. Prokaryotic vectors also include derivatives of phage DNA such as M13 and other filamentous single-stranded DNA phages. An example of a vector useful in yeast is the 2p plasmid. Suitable vectors for expression in mammalian cells include well-known derivatives of SV-40, adenovirus, retrovirus-derived DNA sequences and shuttle vectors derived from combination of functional mammalian vectors, such as those described above, and functional plasmids and phage DNA
Additional eukaryotic expression vectors are known in the art (e.g., P J. Southern & P. Berg, J. Mol. Appl. Genet, 1:327-341 (1982); Subramani et al, Mol. Cell. Biol, 1: 854-864 (1981); Kaufinann & Sharp, “Amplification And Expression of Sequences Cotransfected with a Modular Dihydrofolate Reductase Complementary DNA Gene,” J. Mol. Biol, 159:601-621 (1982); Kaufhiann & Sharp, Mol. Cell. Biol, 159:601-664 (1982); Scahill et al., “Expression And Characterization Of The Product Of A Human Immune Interferon DNA Gene In Chinese Hamster Ovary Cells,” Proc. Nat'l Acad. Sci USA, 80:4654-4659 (1983); Urlaub & Chasin, Proc. Nat'l Acad. Sci USA, 77:4216-4220, (1980), all of which are incorporated by reference herein).
The expression vectors typically contain at least one expression control sequence that is operatively linked to the DNA sequence or fragment to be expressed. The control sequence is inserted in the vector in order to control and to regulate the expression of the cloned DNA sequence. Examples of useful expression control sequences are the lac system, the trp system, the tac system, the trc system, major operator and promoter regions of phage lambda, the control region of fd coat protein, the glycolytic promoters of yeast, e.g., the promoter for 3-phosphoglycerate kinase, the promoters of yeast acid phosphatase, e.g., Pho5, the promoters of the yeast alpha-mating factors, and promoters derived from polyoma, adenovirus, retrovirus, and simian virus, e.g., the early and late promoters or SV40, and other sequences known to control the expression of genes of prokaryotic or eukaryotic cells and their viruses or combinations thereof.
Also described herein are recombinant host cells containing the expression vectors previously described. The fusion proteins described herein can be expressed in cell lines other than in hybridomas. Nucleic acids, which comprise a sequence encoding a polypeptide according to the invention, can be used for transformation of a suitable mammalian host cell.
Cell lines of particular preference are selected based on high level of expression, constitutive expression of protein of interest and minimal contamination from host proteins. Mammalian cell lines available as hosts for expression are well known in the art and include many immortalized cell lines, such as but not limited to, HEK 293 cells, Chinese Hamster Ovary (CHO) cells, Baby Hamster Kidney (BHK) cells and many others. Suitable additional eukaryotic cells include yeast and other fungi. Useful prokaryotic hosts include, for example, E. coli, such as E. coli SG-936, E. coli HB 101, E. coli W3110, E. coli X1776, E. coli X2282, E. coli DHI, and E. coli MRC1, Pseudomonas, Bacillus, such as Bacillus subtilis, and Streptomyces.
These present recombinant host cells can be used to produce fusion proteins by culturing the cells under conditions permitting expression of the polypeptide and purifying the polypeptide from the host cell or medium surrounding the host cell. Targeting of the expressed polypeptide for secretion in the recombinant host cells can be facilitated by inserting a signal or secretory leader peptide-encoding sequence (See, Shokri et al, (2003) Appl Microbiol Biotechnol. 60(6): 654-664, Nielsen et al, Prot. Eng., 10:1-6 (1997); von Heinje et al., Nucl. Acids Res., 14:4683-4690 (1986), all of which are incorporated by reference herein) at the 5 end of the antibody-encoding gene of interest. These secretory leader peptide elements can be derived from either prokaryotic or eukaryotic sequences. Accordingly suitably, secretory leader peptides are used, being amino acids joined to the N-terminal end of a polypeptide to direct movement of the polypeptide out of the host cell cytosol and secretion into the medium.
The fusion proteins described herein can be fused to additional amino acid residues. Such amino acid residues can be a peptide tag to facilitate isolation, for example. Other amino acid residues for homing of the antibodies to specific organs or tissues are also contemplated.
It will be understood that a Fab-nanocage can be generated by co-transfection of HC-ferritin and LC. Alternatively, single-chain Fab-ferritin nanocages can be used that only require transfection of one plasmid. This can be done with linkers of different lengths between the LC and HC for example 60 or 70 amino acids. When single-chain Fabs are used, it can be ensured that the heavy chain and light chain are paired. Tags (e.g. Flag, HA, myc, His6×, Strep, etc.) can also be added at the N terminus of the construct or within the linker for ease of purification as described above. Further, a tag system can be used to make sure many different Fabs are present on the same nanoparticle using serial/additive affinity chromatography steps when different Fab-nanoparticle plasmids are co-transfected. This provides multi-specificity to the nanoparticles. Protease sites (e.g. TEV, 3C, etc.) can be inserted to cleave linkers and tags after expression and/or purification, if desired.
Any suitable method or route can be used to administer the fusion proteins described herein. Routes of administration include, for example, oral, intravenous, intraperitoneal, subcutaneous, or intramuscular administration.
It is understood that the fusion proteins described herein, where used in a mammal for the purpose of prophylaxis or treatment, will be administered in the form of a composition additionally comprising a pharmaceutically acceptable carrier. Suitable pharmaceutically acceptable carriers include, for example, one or more of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof. Pharmaceutically acceptable carriers may further comprise minor amounts of auxiliary substances such as wetting or emulsifying agents, preservatives or buffers, which enhance the shelf life or effectiveness of the binding proteins. The compositions of the injection may, as is well known in the art, be formulated so as to provide quick, sustained or delayed release of the active ingredient after administration to the mammal.
Although human antibodies are particularly useful for administration to humans, they may be administered to other mammals as well. The term “mammal” as used herein is intended to include, but is not limited to, humans, laboratory animals, domestic pets and farm animals.
In one aspect, provided are methods that may be useful for treating, ameliorating, or preventing a disease or condition, such as cancer, an autoimmune disorder, an infectious disease, or a metabolic disorder, generally comprising a step of administering a composition comprising a self-assembled polypeptide complex of the present disclosure to a subject.
In some embodiments, the subject is a mammal, e.g., a human.
Compositions for administration to subjects generally comprise a self-assembled polypeptide complex as disclosed herein. In some embodiments, such compositions further comprise a pharmaceutically acceptable excipient.
Compositions may be formulated for administration for any of a variety of routes of administration, including systemic routes (e.g., oral, intravenous, intraperitoneal, subcutaneous, or intramuscular administration).
The above disclosure generally describes the present invention. A more complete understanding can be obtained by reference to the following specific examples. These examples are provided for purposes of illustration only, and are not intended to be limiting unless otherwise specified. Thus, the invention should in no way be construed as being limited to the following examples, but rather, should be construed to encompass any and all variations which become evident as a result of the teaching provided herein.
The following examples do not include detailed descriptions of conventional methods, such as those employed in the construction of vectors and plasmids, the insertion of genes encoding polypeptides into such vectors and plasmids, or the introduction of plasmids into host cells. Such methods are well known to those of ordinary skill in the art and are described in numerous publications including Sambrook, J., Fritsch, E. F. and Maniatis, T. (1989), Molecular Cloning: A Laboratory Manual, 2nd edition, Cold Spring Harbor Laboratory Press, which is incorporated by reference herein.
Without further description, it is believed that one of ordinary skill in the art can, using the preceding description and the following illustrative examples, make and utilize the compounds of the present invention and practice the claimed methods. The following working examples therefore, specifically point out the typical aspects of the present invention, and are not to be construed as limiting in any way the remainder of the disclosure.
This example describes the design, expression, purification, and characterization of fusion proteins with apoferritin. Apoferritin protomers self-assemble into an octahedrally symmetric structure with an ˜6 nm hydrodynamic radius (Rh) composed of 24 identical polypeptides. The N-terminus of each apoferritin subunit points outwards of the spherical nanocage and is therefore accessible for the genetic fusion of proteins of interest. The fusion proteins were designed such that upon folding, apoferritin protomers act as building blocks that drive the multimerization of the 24 proteins fused to the apoferritin termini.
SARS-CoV-2, the virus responsible for COVID-19, has caused a global pandemic. Antibodies can be powerful biotherapeutics to fight viral infections. Here, we use the human apoferritin protomer as a modular subunit to drive oligomerization of antibody fragments and transform antibodies targeting SARS-CoV-2 into exceptionally potent neutralizers. Using this platform, half-maximal inhibitory concentration (IC50) values as low as 9×10−14 M are achieved as a result of up to 10,000-fold potency enhancements compared to corresponding IgGs. Combination of three different antibody specificities and the fragment crystallizable (Fc) domain on a single multivalent molecule conferred the ability to overcome viral sequence variability together with outstanding potency and IgG-like bioavailability. The MULTi-specific, multi-Affinity antiBODY (Multabody or MB) platform thus uniquely leverages binding avidity together with mufti-specificity to deliver ultrapotent and broad neutralizers against SARS-CoV-2. The modularity of the platform also makes it relevant for rapid evaluation against other infectious diseases of global health importance. Neutralizing antibodies are a promising therapeutic for SARS-CoV-2.
The continuous threat to public health from respiratory viruses such as the novel SARS-CoV-2 underscores the urgent need to rapidly develop and deploy prophylactic and therapeutic interventions to combat pandemics. Monoclonal antibodies (mAbs) have been used effectively for the treatment of infectious diseases as exemplified by palivizumab for the prevention of respiratory syncytial virus in high-risk infants1 or Zmapp, mAb114, and REGN-EB3 for the treatment of Ebola2. Consequently, mAbs targeting the Spike (S) protein of SARS-CoV-2 have been a focus for the development of biomedical countermeasures against COVID-19. To date, several antibodies targeting the S protein have been identified3,4,5,6,7,8,9,10,11,12,13,14,15,16,17,18,19 with bamlanivimab being the first antibody approved in the United States by the Food and Drug Administration (FDA) for the emergency treatment of SARS-CoV-2 in November 2020. Receptor binding domain (RBD)-directed mAbs that interfere with binding to angiotensin converting enzyme 2 (ACE2), the receptor for cell entry20, are usually associated with the highest neutralization potencies6,18,19.
mAbs can be isolated by B-cell sorting from infected donors, immunized animals, or by identifying binders in preassembled libraries. Despite these methodologies being robust and reliable for the discovery of virus-specific mAbs, identification of the best antibody clone is usually associated with a time-cost penalty. In addition, RNA viruses have higher mutations rates than DNA viruses and such mutations can significantly alter the potency of neutralizing antibodies. Indeed, several studies have already shown a reduction in neutralization potency from convalescent serum and resistance of certain mAbs21,22,23 to the more recent B.1.1.724, B.1.35125, and B.1.1.2826,27 variants of SARS-CoV-2. Hence, there is an unmet need for the development of a platform that bridges antibody discovery and the rapid identification and deployment of highly potent neutralizers less susceptible to viral sequence variability.
The potency of an antibody is greatly affected by its ability to simultaneously interact multiple times with its epitope28,29,30. This enhanced apparent affinity, known as avidity, has been previously reported to increase the neutralization potency of nanobodies31,32 and of IgGs over Fabs8,10,16 against SARS-CoV-2. To leverage the full power of binding avidity, we have developed an antibody-scaffold technology using the human apoferritin protomer as a modular subunit to multimerize antibody fragments and propel mAbs into ultrapotent neutralizers against SARS-CoV-2. Indeed, the resulting Multabody molecules can increase potency by up to four orders of magnitude over corresponding IgGs. In addition, we demonstrate the ability of this technology to combine three different Fab specificities to better overcome point mutations in the Spike. The Multabody offers a versatile IgG-like “plug-and-play” platform to enhance antiviral characteristics of mAbs against SARS-CoV-2, and demonstrates the power of avidity as a mechanism to be leveraged against viral pathogens.
Genes encoding VHH-human apoferritin fusion, Fc fusions, Fabs, IgG, and RBD mutants were synthesized and cloned by GeneArt (Life Technologies) into the pcDNA3.4 expression vector. All constructs were expressed transiently in HEK 293F cells (Thermo Fisher Scientific) at a density of 0.8×108 cells/mL with 50 μg of DNA per 200 mL of cells using FectoPRO (Polyplus Transfections) in a 1:1 ratio unless specified otherwise. After 6-7 days of incubation at 125 rpm oscillation at 37° C., 8% CO2, and 70% humidity in a Multitron Pro shaker (Infors HT), cell suspensions were harvested by centrifugation at 5000×g for 15 min and supernatants were filtered through a 0.22 μm Steritop filter (EMD Millipore). Fabs and IgGs were transiently expressed by co-transfecting 90 μg of the LC and the HC in a 1:2 ratio and purified using KappaSelect affinity column (GE Healthcare) and HiTrap Protein A HP column (GE Healthcare), respectively with 100 mM glycine pH 2.2 as the elution buffer. Eluted fractions were immediately neutralized with 1 M Tris-HCl, pH 9.0, and further purified using a Superdex 200 Increase size exclusion column (GE Healthcare). Fc fusions of ACE2 and VHH-72 were purified the same way as IgGs. The VHH-72 apoferritin fusion was purified by hydrophobic interaction chromatography using a HiTrap Phenyl HP column and the eluted fraction was loaded onto a Superose 6 10/300 GL size exclusion column (GE Healthcare) in 20 mM sodium phosphate pH 8.0, 150 mM NaCl. Wild type (BEI NR52309) and mutant RBDs, the prefusion S ectodomain (BEI NR52394) and Fc receptors (FcRn and FcγRI) from mouse and human were purified using a HisTrap Ni-NTA column (GE Healthcare). Ni-NTA purification was followed by Superose 6 in the case of the S trimer and Superdex 200 Increase size exclusion columns (GE Healthcare) in the case of the RBD and Fc receptors, in all cases in 20 mM phosphate pH 8.0, 150 mM NaCl buffer.
All molecules referred herein as Multabodies contain scFab and scFc fragments. The scFabs and scFc polypeptide constructs were generated using a 70 amino acid flexible linker [(GGGGS)x14] to generate heterodimers and homodimer fragments, respectively. Specifically, the C terminus of the Fab light chain is fused, through the linker, to the N terminus of the Fab heavy chain. In the case of the scFc, the two single Fc chains that form the functional homodimer Fc were fused in tandem. The individual domains are fused to apoferritin monomers with a 25 amino acid linker (GGGGS)x5. Genes encoding scFab and scFc fragments linked to half apoferritin were generated by deletion of residues 1 to 90 (C-Ferritin) and 91 to 175 (N-Ferritin) of the light chain of human apoferritin. Transient transfection of the Multabodies in HEK 293F cells were obtained by mixing 66 μg of the plasmids scFab-human apoferritin:scFc-human N-Ferritin:scFab-C-Ferritin in a 2:1:1 ratio. Addition of scFab-human apoferritin allowed efficient Multabody assembly and increased the number of Fab's compared to Fc's in the final molecule, thus favoring Fab avidity over Fc avidity. In the case of multi-specific Multabodies, a 4:2:1:1 ratio of scFab1-human apoferritin:scFc-human N-Ferritin:scFab2-C-Ferritin:scFab3-C-Ferritin was used. The DNA mixture was filtered and incubated at room temperature (RT) with 66 μl of FectoPRO before adding to the cell culture. Split Multabodies were purified by affinity chromatography using a HiTrap Protein A HP column (GE Healthcare) with 20 mM Tris pH 8.0, 3 M MgCl2 and 10% glycerol elution buffer. Fractions containing the protein were concentrated and further purified by gel filtration on a Superose 6 10/300 GL column (GE Healthcare).
Three microliters of Multabody at a concentration approximately of 0.02 mg/mL was placed on the surface of a carbon-coated copper grid that had previously been glow-discharged in air for 15 s, allowed to adsorb for 30 s, and stained with 3 μL of 2% uranyl formate. Excess stain was removed immediately from the grid using Whatman No. 1 filter paper and an additional 3 μL of 2% uranyl formate was added for 20 s. Grids were imaged with a FEI Tecnai T20 electron microscope operating at 200 kV and equipped with an Orius charge-coupled device (CCD) camera (Gatan Inc).
Direct binding kinetics measurements were conducted using an Octet RED96 BLI system (Sartorius ForteBio) in PBS pH 7.4, 0.01% BSA, and 0.002% Tween at 25° C. His-tagged RBD, SARS-CoV-2 Spike was loaded onto Ni-NTA (NTA) biosensors (Sartorius ForteBio) to reach a BLI signal response of 0.8 nm. Association rates were measured by transferring the loaded biosensors to wells containing a two-fold dilution series from 250 to 8 nM (Fabs), 125 to 4 nM (IgG), and 16 to 0.5 nM (MB). Dissociation rates were measured by dipping the biosensors into buffer-containing wells. The duration of each step was 180 s. Fc characterization in the split Multabody design was assessed by measuring binding to hFcγRI and hFcRn loaded onto Ni-NTA (NTA) biosensors following the experimental conditions and concentration ranges indicated above. To probe the theoretical capacity of the Multabodies to undergo endosomal recycling, binding to the hFcRn β2-microglobulin complex was measured at physiological (7.4) and endosomal (5.6) pH. Similarly, Fc characterization of the mouse surrogate MB was assessed by measuring binding to mFcγRI and mFcRn, pre-immobilized onto Ni-NTA (NTA) biosensors. Two-fold dilution series from 100 to 3 nM (IgG) and 10 to 0.3 nM (MB) were used. Analysis of the sensograms was performed using the Octet software, with a 1:1 fit model. Competition assays were performed in a two-step binding process. Ni-NTA biosensors preloaded with His-tagged RBD were first dipped into wells containing the primary antibody at 50 μg/mL for 180 s. After a 30 s baseline period, the sensors were dipped into wells containing the second antibody at 50 μg/ml for an additional 300 s. All incubation steps were performed in PBS pH 7.4, 0.01% BSA, and 0.002% Tween at 25° C. ACE2-Fc was used to map mAb binding to the receptor binding site.
The Rh of the Multabody was determined by dynamic light scattering (DLS) using a DynaPro Plate Reader III (Wyatt Technology). About 20 μL of the Multabody at a concentration of 1 mg/mL was added to a 384-well black, clear bottom plate (Corning) and measured at a fixed temperature of 25° C. with a duration of 5 s per read. Particle size determination and polydispersity were obtained from the accumulation of five reads using the Dynamics software (Wyatt Technology).
Aggregation temperature (Tagg) of the Multabodies and parental IgGs were determined using a UNit instrument (Unchained Labs). Samples were concentrated to 1.0 mg/mL and subjected to a thermal ramp from 25 to 95° C. with 1° C. increments. Tagg was determined as the temperature at which 50% increase in the static light scattering at a 266 nm wavelength relative to baseline was observed (i.e., the maximum value of the differential curve). The average and the standard error of two independent measurements were calculated using the UNit analysis software.
A surrogate Multabody composed of the scFab and scFc fragments of mouse HD37 (anti-hCD19) IgG2a fused to the N-terminus of the light chain of mouse apoferritin (mFerritin) was used for the study. HD37 scFab-mFerritin:Fc-mFerritin:mFerritin in a 2:1:1 ratio was transfected and purified following the procedure described above. L234A, L235A, and P329G (LALAP) mutations were introduced in the mouse IgG2a Fc-construct to silence effector functions of the Multabody48. In vivo studies were performed using 12-week-old male C57BL/6 mice purchased from Charles River (Strain code: 027), housed in individually-vented cages under 12 h light/dark cycle (7 a.m./7 p.m.) at a temperature of 21-23° C. and a humidity of 40-55%. All procedures were approved by the Local Animal Care Committee at the University of Toronto Scarborough. A single injection of ˜5 mg/kg of Multabodies or control samples (HD37 single chain IgG-IgG1 or IgG2a subtypes) and Helicobacter pylori ferritin (HpFerritin)-PfCSP malaria peptide in 200 μL of PBS (pH 7.5) were subcutaneously injected. Blood samples were collected at multiple time points and serum samples were assessed for levels of circulating antibodies and anti-drug antibodies by ELISA. Briefly, 96-well Pierce Nickel Coated Plates (Thermo Fisher) were coated with 50 μL at 0.5 μg/ml of the His6×-tagged antigen hCD19 to determine circulating HD37-specific concentrations using reagent-specific standard curves for IgGs and Multabodies. HRP-ProteinA (Invitrogen) was used to detect the levels of IgG/MBs bound (dilution 1:10,000). For anti-drug-antibody determination, Nunc MaxiSorp plates (Biolegend) were coated with a 12-mer HD37 scFab-mFerritin or with the HpFerritin-PfCSP malaria peptide. 1:100 sera dilution was incubated for 1 h at RT and further develop using HRP-ProteinA (Invitrogen) as a secondary molecule (dilution 1:10,000). The chemiluminescence signal at 450 nm was quantified using a Synergy Neo2 Multi-Mode Assay Microplate Reader (Biotek Instruments).
Eight-week-old male BALB/c mice were purchased from The Jackson Laboratory and housed in individually-vented caging. Mice were housed 14 h of light/10 h dark with phased in dawn to dusk intensity, maximum at noon at a temperature of 20-21° C. and a humidity of 40-60%. All procedures were approved by the Local Animal Care Committee at the University of Toronto. Multabodies composed of the scFab and scFc fragments of mouse HD37 IgG2a fused to the N-terminus of mouse apoferritin light chain was used for this study. HD37 IgG2a Multabody or control samples (HD37 single chain IgG2a) were fluorescently conjugated with Alexa-647 using Alexa Fluor™ 647 Antibody Labeling kit (Invitrogen) as per the manufacturer's instruction. The 15 nm gold nanoparticles labeled with Alexa Fluor™ 647 were purchased from Creative Diagnostics (GFLV-15). PerkinElmer IVIS Spectrum (PerkinElmer) was used to conduct noninvasive biodistribution experiments. BALB/c mice were injected subcutaneously into the loose skin over the shoulders with ˜5 mg/kg of the MB, HD37 IgG2a, or gold nanoparticles in 200 μL of PBS (pH 7.5) and imaged at time 0, 1 h, 6 h, 24 h, 2, 3, 4, 8, and 11 days following injection. Prior to imaging, mice were placed in an anesthesia induction chamber containing a mixture of isoflurane and oxygen for 1 min. Anesthetized mice were then placed in the prone position at the center of a built-in heated docking system within the IVIS imaging system (maintained at 37° C. and supplied with a mixture of isoflurane and oxygen). For whole body 2D imaging, mice were imaged for 1-2 s (excitation 640 nm and emission 680 nm) inside the imaging system. Data were analyzed using the IVIS software (Living Image Software for IVIS). After confirming the fluorescent signal from 2D epi-illumination images, 3D transilluminating fluorescence imaging tomography (FLIT) was performed on regions of interest using a built-in scan field of 3×3 or 3×4 transillumination positions. A series of 2D fluorescent surface radiance images were taken at various transillumination positions using an excitation of 640 and 680 nm emission. A series of CT scans were also taken at the corresponding positions. A 3D distribution map of the fluorescent signal was reconstructed by combining fluorescent signal and CT scans. Resulting 3D fluorescent images were thresholded based on the 3D images of PBS injected mice taken at the corresponding body positions. Images were mapped to the rainbow LUT in the IVIS software, with the upper end of the color scale set to 50 pmol M−1 cm−1 for mice injected with gold nanoparticles, and 1 000 pmol M−1 cm−1 for MB and IgG2a injected mice, to allow for better visualization of biodistribution over the time course. A mouse organ registration feature of the IVIS software was used as a general guideline for assessing the sample body locations from 3D images.
The commercial SuperHuman 2.0 Phage library (Distributed Bio/Charles River Laboratories) was used to identify monoclonal antibody binders to the SARS-CoV-2 RBD. For this purpose, an RBD-Fc-Avi tag construct of the SARS-CoV-2 was expressed in the EXPi-293 mammalian expression system. This protein was subsequently purified by protein G Dynabeads, biotinylated and quality-controlled for biotinylation and binding to ACE2 recombinant protein (Sino Biologics Inc). The SuperHuman 2.0 Phage library (5×1012) was heated for 10 min at 72° C. and de-selected against Protein G Dynabeads™ (Invitrogen), M-280 Streptavidin Dynabeads™ (Invitrogen), Histone from Calf Thymus (Sigma), Human IgG (Sigma) and ssDNA-Biotin NNK from Integrated DNA Technologies and DNA-Biotin NNK from Integrated DNA Technologies. Next, the library was panned against the RBD-captured by M-280 Streptavidin Dynabeads™ using an automated protocol on Kingfisher FLEX (Thermofisher). Selected phages were acid eluted from the beads and neutralized using Tris-HCl pH 7.9 (Teknova). ER2738 cells were infected with the neutralized phage pools at OD600=0.5 at a 1:10 ratio and after 40 min incubation at 37° C. and 100 rpm, the phage pools were centrifuged and incubated on agar with antibiotic selection overnight at 30° C. The rescued phages were precipitated by PEG and subjected to three additional rounds of soluble-phase automated panning. PBST/1% BSA buffer and/or PBS/1% BSA was used in the de-selection, washes and selection rounds.
Screening of Anti-SARS-CoV-2 scFvs in Bacterial PPE with SARS-CoV-2 RBD
Anti-SARS-CoV-2 RBD scFvs selected from phage display were expressed and screened using high-throughput surface plasmon resonance (SPR) on Carterra LSA Array SPR instrument (Carterra) equipped with HC200M sensor chip (Carterra) at 25° C. A V5 epitope tag was added to the scFv to enable capture via immobilized anti-V5 antibody (Abcam, Cambridge, MA) that was pre-immobilized on the chip surface by standard amine-coupling. Briefly: the chip surface was first activated by 10 min injection of a 1:1:1 (v/v/v) mixture of 0.4 M 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide hydrochloride (EDC), 0.1 M N-hydroxysulfosuccinimide (sNHS) and 0.1 M 2-(N-morpholino) ethanesulfonic acid (MES) pH 5.5. Then, 50 μg/ml of anti-V5 tag antibody prepared in 10 mM sodium acetate pH 4.3 was coupled for 14 min and the excess reactive esters were blocked with 1 M ethanolamine HCl pH 8.5 during a 10 min injection. For screening, a 384-ligand array comprising of crude bacterial periplasmic extracts (PPE) containing the scFvs (one spot per scFv) was prepared. Each extract was prepared at a twofold dilution in running buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 3 mM EDTA, and 0.01% (v/v) Tween-20 (HBSTE)) and printed on the anti-V5 surface for 15 min. SARS-CoV-2 RBD Avi Tev His tagged was then prepared at 0, 3.7, 11.1, 33.3, 100, 37, and 300 nM in 10 mM HEPES pH 7.4, 150 mM NaCl, and 0.01% (v/v) Tween-20 (HBST) supplemented with 0.5 mg/ml BSA and injected as analyte for 5 min with a 15 min dissociation time. Samples were injected in ascending concentration without any regeneration step. Binding data from the local reference spots was used to subtracted signal from the active spots and the nearest buffer blank analyte responses were subtracted to double-reference the data. The double-referenced data were fitted to a simple 1:1 Langmuir binding model in Carterra's Kinetic Inspection Tool (version October 2019). Twenty medium-affinity binders from phage display screening were selected for the present study.
SARS-CoV-2 pseudotyped viruses (PsV) were generated using an HIV-based lentiviral system49 with few modifications. Briefly, 293T cells were co-transfected with a lentiviral backbone encoding the luciferase reporter gene (BEI NR52516), a plasmid expressing the Spike (BEI NR52310) and plasmids encoding the HIV structural and regulatory proteins Tat (BEI NR52518), Gag-pol (BEI NR52517), and Rev (BEI NR52519) using BioT transfection reagent (Bioland Scientific) and following the manufacturer's instructions. 24 h post transfection at 37° C., 5 mM sodium butyrate was added to the media and the cells were incubated for an additional 24-30 h at 30° C. SARS-CoV-2 Spike mutant D614G was kindly provided by D. R. Burton (The Scripps Research Institute), SARS-COV-2 PsV variant B.1.351 was kindly provided by D. D. Ho (Columbia University) and the rest of the PsV mutants were generated using the KOD-Plus mutagenesis kit (Toyobo, Osaka, Japan) using primers described in Table 1. PsV particles were harvested, passed through 0.45 μm pore sterile filters and finally concentrated using a 100 K Amicon (Merck Millipore Amicon-Ultra 2.0 Centrifugal Filter Units).
Neutralization was determined in a single-cycle neutralization assay using 293T-ACE2 cells (BEI NR52511) and HeLa-ACE2 cells (kindly provided by D. R. Burton; The Scripps Research Institute). Cells were seeded the day before the experiment at a density of 10,000 cells/well in a 100 μl volume. In the case of 293T cells, plates where pre-coated with poly-L-lysine (Sigma-Aldrich). The day of the experiment, 50 μl of serially diluted IgGs and MB samples were incubated with 50 μl of PsV for 1 h at 37° C. After 1 h incubation, the incubated volume was added to the cells and incubated for 48 h. PsV neutralization was monitored by adding 50 μl Britelite plus reagent (PerkinElmer) to 50 μl of the cells and after 2 min incubation, the volume was transferred to a 96-well white plate (Sigma-Aldrich) and the luminescence in relative light units (RLUs) was measured using a Synergy Neo2 Multi-Mode Assay Microplate Reader (Biotek Instruments). Two to three biological replicates with two technical replicates each were performed. IC50 fold increase was calculated as:
VeroE6 cells were seeded in a 96 F plate at a concentration of 30,000/well in DMEM supplemented with 100 U Penicillin, 100 U Streptomycin, and 10% FBS. Cells were allowed to adhere to the plate and rest overnight After 24 h, fivefold serial dilutions of the IgG and MB samples were prepared in DMEM supplemented with 100 U Penicillin and 100 U Streptomycin in a 96 R plate in quadruplicates (25 μL/well). About 25 μL of SARS-CoV-2/SB2-P4-PB50 Clone 1 was added to each well at 100 TCID/well and incubated for 1 h at 37° C. with shaking every 15 min. After co-culturing, the media from the VeroE6 plate was removed, and 50 μL antibody-virus sample was used to inoculate VeroE6 cells in quadruplicates for 1 h at 37° C., 5% CO2, shaking every 15 min. After 1 h inoculation, the inoculum was removed and 200 μL of fresh DMEM supplemented with 100U Penicillin, 100U Streptomycin, and 2% FBS was added to each well. The plates were further incubated for 5 days. The cytopathic effect (CPE) was monitored and PRISM was used to calculate IC50 values. Three biological replicates with four technical replicates each were performed.
Cross-Linking of Spike Protein with Fabs 80, 298 and 324
About 100 μg of Spike trimer was mixed with 2× molar excess of Fab 80, 298, or 324 in 20 mM HEPES pH 7.0 and 150 mM NaCl. Proteins were crosslinked by addition of 0.075% (v/v) glutaraldehyde (Sigma Aldrich) and incubated at RT for 120 min. Complexes were purified via size exclusion chromatography (Superose6 Increase 10/300 GL, GE Healthcare), concentrated to 0.5 mg/mL and directly used for cryo-EM grid preparation.
About 100 μg of Fab 46 was mixed with 2× molar excess of RBD in 20 mM HEPES pH 7.0 and 150 mM NaCl. The complex was crosslinked by addition of 0.05% (v/v) glutaraldehyde (Sigma Aldrich) and incubated at RT for 45 min. The cross-linked complex was purified via size exclusion chromatography (Superdex 200 Increase 10/300 GL, GE Healthcare), concentrated to 2.0 mg/ml and directly used for cryo-EM grid preparation.
Three microliters of sample was deposited on holey gold grids prepared in-house51, which were glow-discharged in air for 15 s with a PELCO easiGlow (Ted Pella) before use. Sample was blotted for 6 s with a modified FEI Mark Ill Vitrobot (maintained at 4° C. and 100% humidity) using an offset of −5, and subsequently plunge-frozen in a mixture of liquid ethane and propane. Data were acquired at 300 kV with a Thermo Fisher Scientific Titan Krios G3 electron microscope and prototype Falcon 4 camera operating in electron counting mode at 250 frames/s. Movies were collected for 9.6 s with 29 exposure fractions, a camera exposure rate of ˜5 e−/pix/s, and total specimen exposure of ˜44 e−/Å2. No objective aperture was used. The pixel size was calibrated at 1.03 Å/pixel from a gold diffraction standard. The microscope was automated with the EPU software package and data collection were monitored with cryoSPARC Live52.
To overcome preferred orientation encountered with some of the samples, tilted data collection was employed53. For the Spike-Fab 80 complex, 820 0° tilted movies and 2790 40° tilted movies were collected. For the Spike-Fab 298 complex, 4259 0° tilted movies and 3513 40° tilted movies were collected. For the Spike-Fab 324 complex, 1098 0° tilted movies and 3380 40° tilted movies were collected. For the RBD-Fab 46 complex, 4722 0° tilted movies were collected. For 0° tilted movies, cryoSPARC patch motion correction was performed. For 40° tilted movies, Relion MotionCorr54,55. was used. Micrographs were then imported into cryoSPARC and patch CTF estimation was performed. Templates generated from 2D classification during the cryoSPARC Live session were used for template selection of particles. 2D classification was used to remove junk particle images, resulting in a dataset of 80,951 particle images for the Spike-Fab 80 complex, 203,138 particle images for the Spike-Fab 298 complex, 64,365 particle images for the Spike-Fab 324 complex, and 2,143,629 particle images for the RBD-Fab 46 complex. Multiple rounds of multi-class ab initio refinement were used to clean up the particle image stacks, and homogeneous refinement was used to obtain consensus structures. For tilted particles, particle polishing was done within Relion at this stage and reimported back into cryoSPARC. For the Spike-Fab complexes, extensive flexibility was observed. 3D variability analysis was performed56 and together with heterogeneous refinement used to classify out the different states present. Nonuniform refinement was then performed on the final set of particle images57. For the RBD-Fab 46 complex, cryoSPARC ab initio refinement with three classes was used iteratively to clean up the particle image stack. Thereafter, the particle image stack with refined Euler angles was brought into cisTEM for reconstruction56 to produce a 4.0 Å resolution map. Transfer of data between Relion and cryoSPARC was done with pyem59.
A ternary complex of 52 Fab-298 Fab-RBD was obtained by mixing 200 μg of RBD with 2× molar excess of each Fab in 20 mM Tris pH 8.0, 150 mM NaCl, and subsequently purified via size exclusion chromatography (Superdex 200 Increase 10/300 GL, GE Healthcare). Fractions containing the complex were concentrated to 7.3 mg/ml and mixed in a 1:1 ratio with 20% (w/v) 2-propanol, 20% (w/v) PEG 4000, and 0.1 M sodium citrate pH 5.6. Crystals appeared after ˜1 day and were cryoprotected in 10% (v/v) ethylene glycol before being flash-frozen in liquid nitrogen.
Data were collected on the 23-ID-D beamline at the Argonne National Laboratory Advanced Photon Source. The dataset was processed using XDS60 and XPREP. Phases were determined by molecular replacement using Phaser61 with CNTO88 Fab as a model for 52 Fab (PDB ID: 4DN3), 20358 Fab as a model for 298 Fab (PDB ID: 5CZX), and PDB ID: 6XDG as a search model for the RBD. Refinement of the structure was performed using phenix.refine62 and iterations of manual building in Coot63. PyMOL was utilized for structure analysis and figure rendering64. Access to all software was supported through SBGrid65. Representative electron density for the two Fab-RBD interfaces is shown in
The electron microscopy maps have been deposited in the Electron Microscopy Data Bank (EMDB) with accession codes EMD-22738, EMD-22739, EMD-22740, and EMD-22741 (Table 2). The crystal structure of the 298-52-RBD complex (Table 3) is available from the Protein Data Bank under accession PDB ID: 7K9Z. The sequences of the monoclonal antibodies used are provided with this paper (Table 4). Additional PDB/EMDB entries were used throughout the manuscript to perform a comparative analysis of the different epitope bins targeted by mAbs. The entries used in this analysis are: REGN10933 (PDB ID: 6XDG), CV30 (PDB ID: 6XE1), C105 (PDB ID: 6XCM), COVA2-04 (PDB ID: 7JMO), COVA2-39 (PDB ID: 7JMP), CC12.1 (PDB ID: 6XC2), BD23 (PDB ID: 7BYR), B38 (PDB ID: 7BZ5), P2C-1F11 (PDB ID: 7BWJ), 2-4 (PDB ID: 6XEY), CB6 (PDB ID: 7C01), REGN10987 (PDB ID: 6XDG), S309 (PDB ID: 6WPS, 6WPT), EY6A (PDB ID: 6ZCZ), CR3022 (PDB ID: 6YLA), H014 (PDB ID: 7CAH), 4-8 (EMDB ID: 22159), 4A8 (PDB ID: 7C2L), and 2-43 (EMDB ID: 22275).
We used the self-assembly of the light chain of human apoferritin to multimerize antigen binding moieties targeting the SARS-CoV-2 S glycoprotein. Apoferritin protomers self-assemble into an octahedrally symmetric structure with an ˜6 nm hydrodynamic radius (Rh) composed of 24 identical polypeptides33. The N terminus of each apoferritin subunit points outwards of the spherical nanocage and is therefore accessible for the genetic fusion of proteins of interest. Upon folding, apoferritin protomers act as building blocks that drive the multimerization of the 24 proteins fused to their N termini (
First, we investigated the impact of multivalency on the ability of the single chain variable domain VHH-72 to block viral infection. VHH-72 has been previously described to neutralize SARS-CoV-2 when fused to a Fc domain, but not in its monovalent format31. The light chain of human apoferritin displaying 24 copies of VHH-72 assembled into monodisperse, well-formed spherical particles (
Muitabodies have IgG-Like Properties
The Fc confers IgGs in vivo half-life and effector functions through interaction with neonatal Fc receptor (FcRn) and Fc gamma receptors (FcγR), respectively. To confer these IgG-like properties to our multimeric scaffold, we next sought to incorporate both binding moieties and Fc domains. Because a Fab is a hetero-dimer consisting of a light and a heavy chain, and the Fc is a homodimer, we created single-chain Fab (scFab) and single-chain Fc (scFc) polypeptide constructs. scFab and scFc domains were directly fused to the N terminus of the apoferritin protomer. For in vivo proof-of-principle experiments, we generated a species-matched surrogate molecule that consists of mouse light chain apoferritin fusions to a mouse scFab and a mouse scFc (IgG2a subtype). Binding kinetics showed that the resulting MB molecule binds mouse FcRn in a pH dependent manner—binding at endosomal pH (5.6) and no binding at physiological pH (7.4)—similar to the parental IgG (
In view of these favorable results for a mouse MB surrogate, we aimed to generate fully-human MBs derived from the previously reported IgG BD2312 and IgG 4A813 that target the SARS-CoV-2 spike RBD and N-terminal domain (NTD), respectively. Addition of scFcs into the MB reduces the number of scFabs that can be multimerized. In order to endow the MB platform with Fc without compromising Fab avidity and hence neutralization potency, we engineered the apoferritin protomer to accommodate more than 24 components per particle. Based on its four-helical bundle fold, the human apoferritin protomer was split into two halves: the two N-terminal α helices (N-Ferritin) and the two C-terminal α helices (C-Ferritin). In this configuration, the scFc fragment of human IgG1 and the scFab of anti-SARS-CoV-2 IgGs were genetically fused at the N terminus of each apoferritin half, respectively. Split apoferritin complementation led to hetero-dimerization of the two halves and consequently resulted in a very efficient hetero-dimerization process of the fused proteins. Co-expression of the scFab-C-Ferritin and scFc-N-Ferritin genes together with the scFab-Ferritin gene in excess resulted in a full apoferritin self-assembly that displays high numbers of scFab and low numbers of scFc on the nanocage periphery (
This split MB design forms 16 nm Rh spherical particles with an uninterrupted ring of density and regularly spaced protruding scFabs and scFc (
Binding kinetics experiments demonstrated that high binding avidity of the MB for the Spike was preserved upon addition of Fc fragments (
Fc mutations of IgG1 backbone evaluated in Multabodies include: LALAP (L234A, L235A and P329G) and I235A, and combinations thereof that decrease antibody binding to FcγR. (Numberings are according to the EU numbering scheme.)
The values determined for kon, koff, and the resulting equilibrium dissociation constant (KD) for the Multabodies are summarized in Tables 6-10. Binding kinetics showed that the resulting mouse MB molecule binds mouse FcRn in a pH dependent manner—binding at endosomal pH (5.6) and no binding at physiological pH (7.4)—similar to the parental IgG (
We next assessed the ability of the MB platform to transform mAb binders identified from initial phage display screens into potent neutralizers against SARS-CoV-2 (
Retrospectively, all IgGs and MBs were tested for their ability to bind to the Spike glycoprotein and the RBD of SARS-CoV-2 (
Based on their neutralization potency, seven mAbs were selected for further characterization: 298 (IGHV1-46/IGKV4-1), 82 (IGHV1-461/IGKV1-39), 46 (IGHV3-23/IGKV1-39), 324 (IGHV1-69/IGKV1-39), 236 (IGHV1-69/IGKV2-28), 52 (IGHV1-69/IGKV1-39), and 80 (IGHV1-69/IGKV4-1) (
The crystal structure shows that Fab 298 binds almost exclusively to the ACE2 receptor binding motif (RBM) of the RBD (residues 438-506). In fact, out of 16 RBD residues involved in binding Fab 298, 12 are also involved in ACE2-RBD binding (
Detailed analysis of the RBD-52 Fab interface reveals that the epitope of mAb 52 is shifted towards the core of the RBD encompassing 20 residues of the RBM and seven residues in the core domain (
C, K-KC)
, K-Tyr92
, H-Asp95
C, K-KC)
-H
-H
-H
-H
, Tyr489
-K
-K
-K
-K
-K
, Ser477
-K
, Phe486
-H
-H
, Glu471
-H
-H
-K
, Arg357
-K
-K
-K
-K
indicates data missing or illegible when filed
To explore whether MBs could potentially resist viral escape via their enhanced binding avidity, we tested the effect of four naturally occurring RBD mutations35 on the binding and neutralization of the seven human mAbs of highest potency: L452R—located within the epitope of antibodies 46 and 52 (bin 1), A475V and V483A—located within the ACE2 binding site (bin 2), and the circulating RBD variant N439K63 (
MB cocktails consisting of three monospecific MBs resulted in pan-neutralization across all PsV variants without a significant loss in potency and hence achieved a 100-1000-fold higher potency compared to the corresponding IgG cocktails (
The values determined for median IC50 of neutralization are summarized in Table 13 and Table 15.
In this study, we reveal how binding avidity can be leveraged as an effective mechanism to propel antibody neutralization potency and resistance from viral mutations. To this effect, we used protein engineering to develop a plug-and-play antibody-multimerization platform that increases avidity of mAbs targeting SARS-CoV-2. The seven most potent MBs have IC50 values of 0.2 to 2 ng/mL (9×10−14 to 9×10−13 M) against SARS-CoV-2 PsVs and therefore are, to our knowledge, within the most potent antibody-like molecules reported to date against SARS-CoV-2.
The MB platform was designed to include key favorable attributes from a developability perspective. First, the ability to augment antibody potency is independent of antibody sequence, format or epitope targeted. The modularity and flexibility of the platform was exemplified by enhancing the potency of a VHH and multiple Fabs that target non-overlapping regions on two SARS-CoV-2 S sub-domains (RBD and NTD). Using the MB to enhance the potency of VHH domains could provide particular value to this class of molecules since its small size allows highly efficient multimerization. Second, in contrast to other approaches that enhance avidity through tandem fusions of single chain variable fragments38,39, MBs do not suffer from low stability and in fact self-assemble into highly stable particles with aggregation temperatures similar to those of their parental IgGs. Third, alternative multimerization strategies like streptavidin40, verotoxin B subunit scaffolds41, or viral-like nanoparticles42 face immunogenicity challenges and/or poor bioavailability because of the absence of a Fc fragment and therefore the inability to undergo FcRn-mediated recycling. The light chain of apoferritin is fully human, biologically inactive, has been engineered to include Fc domains, and despite multimerization of >24 Fab/Fc fragments, has a Rh similar to an IgM. As such, a surrogate mouse MB did not elicit antidrug antibodies in mice and similar to its parental IgG was detectable in the sera for over a week. However, in vivo bioavailability of the MB was dependent on its binding affinity to FcγRs, suggesting that Fc avidity will need to be carefully fine-tuned for efficient translation of the MB to the clinic. In addition, further studies will be needed to evaluate how the MB distributes at anatomical sites of interest, such as the lungs in the case of SARS-CoV-2 infection. The plug-and-play nature of the Multabody also lends itself to exploring alternate half-life extending moieties other than the Fc if bioavailability is the only desired trait absent of effector functions e.g., human serum albumin43, or binding moieties that bind human serum albumin44,45.
Different increases in neutralization potency were observed for different mAb sequences tested on the MB against SARS-CoV-2. This suggests that the ability of the MB to enhance potency may depend on epitope location on the Spike, or the geometry of how the Fabs engage the antigen to achieve neutralization. The fact that the neutralization of two out of 20 SARS-CoV-2 RBD binders were not rescued by the MB platform suggests limitations based on mAb sequences and binding properties alone. Nevertheless, the capacity of the MB to transform avidity into neutralization potency across a range of epitope specificities on the SARS-CoV-2 Spike highlights the potential for using this technology broadly. It will be interesting to explore the potency-enhancement capacity of the MB platform against viruses with low surface spike density like HIV-146, or against other targets like the tumor necrosis factor receptor superfamily, where bivalency of conventional antibodies limits their efficient activation47.
Virus escape can arise in response to selective pressure from treatments or during natural selection. A conventional approach to combat escape mutants is the use of antibody cocktails targeting different epitopes. MBs showed a lower susceptibility to S mutations in comparison to their parental IgGs, presumably because the loss in affinity was compensated by enhanced binding avidity. Hence, when used in cocktails, the MB overcame viral sequence variability with exceptional potency. In addition, the split MB design allows combination of multiple antibody specificities within a single multimerized molecule resulting in similar potency and breadth as the MB cocktails. Importantly, the B.1.351 variant of concern that can escape the neutralization of several mAbs21,22,23 is neutralized with high potency by a tri-specific Multabody, thus further highlighting the capacity of these molecules to resist viral escape. Multi-specificity within the same particle could offer additional advantages such as intra-S avidity and synergy for the right combination of mAbs, setting the stage for further investigation of different combinations of mAb specificities on the MB. Avidity and multi-specificity could also be leveraged to deliver a single molecule that neutralizes potently across viral genera.
Overall, the MB platform provides a tool to surpass antibody affinity limits and generate broad and potent neutralizing molecules while by-passing extensive antibody discovery or engineering efforts. This platform is an example of how binding avidity can be leveraged to accelerate the timeline to discovery of the most potent biologics against infectious diseases of global health importance.
SARS-CoV-2, the causative agent of COVID-19, has been responsible for a global pandemic. Monoclonal antibodies have been used as antiviral therapeutics but have been limited in efficacy by viral sequence variability in emerging variants of concern (VOCs), and in deployment by the need for high doses. In this study, we leverage the MULTI-specific, multi-Affinity antiBODY (Multabody, MB) platform, derived from the human apoferritin protomer, to drive the multimerization of antibody fragments and generate exceptionally potent and broad SARS-CoV-2 neutralizers. CryoEM revealed a high degree of homogeneity for the core of these engineered antibody-like molecules at 2.1 Å resolution. We demonstrate that neutralization potency improvements of the MB over corresponding IgGs translates into superior in vivo protection: in the SARS-CoV-2 mouse challenge model, comparable in vivo protection was achieved for the MB delivered at 30× lower dose compared to the corresponding IgGs. Furthermore, we show how MBs potently neutralize SARS-CoV-2 VOCs by leveraging augmented avidity, even when corresponding IgGs lose their ability to neutralize potently. Our work demonstrates how avidity and multi-specificity combined can be leveraged to confer protection and resilience against viral diversity that exceeds that of traditional monoclonal antibody therapies.
Emerging infectious agents, including viruses such as SARS-CoV-2, present enormous challenges to global public health through the lack of pre-existing immunity in the population. Despite the availability of vaccines against SARS-CoV-2 disease (COVID-19), global vaccine coverage remains low, with only 19.9% of people in low-income countries having received at least one dose. Relatively short-lived vaccine-mediated protection, coupled with the emergence of new viral variants, further highlights the necessity for effective prophylactic and treatment options. Monoclonal antibodies (mAbs), which have been efficacious in the treatment of infectious diseases including respiratory syncytial virus (RSV) and Ebola virus, present a promising option. Some mAbs, including Bamlanivimab and Etesevimab delivered together, and the REGEN-COV cocktail of Casirivimab and Imdevimab, received US Food and Drug Administration (FDA) authorization to treat COVID-19, but have struggled to overcome viral diversity, and are limited by the requirement for high doses and intravenous administration. Both combinations had their authorization revoked following the emergence of the Omicron BA.1 VOC, which has 37 mutations within the spike domain and 15 mutations within the receptor binding domain (RBD), the target of most clinical antibodies against SARS-CoV-2. To date, only one mAb, Bebtelovimab, retains adequate in vitro activity against circulating Omicron subvariants and is FDA-authorized for use against SARS-CoV-2. Authorization has also been updated to allow for an increased dose of a cocktail of Tixagevimab and Cilgavimab, which is expected to maintain activity against subvariants despite a loss of potency at the original dose. Despite these limited authorizations, a number of additional antibodies targeting SARS-CoV-2 spike epitopes have been identified. However, such increases in mAb breadth are often associated with a reduction in potency, highlighting the necessity of identifying therapeutics that combine potency and breadth.
Increasing antibody valency is a promising approach to enhance apparent binding affinity, potentially lowering therapeutic dose, improving breadth, and allowing administration through alternative routes, such as subcutaneous or intramuscular delivery. Aiming to exploit avidity to enhance antibody functional responses, a wide range of antibody engineering strategies have been described. Among those, biologics assembled based on IgM, synthetic nanocages and Minibinder formats have demonstrated superior neutralization properties against SARS-CoV-2 compared to conventional mAb formats. Additionally, the avid molecules GEN3009, INBRX-106(Inhibrx) and IGM-8444 are being tested in Phase I/II clinical trials for the treatment of hematological and solid tumors, highlighting the clinical benefit of multivalent antibody-presenting formats. Following a similar principle but using the human light-chain apoferritin protomer to drive oligomerization of antibody fragments, we developed a platform called the Multabody (MB) to increase neutralization potency of antibodies targeting SARS-CoV-2 and HIV-1. Using this platform, enhanced affinity can be coupled with multi-specificity—the inclusion of several antibody fragments recognizing different epitopes—to result in antigen recognition that is more resistant to viral mutations. This is particularly relevant in light of immune pressure driving the continued emergence of new variants of SARS-CoV-2, including those against which existing vaccines and drugs are less efficacious.
Here, we explored whether the increased in vitro SARS-CoV-2 neutralization for the Multabody could translate to in vivo protection at low doses. In addition, we assessed whether MBs could rescue the loss in neutralization potency observed for conventional mAbs against different variants of concern (VOCs). Our data provide proof-of-concept that the MB is a tractable platform that harnesses avidity to provide gains in both the in vitro and in vivo potency and breadth of antibody-based molecules against SARS-CoV-2.
Direct binding kinetics measurements were conducted using an Octet RED96 BLI system (Sartorius ForteBio) in PBS pH 7.4, 0.01% BSA and 0.002% Tween at 25° C. His-tagged RBD or SARS-CoV-2 Spike protein was loaded onto Ni-NTA (NTA) biosensors (Sartorius ForteBio) to reach a BLI signal response of 0.8 nm. Association rates were measured by transferring the loaded biosensors to wells containing a 2-fold dilution series from 250 to 16 nM (Fabs), 125 to 4 nM (IgG), and 16 to 0.5 nM (MB). Dissociation rates were measured by dipping the biosensors into buffer-containing wells. The duration of each of these two steps was 180 s. Fc characterization in the split Multabody design was assessed by measuring binding to hFcγRI and hFcRn. To probe the theoretical capacity of the Multabodies to undergo endosomal recycling, binding to the hFcRn β2-microglobulin complex was measured at physiological (7.5) and endosomal (5.6) pH. In some cases, association of the Multabodies to the hFcRn β2-microglobulin complex was done at pH 5.6 and dissociation was done at pH 7.4. Competition assays were performed in a two-step binding process. Ni-NTA biosensors preloaded with His-tagged RBD were first dipped into wells containing the primary antibody at 50 μg/mL for 180 s. After a 30 s baseline period, the sensors were dipped into wells containing the second antibody at 50 μg/ml for an additional 300 s.
SARS-CoV-2 pseudotyped viruses (PsV) were generated using an HIV-based lentiviral system as previously described with few modifications. Briefly, 293T cells were co-transfected with a lentiviral backbone encoding the luciferase reporter gene (BEI NR52516), a plasmid expressing the Spike (BEI NR52310) and plasmids encoding the HIV structural and regulatory proteins Tat (BEI NR52518), Gag-pol (BEI NR52517) and Rev (BEI NR52519). 24 h post transfection at 37° C., 5 mM sodium butyrate was added to the media and the cells were incubated for an additional 24-30 h at 30° C. SARS-CoV-2 Spike mutant D614G was kindly provided by D. R. Burton (The Scripps Research Institute) and the rest of the PsV mutants were generated using the KOD-Plus mutagenesis kit (Toyobo, Osaka, Japan). SARS-CoV-2 spike variants of concern B.1.117, B.1.351, P.1 and B.1.617.2 were kindly provided by David Ho (Columbia). Neutralization was determined in a single-cycle neutralization assay using 293T-ACE2 cells (BEI NR52511) and HeLa-ACE2 cells (kindly provided by D. R. Burton; The Scripps Research Institute). PsV neutralization was monitored by adding Britelite plus reagent (PerkinElmer) to the cells and measuring luminescence in relative light units (RLUs) using a Synergy Neo2 Multi-Mode Assay Microplate Reader (Biotek Instruments). IC50 fold increase was calculated as: IgGIC50 (μg/mL)/MBIC50 (μg/mL). Two to three biological replicates with two technical replicates each were performed.
VeroE6 cells were seeded in a 96F plate at a concentration of 30,000/well in DMEM supplemented with 100U Penicillin, 100U Streptomycin and 10% FBS. Cells were allowed to adhere to the plate and rest overnight After 24 h, 5-fold serial dilutions of the IgG and MB samples were prepared in DMEM supplemented with 100 U Penicillin and 100 U Streptomycin in a 96R plate in quadruplicates (25 uL/well). 25 μL of SARS-CoV-2/SB2-P4-PB Clone 1 was added to each well at 100 TCID/well and incubated for 1 h at 37° C. with shaking every 15 min. After co-culturing, the media from the VeroE6 plate was removed, and 50 uL antibody-virus sample was used to inoculate VeroE6 cells in quadruplicates for 1 h at 37° C., 5% CO2, shaking every 15 min. After 1 h inoculation, the inoculum was removed and 200 μL of fresh DMEM supplemented with 100U Penicillin, 100U Streptomycin and 2% FBS was added to each well. The plates were further incubated for 3 days. The cytopathic effect (CPE) was monitored, and PRISM was used to calculate IC50 values. Three biological replicates with four technical replicates each were performed.
Immune complexes were formed by incubating SARS-CoV-2 Spike-coated fluorescent beads with diluted MB or IgG preparations for 2 h at 37° C.+5% CO2 (10 μL beads and 10 μL of 1 mg/mL antibody sample). THP-1 cells (ATCC, TIB-202) were maintained at fewer than 5×105 cells/mL and 5×104 cells/well in 200 μL were added to the immune complexes for 1 h at 37° C.+5% CO2 Cells were washed and stained with Live Dead Fixable Violet stain (Invitrogen, L34995) according to the provided protocol before being washed and fixed with 1% PFA for 20 min at room temperature. Fixed cells were washed with FACS buffer (PBS+10% FBS, 0.5 mM EDTA) and collected on an LSRII Flow Cytometer (BD Biosciences). Data was analyzed in FlowJo (BD Biosciences, Ashland, OR), and phagocytosis was quantified as the percentage of live THP-1 cells that had phagocytosed red fluorescent SARS-CoV-2 Spike beads.
6-8-week old female hFcRn/hACE2 double transgenic mice were purchased from Jackson laboratories (stock #034902). All procedures were approved by the Local Animal Care Committee at the University of Toronto. Tri-specific 298-80-52 (T10) MBs or PGDM1400 negative control IgG were administered by intraperitoneal (i.p.) injection with a total of between 6-60 μg of MB or 60-180 μg of IgG one day prior to infection, depending on the experiment 24 h later, mice were infected with SARS-CoV-2/SB2-P4-PB Clone 1 at a dose of between 1×104-1×105 PFU/mouse. Mice were monitored daily for body weight until 12 days post infection. At endpoint, which is described as the time at which either the mice were sacrificed due to a >20% loss in body weight or survived to d12, the lungs were harvested for analysis of lung viral titer and MB/IgG quantification. Data represented in
Lungs were harvested from mice at endpoint, weighed and then homogenized in 1 mL of incomplete DMEM. Samples were spun down and supernatant was collected and frozen until sample analysis. For quantification of lung viral titers, samples were added to VeroE6 cells at a 1:10 serial dilution and allowed to infect for 1 h at 37° C. Following infection, supernatants were removed, and the cells were replenished with 100 μL fresh media and allowed to incubate for 5 days. The cytopathic effect (CPE) was monitored, and PRISM was used to calculate ID50 values. Three technical replicates each were performed. For quantification of MB/IgG levels in the lung, 96-well Pierce Nickel Coated Plates (Thermo Fisher) were coated with either 50 μL at 0.5 μg/ml of the His6×-tagged RBD antigen or His6×-tagged BG505 to determine T10 MBs and PGDM1400 IgG levels, respectively. HRP-ProteinA (Invitrogen) was used as a secondary molecule and the chemiluminescence signal was quantified using a Synergy Neo2 Multi-Mode Assay Microplate Reader (Biotek Instruments).
SARS-CoV-2 challenge studies performed for the quantification of T10 MB levels in the lung at D2 post infection were done as previously described, with an n=3 mice/group. Briefly, 96-well Pierce Nickel Coated Plates (Thermo Fisher) were coated with 50 μL at 0.5 μg/ml of the His6×-tagged RBD antigen. Anti-human Fab IgG (Jackson ImmunoResearch) was used as a secondary molecule and the chemiluminescence signal was quantified using a Synergy Neo2 Multi-Mode Assay Microplate Reader (Biotek Instruments).
The tri-specific MB (298-52-80) sample was concentrated to 2.0 mg/mL and 3.0 μl of the sample was deposited on homemade holey gold grids, which were glow-discharged in air for 15 s before use. Sample was blotted for 3.0 s, and subsequently plunge-frozen in liquid ethane using a Leica EM GP2 Automatic Plunge Freezer (maintained at 4° C. and 100% humidity). Data collection was performed on a Thermo Fisher Scientific Titan Krios G3 operated at 300 kV with a Falcon 4i camera automated with the EPU software. A nominal magnification of 75,000× and defocus range between 0.5 and 2.0 μm were used for data collection. Exposures were collected for 8.3 s as movies of 30 frames with a camera exposure rate of ˜6.3 e− per pixel per second, and total exposure of 49.6 electrons/Å2. A total of 4,385 raw movies were obtained.
Image processing was carried out in cryoSPARC v3. Initial specimen movement correction, exposure weighting, and CTF parameters estimation were done using patch-based algorithms. Micrographs were sorted based on CTF fit resolution, and only micrographs with a fit better than 5.0 Å were accepted for further processing. Manual picking was performed to create templates for template-based picking, which resulted in selection of 955,995 particle images. Particle images were sorted via several rounds of 2D classification, which resulted in selection of 358,036 particle images. A preliminary 3D model was obtained ab-initio with no symmetry applied. To further select the highest-quality particle images, 151,443 particle images with CTF fit resolution better than 3.0 Å were re-extracted from micrographs and subjected to non-uniform refinement75 with no symmetry applied, which resulted in a 2.4 Å resolution map of the tri-specific MB. 65,478 particle images with CTF fit better than 2.7 Å, were extracted from micrographs and subjected to non-uniform refinement with octahedral symmetry applied, which resulted in a 2.1 Å resolution map. Non-uniform refinements were performed with defocus refinement and optimization of per-group CTF parameters. The pixel size was calibrated at 1.04 Å per pixel by fitting a structure of human apoferritin light chain (PDB ID: 2FFX).
To obtain 3D reconstructions of Fab and Fc molecules on the surface of the tri-specific MB, manual picking was performed, and templates were created for template-based picking, resulting in the selection of 6,692,141 particle images. Particle images were sorted via several rounds of 2D classification, which resulted in the selection of 668,214 particle images. Preliminary 3D maps were obtained ab-initio with no symmetry applied. Further cleaning of the dataset was performed via several rounds of heterogenous refinement and resulted in 73,163 Fab particle images and 13,328 Fc particle images. Final cryoEM maps at 6.7 Å resolution for Fab and 7.1 Å resolution for Fc were obtained using the local refinement job with a custom soft mask.
To assess the quality of obtained maps, models of human apoferritin light chain (PDB ID: 6WX6), human IgG1 Fc (PDB ID: 6CJX)78 and Fab 298 (PDB ID: 7K9Z) were manually docked in cryoEM maps using UCSF Chimera79. Figures were prepared with Pymol, UCSF Chimera and UCSF ChimeraX.
A binary complex of purified 80 Fab-RBD was obtained by mixing Fab:RBD in a 2:1 molar ratio. After 30 min incubation at 4° C., the complex was purified by size exclusion chromatography (Superdex 200 Increase size exclusion column, GE Healthcare, Chicago, IL) in 20 mM Tris pH 8.0, 150 mM NaCl buffer. The fractions of interest were then concentrated to 10 mg/mL and crystallization trials were set up using the sitting drop vapor diffusion method with JCSG Top 96 screen in a 1:1 protein: reservoir ratio. Crystals appeared on day 70 in a condition containing 0.2 M di-ammonium tartrate and 20% (w/v) PEG 3350. Crystals were cryoprotected in 10% (v/v) ethylene glycol and flash-frozen in liquid nitrogen. X-ray diffraction data was collected at the Argonne National Laboratory Advanced Photon Source on the 23-ID-D beamline. The data set was processed using XDS and XPREP. Phases were determined using Phaser with the 80 Fab predicted by ABodyBuilder and the SARS-CoV-2 RBD (PDB ID: 7LM8) as search models. Iterative refinement was performed using Phenix Refine and manual building was done in Coot. All software were accessed through SBGrid.
in silico analysis of lead VH/VL sequences identified a deamidation site in the CDRL3 of mAb52 at position N92. Deamidation sites in mAbs can contribute to both changes in binding kinetics and heterogeneity in the drug product. In order to circumvent this potential effect, we generated variants in which the asparagine residue was mutated to a threonine (N92T).
T10 MB was assessed for potency to WT SARS-CoV-2 and across the variants of concern (VOCs) in both pseudovirus and authentic virus neutralization assays. As shown in Table 16 and in
In Vivo Protection with T10 MB in a SARS-CoV-2 Challenge Study
Following identification of the ultra potent T10 MB in PsV and authentic virus neutralization assays, we explored the ability of this MB to confer protection in a SARS-CoV-2 challenge study using hFcRn/hACE2 double transgenic mice. T10 MB nomenclature as discussed below is set out in Table 17.
To specifically assess the effect of neutralization potency on in vivo protection from lethal SARS-CoV-2 challenge, T10 MB and the corresponding IgG cocktail were generated with an IgG4 Fc containing mutations to ablate binding to Fcγ receptors (S228P, F234A, L235A, G237A, P238S), hereafter referred to as MB* (or T10.A MB) and IgG4*, respectively. As expected, replacement of the Fc subtype from IgG1 to IgG4* did not affect the neutralization potency of the IgG or the MB, and, as previously reported. The tri-specific MB* exhibited >1000-fold increase in potency relative to its corresponding cocktail IgG (
To assess whether the increased neutralization potency achieved with the MB resulted in improved in vivo protection against SARS-CoV-2, hACE2 and hFcRn double transgenic mice were treated with 30 μg (1.5 mg/kg) of the FcγR-binding deficient IgG4* and MB* molecules, one day prior to infection, and challenged intranasally with a high dose (1×105 TCID50) of SARS-CoV-2. The tri-specific MB* provided significantly better protection (60% survival) compared to the IgG4* cocktail, with all cocktail-recipient animals succumbing to the challenge at D6-7 (
In order to endow the MB with a range of putative effector function properties in vivo, IgG4 based variants were generated with a range in binding profiles to human FcγRs using three sets of mutations. Set #1 used the S228P, F234A and L235A mutations (T10.B MB); set #2 used the F234A, L235A, G237A and P238S mutations (T10.G MB); and set #3 used the S228P, F234A, L235A, G237A and P238S mutations (T10.A MB).
In Vivo Protection with T10.B and T10.G MBs in a SARS-CoV-2 Challenge Study
Following the generation of T10.B and T10.G MBs, the ability of these MBs to confer protection in SARS-CoV-2 challenge studies was explored. hACE2/hFcRn transgenic mice (n=8 mice/group) were treated with a total of 60 μg of either T10.B MB, T10.G MB or negative control IgG and challenged intranasally with 5×104 PFU/mouse of SARS-CoV-2. The results from this study show that both T10.B and T10.G MBs were able to confer 75% survival at d12 compared to the negative IgG control, which had all mice succumb by d7 (
T10.G MB was subsequently tested for its ability to confer protection in hACE2/hFcRn double transgenic mice which are homozygous for the hFcRn transgene (JAX #037043). In this study, mice (n=4/group) were treated with 30 μg (1.5 mg/kg) of T10.G MB or negative control IgG and subsequently challenged intranasally with 1×104 PFU/mouse of SARS-CoV-2. The results from this study show that T10.G MB was able to confer 75% protection, compared to the negative IgG control group which had all mice succumb to infection by d8 (
In order to determine MB exposure in NHPs, T10.B MB was administered subcutaneously in male and female cynomolgus macaques (n=3 per group) at 1.5 mg/kg.
We have previously reported the generation of tri-specific MB molecules using an engineered apoferritin split design (
Analysis of cryoEM micrographs revealed the formation of highly decorated and homogeneous nanocage-like particles (
3D reconstructions of the apoferritin scaffold of the MB reached 2.4 Å and 2.1 Å resolution, respectively, when no symmetry (C1;
Next, we sought to understand the molecular basis of binding of mAb 80, as its structure had remained elusive. We solved the crystal structure of 80 Fab in complex with RBD at 3.1 Å resolution (
Detailed analysis of the RBD-80 Fab interface revealed that residues S477 and T478 of the RBD form hydrogen bonds with Y92 and D100D of the antibody, burying 124 Å2 of its surface area and accounting for 15% of the total buried surface area (BSA) of the RBD (
The rapid emergence of new SARS-CoV-2 VOCs has stymied mAb therapeutics and driven antibody discovery efforts focused on expanding the breadth of viral sequences recognized by a single antibody. The evidence that several FDA-authorized mAb therapies lost efficacy against the Omicron VOC supports the urgent need for new therapeutic interventions with improved breadth. In addition, strategies to propel the potency of such mAbs have the potential to reduce the therapeutic dose and enable more practical routes of administration, which could reduce manufacturing costs and enable global availability. We have previously described a Multabody platform capable of delivering highly potent and broadly-acting molecules in vitro. Indeed, two years after the identification of the tri-specific 298-52-80 MB, derived from three mAbs of modest potency, to our knowledge, no mAb that surpasses the in vitro neutralization potency of this molecule against WT SARS-CoV-2 (IC50 of 0.0002 μg/mL) has yet been described. Here, we have demonstrated that potent in vitro neutralization translates into in vivo SARS-CoV-2 protection at low dose and that combination of avidity and multi-specificity can yield molecules with broad neutralization coverage against SARS-CoV-2.
The MB platform offers multiple advantages as a next-generation multivalent biologic, including high stability, efficient assembly, ease of production and purification, and plug-and-play genetic fusion of antibodies of choice. Here, we further confirmed the proper assembly of a tri-specific MB by cryoEM. This structural technique has been useful for the characterization of large and complex biological designs such as subunit vaccines, including self-assembling protein nanoparticles presenting the ectodomains of influenza and RSV viral glycoprotein trimers, two-component protein nanoparticles displaying a stabilized HIV-1 Env trimer, or a COVID-19 vaccine candidate nanoparticle utilizing SpyCatcher multimerization of the SARS-CoV-2 spike protein RBD. Even though simultaneous visualization of both nanoparticle scaffold and molecules displayed at their periphery can be challenging due to the flexibility of connecting linkers, recent advances in cryoEM data processing allow for independent analysis of different nanoparticle components. By adopting this strategy, we were able to confirm the proper folding of scFabs and scFcs at the periphery of the MB. Furthermore, we confirm at 2.1 Å resolution the proper assembly of the human light chain apoferritin scaffold of the MB in the context of the engineered split design, on which the assembly of multi-specific antibody components is built. These analyses are important as they further support a central role for structure-guided protein engineering in the rational design of novel biologics and substantiate the MB as a uniform biologic.
Next, we investigated the ability of the MB to confer protection from lethal challenge in vivo. The specific role of increased neutralization potency in mediating in vivo protection was assessed with a tri-specific MB* molecule expressing a mutant IgG4 Fc that is defective for Fcg receptor binding. In attempts to retain IgG-like bioavailability as previously described, we maintained the ability of the MB Fc to interact with FcRn, a receptor associated with antibody recycling and half-life extension. In vivo, the dramatic increase in neutralization potency of the tri-specific MB relative to the IgG4* cocktail resulted in significantly better protection against lethal SARS-CoV-2 challenge and facilitated a reduction in the dose required for protection. Previous studies have shown that some mAbs targeting SARS-CoV-2 require Fc-mediated effector functions for optimal efficacy. Our data illustrates that gains in neutralization potency are sufficient to confer protection from lethal challenge, even in the absence of effector function, and supports the use of avidity-based increases in potency to facilitate dose-sparing of antibody-based therapeutics. We have previously shown that the MB format is capable of triggering ADCP in vitro, indicating that the format in itself does not preclude incorporating effector function into the molecule.
Single-specificity MBs showed an elevated degree of resilience against viral sequence variability through improvements in their apparent binding affinity compared to IgGs, allowing these molecules to retain neutralization capabilities even when mAbs lose potency. In the case of mAb 80, mutations within the RBD epitope found in the VOCs cause a loss in potency by the mAb. In contrast, when the specificity of 80 is displayed on a MB, mutations present in the VOCs minimally alter the high binding affinity and potent neutralization profile of this molecule. The ability of the MB to better tolerate sequence variability presumably stems from the reduced off rate that drives increased avidity, which might be favoured by a high spike density on the virion surface. The potential for avid antibody technologies to endure sequence variability can provide benefits to antibody discovery timelines by boosting the longevity of early identified mAbs with the ability to neutralize emerging VOCs.
The identification of potent bnAbs can take years or even decades of antibody discovery and engineering efforts, as exemplified in the cases of HIV-1 and Influenza. The continuous monitoring and screening of emerging variants will be required to confirm persistence in neutralization; however, the larger footprint of the RBD covered by a tri-specific MB compared to conventional mAbs, provides a unique advantage for the MBs in remaining resilient against future VOCs compared to mAbs alone. Furthermore, the ability to combine multiple specificities into a single molecule might offer the additional potential benefit of ensuring the bioavailability of all components throughout the course of therapy, which has been a limiting feature of mAb cocktail combinations.
GGGSGGGGSGGGGSGGGGSGGG
SSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDV
ALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKL
NQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLR
HD
GSGGGGSGGGGSGGGGSGGGGSQVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQAP
GGGGSGGGGSGGGGSGG
SSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRDDVALEGV
SHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEKKLNQALL
DLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLRHD
GGSGGGGGGGGSGGGGSGGGGSQVQLVQSGSELKKPGASVKVSCKASGYTFTSYAMNWVRQA
SGGGGSGGGGSGGGGSGG
GKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCDFLETHFL
DEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLRHD
GGGGSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGSDKTHTCPPCPAPELLGGPSVFLFPPKPK
GGGSGGGGSGGGGSGGGGSGGGGSGG
SSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFD
RDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEW
GGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHN
APIEKTISKAKGQPREPQVYTLPP
SGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGAEVKKPGASVKVSCKVSGYTLTELSMHWV
GSGGGGSGGGGSGGGGSGGGGSGG
SSQIRQNYSTDVEAAVNSLVNLYLQASYTYLSLGFYFDRD
DVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEWGKTPDAMKAAMALEK
KLNQALLDLHALGSARTDPHLCDFLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLT
LRHD
SGGGGSGGGGSGGGGSGGGGSGGGGSEVQLVESGAEVKKPGASVKVSCKVSGYTLTELSMHWV
GSGGGGSGGGGSGGGGSGGGGSGG
GKTPDAMKAAMALEKKLNQALLDLHALGSARTDPHLCD
FLETHFLDEEVKLIKKMGDHLTNLHRLGGPEAGLGEYLFERLTLRHD
ATAGASSGSGSSGSSSSGGTGTGQVQLQQSGAELVRPGSSVKISCKASGYAFSSYWMNWVKQRP
SGGGGSAGGTATAGASSGSGSSGSSSSGGTGKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSP
SGGGGGGSGGSGGSGGS
MTSQIRQNYSTEVEAAVNRLVNLHLRASYTYLSLGFFFDRDDVALEGV
GHFFRELAEEKREGAERLLEFQNDRGGRALFQDVQKPSQDEWGKTQEAMEAALAMEKNLNQALL
DLHALGSARTDPHLCDFLESHYLDKEVKLIKKMGNHLTNLRRVAGPQPAQTGAPQGSLGEYLFER
LTLKHD
GGPSVFLFPPKPKDTLM
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVH
APIEKTISKAKGQPREPQVYTLP
GSGGGGSGGGGSGGGGSGGGGSGGGGSGGGGGGGGSDKTHTCPPCPAPE GGPSVFLFPP
SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQ
APIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA
LGFYFDRDDVALEGVSHFFRELAEEKREGYERLLKMQNQRGGRALFQDIKKPAEDEW
GFPLTFGPGTKVDIKRTVAAPSVFIFPPSDEQLKSGTASVVCLL
While the invention has been described in connection with specific embodiments thereof, it will be understood that it is capable of further modifications and this application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure that come within known or customary practice within the art to which the invention pertains and may be applied to the essential features herein before set forth.
The present application claims the benefit of and priority to U.S. Provisional Application No. 63/256,566 filed Oct. 16, 2021, the entire content of which is hereby incorporated by reference in its entirety for all purposes.
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/CA2022/051516 | 10/14/2022 | WO |
Number | Date | Country | |
---|---|---|---|
63256566 | Oct 2021 | US |