MODULATION OF A PATHOGENIC PHENOTYPE IN TH1 CELLS

Abstract

The subject matter disclosed herein is generally directed to pathogenic Th1 cells whose phenotype is dependent on IL-23R signaling. Th1 cell specific therapeutic targets and gene programs are disclosed herein. In particular, inhibition of CD160 reduces Th1 cell pathogenicity.

Description

REFERENCE TO AN ELECTRONIC SEQUENCE LISTING

The contents of the electronic sequence listing (“BROD-5340WP_ST25.txt”; Size is 59,263 bytes and it was created on Jan. 20, 2022) is herein incorporated by reference in its entirety.

TECHNICAL FIELD

The subject matter disclosed herein is generally directed to colitogenic Th1 cells whose phenotype is dependent on IL-23R signaling.

BACKGROUND

The cytokine IL-23 and its receptor IL-23R play a fundamental role in inducing tissue inflammation and autoimmunity⁴. It has been shown that pre-clinical models of Multiple Sclerosis, arthritis and inflammatory bowel disease (IBD) are all protected from disease in animals deficient for IL-23 signaling.^1-3. The relevance to human disease is emphasized by genome-wide association studies (GWAS) that established IL-23R as a risk gene in multiple human autoimmune diseases including IBD⁵ and a number of anti-IL-23 inhibitors have been approved for the treatment of Psoriasis and are now being tested in other autoimmune conditions where Th17 cells have not been implicated in disease induction¹².

IL-23R signaling is crucial for evoking a pathogenic phenotype in Th17 cells by stabilizing their function and inducing multiple factors that make Th17 cells highly pro-inflammatory¹³. Although the Th17 cell subset is most prominently associated with IL-23R function, several observations, however, have been difficult to reconcile under the assumption that IL-23R solely operates in pathogenic Th17 cells and not other pathogenic subsets. Importantly, in the pre-clinical colitis models, IL-23R signaling has also been implicated in regulating FoxP3⁺Treg function^{14, 15}. However, it has been observed that bona fide Th1 cells also elicit colitis in pre-clinical models, particularly in the adoptive transfer colitis model⁷, but Th1 cells are not known to express IL-23R. These data are conflicting with the observation that IL-23R signaling is required for the induction of colitis. Interestingly, a recent report suggests that Th17 cells need to transdifferentiate into Th1 cells to elicit colitis in this model⁷, however, whether Th1 cells themselves, driven by IL-23R, could trigger colitis without going through a Th17 cell-state has not been addressed. Clinically, secukinumab, a monoclonal antibody targeting IL-17A has been found effective in plaque psoriasis, psoriatic arthritis and ankylosing spondylitis yet ineffective in IBD⁶. In contrast, ustekinumab, a monoclonal antibody targeting both IL-12 and IL-23, and therefore targeting differentiation of both Th1 cells and Th17 cells, has proven to be effective in treating IBD^16,17. Indeed, the seminal studies by Powrie and colleagues have established that both Th1 and Th17 cells develop in the pre-clinical disease model of IBD through the adoptive transfer of naïve CD45RB^hi T cells^3,18. These observations raised important questions and provided impetus to investigate whether IL-23 may also confer pathogenicity to another T helper cell subset, in addition to quintessential Th17 cells, to thereby contribute to the induction of IBD.

Citation or identification of any document in this application is not an admission that such a document is available as prior art to the present invention.

SUMMARY

In one aspect, the present invention provides for a method of treating an autoimmune disease caused by pathogenic Th1 cells comprising administering one or more agents capable of inhibiting the expression, activity and/or function of one or more genes selected from the group consisting of CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW. In certain embodiments, the one or more agents inhibit the expression, activity and/or function of CD160. In certain embodiments, the one or more agents inhibit the expression, activity and/or function of GPR18. In certain embodiments, the one or more agents comprises an antibody, antibody fragment, intrabody, small molecule, small molecule degrader, antibody-like protein scaffold, aptamer, polypeptide, genetic modifying agent, or any combination thereof. In certain embodiments, the genetic modifying agent comprises an RNA-guided nuclease system, RNAi system, a zinc finger nuclease, a TALE, or a meganuclease. In certain embodiments, the RNA-guided nuclease system is a CRISPR system or IscB system. In certain embodiments, the CRISPR system comprises a CRISPR-Cas base editing system, a prime editor system, or a CAST system.

In another aspect, the present invention provides for a method of treating an autoimmune disease caused by pathogenic Th1 cells comprising administering Th1 cells modified to have decreased expression of IL-23R.

In another aspect, the present invention provides for a method of detecting a Th1 inflammatory response for diagnosis or monitoring of a treatment of a subject suffering from an autoimmune disease caused by colitogenic Th1 cells comprising detecting in a sample obtained from the subject Th1 cells expressing one or more genes selected from the group consisting of: IL23R, CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW, wherein the expression of one or more genes are increased in an inflammatory response; or clusters 2, 9 and 7 in Table 3, wherein the expression of one or more genes or program from cluster 2 and/or 9 are increased in an inflammatory response and the expression of one or more genes or program in cluster 7 are decreased in an inflammatory response. In certain embodiments, the treatment comprises one or more agents capable of inhibiting the expression, activity and/or function of CD160, GPR18, IL-23, or IL-12 and IL-23. In certain embodiments, the Th1 cells are detected by immunohistochemistry (IHC), fluorescence activated cell sorting (FACS), fluorescently bar-coded oligonucleotide probes, RNA FISH (fluorescent in situ hybridization), RNA-seq, or any combination thereof. In certain embodiments, the Th1 cell expression is inferred from bulk RNA-seq. In certain embodiments, the Th1 cell expression is determined by single cell RNA-seq. In certain embodiments, the sample is obtained by biopsy.

In certain embodiments, the autoimmune disease is inflammatory bowel disease (IBD) or type 1 diabetes.

In another aspect, the present invention provides for a method of obtaining IL-23R+Th1 cells comprising differentiating naïve CD4+ T cells in vitro with IL-12 and IL-21. In certain embodiments, the method further comprises differentiating with IL-23.

In another aspect, the present invention provides for a method of treating cancer comprising administering to a subject in need thereof Th1 cells differentiated according to any embodiment herein. In certain embodiments, the naïve CD4+ T cells are obtained from the subject.

In another aspect, the present invention provides for a method of screening for drugs capable of shifting pathogenic Th1 cells to non-pathogenic Th1 cells comprising: treating Th1 cells obtained according to any embodiment herein with a drug candidate; detecting expression of one or more genes or program selected from cluster 2, 9 or 7 in Table 3; and identifying the drug, wherein the expression of one or more genes or program from cluster 2 or 9 decrease, and/or the expression of one or more genes or program in cluster 7 increase as compared to cells not contacted with the drug candidate.

These and other aspects, objects, features, and advantages of the example embodiments will become apparent to those having ordinary skill in the art upon consideration of the following detailed description of example embodiments.

BRIEF DESCRIPTION OF THE DRAWINGS

An understanding of the features and advantages of the present invention will be obtained by reference to the following detailed description that sets forth illustrative embodiments, in which the principles of the invention may be utilized, and the accompanying drawings of which:

FIGS. 1A-1G—IL-12+IL-21 strongly induce IL-23R in Th1 cells in vitro. FIG. 1a, Naïve CD44^lowCD62L^hi CD4⁺ T cells were cultured under four different conditions in vitro for 5 days on anti-CD3/CD28 antibody-coated plates with the following conditions: TGF-β+IL-6 (non-pathogenic Th17 cells), IL-1β+IL-6+IL-23 (pathogenic Th17 cells), IL-12+IL-21 and IL-12+IL-21+IL-23. Flow cytometry was used to measure the extent of IL-23R expression taking advantage of an eGFP reporter allele. FIG. 1b, qPCR analysis shows the expression of Il23r in wildtype (Il23r^eGFP/wt) cells. Important signature Th1 and Th17 genes such as Ifng, Il17a, Tbx21, Rorc and Stat3 were measured in both wildtype (Il23r^eGFP/wt) and KO cells (Il23r^eGFP/eGFP) FIG. 1c, Schematic of sorting by FACS of IL-23R⁺ (eGFP⁺) and IL-23R⁻ (eGFP⁻) cells differentiated with IL-12+IL-21+IL-23 in preparation of scRNAseq (Smart-seq2). FIG. 1d, t-SNE plots showing the expression of Th1 and Th17 signature genes. FIG. 1e, Selected genes are shown that are expressed in eGFP⁺ and eGFP⁻ cells in wildtype (Il23r^eGFP/wt) cells. Green violin plots represent eGFP⁺-sorted cells. FIG. 1f, 528 genes were found to be differentially expressed between eGFP⁺ and eGFP⁻ cells from wildtype cells (Il23r^eGFP/wt) In knockout cells for IL-23R (Il23r^eGFP/eGFP) only 129 genes were found to be differentially expressed between eGFP⁺ and eGFP⁻ cells. FIG. 1g, Volcano plot showing genes differentially expressed in an IL-23R dependent manner. An interaction coefficient was computed to identify differences between the eGFP⁺ and eGFP⁻ populations which varied according to genotype (wildtype Il23r^eGFP/wt vs. knockout Il23r^eGFP/eGFP) Panel a is representative of several experiments and mean+s.e.m are shown. In Panel b mean+s.e.m are shown.

FIGS. 2A-2F—scRNAseq of tissue-infiltrating Th1 cells in a pre-clinical model of adoptive transfer colitis. FIG. 2a, Schematic of adoptive transfer colitis by in vitro differentiated Th1 cells followed by histopathology and 10× scRNAseq. Viable CD45⁺CD4⁺ T lymphocytes from RAG1^−/− recipients of either wildtype cells (Il23r^wt/eGFP) or knockout cells (Il23r^eGFP/eGFP) respectively, were isolated from the intestinal mucosa through FACS in preparation of scRNAseq. FIG. 2b, Deficiency of IL-23R protects from Th1 cell mediated adoptive transfer colitis as evaluated by histopathology. H&E staining and clinical score are shown. Mean+s.e.m. FIG. 2c, UMAP of 30,260 single cells sequenced from spleen, colonic and small intestinal (SI) lamina propria (LPL) and colonic epithelium (IEL=intraepithelial lymphocytes). FIG. 2d, Heatmap of differentially expressed genes among the tissues analyzed with selected genes highlighted as dot plots. FIG. 2e, Identification of wildtype (teal) and knockout cells (magenta), respectively. FIG. 2f, Selected genes are shown that are expressed in an IL-23R dependent manner. Red representing higher expression in wildtype cells and blue representing higher expression in knockout cells.

FIGS. 3A-3E—IL-23R drives the expansion of highly inflammatory and colitogenic T cells in the lamina propria as identified by scRNAseq. FIG. 3a, UMAP of T cells isolated from the lamina propria of small intestine and colon. Wildtype cells (teal) and knockout cells (magenta) are highlighted. FIG. 3b, Cluster analysis identifies 12 clusters with particular transcriptional signatures. FIG. 3c, The size of each cluster is shown as a percentage of the total number of cells. For each cluster, its relative abundance among wild type vs. knockout cells is visualized. FIG. 3d, Two clusters with a highly inflammatory and colitogenic signature are shown (clusters 2 and 9) which are dominated by wildtype cells. The top 20 differentially expressed genes in comparison to all other clusters are shown. Cluster 7 consists in the majority of knockout cells and exhibits a signature reminiscent of Tr-like cells FIG. 3e, Applicants assembled a list of genes (597 genes) found within IBD GWAS risk loci for which De Lange et al. (2017) provided the main basis. Applicants then asked which of these genes are expressed in clusters 2, 7 and 9 in an IL-23R-dependent manner comparing expression levels between wildtype and knockout cells. Positive values indicate higher expression in wildtype cells (Il23r^eGFP/wt) Asterisks indicate statistically significant differences (FDR<0.1).

FIGS. 4A-4E—Ranking algorithm and validation identify novel drivers of T cell-mediated intestinal inflammation in an IL-23R dependent manner. FIG. 4a, Identification and ranking of potential novel drivers of intestinal inflammation taking several critical considerations into account. 4 tracks are shown. Track 1: Genes are evaluated based on their expression in vivo in a cluster and genotype specific manner emphasizing clusters 2 and 9. Track 2: Genes are ranked based on their tissue specific expression comparing intestinal and peripheral (splenic) expression. Track 3: Genes are ranked based on their IL-23R dependent expression in vitro following differentiation with IL-12+IL-21+IL-23 (Smart-seq2 data from FIG. 1). Track 4: Genes that are found within an IBD GWAS risk locus are identified contributing to an increased ranking score. See methods for details of ranking. FIG. 4b, Deficiency for CD160 in Th1 cells adoptively transferred into RAG1^−/− recipients protects from colitis. Representative H&E histopathological stainings are shown. FIG. 4c, Intestinal inflammation and colitis are scored in the following way: 0 (healthy)-4 (most severe colitis). Pooled data from three independent experiments are shown for small intestine and proximal colon. Mean+s.e.m. are indicated. FIG. 4d, Colon length in RAG1^−/− recipients of either wildtype or CD160^−/− cells. Pooled data are shown from two independent experiments. FIG. 4e, Gzmb expression is measured by flow cytometry in both Cd160^+/+ and Cd160^−/− Th1 cells prior to adoptive transfer. One experiment. Technical replicates. A t-test was used to determine statistical significance in panels c, d and e.

FIG. 5—Cytokine screen identifies IL-21 as a cytokine that together with IL-12 induces strong expression of IL-23R in Th1 cells in vitro. Applicants isolated naïve T cells from Il23r^wt/eGFP reporter mice and tested 19 different conditions. IL-23R expression was measured by flow cytometry identifying eGFP⁺ cells. Several conditions strongly induced IL-23R expression including the pathogenic Th17 cell condition IL-1β+IL-6+IL-23. The strongest expression of IL-17 was observed with the condition TGF-β+IL-6. Even though IL-21 and IL-6 alone induced IL-23R expression they resulted in the complete lack of IFN-γ expression and showed slight induction of IL-17A. Importantly, both IL-12+IL-21 and IL-12+IL-21+IL-23 induced strong expression of the Th1 cell signature cytokine IFN-γ and complete lack of IL-17A expression.

FIG. 6—Dot plot showing expression of 12 key genes in Th1 and Th17 cell biology across the 4 populations profiled by Smart-seq2. Tbx21, Il12rb2 and Il21r expression appeared largely unaltered by deficiency for Il23r which was consistent with unaltered expression between eGFP⁺ and eGFP⁻ populations. Of note, the expression level of Il23r in knockout cells (Il23r^eGFP/eGFP) is merely reminiscent of the fact that these cells produce mRNA truncated of the essential C-terminal region of IL-23R which was replaced by an IRES-eGFP sequence which results in a functional KO but is detected by Smart-seq2.

FIGS. 7A-7D—IL-23R⁺ Th1 and IL-23R⁺ Th17 cells show both common and unique transcriptional signatures. Pathogenic Th17 cells were differentiated with IL-1β+IL-6+IL-23 and IL-23R⁺ (i.e., eGFP⁺) and IL-23R⁻ (i.e., eGFP⁻) were sorted and then single-cell Smart-seq2 was performed and the transcriptional signatures were compared to Th1 cells differentiated with IL-12+IL-21+IL-23 reported in FIG. 1. FIG. 7a, Th1 cells and Th17 cells show a set of genes that is similarly regulated in both IL-23R⁺ cells from either population. FIG. 7b, Some genes are differentially regulated between IL-23R⁺ and IL-23R⁻ cells in Th1 cells only. FIG. 7c, Some genes show the exact opposite behavior in Th1 and Th17 cells. FIG. 7d, A fourth set of genes was differentially regulated between IL-23R⁺ and IL-23R⁻ cells in Th17 cells only.

FIGS. 8A-8G—Tissue infiltrating CD45⁺CD4⁺ T cells show strong expression of IFN-γ. Flow cytometric analyses of tissue infiltrating T cells isolated from the intestine of recipients of either wildtype or IL-23R KO cells and cultured ON with the cytokines IL-7+IL-23. ICC was performed after restimulation with PMA/ionomycin. FIG. 8a, Colonic LPL cells. Two recipients of wildtype cells (Il23r^eGFP/wt) and one recipient of KO cells (Il23r^eGFP/eGFP) are shown. Gated on viable CD45⁺ cells. FIG. 8b, FIG. 8c ICC for IFN-γ, IL-17A and GMCSF of the two recipients of wildtype cells is shown. FIG. 8d, Colonic IEL cells. One recipient of wildtype cells and one recipient of KO cells are shown. Gated on viable CD45⁺ cells. FIG. 8e, ICC for IFN-γ and IL-17A of the IEL samples. FIG. 8f, FIG. 8g Pooled values of LPL and IEL samples. LPL and IEL samples were isolated and analyzed in independent experiments. Data in panels f and g are mean±SD. Unpaired t-test, p value **<0.01 in panel f.

FIG. 9—Cluster 8 represents highly proliferating cells. UMAPs show that cells of cluster 8 highly express genes critical to cell cycle progression such as Cdc20, Ccnb1 (cyclin B), Cdc6, Cdk1 and the proliferative marker Mki67.

FIGS. 10A-10D—IL-23R negatively impacts the development of regulatory Tr1 cells in the intestinal lamina propria as identified by scRNAseq. FIG. 10a, UMAPs and correlated expression profiles of signature genes of regulatory Tr cells exposing cluster 7. FIG. 10b, Dot plot showing the expression of signature genes in comparison to all other clusters. FIG. 10c, Transcriptional signature of Tr regulatory cells identified by Gruarin et al. (2019) highlights cluster 7. FIG. 10d, Volcano plot highlighting differentially expressed genes between wildtype (Il23r^eGFP/wt) and knockout (II23r^eGFP/eGFP) cells within cluster 7.

FIGS. 11A-11B—In vitro differentiated Th1 cells from either Cd160^+/+ or Cd160^−/− cells do not show a difference in IFN-γ expression prior to adoptive transfer. FIG. 11a, In vitro differentiated Th1 cells do not show a difference in IFN-γ production under culture with IL-12+IL-21+IL-23 between wildtype and CD160 knockout cells. One representative experiment of three independent experiments is shown. FIG. 11b, Pooled data from in vitro differentiated Th1 cells are shown prior to adoptive transfer into RAG1^−/− mice. 3 independent experiments. Mean is shown with SD error bars. All differences are non-significant.

FIG. 12—Overview of T cell and NK cell markers in cells isolated from the intestinal mucosa (LPL) and sequenced by 10× technology. UMAPs of cells sequenced that show uniform expression of CD45, CD3, CD4 and lack expression of NK cell markers such as NK1.1, CD56 and CD16 in addition to the lack of CD8a.

The figures herein are for illustrative purposes only and are not necessarily drawn to scale.

DETAILED DESCRIPTION OF THE EXAMPLE EMBODIMENTS

General Definitions

Unless defined otherwise, technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure pertains. Definitions of common terms and techniques in molecular biology may be found in Molecular Cloning: A Laboratory Manual, 2^nd edition (1989) (Sambrook, Fritsch, and Maniatis); Molecular Cloning: A Laboratory Manual, 4^th edition (2012) (Green and Sambrook); Current Protocols in Molecular Biology (1987) (F. M. Ausubel et al. eds.); the series Methods in Enzymology (Academic Press, Inc.): PCR 2: A Practical Approach (1995) (M. J. MacPherson, B. D. Hames, and G. R. Taylor eds.): Antibodies, A Laboratory Manual (1988) (Harlow and Lane, eds.): Antibodies A Laboratory Manual, 2^nd edition 2013 (E. A. Greenfield ed.); Animal Cell Culture (1987) (R. I. Freshney, ed.); Benjamin Lewin, Genes IX, published by Jones and Bartlet, 2008 (ISBN 0763752223); Kendrew et al. (eds.), The Encyclopedia of Molecular Biology, published by Blackwell Science Ltd., 1994 (ISBN 0632021829); Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 9780471185710); Singleton et al., Dictionary of Microbiology and Molecular Biology 2nd ed., J. Wiley & Sons (New York, N.Y. 1994), March, Advanced Organic Chemistry Reactions, Mechanisms and Structure 4th ed., John Wiley & Sons (New York, N.Y. 1992); and Marten H. Hofker and Jan van Deursen, Transgenic Mouse Methods and Protocols, 2^nd edition (2011).

As used herein, the singular forms “a” “an”, and “the” include both singular and plural referents unless the context clearly dictates otherwise.

The term “optional” or “optionally” means that the subsequent described event, circumstance or substituent may or may not occur, and that the description includes instances where the event or circumstance occurs and instances where it does not.

The recitation of numerical ranges by endpoints includes all numbers and fractions subsumed within the respective ranges, as well as the recited endpoints.

The terms “about” or “approximately” as used herein when referring to a measurable value such as a parameter, an amount, a temporal duration, and the like, are meant to encompass variations of and from the specified value, such as variations of +/−10% or less, +/−5% or less, +/−1% or less, and +/−0.1% or less of and from the specified value, insofar such variations are appropriate to perform in the disclosed invention. It is to be understood that the value to which the modifier “about” or “approximately” refers is itself also specifically, and preferably, disclosed.

As used herein, a “biological sample” may contain whole cells and/or live cells and/or cell debris. The biological sample may contain (or be derived from) a “bodily fluid”. The present invention encompasses embodiments wherein the bodily fluid is selected from amniotic fluid, aqueous humour, vitreous humour, bile, blood serum, breast milk, cerebrospinal fluid, cerumen (earwax), chyle, chyme, endolymph, perilymph, exudates, feces, female ejaculate, gastric acid, gastric juice, lymph, mucus (including nasal drainage and phlegm), pericardial fluid, peritoneal fluid, pleural fluid, pus, rheum, saliva, sebum (skin oil), semen, sputum, synovial fluid, sweat, tears, urine, vaginal secretion, vomit and mixtures of one or more thereof. Biological samples include cell cultures, bodily fluids, cell cultures from bodily fluids. Bodily fluids may be obtained from a mammal organism, for example by puncture, or other collecting or sampling procedures.

The terms “subject,” “individual,” and “patient” are used interchangeably herein to refer to a vertebrate, preferably a mammal, more preferably a human. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets. Tissues, cells and their progeny of a biological entity obtained in vivo or cultured in vitro are also encompassed.

Various embodiments are described hereinafter. It should be noted that the specific embodiments are not intended as an exhaustive description or as a limitation to the broader aspects discussed herein. One aspect described in conjunction with a particular embodiment is not necessarily limited to that embodiment and can be practiced with any other embodiment(s). Reference throughout this specification to “one embodiment”, “an embodiment,” “an example embodiment,” means that a particular feature, structure or characteristic described in connection with the embodiment is included in at least one embodiment of the present invention. Thus, appearances of the phrases “in one embodiment,” “in an embodiment,” or “an example embodiment” in various places throughout this specification are not necessarily all referring to the same embodiment, but may. Furthermore, the particular features, structures or characteristics may be combined in any suitable manner, as would be apparent to a person skilled in the art from this disclosure, in one or more embodiments. Furthermore, while some embodiments described herein include some but not other features included in other embodiments, combinations of features of different embodiments are meant to be within the scope of the invention. For example, in the appended claims, any of the claimed embodiments can be used in any combination.

All publications, published patent documents, and patent applications cited herein are hereby incorporated by reference to the same extent as though each individual publication, published patent document, or patent application was specifically and individually indicated as being incorporated by reference.

Overview

Embodiments disclosed herein provide methods of treating Th1 cell-mediated autoimmune diseases, generating IL-23R⁺ Th1 cells, and detection and modulation of pathogenic and regulatory cell programs. The cytokine receptor IL-23R plays a fundamental role in inflammation and autoimmunity^1-5. However, several observations have been difficult to reconcile under the assumption that only Th17 cells critically depend on IL-23 to acquire a pathogenic phenotype^6,7. To this end, Applicants performed a cytokine screen and discovered that the cytokine combination IL-12+IL-21 strongly induces IL-23R on Th1 cells in vitro. Th1 cells differentiated in vitro with IL-12+IL-21 show similar levels of IL-23R expression as in pathogenic Th17 cells^8,9. Applicants demonstrate that IL-23R is required for Th1 cells to acquire a highly pathogenic/colitogenic phenotype in an adoptive transfer colitis model^3,7. Thus, the Th1 cells were pathogenic. Loss of IL-23R expression on Th1 cells almost completely abrogated the ability of Th1 cells to transfer colitis. Thus, the Th1 cells were non-pathogenic. Using massively parallel single-cell RNA-sequencing (scRNAseq) of intestinal tissue-infiltrating colitogenic Th1 cells, Applicants demonstrated a striking expression of genes that promote inflammation and linked these genes with multiple pathways implicated in the induction of IBD in humans as identified by GWAS analysis. scRNAseq analysis of intestinal T cells enabled identification of novel regulators induced by IL-23R-signaling in Th1 cells which differed from those expressed in Th17 cells^9-11. Applicants identified a number of novel regulators induced by IL-23R-dependent signaling in Th1 cells and demonstrated a critical role for the IL-23R-dependent gene Cd160 in colitis. The perturbation of CD160 in Th1 cells inhibited induction of colitis, validating the role of IL-23R signaling in Th1 cells.

Applicants were able to uncouple IL-23R as a purely Th17 cell-specific factor and implicate IL-23R signaling as a pathogenic driver of Th1 cell-mediated tissue inflammation and disease. Thus, Applicants identified a pathogenic function for IL-23R signaling in Th1 cells that promotes colitis, expanding the importance of this pathway beyond Th17 cells in autoimmune disease and enabling identification of novel targets linked with human IBD for further investigation. The findings provide a reason to target the pathogenic function of IL-23R in autoimmune diseases in which Th1 or other T cell subsets are the main drivers of the disease.

Pathogenic Th1 Cells

The present invention identified pathogenic Th1 cells. As used herein, pathogenic Th1 cells refer to Th1 cells capable of inducing inflammation or an autoimmune response in vivo. In regard to the digestive track, pathogenic Th1 cells are also referred to herein as colitogenic Th1 cells. In certain embodiments, pathogenic Th1 cells are IFN-γ-producing Th1 cells. In certain embodiments, pathogenic Th1 cells are characterized by high expression of IL-23R or are IL-23R+Th1 cells. In certain embodiments, pathogenic Th1 cells express a gene program comprising one or more of IL23R, CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW.

In certain embodiments, pathogenic Th1 cells express a gene program described herein as cluster 2 or LPL-2 (see, Table 3). For example, the top 50 genes differentially expressed for cluster 2 compared to all other Th1 clusters includes Lgals1, Crip1, S100a6, S100a10, Lgals3, S100a4, Itgb1, Emp3, Actg1, Vim, Ifitm1, Rps27, Rps29, Itgb7, Ms4a4b, Junb, Pglyrp1, Lsp1, Cd52, Klrd1, Got1, Odc1, Nkg7, Cd48, Glipr2, Anxa1, Klf2, Pycard, Rps28, AA467197, Ramp3, Rps27rt, Fxyd5, S1pr4, Rgs1, Bin2, Zyx, Anxa2, Tnfrsf4, Ifitm2, Ctla4, Malat1, Crem, Ifitm3, Myl6, Gnal5, Reep5, Rpl12, S1pr1 and Arhgdib (Positive log FC values are associated with genes with higher expression in cluster 2 and negative log FC values are associated with genes with lower expression in cluster 2). As used herein an increase in cluster 2 means an increase in the gene program that includes both upregulated and downregulated genes.

In certain embodiments, pathogenic Th1 cells express a gene program described herein as cluster 9 or LPL-9 (see, Table 3). For example, the top 50 genes differentially expressed for cluster 9 compared to all other Th1 clusters includes Vps37b, Ubald2, Junb, H3f3b, Ifngr1, Bhlhe40, AW112010, Cd52, Tnfrsf4, Eif1, Odc1, Btg1, Tmsb4x, Gramd3, Hspa5, Ctla4, Jund, Dusp5, Pnrc1, Ifrd1, Prr7, Nfkbia, Pim1, Tnfaip3, Bcl2a1b, Tgif1, Icos, Orail, Il21r, Crem, Cd160, Cytip, Btg2, Rgs2, Gna13, Ramp3, Gpr132, Rsrp1, Hspa8, Kdm6b, Dnaja1, Tbc1d10c, Traf1, Got1, Serpinb9, Tnfsf8, Arf4, Dgat1, Fos12 and Sub1 (Positive log FC values are associated with genes with higher expression in cluster 9 and negative log FC values are associated with genes with lower expression in cluster 9). As used herein an increase in cluster 9 means an increase in the gene program that includes both upregulated and downregulated genes.

In certain embodiments, regulatory Th1 cells express a gene signature or gene program described herein as cluster 7 (see, Table 3). In certain embodiments, regulatory Th1 cells are also referred to as non-pathogenic Th1 cells or Tr1-like cells. For example, the top 50 genes differentially expressed for cluster 7 compared to all other Th1 clusters includes Eomes, Gzmk, Cd27, Furin, Ifitm2, Cxcr6, Cc15, Plac8, Esm1, Gm43291, Sh3bgr13, Tnfsf8, Sh2d1a, Bend4, Rgs16, Tmsb4x, Ly6e, Tmsb10, Rpa2, Ifitm3, Nkg7, Tox, Cd52, Emb, Chchd10, Pim1, Lgals1, Vim, Cldnd1, Rgs10, Actn2, Cxcr5, Lgals3, Capg, Rpl41, AA467197, Tapbpl, Ly6a, Il18r1, Saraf, Asb2, Itgb7, Rasgef1a, Klrg1, Tmem176b, Tnfsf11, Dcp1b, Rps27, Fxyd5 and H2afy (Positive log FC values are associated with genes with higher expression in cluster 7 and negative log FC values are associated with genes with lower expression in cluster 7). As used herein an increase in cluster 7 means an increase in the gene program that includes both upregulated and downregulated genes.

As used herein an increase in a cluster means an increase in the gene program that includes both upregulated and downregulated genes (i.e., there is an increase in Th1 cells expressing the program or the expression of genes in a cell is shifted closer to the gene program than in a control or to any other programs). Clusters as described herein can also be described as a metagene. As used herein a “metagene” refers to a pattern or aggregate of gene expression and not an actual gene. Each metagene may represent a collection or aggregate of genes behaving in a functionally correlated fashion within the genome. The metagene can be increased if the pattern is increased. As used herein the term “gene program” or “program” can be used interchangeably with “biological program”, “expression program”, “transcriptional program”, “expression profile”, “signature”, “gene signature” or “expression program” and may refer to a set of genes that share a role in a biological function (e.g., an activation program, cell differentiation program, proliferation program). Biological programs can include a pattern of gene expression that result in a corresponding physiological event or phenotypic trait (e.g., inflammation). Biological programs can include up to several hundred genes that are expressed in a spatially and temporally controlled fashion. Expression of individual genes can be shared between biological programs. Expression of individual genes can be shared among different single cell types; however, expression of a biological program may be cell type specific or temporally specific (e.g., the biological program is expressed in a cell type at a specific time). Multiple biological programs may include the same gene, reflecting the gene's roles in different processes. Expression of a biological program may be regulated by a master switch, such as a nuclear receptor or transcription factor.

As used herein a “signature” or “gene program” may encompass any gene or genes, protein or proteins, or epigenetic element(s) whose expression profile or whose occurrence is associated with a specific cell type, subtype, or cell state of a specific cell type or subtype within a population of cells. For ease of discussion, when discussing gene expression, any of gene or genes, protein or proteins, or epigenetic element(s) may be substituted. Levels of expression or activity or prevalence may be compared between different cells in order to characterize or identify for instance signatures specific for cell (sub)populations. Increased or decreased expression or activity or prevalence of signature genes may be compared between different cells in order to characterize or identify for instance specific cell (sub)populations. The detection of a signature in single cells may be used to identify and quantitate for instance specific cell (sub)populations. A signature may include a gene or genes, protein or proteins, or epigenetic element(s) whose expression or occurrence is specific to a cell (sub)population, such that expression or occurrence is exclusive to the cell (sub)population. A gene signature as used herein, may thus refer to any set of up- and down-regulated genes that are representative of a cell type or subtype. A gene signature as used herein, may also refer to any set of up- and down-regulated genes between different cells or cell (sub)populations derived from a gene-expression profile. For example, a gene signature may comprise a list of genes differentially expressed in a distinction of interest.

The signature as defined herein (being it a gene signature, protein signature or other genetic or epigenetic signature) can be used to indicate the presence of a cell type, a subtype of the cell type, the state of the microenvironment of a population of cells, a particular cell type population or subpopulation, and/or the overall status of the entire cell (sub)population. Furthermore, the signature may be indicative of cells within a population of cells in vivo. The signature may also be used to suggest for instance particular therapies, or to follow up treatment, or to suggest ways to modulate immune systems. The presence of subtypes or cell states may be determined by subtype specific or cell state specific signatures. The presence of these specific cell (sub)types or cell states may be determined by applying the signature genes to bulk sequencing data in a sample. Not being bound by a theory the signatures of the present invention may be microenvironment specific, such as their expression in a particular spatio-temporal context. Not being bound by a theory, signatures as discussed herein are specific to a particular pathological context. Not being bound by a theory, a combination of cell subtypes having a particular signature may indicate an outcome. Not being bound by a theory, the signatures can be used to deconvolute the network of cells present in a particular pathological condition. Not being bound by a theory the presence of specific cells and cell subtypes are indicative of a particular response to treatment, such as including increased or decreased susceptibility to treatment. The signature may indicate the presence of one particular cell type. In one embodiment, the novel signatures are used to detect multiple cell states or hierarchies that occur in subpopulations of immune cells that are linked to particular pathological condition (e.g., inflammation), or linked to a particular outcome or progression of the disease (e.g., autoimmunity), or linked to a particular response to treatment of the disease.

The signature according to certain embodiments of the present invention may comprise or consist of one or more genes, proteins and/or epigenetic elements, such as for instance 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of two or more genes, proteins and/or epigenetic elements, such as for instance 2, 3, 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of three or more genes, proteins and/or epigenetic elements, such as for instance 3, 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of four or more genes, proteins and/or epigenetic elements, such as for instance 4, 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of five or more genes, proteins and/or epigenetic elements, such as for instance 5, 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of six or more genes, proteins and/or epigenetic elements, such as for instance 6, 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of seven or more genes, proteins and/or epigenetic elements, such as for instance 7, 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of eight or more genes, proteins and/or epigenetic elements, such as for instance 8, 9, 10 or more. In certain embodiments, the signature may comprise or consist of nine or more genes, proteins and/or epigenetic elements, such as for instance 9, 10 or more. In certain embodiments, the signature may comprise or consist of ten or more genes, proteins and/or epigenetic elements, such as for instance 10, 11, 12, 13, 14, 15, or more. It is to be understood that a signature according to the invention may for instance also include genes or proteins as well as epigenetic elements combined.

It is to be understood that “differentially expressed” genes/proteins include genes/proteins which are up- or down-regulated as well as genes/proteins which are turned on or off. When referring to up-or down-regulation, in certain embodiments, such up- or down-regulation is preferably at least two-fold, such as two-fold, three-fold, four-fold, five-fold, or more, such as for instance at least ten-fold, at least 20-fold, at least 30-fold, at least 40-fold, at least 50-fold, or more. Alternatively, or in addition, differential expression may be determined based on common statistical tests, as is known in the art.

As discussed herein, differentially expressed genes/proteins, or differential epigenetic elements may be differentially expressed on a single cell level, or may be differentially expressed on a cell population level. Preferably, the differentially expressed genes/proteins or epigenetic elements as discussed herein, such as constituting the gene signatures as discussed herein, when as to the cell population level, refer to genes that are differentially expressed in all or substantially all cells of the population (such as at least 80%, preferably at least 90%, such as at least 95% of the individual cells). This allows one to define a particular subpopulation of tumor cells. As referred to herein, a “subpopulation” of cells preferably refers to a particular subset of cells of a particular cell type which can be distinguished or are uniquely identifiable and set apart from other cells of this cell type. The cell subpopulation may be phenotypically characterized, and is preferably characterized by the signature as discussed herein. A cell (sub)population as referred to herein may constitute of a (sub)population of cells of a particular cell type characterized by a specific cell state.

When referring to induction, or alternatively suppression of a particular signature, preferable is meant induction or alternatively suppression (or upregulation or downregulation) of at least one gene/protein and/or epigenetic element of the signature, such as for instance at least two, at least three, at least four, at least five, at least six, or all genes/proteins and/or epigenetic elements of the signature.

As used herein, all gene name symbols refer to the gene as commonly known in the art. The examples described herein that refer to the mouse gene names are to be understood to also encompasses human genes, as well as genes in any other organism (e.g., homologous, orthologous genes). Mouse gene symbols are generally italicized, with only the first letter in upper-case (e.g., 1123). Mouse protein symbols are generally not italicized, and all letters are in upper-case (e.g., IL-23). As used herein mouse gene symbols may be shown with only the first letter in upper-case and not italicized (e.g., 11123). Any reference to the gene symbol is a reference made to the entire gene or variants of the gene. Any reference to the gene symbol is also a reference made to the gene product (e.g., protein). The term, homolog, may apply to the relationship between genes separated by the event of speciation (e.g., ortholog). Orthologs are genes in different species that evolved from a common ancestral gene by speciation. Normally, orthologs retain the same function in the course of evolution. Gene symbols may be those referred to by the HUGO Gene Nomenclature Committee (HGNC) or National Center for Biotechnology Information (NCBI). The signature as described herein may encompass any of the genes described herein.

Functional T Cell Immune States

The present invention relates to immune cell balance and function, in particular Th1 cell pathogenicity or non-pathogenicty. In general, aberrant immune balance can lead to autoimmunity when the immune response is too strong and cancer when the immune response is suppressed. An immune response can include the interaction of several immune cell types and different immune responses can be mediated by specific immune cells. In certain embodiments, T cells can affect the overall immune state, such as other immune cells in proximity.

The term “immune cell” as used throughout this specification generally encompasses any cell derived from a hematopoietic stem cell that plays a role in the immune response. The term is intended to encompass immune cells both of the innate or adaptive immune system. The immune cell as referred to herein may be a leukocyte, at any stage of differentiation (e.g., a stem cell, a progenitor cell, a mature cell) or any activation stage. Immune cells include lymphocytes (such as natural killer cells, T-cells (including, e.g., thymocytes, Th or Tc; Th1, Th2, Th17, Thαβ, CD4+, CD8+, effector Th, memory Th, regulatory Th, CD4+/CD8+ thymocytes, CD4−/CD8− thymocytes, γδ T cells, etc.) or B-cells (including, e.g., pro-B cells, early pro-B cells, late pro-B cells, pre-B cells, large pre-B cells, small pre-B cells, immature or mature B-cells, producing antibodies of any isotype, T1 B-cells, T2, B-cells, naïve B-cells, GC B-cells, plasmablasts, memory B-cells, plasma cells, follicular B-cells, marginal zone B-cells, B-1 cells, B-2 cells, regulatory B cells, etc.), such as for instance, monocytes (including, e.g., classical, non-classical, or intermediate monocytes), (segmented or banded) neutrophils, eosinophils, basophils, mast cells, histiocytes, microglia, including various subtypes, maturation, differentiation, or activation stages, such as for instance hematopoietic stem cells, myeloid progenitors, lymphoid progenitors, myeloblasts, promyelocytes, myelocytes, metamyelocytes, monoblasts, promonocytes, lymphoblasts, prolymphocytes, small lymphocytes, macrophages (including, e.g., Kupffer cells, stellate macrophages, M1 or M2 macrophages), (myeloid or lymphoid) dendritic cells (including, e.g., Langerhans cells, conventional or myeloid dendritic cells, plasmacytoid dendritic cells, mDC-1, mDC-2, Mo-DC, HP-DC, veiled cells), granulocytes, polymorphonuclear cells, antigen-presenting cells (APC), etc.

As used throughout this specification, “immune response” refers to a response by a cell of the immune system, such as a B cell, T cell (CD4+ or CD8+), regulatory T cell, antigen-presenting cell, dendritic cell, monocyte, macrophage, NKT cell, NK cell, basophil, eosinophil, or neutrophil, to a stimulus. In some embodiments, the response is specific for a particular antigen (an “antigen-specific response”), and refers to a response by a CD4 T cell, CD8 T cell, or B cell via their antigen-specific receptor. In some embodiments, an immune response is a T cell response, such as a CD4+ response or a CD8+ response. Such responses by these cells can include, for example, cytotoxicity, proliferation, cytokine or chemokine production, trafficking, or phagocytosis, and can be dependent on the nature of the immune cell undergoing the response.

T cell response refers more specifically to an immune response in which T cells directly or indirectly mediate or otherwise contribute to an immune response in a subject. T cell-mediated response may be associated with cell mediated effects, cytokine mediated effects, and even effects associated with B cells if the B cells are stimulated, for example, by cytokines secreted by T cells. By means of an example but without limitation, effector functions of NMC class I restricted Cytotoxic T lymphocytes (CTLs), may include cytokine and/or cytolytic capabilities, such as lysis of target cells presenting an antigen peptide recognized by the T cell receptor (naturally-occurring TCR or genetically engineered TCR, e.g., chimeric antigen receptor, CAR), secretion of cytokines, preferably IFN gamma, TNF alpha and/or or more immunostimulatory cytokines, such as IL-2, and/or antigen peptide-induced secretion of cytotoxic effector molecules, such as granzymes, perforins or granulysin. By means of example but without limitation, for NMC class II restricted T helper (Th) cells, effector functions may be antigen peptide-induced secretion of cytokines, preferably, IFN gamma, TNF alpha, IL-4, IL5, IL-10, and/or IL-2. By means of example but without limitation, for T regulatory (Treg) cells, effector functions may be antigen peptide-induced secretion of cytokines, preferably, IL-10, IL-35, and/or TGF-beta. B cell response refers more specifically to an immune response in which B cells directly or indirectly mediate or otherwise contribute to an immune response in a subject. Effector functions of B cells may include in particular production and secretion of antigen-specific antibodies by B cells (e.g., polyclonal B cell response to a plurality of the epitopes of an antigen (antigen-specific antibody response)), antigen presentation, and/or cytokine secretion.

During persistent immune activation, such as during uncontrolled tumor growth or chronic infections, subpopulations of immune cells, particularly of CD8+ or CD4+ T cells, become compromised to different extents with respect to their cytokine and/or cytolytic capabilities. Such immune cells, particularly CD8+ or CD4+ T cells, are commonly referred to as “dysfunctional” or as “functionally exhausted” or “exhausted”. As used herein, the term “dysfunctional” or “functional exhaustion” refer to a state of a cell where the cell does not perform its usual function or activity in response to normal input signals, and includes refractivity of immune cells to stimulation, such as stimulation via an activating receptor or a cytokine. Such a function or activity includes, but is not limited to, proliferation (e.g., in response to a cytokine, such as IFN-gamma) or cell division, entrance into the cell cycle, cytokine production, cytotoxicity, migration and trafficking, phagocytotic activity, or any combination thereof. Normal input signals can include, but are not limited to, stimulation via a receptor (e.g., T cell receptor, B cell receptor, co-stimulatory receptor). Unresponsive immune cells can have a reduction of at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or even 100% in cytotoxic activity, cytokine production, proliferation, trafficking, phagocytotic activity, or any combination thereof, relative to a corresponding control immune cell of the same type. In some particular embodiments of the aspects described herein, a cell that is dysfunctional is a CD8+ T cell that expresses the CD8+ cell surface marker. Such CD8+ cells normally proliferate and produce cell killing enzymes, e.g., they can release the cytotoxins perforin, granzymes, and granulysin. However, exhausted/dysfunctional T cells do not respond adequately to TCR stimulation, and display poor effector function, sustained expression of inhibitory receptors and a transcriptional state distinct from that of functional effector or memory T cells. Dysfunction/exhaustion of T cells thus prevents optimal control of infection and tumors. Exhausted/dysfunctional immune cells, such as T cells, such as CD8+ T cells, may produce reduced amounts of IFN-gamma, TNF-alpha and/or one or more immunostimulatory cytokines, such as IL-2, compared to functional immune cells. Exhausted/dysfunctional immune cells, such as T cells, such as CD8+ T cells, may further produce (increased amounts of) one or more immunosuppressive transcription factors or cytokines, such as IL-10 and/or Foxp3, compared to functional immune cells, thereby contributing to local immunosuppression. Dysfunctional CD8+ T cells can be both protective and detrimental against disease control. As used herein, a “dysfunctional immune state” refers to an overall suppressive immune state in a subject or microenvironment of the subject (e.g., tumor microenvironment). For example, increased IL-10 production leads to suppression of other immune cells in a population of immune cells.

CD8+ T cell function is associated with their cytokine profiles. It has been reported that effector CD8+ T cells with the ability to simultaneously produce multiple cytokines (polyfunctional CD8+ T cells) are associated with protective immunity in patients with controlled chronic viral infections as well as cancer patients responsive to immune therapy (Spranger et al., 2014, J. Immunother. Cancer, vol. 2, 3). In the presence of persistent antigen CD8+ T cells were found to have lost cytolytic activity completely over time (Moskophidis et al., 1993, Nature, vol. 362, 758-761). It was subsequently found that dysfunctional T cells can differentially produce IL-2, TNFa and IFNg in a hierarchical order (Wherry et al., 2003, J. Virol., vol. 77, 4911-4927). Decoupled dysfunctional and activated CD8+ cell states have also been described (see, e.g., Singer, et al. (2016). A Distinct Gene Module for Dysfunction Uncoupled from Activation in Tumor-Infiltrating T Cells. Cell 166, 1500-1511 e1509; WO/2017/075478; and WO/2018/049025).

The invention provides compositions and methods for modulating T cell balance, in particular Th1 cell pathogenicity (i.e., balance between pathogenic and non-pathogenic Th1 cells). The invention provides T cell modulating agents that modulate T cell balance. For example, in some embodiments, the invention provides T cell modulating agents and methods of using these T cell modulating agents to regulate, influence or otherwise impact the level of and/or balance of Th1 cells. For example, in some embodiments, the invention provides T cell modulating agents and methods of using these T cell modulating agents to regulate, influence or otherwise impact the level of and/or balance between Th1 activity and inflammatory potential. As used herein, terms such as “Th1 cell” and/or “Th1 phenotype” and all grammatical variations thereof refer to a differentiated T helper cell that expresses interferon gamma (IFNγ). Further, Th1 cells are characterized as expressing IFN-γ, IL-2, lymphotoxin (LT) and the master transcription factor T-bet but do not produce IL-17A, the signature cytokine of Th17 cells.

In certain embodiments, Th17 balance is modified in combination with Th1 cells. As used herein, terms such as “Th17 cell” and/or “Th17 phenotype” and all grammatical variations thereof refer to a differentiated T helper cell that expresses one or more cytokines selected from the group the consisting of interleukin 17A (IL-17A), interleukin 17F (IL-17F), and interleukin 17A/F heterodimer (IL17-AF). As used herein, terms such as “Th2 cell” and/or “Th2 phenotype” and all grammatical variations thereof refer to a differentiated T helper cell that expresses one or more cytokines selected from the group the consisting of interleukin 4 (IL-4), interleukin 5 (IL-5) and interleukin 13 (IL-13). As used herein, terms such as “Treg cell” and/or “Treg phenotype” and all grammatical variations thereof refer to a differentiated T cell that expresses Foxp3.

Depending on the cytokines used for differentiation, in vitro polarized Th17 cells can either cause severe autoimmune responses upon adoptive transfer (‘pathogenic Th17 cells’) or have little or no effect in inducing autoimmune disease (‘non-pathogenic cells’) (Ghoreschi et al., 2010; and Lee et al., 2012 “Induction and molecular signature of pathogenic Th17 cells,” Nature Immunology, vol. 13(10): 991-999). In vitro differentiation of naïve CD4 T cells in the presence of TGF-β1+IL-6 induces an IL-17A and IL-10 producing population of Th17 cells, that are generally nonpathogenic, whereas activation of naïve T cells in the presence of IL-1β+IL-6+IL-23 or TGF-β3+IL-6 induces a T cell population that produces IL-17A and IFN-γ, and are potent inducers of autoimmune disease induction (Ghoreschi et al., 2010, Lee et al., 2012).

As used herein, terms such as “pathogenic Th17 cell” and/or “pathogenic Th17 phenotype” and all grammatical variations thereof refer to Th17 cells that, exhibit a distinct pathogenic signature where one or more of the following genes or products of these genes is upregulated in Th17 cells: Cxcl3, Il22, Il3, Ccl4, Gzmb, Lrmp, Cc15, Casp1, Csf2, Ccl3, Tbx21, Icos, Il7r, Stat4, Lgals3 or Lag3. In certain embodiments, the pathogenic signature is elevated in TGF-β3-induced Th17 cells as compared to TGF-β1-induced Th17 cells. As used herein, terms such as “non-pathogenic Th17 cell” and/or “non-pathogenic Th17 phenotype” and all grammatical variations thereof refer to Th17 cells that exhibit a distinct non-pathogenic signature where one or more of the following genes or products of these genes is up-regulated in Th17 cells: Il6st, Il1rn, lkzf3, Maf, Ahr, Il9 or Il10. In certain embodiments, the non-pathogenic signature is elevated in TGF-β1-induced Th17 cells as compared to TGF-β3-induced Th17 cells. In certain embodiments, when induced in the presence of TGF-β3, Th17 cells express a decreased level of one or more genes selected from IL6st, IL1rn, Ikzf3, Maf, Ahr, IL9 and IL10, as compared to the level of expression in TGF-β3-induced Th17 cells.

A dynamic regulatory network controls Th17 differentiation (See e.g., Yosef et al., Dynamic regulatory network controlling Th17 cell differentiation, Nature, vol. 496: 461-468 (2013); Wang et al., CD5L/AIM Regulates Lipid Biosynthesis and Restrains Th17 Cell Pathogenicity, Cell Volume 163, Issue 6, p 1413-1427, 3 Dec. 2015; Gaublomme et al., Single-Cell Genomics Unveils Critical Regulators of Th17 Cell Pathogenicity, Cell Volume 163, Issue 6, p 1400-1412, 3 Dec. 2015; and International publication numbers WO2016138488A2, WO2015130968, WO/2012/048265, WO/2014/145631 and WO/2014/134351, the contents of which are hereby incorporated by reference in their entirety).

Diseases

In certain embodiments, diseases or conditions are treated, monitored or detected. In certain embodiments, diseases relevant to the present invention are caused by pathogenic Th1 cells or are capable of being controlled by pathogenic Th1 cells. In certain embodiments, the diseases are associated with IL-23 or IL-23R.

In certain embodiments, the diseases are associated with IL-23R by genome wide association studies (GWAS) (e.g., Duerr R H, Taylor K D, Brant S R, et al. A genome-wide association study identifies TL23R as an inflammatory bowel disease gene. Science. 2006; 314(5804):1461-1463; Zhu W, Deng Y, Zhou X. Multiple Membrane Transporters and Some Immune Regulatory Genes are Major Genetic Factors to Gout. Open Rheumatol J. 2018; 12:94-113; Peng L L, Wang Y, Zhu F L, Xu W D, Ji X L, Ni J. IL-23R mutation is associated with ulcerative colitis: A systemic review and meta-analysis. Oncotarget. 2017; 8(3):4849-4863; Zhang F, Liu H, Chen S, et al. Identification of two new loci at IL23R and RAB32 that influence susceptibility to leprosy. Nat Genet. 2011; 43(12):1247-1251; Mizuki N, Meguro A, Ota M, et al. Genome-wide association studies identify IL23R-IL12RB2 and IL10 as Behçet's disease susceptibility loci. Nat Genet. 2010; 42(8):703-706; and Remmers E F, Cosan F, Kirino Y, et al. Genome-wide association study identifies variants in the MHC class I, IL10, and IL23R-IL12RB2 regions associated with Behçet's disease. Nat Genet. 2010; 42(8):698-702). For example, shifting Th1 cell pathogenicity may be used to treat ankylosing spondylitis, psoriasis, ulcerative colitis, Crohn's disease, sclerosing cholangitis, inflammatory bowel disease (IBD), adolescent idiopathic scoliosis, autoimmune thyroid disease, type I diabetes mellitus, Common variable immunodeficiency, celiac disease, juvenile idiopathic arthritis, systemic lupus erythematosus, malaria, psoriatic arthritis, anterior uveitis, type II diabetes mellitus, psoriasis vulgaris or tuberculosis (see, e.g., Buniello, et al. The NHGRI-EBI GWAS Catalog of published genome-wide association studies, targeted arrays and summary statistics 2019. Nucleic Acids Research, 2019, Vol. 47 (Database issue): D1005-D1012).

In certain embodiments, autoimmune or inflammatory diseases are treated, monitored or detected. As used throughout the present specification, the terms “autoimmune disease” or “autoimmune disorder” used interchangeably refer to a diseases or disorders caused by an immune response against a self-tissue or tissue component (self-antigen) and include a self-antibody response and/or cell-mediated response. The terms encompass organ-specific autoimmune diseases, in which an autoimmune response is directed against a single tissue, as well as non-organ specific autoimmune diseases, in which an autoimmune response is directed against a component present in two or more, several or many organs throughout the body. Examples of autoimmune diseases include but are not limited to acute disseminated encephalomyelitis (ADEM); Addison's disease; ankylosing spondylitis; antiphospholipid antibody syndrome (APS); aplastic anemia; autoimmune gastritis; autoimmune hepatitis; autoimmune thrombocytopenia; Behçet's disease; coeliac disease; dermatomyositis; diabetes mellitus type I; Goodpasture's syndrome; Graves' disease; Guillain-Barre syndrome (GBS); Hashimoto's disease; idiopathic thrombocytopenic purpura; inflammatory bowel disease (IBD) including Crohn's disease and ulcerative colitis; mixed connective tissue disease; multiple sclerosis (MS); myasthenia gravis; opsoclonus myoclonus syndrome (OMS); optic neuritis; Ord's thyroiditis; pemphigus; pernicious anaemia; polyarteritis nodosa; polymyositis; primary biliary cirrhosis; primary myoxedema; psoriasis; rheumatic fever; rheumatoid arthritis; Reiter's syndrome; scleroderma; Sjögren's syndrome; systemic lupus erythematosus; Takayasu's arteritis; temporal arteritis; vitiligo; warm autoimmune hemolytic anemia; or Wegener's granulomatosis.

Examples of inflammatory diseases or disorders include, but are not limited to, asthma, allergy, allergic rhinitis, allergic airway inflammation, atopic dermatitis (AD), chronic obstructive pulmonary disease (COPD), inflammatory bowel disease (IBD), Irritable bowel syndrome (IBS), multiple sclerosis, arthritis, psoriasis, eosinophilic esophagitis, eosinophilic pneumonia, eosinophilic psoriasis, hypereosinophilic syndrome, graft-versus-host disease, uveitis, cardiovascular disease, pain, multiple sclerosis, lupus, vasculitis, chronic idiopathic urticaria and Eosinophilic Granulomatosis with Polyangiitis (Churg-Strauss Syndrome).

In certain embodiments, cancer is treated by increasing Th1 pathogenicity or a cancer treatment is monitored by detecting Th1 pathogenicity. The cancer may include, without limitation, liquid tumors such as leukemia (e.g., acute leukemia, acute lymphocytic leukemia, acute myelocytic leukemia, acute myeloblastic leukemia, acute promyelocytic leukemia, acute myelomonocytic leukemia, acute monocytic leukemia, acute erythroleukemia, chronic leukemia, chronic myelocytic leukemia, chronic lymphocytic leukemia), polycythemia vera, lymphoma (e.g., Hodgkin's disease, non-Hodgkin's disease), Waldenstrom's macroglobulinemia, heavy chain disease, or multiple myeloma.

The cancer may include, without limitation, solid tumors such as sarcomas and carcinomas. Examples of solid tumors include, but are not limited to fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, epithelial carcinoma, bronchogenic carcinoma, hepatoma, colorectal cancer (e.g., colon cancer, rectal cancer), anal cancer, pancreatic cancer (e.g., pancreatic adenocarcinoma, islet cell carcinoma, neuroendocrine tumors), breast cancer (e.g., ductal carcinoma, lobular carcinoma, inflammatory breast cancer, clear cell carcinoma, mucinous carcinoma), ovarian carcinoma (e.g., ovarian epithelial carcinoma or surface epithelial-stromal tumour including serous tumour, endometrioid tumor and mucinous cystadenocarcinoma, sex-cord-stromal tumor), prostate cancer, liver and bile duct carcinoma (e.g., hepatocelluar carcinoma, cholangiocarcinoma, hemangioma), choriocarcinoma, seminoma, embryonal carcinoma, kidney cancer (e.g., renal cell carcinoma, clear cell carcinoma, Wilm's tumor, nephroblastoma), cervical cancer, uterine cancer (e.g., endometrial adenocarcinoma, uterine papillary serous carcinoma, uterine clear-cell carcinoma, uterine sarcomas and leiomyosarcomas, mixed mullerian tumors), testicular cancer, germ cell tumor, lung cancer (e.g., lung adenocarcinoma, squamous cell carcinoma, large cell carcinoma, bronchioloalveolar carcinoma, non-small-cell carcinoma, small cell carcinoma, mesothelioma), bladder carcinoma, signet ring cell carcinoma, cancer of the head and neck (e.g., squamous cell carcinomas), esophageal carcinoma (e.g., esophageal adenocarcinoma), tumors of the brain (e.g., glioma, glioblastoma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodenroglioma, schwannoma, meningioma), neuroblastoma, retinoblastoma, neuroendocrine tumor, melanoma, cancer of the stomach (e.g., stomach adenocarcinoma, gastrointestinal stromal tumor), or carcinoids. Lymphoproliferative disorders are also considered to be proliferative diseases.

In Vitro Differentiated Pathogenic Th1 Cells

In certain embodiments, pathogenic Th1 cells can be obtained by differentiating naïve CD4+ T cells in vitro. The naïve T cells may be obtained from a healthy donor subject. The naïve T cells may be obtained from a subject suffering from an aberrant immune response. The naïve T cells may be obtained from a subject suffering from cancer. The naïve T cells may be obtained from an animal model, such as a mouse model. In certain embodiments, the mouse model is a model of any disease described herein. T cells may be obtained from the spleen or lymph nodes. The T cells may be obtained from a blood sample. CD4⁺ T cells can be enriched using any method commonly used in the art, such as microbeads. Naïve CD4⁺ T cells can be isolated using any method known in the art, such as cell sorting. In certain embodiments, naïve CD4+ T cells (CD4⁺CD44^lowCD62L^highCD25⁻) can be isolated by fluorescence-activated cell sorting (FACS). In certain embodiments, naïve CD4+ T cells are activated (e.g., with anti-CD3 and anti-CD28 antibodies). In certain embodiments, naïve CD4+ T cells are differentiated with cytokines. In certain embodiments, pathogenic Th1 cells are obtained by differentiating with IL-12 and IL-21. In certain embodiments, pathogenic Th1 cells are obtained by differentiating with IL-12, IL-21 and IL-23. Recombinant cytokines are commercially available.

The differentiated pathogenic Th1 cells may be used for various applications described further herein. For example, in methods of screening for agents capable of shifting Th1 pathogenicity or for adoptive transfer. In certain embodiments, adoptively transferred pathogenic Th1 cells can be used to enhance anti-tumor immunity. In certain embodiments, the Th1 cells are specific for a tumor antigen as described herein.

Therapeutic Methods

In certain embodiments, shifting Th1 pathogenicity can be used in a therapeutic method (i.e., treatment) to decrease or increase an immune response. In certain embodiments, autoimmune diseases are treated by specifically targeting pathogenic Th1 cells or decreasing pathogenic Th1 cells. In certain embodiments, cancer is treated by specifically targeting Th1 cells or increasing pathogenic Th1 cells. Targeting Th1 cells can be performed by targeting specific pathogenic Th1 cell programs or markers, as described herein. In certain embodiments, surface markers are targeted. In certain embodiments, CD160 expression or activity is inhibited to decrease Th1 pathogenicity. In certain embodiments, CD160 expression or activity is enhanced or activated to increase Th1 pathogenicity. In certain embodiments, one or markers selected from CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW is targeted by one or more therapeutic agents. In certain embodiments, Th1 cells are targeted with one or more therapeutic agents. In certain embodiments, small molecules may be used to inhibit a target that has enzymatic activity. In certain embodiments, binding molecules, such as antibodies, are used to target surface proteins.

As used herein, “treatment” or “treating,” or “palliating” or “ameliorating” are used interchangeably. These terms refer to an approach for obtaining beneficial or desired results including but not limited to a therapeutic benefit and/or a prophylactic benefit. By therapeutic benefit is meant any therapeutically relevant improvement in or effect on one or more diseases, conditions, or symptoms under treatment. For prophylactic benefit, the compositions may be administered to a subject at risk of developing a particular disease, condition, or symptom, or to a subject reporting one or more of the physiological symptoms of a disease, even though the disease, condition, or symptom may not have yet been manifested. As used herein “treating” includes ameliorating, curing, preventing it from becoming worse, slowing the rate of progression, or preventing the disorder from re-occurring (i.e., to prevent a relapse).

In certain embodiments, diabetes is treated. Type 1 diabetes is an autoimmune disease where the insulin-producing beta cells in the pancreas are wrongly detected as foreign and destroyed by the immune system (e.g., pathogenic Th1 cells). In certain embodiments, Type I diabetes can be treated at two main stages of the disease process—prior to clinical onset but after the appearance of islet autoantibodies (secondary prevention) and immediately after diagnosis (intervention) (see, e.g., Staeva-Vieira T, Peakman M, von Herrath M. Translational mini-review series on type 1 diabetes: Immune-based therapeutic approaches for type 1 diabetes [published correction appears in Clin Exp Immunol. 2007 July; 149(1):203]. Clin Exp Immunol. 2007; 148(1):17-31). At the intervention stage there is still residual beta cell mass (about 15-20%). Id.

In certain embodiments, IBD is treated by targeting pathogenic Th1 cells. Inflammatory bowel disease (IBD) is a chronic disabling inflammatory process that affects mainly the gastrointestinal tract and may present associated extraintestinal manifestations (see, e.g., Catalan-Serra I, Brenna Ø. Immunotherapy in inflammatory bowel disease: Novel and emerging treatments. Hum Vaccin Immunother. 2018; 14(11):2597-2611). IBD includes both ulcerative colitis (UC) and Crohn's disease (CD). Id. The IL-23 pathway is altered in both conditions. Id Current pharmacological treatments used in clinical practice like thiopurines or anti-TNF are effective but can produce significant side effects and their efficacy may diminish over time. Id. The current treatment of IBD includes mesalazine (oral and rectal formulations), glucocorticoids (conventional and other forms like budesonide or beclomethasone), antibiotics (typically ciprofloxacine and metronidazole), immunosuppressants (mostly azathioprine/6-mercaptopurine or methotrexate) and anti-TNF agents (infliximab, adalimumab, certolizumab pegol and golimumab). Recently, the anti-integrin antibody vedolizumab and the antibody against IL-12/23 ustekinumab have been approved for IBD. Id. In certain embodiments, targeting pathogenic Th1 cells can be used to control inflammation in IBD without producing significant side effects. In certain embodiments, the treatment as described herein is administered in combination with the current treatments, such that side effects are diminished. In certain embodiments, the standard doses can be decreased in such combination treatments.

In certain embodiments, the present invention provides for one or more therapeutic agents against one or more of the targets identified. In certain embodiments, the one or more agents comprises a small molecule inhibitor, small molecule degrader (e.g., ATTEC, AUTAC, LYTAC, or PROTAC), genetic modifying agent, antibody, antibody fragment, antibody-like protein scaffold, aptamer, protein, or any combination thereof.

The terms “therapeutic agent”, “therapeutic capable agent” or “treatment agent” are used interchangeably and refer to a molecule or compound that confers some beneficial effect upon administration to a subject. The beneficial effect includes enablement of diagnostic determinations; amelioration of a disease, symptom, disorder, or pathological condition; reducing or preventing the onset of a disease, symptom, disorder or condition; and generally counteracting a disease, symptom, disorder or pathological condition.

In certain embodiments, the therapeutic agents are administered in an effective amount or therapeutically effective amount. The term “effective amount” or “therapeutically effective amount” refers to the amount of an agent that is sufficient to effect beneficial or desired results. The therapeutically effective amount may vary depending upon one or more of: the subject and disease condition being treated, the weight and age of the subject, the severity of the disease condition, the manner of administration and the like, which can readily be determined by one of ordinary skill in the art. The term also applies to a dose that will provide an image for detection by any one of the imaging methods described herein. The specific dose may vary depending on one or more of: the particular agent chosen, the dosing regimen to be followed, whether it is administered in combination with other compounds, timing of administration, the tissue to be imaged, and the physical delivery system in which it is carried.

In certain embodiments, an agent against one of the targets is used in combination with a treatment already be known or used clinically. In certain embodiments, targeting the combination may require less of the agent as compared to the current standard of care and provide for less toxicity and improved treatment. The term “standard of care” as used herein refers to the current treatment that is accepted by medical experts as a proper treatment for a certain type of disease and that is widely used by healthcare professionals. Standard of care is also called best practice, standard medical care, and standard therapy.

In certain embodiments, the agents are used to modulate cell types in vivo. In certain embodiments, the agents are used to modulate cell types in vitro. For example, the agents may be used to modulate cells for adoptive cell transfer.

CD160

In certain embodiments, CD160 is targeted for shifting Th1 cell pathogenicity. In certain embodiments, inhibiting CD160 reduces Th1 pathogenicity and enhancing CD160 increases Th1 pathogenicity. As used herein CD160 (also known as, BY55, NK1, NK28) refers to the CD160 molecule. Exemplary sequences include NCBI accession numbers NM_007053.4 and NP_008984.1. CD160 is a glycoprotein and ligand for Herpesvirus entry mediator (HVEM), also known as tumor necrosis factor receptor superfamily member 14 (TNFRSF14), and considered a proposed immune checkpoint inhibitor with anti-cancer activity along with anti-PD-1 antibodies (Stecher C, Battin C, Leitner J, et al. PD-1 Blockade Promotes Emerging Checkpoint Inhibitors in Enhancing T Cell Responses to Allogeneic Dendritic Cells. Front Immunol. 2017; 8:572). Blocking checkpoint inhibitors enhances an immune response. The present invention shows for the first time that CD160 is necessary for Th1 cell pathogenicity and inhibiting CD160 decreases an immune response. Stecher et al. discloses monoclonal-blocking antibodies for CD160 that can be used as a therapeutic to decrease inflammation or autoimmunity caused by pathogenic Th1 cells. Other non-limiting CD160 antibodies applicable to the present invention have been described (Menguy T, Briaux A, Jeunesse E, et al. Anti-CD160, Alone or in Combination With Bevacizumab, Is a Potent Inhibitor of Ocular Neovascularization in Rabbit and Monkey Models. Invest Ophthalmol Vis Sci. 2018; 59(7):2687-2698; El-Far M, Pellerin C, Pilote L, et al. CD160 isoforms and regulation of CD4 and CD8 T-cell responses. J Transl Med. 2014; 12:217; U.S. Ser. No. 10/208,124B2; US20200109211A1; US20190256595A1; WO2010084158A1; and US20150004170A1).

GPR18

In certain embodiments, GPR18 is targeted for shifting Th1 cell pathogenicity. In certain embodiments, inhibiting GPR18 reduces Th1 pathogenicity and enhancing GPR18 increases Th1 pathogenicity. As used herein GPR18 refers to the G protein-coupled receptor 18 (also known as, N-Arachidonyl glycine receptor, NAGly receptor). Exemplary sequences include NCBI accession numbers NM_001098200.2, NM_005292.4, NP 001091670.1 and NP_005283.1. Non-limiting GPR18 agonists include PSB-KK-1415, PSB-KD107, PSB-KD477, N-Arachidonoylglycine (NAGly), Abnormal cannabidiol (Abn-CBD), AM-251, Cannabidiol, O-1602, Δ⁹-Tetrahydrocannabinol (Δ⁹-THC), Anandamide (N-arachidonoyl ethanolamine, AEA), Arachidonylcyclopropylamide (ACPA), and Resolvin D2 (RvD2). Non-limiting GPR18 antagonists include PSB-CB5, Amauromine, O-1918, and CID-85469571. See, also, Fabisiak A, Fabisiak N, Mokrowiecka A, et al. Novel selective agonist of GPR18, PSB-KK-1415 exerts potent anti-inflammatory and anti-nociceptive activities in animal models of intestinal inflammation and inflammatory pain [published online ahead of print, 2020 Oct. 14]. Neurogastroenterol Motil. 2020; e14003; and Schoeder C T, Mahardhika A B, Drabczynska A, Kied-Kononowicz K, Müller CE. Discovery of Tricyclic Xanthines as Agonists of the Cannabinoid-Activated Orphan G-Protein-Coupled Receptor GPR18. ACS Med Chem Lett. 2020; 11(10):2024-2031.

Antibodies

In certain embodiments, the one or more agent is an antibody. In certain embodiments, an antibody targets one or more surface genes or polypeptides. The term “antibody” is used interchangeably with the term “immunoglobulin” herein, and includes intact antibodies, fragments of antibodies, e.g., Fab, F(ab′)2 fragments, and intact antibodies and fragments that have been mutated either in their constant and/or variable region (e.g., mutations to produce chimeric, partially humanized, or fully humanized antibodies, as well as to produce antibodies with a desired trait, e.g., enhanced binding and/or reduced FcR binding). The term “fragment” refers to a part or portion of an antibody or antibody chain comprising fewer amino acid residues than an intact or complete antibody or antibody chain. Fragments can be obtained via chemical or enzymatic treatment of an intact or complete antibody or antibody chain. Fragments can also be obtained by recombinant means. Exemplary fragments include Fab, Fab′, F(ab′)2, Fabc, Fd, dAb, V_HH and scFv and/or Fv fragments.

As used herein, a preparation of antibody protein having less than about 50% of non-antibody protein (also referred to herein as a “contaminating protein”), or of chemical precursors, is considered to be “substantially free.” 40%, 30%, 20%, 10% and more preferably 5% (by dry weight), of non-antibody protein, or of chemical precursors is considered to be substantially free. When the antibody protein or biologically active portion thereof is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 30%, preferably less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume or mass of the protein preparation.

The term “antigen-binding fragment” refers to a polypeptide fragment of an immunoglobulin or antibody that binds antigen or competes with intact antibody (i.e., with the intact antibody from which they were derived) for antigen binding (i.e., specific binding). As such these antibodies or fragments thereof are included in the scope of the invention, provided that the antibody or fragment binds specifically to a target molecule.

It is intended that the term “antibody” encompass any Ig class or any Ig subclass (e.g., the IgG1, IgG2, IgG3, and IgG4 subclassess of IgG) obtained from any source (e.g., humans and non-human primates, and in rodents, lagomorphs, caprines, bovines, equines, ovines, etc.).

The term “Ig class” or “immunoglobulin class”, as used herein, refers to the five classes of immunoglobulin that have been identified in humans and higher mammals, IgG, IgM, IgA, IgD, and IgE. The term “Ig subclass” refers to the two subclasses of IgM (H and L), three subclasses of IgA (IgA1, IgA2, and secretory IgA), and four subclasses of IgG (IgG1, IgG2, IgG3, and IgG4) that have been identified in humans and higher mammals. The antibodies can exist in monomeric or polymeric form; for example, lgM antibodies exist in pentameric form, and IgA antibodies exist in monomeric, dimeric or multimeric form.

The term “IgG subclass” refers to the four subclasses of immunoglobulin class IgG-IgG1, IgG2, IgG3, and IgG4 that have been identified in humans and higher mammals by the heavy chains of the immunoglobulins, VI—7⁴, respectively. The term “single-chain immunoglobulin” or “single-chain antibody” (used interchangeably herein) refers to a protein having a two-polypeptide chain structure consisting of a heavy and a light chain, said chains being stabilized, for example, by interchain peptide linkers, which has the ability to specifically bind antigen. The term “domain” refers to a globular region of a heavy or light chain polypeptide comprising peptide loops (e.g., comprising 3 to 4 peptide loops) stabilized, for example, by p pleated sheet and/or intrachain disulfide bond. Domains are further referred to herein as “constant” or “variable”, based on the relative lack of sequence variation within the domains of various class members in the case of a “constant” domain, or the significant variation within the domains of various class members in the case of a “variable” domain. Antibody or polypeptide “domains” are often referred to interchangeably in the art as antibody or polypeptide “regions”. The “constant” domains of an antibody light chain are referred to interchangeably as “light chain constant regions”, “light chain constant domains”, “CL” regions or “CL” domains. The “constant” domains of an antibody heavy chain are referred to interchangeably as “heavy chain constant regions”, “heavy chain constant domains”, “CH” regions or “CH” domains). The “variable” domains of an antibody light chain are referred to interchangeably as “light chain variable regions”, “light chain variable domains”, “VL” regions or “VL” domains). The “variable” domains of an antibody heavy chain are referred to interchangeably as “heavy chain constant regions”, “heavy chain constant domains”, “VH” regions or “VH” domains).

The term “region” can also refer to a part or portion of an antibody chain or antibody chain domain (e.g., a part or portion of a heavy or light chain or a part or portion of a constant or variable domain, as defined herein), as well as more discrete parts or portions of said chains or domains. For example, light and heavy chains or light and heavy chain variable domains include “complementarity determining regions” or “CDRs” interspersed among “framework regions” or “FRs”, as defined herein.

The term “conformation” refers to the tertiary structure of a protein or polypeptide (e.g., an antibody, antibody chain, domain or region thereof). For example, the phrase “light (or heavy) chain conformation” refers to the tertiary structure of a light (or heavy) chain variable region, and the phrase “antibody conformation” or “antibody fragment conformation” refers to the tertiary structure of an antibody or fragment thereof.

The term “antibody-like protein scaffolds” or “engineered protein scaffolds” broadly encompasses proteinaceous non-immunoglobulin specific-binding agents, typically obtained by combinatorial engineering (such as site-directed random mutagenesis in combination with phage display or other molecular selection techniques). Usually, such scaffolds are derived from robust and small soluble monomeric proteins (such as Kunitz inhibitors or lipocalins) or from a stably folded extra-membrane domain of a cell surface receptor (such as protein A, fibronectin or the ankyrin repeat).

Such scaffolds have been extensively reviewed in Binz et al. (Engineering novel binding proteins from nonimmunoglobulin domains. Nat Biotechnol 2005, 23:1257-1268), Gebauer and Skerra (Engineered protein scaffolds as next-generation antibody therapeutics. Curr Opin Chem Biol. 2009, 13:245-55), Gill and Damle (Biopharmaceutical drug discovery using novel protein scaffolds. Curr Opin Biotechnol 2006, 17:653-658), Skerra (Engineered protein scaffolds for molecular recognition. J Mol Recognit 2000, 13:167-187), and Skerra (Alternative non-antibody scaffolds for molecular recognition. Curr Opin Biotechnol 2007, 18:295-304), and include without limitation affibodies, based on the Z-domain of staphylococcal protein A, a three-helix bundle of 58 residues providing an interface on two of its alpha-helices (Nygren, Alternative binding proteins: Affibody binding proteins developed from a small three-helix bundle scaffold. FEBS J 2008, 275:2668-2676); engineered Kunitz domains based on a small (ca. 58 residues) and robust, disulphide-crosslinked serine protease inhibitor, typically of human origin (e.g., LACI-D1), which can be engineered for different protease specificities (Nixon and Wood, Engineered protein inhibitors of proteases. Curr Opin Drug Discov Dev 2006, 9:261-268); monobodies or adnectins based on the 10th extracellular domain of human fibronectin III (1° F.n3), which adopts an Ig-like beta-sandwich fold (94 residues) with 2-3 exposed loops, but lacks the central disulphide bridge (Koide and Koide, Monobodies: antibody mimics based on the scaffold of the fibronectin type III domain. Methods Mol Biol 2007, 352:95-109); anticalins derived from the lipocalins, a diverse family of eight-stranded beta-barrel proteins (ca. 180 residues) that naturally form binding sites for small ligands by means of four structurally variable loops at the open end, which are abundant in humans, insects, and many other organisms (Skerra, Alternative binding proteins: Anticalins-harnessing the structural plasticity of the lipocalin ligand pocket to engineer novel binding activities. FEBS J 2008, 275:2677-2683); DARPins, designed ankyrin repeat domains (166 residues), which provide a rigid interface arising from typically three repeated beta-turns (Stumpp et al., DARPins: a new generation of protein therapeutics. Drug Discov Today 2008, 13:695-701); avimers (multimerized LDLR-A module) (Silverman et al., Multivalent avimer proteins evolved by exon shuffling of a family of human receptor domains. Nat Biotechnol 2005, 23:1556-1561); and cysteine-rich knottin peptides (Kolmar, Alternative binding proteins: biological activity and therapeutic potential of cystine-knot miniproteins. FEBS J 2008, 275:2684-2690).

“Specific binding” of an antibody means that the antibody exhibits appreciable affinity for a particular antigen or epitope and, generally, does not exhibit significant cross reactivity. “Appreciable” binding includes binding with an affinity of at least 25 μM. Antibodies with affinities greater than 1×10⁷ M⁻¹ (or a dissociation coefficient of 1 μM or less or a dissociation coefficient of 1 nm or less) typically bind with correspondingly greater specificity. Values intermediate of those set forth herein are also intended to be within the scope of the present invention and antibodies of the invention bind with a range of affinities, for example, 100 nM or less, 75 nM or less, 50 nM or less, 25 nM or less, for example 10 nM or less, SnM or less, lnM or less, or in embodiments 500 pM or less, 100 pM or less, 50 pM or less or 25 pM or less. An antibody that “does not exhibit significant crossreactivity” is one that will not appreciably bind to an entity other than its target (e.g., a different epitope or a different molecule). For example, an antibody that specifically binds to a target molecule will appreciably bind the target molecule but will not significantly react with non-target molecules or peptides. An antibody specific for a particular epitope will, for example, not significantly crossreact with remote epitopes on the same protein or peptide. Specific binding can be determined according to any art-recognized means for determining such binding. Preferably, specific binding is determined according to Scatchard analysis and/or competitive binding assays.

As used herein, the term “affinity” refers to the strength of the binding of a single antigen-combining site with an antigenic determinant. Affinity depends on the closeness of stereochemical fit between antibody combining sites and antigen determinants, on the size of the area of contact between them, on the distribution of charged and hydrophobic groups, etc. Antibody affinity can be measured by equilibrium dialysis or by the kinetic BIACORE™ method. The dissociation constant, Kd, and the association constant, Ka, are quantitative measures of affinity.

As used herein, the term “monoclonal antibody” refers to an antibody derived from a clonal population of antibody-producing cells (e.g., B lymphocytes or B cells) which is homogeneous in structure and antigen specificity. The term “polyclonal antibody” refers to a plurality of antibodies originating from different clonal populations of antibody-producing cells which are heterogeneous in their structure and epitope specificity but which recognize a common antigen. Monoclonal and polyclonal antibodies may exist within bodily fluids, as crude preparations, or may be purified, as described herein.

The term “binding portion” of an antibody (or “antibody portion”) includes one or more complete domains, e.g., a pair of complete domains, as well as fragments of an antibody that retain the ability to specifically bind to a target molecule. It has been shown that the binding function of an antibody can be performed by fragments of a full-length antibody. Binding fragments are produced by recombinant DNA techniques, or by enzymatic or chemical cleavage of intact immunoglobulins. Binding fragments include Fab, Fab′, F(ab′)2, Fabc, Fd, dAb, Fv, single chains, single-chain antibodies, e.g., scFv, and single domain antibodies.

“Humanized” forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. For the most part, humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a hypervariable region of the recipient are replaced by residues from a hypervariable region of a non-human species (donor antibody) such as mouse, rat, rabbit or nonhuman primate having the desired specificity, affinity, and capacity. In some instances, FR residues of the human immunoglobulin are replaced by corresponding non-human residues. Furthermore, humanized antibodies may comprise residues that are not found in the recipient antibody or in the donor antibody. These modifications are made to further refine antibody performance. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin.

Examples of portions of antibodies or epitope-binding proteins encompassed by the present definition include: (i) the Fab fragment, having V_L, C_L, V_H and C_H1 domains; (ii) the Fab′ fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the C_H1 domain; (iii) the Fd fragment having V_H and C_H1 domains; (iv) the Fd′ fragment having V_H and C_H1 domains and one or more cysteine residues at the C-terminus of the CHI domain; (v) the Fv fragment having the V_L and V_H domains of a single arm of an antibody; (vi) the dAb fragment (Ward et al., 341 Nature 544 (1989)) which consists of a V_H domain or a V_L domain that binds antigen; (vii) isolated CDR regions or isolated CDR regions presented in a functional framework; (viii) F(ab′)₂ fragments which are bivalent fragments including two Fab′ fragments linked by a disulphide bridge at the hinge region; (ix) single chain antibody molecules (e.g., single chain Fv; scFv) (Bird et al., 242 Science 423 (1988); and Huston et al., 85 PNAS 5879 (1988)); (x) “diabodies” with two antigen binding sites, comprising a heavy chain variable domain (V_H) connected to a light chain variable domain (V_L) in the same polypeptide chain (see, e.g., EP 404,097; WO 93/11161; Hollinger et al., 90 PNAS 6444 (1993)); (xi) “linear antibodies” comprising a pair of tandem Fd segments (V_H-C_h1-V_H-C_h1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., Protein Eng. 8(10):1057-62 (1995); and U.S. Pat. No. 5,641,870).

As used herein, a “blocking” antibody or an antibody “antagonist” is one which inhibits or reduces biological activity of the antigen(s) it binds (e.g., CD160). In certain embodiments, the blocking antibodies or antagonist antibodies or portions thereof described herein completely inhibit the biological activity of the antigen(s).

Antibodies may act as agonists or antagonists of the recognized polypeptides. For example, the present invention includes antibodies which disrupt receptor/ligand interactions either partially or fully. The invention features both receptor-specific antibodies and ligand-specific antibodies. The invention also features receptor-specific antibodies which do not prevent ligand binding but prevent receptor activation. Receptor activation (i.e., signaling) may be determined by techniques described herein or otherwise known in the art. For example, receptor activation can be determined by detecting the phosphorylation (e.g., tyrosine or serine/threonine) of the receptor or of one of its down-stream substrates by immunoprecipitation followed by western blot analysis. In specific embodiments, antibodies are provided that inhibit ligand activity or receptor activity by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, or at least 50% of the activity in absence of the antibody.

The invention also features receptor-specific antibodies which both prevent ligand binding and receptor activation as well as antibodies that recognize the receptor-ligand complex. Likewise, encompassed by the invention are neutralizing antibodies which bind the ligand and prevent binding of the ligand to the receptor, as well as antibodies which bind the ligand, thereby preventing receptor activation, but do not prevent the ligand from binding the receptor. Further included in the invention are antibodies which activate the receptor. These antibodies may act as receptor agonists, i.e., potentiate or activate either all or a subset of the biological activities of the ligand-mediated receptor activation, for example, by inducing dimerization of the receptor. The antibodies may be specified as agonists, antagonists or inverse agonists for biological activities comprising the specific biological activities of the peptides disclosed herein. The antibody agonists and antagonists can be made using methods known in the art. See, e.g., PCT publication WO 96/40281; U.S. Pat. No. 5,811,097; Deng et al., Blood 92(6):1981-1988 (1998); Chen et al., Cancer Res. 58(16):3668-3678 (1998); Harrop et al., J. Immunol. 161(4):1786-1794 (1998); Zhu et al., Cancer Res. 58(15):3209-3214 (1998); Yoon et al., J. Immunol. 160(7):3170-3179 (1998); Prat et al., J. Cell. Sci. III (Pt2):237-247 (1998); Pitard et al., J. Immunol. Methods 205(2):177-190 (1997); Liautard et al., Cytokine 9(4):233-241 (1997); Carlson et al., J. Biol. Chem. 272(17):11295-11301 (1997); Taryman et al., Neuron 14(4):755-762 (1995); Muller et al., Structure 6(9):1153-1167 (1998); Bartunek et al., Cytokine 8(1):14-20 (1996).

The antibodies as defined for the present invention include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from generating an anti-idiotypic response. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.

Simple binding assays can be used to screen for or detect agents that bind to a target protein, or disrupt the interaction between proteins (e.g., a receptor and a ligand). Because certain targets of the present invention are transmembrane proteins, assays that use the soluble forms of these proteins rather than full-length protein can be used, in some embodiments. Soluble forms include, for example, those lacking the transmembrane domain and/or those comprising the IgV domain or fragments thereof which retain their ability to bind their cognate binding partners. Further, agents that inhibit or enhance protein interactions for use in the compositions and methods described herein, can include recombinant peptido-mimetics.

Detection methods useful in screening assays include antibody-based methods, detection of a reporter moiety, detection of cytokines as described herein, and detection of a gene signature as described herein.

Another variation of assays to determine binding of a receptor protein to a ligand protein is through the use of affinity biosensor methods. Such methods may be based on the piezoelectric effect, electrochemistry, or optical methods, such as ellipsometry, optical wave guidance, and surface plasmon resonance (SPR).

Bispecific Antibodies

In certain embodiments, bispecific antibodies are used to target pathogenic Th1 cells. Bi-specific antigen-binding constructs, e.g., bi-specific antibodies (bsAb) or BiTEs, bind two antigens (see, e.g., Suurs et al., A review of bispecific antibodies and antibody constructs in oncology and clinical challenges. Pharmacol Ther. 2019 September; 201:103-119; and Huehls, et al., Bispecific T cell engagers for cancer immunotherapy. Immunol Cell Biol. 2015 March; 93(3): 290-296). The bi-specific antigen-binding construct includes two antigen-binding polypeptide constructs, e.g., antigen binding domains. In some embodiments, the antigen-binding construct is derived from known antibodies or antigen-binding constructs. In some embodiments, the antigen-binding polypeptide constructs comprise two antigen binding domains that comprise antibody fragments. In some embodiments, the first antigen binding domain and second antigen binding domain each independently comprises an antibody fragment selected from the group of: an scFv, a Fab, and an Fc domain. The antibody fragments may be the same format or different formats from each other. For example, in some embodiments, the antigen-binding polypeptide constructs comprise a first antigen binding domain comprising an scFv and a second antigen binding domain comprising a Fab. In some embodiments, the antigen-binding polypeptide constructs comprise a first antigen binding domain and a second antigen binding domain, wherein both antigen binding domains comprise an scFv. In some embodiments, the first and second antigen binding domains each comprise a Fab. In some embodiments, the first and second antigen binding domains each comprise an Fc domain. Any combination of antibody formats is suitable for the bi-specific antibody constructs disclosed herein.

In certain embodiments, Th1 cells can be engaged to tumor cells. In certain embodiments, two targets are disrupted on a Th1 cell by the bsAb. By means of an example, an agent, such as a bi-specific antibody, capable of specifically binding to a gene product expressed on the cell surface of the Th1 cells and a tumor cell may be used for targeting Th1 cells to tumor cells.

Aptamers

In certain embodiments, the one or more agent is an aptamer. Nucleic acid aptamers are nucleic acid species that have been engineered through repeated rounds of in vitro selection or equivalently, SELEX (systematic evolution of ligands by exponential enrichment) to bind to various molecular targets such as small molecules, proteins, nucleic acids, cells, tissues and organisms. Nucleic acid aptamers have specific binding affinity to molecules through interactions other than classic Watson-Crick base pairing. Aptamers are useful in biotechnological and therapeutic applications as they offer molecular recognition properties similar to antibodies. In addition to their discriminate recognition, aptamers offer advantages over antibodies as they can be engineered completely in a test tube, are readily produced by chemical synthesis, possess desirable storage properties, and elicit little or no immunogenicity in therapeutic applications. In certain embodiments, RNA aptamers may be expressed from a DNA construct. In other embodiments, a nucleic acid aptamer may be linked to another polynucleotide sequence. The polynucleotide sequence may be a double stranded DNA polynucleotide sequence. The aptamer may be covalently linked to one strand of the polynucleotide sequence. The aptamer may be ligated to the polynucleotide sequence. The polynucleotide sequence may be configured, such that the polynucleotide sequence may be linked to a solid support or ligated to another polynucleotide sequence.

Aptamers, like peptides generated by phage display or monoclonal antibodies (“mAbs”), are capable of specifically binding to selected targets and modulating the targets activity, e.g., through binding, aptamers may block their target's ability to function. A typical aptamer is 10-15 kDa in size (30-45 nucleotides), binds its target with sub-nanomolar affinity, and discriminates against closely related targets (e.g., aptamers will typically not bind other proteins from the same gene family). Structural studies have shown that aptamers are capable of using the same types of binding interactions (e.g., hydrogen bonding, electrostatic complementarity, hydrophobic contacts, steric exclusion) that drives affinity and specificity in antibody-antigen complexes.

Aptamers have a number of desirable characteristics for use in research and as therapeutics and diagnostics including high specificity and affinity, biological efficacy, and excellent pharmacokinetic properties. In addition, they offer specific competitive advantages over antibodies and other protein biologics. Aptamers are chemically synthesized and are readily scaled as needed to meet production demand for research, diagnostic or therapeutic applications. Aptamers are chemically robust. They are intrinsically adapted to regain activity following exposure to factors such as heat and denaturants and can be stored for extended periods (>1 yr) at room temperature as lyophilized powders. Not being bound by a theory, aptamers bound to a solid support or beads may be stored for extended periods.

Oligonucleotides in their phosphodiester form may be quickly degraded by intracellular and extracellular enzymes such as endonucleases and exonucleases. Aptamers can include modified nucleotides conferring improved characteristics on the ligand, such as improved in vivo stability or improved delivery characteristics. Examples of such modifications include chemical substitutions at the ribose and/or phosphate and/or base positions. SELEX identified nucleic acid ligands containing modified nucleotides are described, e.g., in U.S. Pat. No. 5,660,985, which describes oligonucleotides containing nucleotide derivatives chemically modified at the 2′ position of ribose, 5 position of pyrimidines, and 8 position of purines, U.S. Pat. No. 5,756,703 which describes oligonucleotides containing various 2′-modified pyrimidines, and U.S. Pat. No. 5,580,737 which describes highly specific nucleic acid ligands containing one or more nucleotides modified with 2′-amino (2′NH), 2′-fluoro (2′-F), and/or 2′-0-methyl (2′-OMe) substituents. Modifications of aptamers may also include, modifications at exocyclic amines, substitution of 4-thiouridine, substitution of 5-bromo or 5-iodo-uracil; backbone modifications, phosphorothioate or allyl phosphate modifications, methylations, and unusual base-pairing combinations such as the isobases isocytidine and isoguanosine. Modifications can also include 3 and 5′ modifications such as capping. As used herein, the term phosphorothioate encompasses one or more non-bridging oxygen atoms in a phosphodiester bond replaced by one or more sulfur atoms. In further embodiments, the oligonucleotides comprise modified sugar groups, for example, one or more of the hydroxyl groups is replaced with halogen, aliphatic groups, or functionalized as ethers or amines. In one embodiment, the 2′-position of the furanose residue is substituted by any of an O-methyl, O-alkyl, O-allyl, S-alkyl, S-allyl, or halo group. Methods of synthesis of 2′-modified sugars are described, e.g., in Sproat, et al., Nucl Acid Res. 19:733-738 (1991); Cotten, et al, Nucl. Acid Res. 19:2629-2635 (1991); and Hobbs, et al, Biochemistry 12:5138-5145 (1973). Other modifications are known to one of ordinary skill in the art. In certain embodiments, aptamers include aptamers with improved off-rates as described in international Patent Publication No. WO 2009012418, “Method for generating aptamers with improved off-rates,” incorporated herein by reference in its entirety. In certain embodiments aptamers are chosen from a library of aptamers. Such libraries include, but are not limited to, those described in Rohloff et al., “Nucleic Acid Ligands With Protein-like Side Chains: Modified Aptamers and Their Use as Diagnostic and Therapeutic Agents,” Molecular Therapy Nucleic Acids (2014) 3, e201. Aptamers are also commercially available (see, e.g., SomaLogic, Inc., Boulder, Colorado). In certain embodiments, the present invention may utilize any aptamer containing any modification as described herein.

Small Molecules

In certain embodiments, the one or more agents is a small molecule. The term “small molecule” refers to compounds, preferably organic compounds, with a size comparable to those organic molecules generally used in pharmaceuticals. The term excludes biological macromolecules (e.g., proteins, peptides, nucleic acids, etc.). Preferred small organic molecules range in size up to about 5000 Da, e.g., up to about 4000, preferably up to 3000 Da, more preferably up to 2000 Da, even more preferably up to about 1000 Da, e.g., up to about 900, 800, 700, 600 or up to about 500 Da. In certain embodiments, the small molecule may act as an antagonist or agonist (e.g., blocking an enzyme active site or activating a receptor by binding to a ligand binding site).

One type of small molecule applicable to the present invention is a degrader molecule (see, e.g., Ding, et al., Emerging New Concepts of Degrader Technologies, Trends Pharmacol Sci. 2020 July; 41(7):464-474). The terms “degrader” and “degrader molecule” refer to all compounds capable of specifically targeting a protein for degradation (e.g., ATTEC, AUTAC, LYTAC, or PROTAC, reviewed in Ding, et al. 2020). Proteolysis Targeting Chimera (PROTAC) technology is a rapidly emerging alternative therapeutic strategy with the potential to address many of the challenges currently faced in modern drug development programs. PROTAC technology employs small molecules that recruit target proteins for ubiquitination and removal by the proteasome (see, e.g., Zhou et al., Discovery of a Small-Molecule Degrader of Bromodomain and Extra-Terminal (BET) Proteins with Picomolar Cellular Potencies and Capable of Achieving Tumor Regression. J. Med. Chem. 2018, 61, 462-481; Bondeson and Crews, Targeted Protein Degradation by Small Molecules, Annu Rev Pharmacol Toxicol. 2017 Jan. 6; 57: 107-123; and Lai et al., Modular PROTAC Design for the Degradation of Oncogenic BCR-ABL Angew Chem Int Ed Engl. 2016 Jan. 11; 55(2): 807-810). In certain embodiments, LYTACs are particularly advantageous for cell surface proteins as described herein (e.g., CD160).

Genetic Modifying Agents

In certain embodiments, the one or more modulating agents may be a genetic modifying agent. The genetic modifying agents may manipulate nucleic acids (e.g., genomic DNA or mRNA). The genetic modulating agent can be used to up- or downregulate expression of a gene either by targeting a nuclease or functional domain to a DNA or RNA sequence. The genetic modifying agent may comprise an RNA-guided nuclease system (e.g., CRISPR system or IscB system), RNAi system, a zinc finger nuclease, a TALE, or a meganuclease.

CRISPR-Cas Modification

In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a CRISPR-Cas and/or Cas-based system (e.g., genomic DNA or mRNA, preferably, for a disease gene). The nucleotide sequence may be or encode one or more components of a CRISPR-Cas system. For example, the nucleotide sequences may be or encode guide RNAs. The nucleotide sequences may also encode CRISPR proteins, variants thereof, or fragments thereof.

In general, a CRISPR-Cas or CRISPR system as used herein and in other documents, such as WO 2014/093622 (PCT/US2013/074667), refers collectively to transcripts and other elements involved in the expression of or directing the activity of CRISPR-associated (“Cas”) genes, including sequences encoding a Cas gene, a tracr (trans-activating CRISPR) sequence (e.g., tracrRNA or an active partial tracrRNA), a tracr-mate sequence (encompassing a “direct repeat” and a tracrRNA-processed partial direct repeat in the context of an endogenous CRISPR system), a guide sequence (also referred to as a “spacer” in the context of an endogenous CRISPR system), or “RNA(s)” as that term is herein used (e.g., RNA(s) to guide Cas, such as Cas9, e.g., CRISPR RNA and transactivating (tracr) RNA or a single guide RNA (sgRNA) (chimeric RNA)) or other sequences and transcripts from a CRISPR locus. In general, a CRISPR system is characterized by elements that promote the formation of a CRISPR complex at the site of a target sequence (also referred to as a protospacer in the context of an endogenous CRISPR system). See, e.g., Shmakov et al. (2015) “Discovery and Functional Characterization of Diverse Class 2 CRISPR-Cas Systems”, Molecular Cell, DOI: dx.doi.org/10.1016/j.molcel. 2015.10.008.

CRISPR-Cas systems can generally fall into two classes based on their architectures of their effector molecules, which are each further subdivided by type and subtype. The two classes are Class 1 and Class 2. Class 1 CRISPR-Cas systems have effector modules composed of multiple Cas proteins, some of which form crRNA-binding complexes, while Class 2 CRISPR-Cas systems include a single, multi-domain crRNA-binding protein.

In some embodiments, the CRISPR-Cas system that can be used to modify a polynucleotide of the present invention described herein can be a Class 1 CRISPR-Cas system. In some embodiments, the CRISPR-Cas system that can be used to modify a polynucleotide of the present invention described herein can be a Class 2 CRISPR-Cas system.

Class 1 CRISPR-Cas Systems

In some embodiments, the CRISPR-Cas system that can be used to modify a polynucleotide of the present invention described herein can be a Class 1 CRISPR-Cas system. Class 1 CRISPR-Cas systems are divided into Types I, II, and IV. Makarova et al. 2020. Nat. Rev. 18: 67-83, particularly as described in FIG. 1. Type I CRISPR-Cas systems are divided into 9 subtypes (I-A, I-B, I-C, I-D, I-E, I-F1, I-F2, I-F3, and IG). Makarova et al., 2020. Class 1, Type I CRISPR-Cas systems can contain a Cas3 protein that can have helicase activity. Type III CRISPR-Cas systems are divided into 6 subtypes (III-A, III-B, III-C, III-D, III-E, and III-F). Type III CRISPR-Cas systems can contain a Cas10 that can include an RNA recognition motif called Palm and a cyclase domain that can cleave polynucleotides. Makarova et al., 2020. Type IV CRISPR-Cas systems are divided into 3 subtypes. (IV-A, IV-B, and IV-C). Makarova et al., 2020. Class 1 systems also include CRISPR-Cas variants, including Type I-A, I-B, I-E, I-F and I-U variants, which can include variants carried by transposons and plasmids, including versions of subtype I-F encoded by a large family of Tn7-like transposon and smaller groups of Tn7-like transposons that encode similarly degraded subtype I-B systems. Peters et al., PNAS 114 (35) (2017); DOI: 10.1073/pnas.1709035114; see also, Makarova et al. 2018. The CRISPR Journal, v. 1, n5, FIG. 5.

The Class 1 systems typically use a multi-protein effector complex, which can, in some embodiments, include ancillary proteins, such as one or more proteins in a complex referred to as a CRISPR-associated complex for antiviral defense (Cascade), one or more adaptation proteins (e.g., Cas1, Cas2, RNA nuclease), and/or one or more accessory proteins (e.g., Cas 4, DNA nuclease), CRISPR associated Rossman fold (CARF) domain containing proteins, and/or RNA transcriptase.

The backbone of the Class 1 CRISPR-Cas system effector complexes can be formed by RNA recognition motif domain-containing protein(s) of the repeat-associated mysterious proteins (RAMPs) family subunits (e.g., Cas 5, Cas6, and/or Cas7). RAMP proteins are characterized by having one or more RNA recognition motif domains. In some embodiments, multiple copies of RAMPs can be present. In some embodiments, the Class I CRISPR-Cas system can include 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more Cas5, Cas6, and/or Cas 7 proteins. In some embodiments, the Cas6 protein is an RNAse, which can be responsible for pre-crRNA processing. When present in a Class 1 CRISPR-Cas system, Cas6 can be optionally physically associated with the effector complex.

Class 1 CRISPR-Cas system effector complexes can, in some embodiments, also include a large subunit. The large subunit can be composed of or include a Cas8 and/or Cas10 protein. See, e.g., FIGS. 1 and 2. Koonin E V, Makarova K S. 2019. Phil. Trans. R. Soc. B 374: 20180087, DOI: 10.1098/rstb.2018.0087 and Makarova et al. 2020.

Class 1 CRISPR-Cas system effector complexes can, in some embodiments, include a small subunit (for example, Cas11). See, e.g., FIGS. 1 and 2. Koonin E V, Makarova K S. 2019 Origins and Evolution of CRISPR-Cas systems. Phil. Trans. R. Soc. B 374: 20180087, DOI: 10.1098/rstb.2018.0087.

In some embodiments, the Class 1 CRISPR-Cas system can be a Type I CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-A CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-B CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-C CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-D CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-E CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-F1 CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-F2 CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-F3 CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a subtype I-G CRISPR-Cas system. In some embodiments, the Type I CRISPR-Cas system can be a CRISPR Cas variant, such as a Type I-A, I-B, I-E, I-F and I-U variants, which can include variants carried by transposons and plasmids, including versions of subtype I-F encoded by a large family of Tn7-like transposon and smaller groups of Tn7-like transposons that encode similarly degraded subtype I-B systems as previously described.

In some embodiments, the Class 1 CRISPR-Cas system can be a Type III CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-A CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-B CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-C CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-D CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-E CRISPR-Cas system. In some embodiments, the Type III CRISPR-Cas system can be a subtype III-F CRISPR-Cas system.

In some embodiments, the Class 1 CRISPR-Cas system can be a Type IV CRISPR-Cas-system. In some embodiments, the Type IV CRISPR-Cas system can be a subtype IV-A CRISPR-Cas system. In some embodiments, the Type IV CRISPR-Cas system can be a subtype IV-B CRISPR-Cas system. In some embodiments, the Type IV CRISPR-Cas system can be a subtype IV-C CRISPR-Cas system.

The effector complex of a Class 1 CRISPR-Cas system can, in some embodiments, include a Cas3 protein that is optionally fused to a Cas2 protein, a Cas4, a Cas5, a Cas6, a Cas7, a Cas8, a Cas10, a Cas11, or a combination thereof. In some embodiments, the effector complex of a Class 1 CRISPR-Cas system can have multiple copies, such as 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, or 14, of any one or more Cas proteins.

Class 2 CRISPR-Cas Systems

The compositions, systems, and methods described in greater detail elsewhere herein can be designed and adapted for use with Class 2 CRISPR-Cas systems. Thus, in some embodiments, the CRISPR-Cas system is a Class 2 CRISPR-Cas system. Class 2 systems are distinguished from Class 1 systems in that they have a single, large, multi-domain effector protein. In certain example embodiments, the Class 2 system can be a Type II, Type V, or Type VI system, which are described in Makarova et al. “Evolutionary classification of CRISPR-Cas systems: a burst of class 2 and derived variants” Nature Reviews Microbiology, 18:67-81 (February 2020), incorporated herein by reference. Each type of Class 2 system is further divided into subtypes. See Markova et al. 2020, particularly at Figure. 2. Class 2, Type II systems can be divided into 4 subtypes: II-A, II-B, II-C1, and II-C2. Class 2, Type V systems can be divided into 17 subtypes: V-A, V-B1, V-B2, V-C, V-D, V-E, V-F1, V-F1(V-U3), V-F2, V-F3, V-G, V-H, V-I, V-K (V-U5), V-U1, V-U2, and V-U4. Class 2, Type IV systems can be divided into 5 subtypes: VI-A, VI-B1, VI-B2, VI-C, and VI-D.

The distinguishing feature of these types is that their effector complexes consist of a single, large, multi-domain protein. Type V systems differ from Type II effectors (e.g., Cas9), which contain two nuclear domains that are each responsible for the cleavage of one strand of the target DNA, with the HNH nuclease inserted inside the Ruv-C like nuclease domain sequence. The Type V systems (e.g., Cas12) only contain a RuvC-like nuclease domain that cleaves both strands. Type VI (Cas13) are unrelated to the effectors of Type II and V systems and contain two HEPN domains and target RNA. Cas13 proteins also display collateral activity that is triggered by target recognition. Some Type V systems have also been found to possess this collateral activity with two single-stranded DNA in in vitro contexts.

In some embodiments, the Class 2 system is a Type II system. In some embodiments, the Type II CRISPR-Cas system is a II-A CRISPR-Cas system. In some embodiments, the Type II CRISPR-Cas system is a II-B CRISPR-Cas system. In some embodiments, the Type II CRISPR-Cas system is a II-C1 CRISPR-Cas system. In some embodiments, the Type II CRISPR-Cas system is a II-C2 CRISPR-Cas system. In some embodiments, the Type II system is a Cas9 system. In some embodiments, the Type II system includes a Cas9.

In some embodiments, the Class 2 system is a Type V system. In some embodiments, the Type V CRISPR-Cas system is a V-A CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-B1 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-B2 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-C CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-D CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-E CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-F1 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-F1 (V-U3) CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-F2 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-F3 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-G CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-H CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-I CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-K (V-U5) CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-U1 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-U2 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system is a V-U4 CRISPR-Cas system. In some embodiments, the Type V CRISPR-Cas system includes a Cas12a (Cpf1), Cas12b (C2c1), Cas12c (C2c3), CasX, and/or Cas14.

In some embodiments the Class 2 system is a Type VI system. In some embodiments, the Type VI CRISPR-Cas system is a VI-A CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system is a VI-B1 CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system is a VI-B2 CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system is a VI-C CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system is a VI-D CRISPR-Cas system. In some embodiments, the Type VI CRISPR-Cas system includes a Cas13a (C2c2), Cas13b (Group 29/30), Cas13c, and/or Cas13d.

Specialized Cas-Based Systems

In some embodiments, the system is a Cas-based system that is capable of performing a specialized function or activity. For example, the Cas protein may be fused, operably coupled to, or otherwise associated with one or more functionals domains. In certain example embodiments, the Cas protein may be a catalytically dead Cas protein (“dCas”) and/or have nickase activity. A nickase is a Cas protein that cuts only one strand of a double stranded target. In such embodiments, the dCas or nickase provide a sequence specific targeting functionality that delivers the functional domain to or proximate a target sequence. Example functional domains that may be fused to, operably coupled to, or otherwise associated with a Cas protein can be or include, but are not limited to a nuclear localization signal (NLS) domain, a nuclear export signal (NES) domain, a translational activation domain, a transcriptional activation domain (e.g. VP64, p65, MyoD1, HSF1, RTA, and SET7/9), a translation initiation domain, a transcriptional repression domain (e.g., a KRAB domain, NuE domain, NcoR domain, and a SID domain such as a SID4X domain), a nuclease domain (e.g., FokI), a histone modification domain (e.g., a histone acetyltransferase), a light inducible/controllable domain, a chemically inducible/controllable domain, a transposase domain, a homologous recombination machinery domain, a recombinase domain, an integrase domain, and combinations thereof. Methods for generating catalytically dead Cas9 or a nickase Cas9 (WO 2014/204725, Ran et al. Cell. 2013 Sep. 12; 154(6):1380-1389), Cas12 (Liu et al. Nature Communications, 8, 2095 (2017), and Cas13 (WO 2019/005884, WO2019/060746) are known in the art and incorporated herein by reference.

In some embodiments, the functional domains can have one or more of the following activities: methylase activity, demethylase activity, translation activation activity, translation initiation activity, translation repression activity, transcription activation activity, transcription repression activity, transcription release factor activity, histone modification activity, nuclease activity, single-strand RNA cleavage activity, double-strand RNA cleavage activity, single-strand DNA cleavage activity, double-strand DNA cleavage activity, molecular switch activity, chemical inducibility, light inducibility, and nucleic acid binding activity. In some embodiments, the one or more functional domains may comprise epitope tags or reporters. Non-limiting examples of epitope tags include histidine (His) tags, V5 tags, FLAG tags, influenza hemagglutinin (HA) tags, Myc tags, VSV-G tags, and thioredoxin (Trx) tags. Examples of reporters include, but are not limited to, glutathione-S-transferase (GST), horseradish peroxidase (HRP), chloramphenicol acetyltransferase (CAT) beta-galactosidase, beta-glucuronidase, luciferase, green fluorescent protein (GFP), HcRed, DsRed, cyan fluorescent protein (CFP), yellow fluorescent protein (YFP), and auto-fluorescent proteins including blue fluorescent protein (BFP).

The one or more functional domain(s) may be positioned at, near, and/or in proximity to a terminus of the effector protein (e.g., a Cas protein). In embodiments having two or more functional domains, each of the two can be positioned at or near or in proximity to a terminus of the effector protein (e.g., a Cas protein). In some embodiments, such as those where the functional domain is operably coupled to the effector protein, the one or more functional domains can be tethered or linked via a suitable linker (including, but not limited to, GlySer linkers) to the effector protein (e.g., a Cas protein). When there is more than one functional domain, the functional domains can be same or different. In some embodiments, all the functional domains are the same. In some embodiments, all of the functional domains are different from each other. In some embodiments, at least two of the functional domains are different from each other. In some embodiments, at least two of the functional domains are the same as each other.

Other suitable functional domains can be found, for example, in International Patent Publication No. WO 2019/018423.

Split CRISPR-Cas Systems

In some embodiments, the CRISPR-Cas system is a split CRISPR-Cas system. See e.g., Zetche et al., 2015. Nat. Biotechnol. 33(2): 139-142 and WO 2019/018423, the compositions and techniques of which can be used in and/or adapted for use with the present invention. Split CRISPR-Cas proteins are set forth herein and in documents incorporated herein by reference in further detail herein. In certain embodiments, each part of a split CRISPR protein are attached to a member of a specific binding pair, and when bound with each other, the members of the specific binding pair maintain the parts of the CRISPR protein in proximity. In certain embodiments, each part of a split CRISPR protein is associated with an inducible binding pair. An inducible binding pair is one which is capable of being switched “on” or “off” by a protein or small molecule that binds to both members of the inducible binding pair. In some embodiments, CRISPR proteins may preferably split between domains, leaving domains intact. In particular embodiments, said Cas split domains (e.g., RuvC and HNH domains in the case of Cas9) can be simultaneously or sequentially introduced into the cell such that said split Cas domain(s) process the target nucleic acid sequence in the algae cell. The reduced size of the split Cas compared to the wild type Cas allows other methods of delivery of the systems to the cells, such as the use of cell penetrating peptides as described herein.

DNA and RNA Base Editing

In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a base editing system. In some embodiments, a Cas protein is connected or fused to a nucleotide deaminase. Thus, in some embodiments the Cas-based system can be a base editing system. As used herein “base editing” refers generally to the process of polynucleotide modification via a CRISPR-Cas-based or Cas-based system that does not include excising nucleotides to make the modification. Base editing can convert base pairs at precise locations without generating excess undesired editing byproducts that can be made using traditional CRISPR-Cas systems.

In certain example embodiments, the nucleotide deaminase may be a DNA base editor used in combination with a DNA binding Cas protein such as, but not limited to, Class 2 Type II and Type V systems. Two classes of DNA base editors are generally known: cytosine base editors (CBEs) and adenine base editors (ABEs). CBEs convert a C·G base pair into a T·A base pair (Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Li et al. Nat. Biotech. 36:324-327) and ABEs convert an A·T base pair to a G·C base pair. Collectively, CBEs and ABEs can mediate all four possible transition mutations (C to T, A to G, T to C, and G to A). Rees and Liu. 2018. Nat. Rev. Genet. 19(12): 770-788, particularly at FIGS. 1b, 2a-2c, 3a-3f, and Table 1. In some embodiments, the base editing system includes a CBE and/or an ABE. In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a base editing system. Rees and Liu. 2018. Nat. Rev. Gent. 19(12):770-788. Base editors also generally do not need a DNA donor template and/or rely on homology-directed repair. Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Gaudeli et al. 2017. Nature. 551:464-471. Upon binding to a target locus in the DNA, base pairing between the guide RNA of the system and the target DNA strand leads to displacement of a small segment of ssDNA in an “R-loop”. Nishimasu et al. Cell. 156:935-949. DNA bases within the ssDNA bubble are modified by the enzyme component, such as a deaminase. In some systems, the catalytically disabled Cas protein can be a variant or modified Cas can have nickase functionality and can generate a nick in the non-edited DNA strand to induce cells to repair the non-edited strand using the edited strand as a template. Komor et al. 2016. Nature. 533:420-424; Nishida et al. 2016. Science. 353; and Gaudeli et al. 2017. Nature. 551:464-471. Base editors may be further engineered to optimize conversion of nucleotides (e.g. A:T to G:C). Richter et al. 2020. Nature Biotechnology. doi.org/10.1038/s41587-020-0453-z.

Other Example Type V base editing systems are described in WO 2018/213708, WO 2018/213726, PCT/US2018/067207, PCT/US2018/067225, and PCT/US2018/067307 which are incorporated by referenced herein.

In certain example embodiments, the base editing system may be a RNA base editing system. As with DNA base editors, a nucleotide deaminase capable of converting nucleotide bases may be fused to a Cas protein. However, in these embodiments, the Cas protein will need to be capable of binding RNA. Example RNA binding Cas proteins include, but are not limited to, RNA-binding Cas9s such as Francisella novicida Cas9 (“FnCas9”), and Class 2 Type VI Cas systems. The nucleotide deaminase may be a cytidine deaminase or an adenosine deaminase, or an adenosine deaminase engineered to have cytidine deaminase activity. In certain example embodiments, the RNA based editor may be used to delete or introduce a post-translation modification site in the expressed mRNA. In contrast to DNA base editors, whose edits are permanent in the modified cell, RNA base editors can provide edits where finer temporal control may be needed, for example in modulating a particular immune response. Example Type VI RNA-base editing systems are described in Cox et al. 2017. Science 358: 1019-1027, WO 2019/005884, WO 2019/005886, WO 2019/071048, PCT/US20018/05179, PCT/US2018/067207, which are incorporated herein by reference. An example FnCas9 system that may be adapted for RNA base editing purposes is described in WO 2016/106236, which is incorporated herein by reference.

An example method for delivery of base-editing systems, including use of a split-intein approach to divide CBE and ABE into reconstitutable halves, is described in Levy et al. Nature Biomedical Engineering doi.org/10.1038/s41441-019-0505-5 (2019), which is incorporated herein by reference.

Prime Editors

In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a prime editing system (See e.g., Anzalone et al. 2019. Nature. 576: 149-157). Like base editing systems, prime editing systems can be capable of targeted modification of a polynucleotide without generating double stranded breaks and does not require donor templates. Further prime editing systems can be capable of all 12 possible combination swaps. Prime editing can operate via a “search-and-replace” methodology and can mediate targeted insertions, deletions, all 12 possible base-to-base conversion, and combinations thereof. Generally, a prime editing system, as exemplified by PE1, PE2, and PE3 (Id.), can include a reverse transcriptase fused or otherwise coupled or associated with an RNA-programmable nickase, and a prime-editing extended guide RNA (pegRNA) to facility direct copying of genetic information from the extension on the pegRNA into the target polynucleotide. Embodiments that can be used with the present invention include these and variants thereof. Prime editing can have the advantage of lower off-target activity than traditional CRIPSR-Cas systems along with few byproducts and greater or similar efficiency as compared to traditional CRISPR-Cas systems.

In some embodiments, the prime editing guide molecule can specify both the target polynucleotide information (e.g., sequence) and contain a new polynucleotide cargo that replaces target polynucleotides. To initiate transfer from the guide molecule to the target polynucleotide, the PE system can nick the target polynucleotide at a target side to expose a 3′hydroxyl group, which can prime reverse transcription of an edit-encoding extension region of the guide molecule (e.g., a prime editing guide molecule or peg guide molecule) directly into the target site in the target polynucleotide. See e.g., Anzalone et al. 2019. Nature. 576: 149-157, particularly at FIGS. 1b, 1c, related discussion, and Supplementary discussion.

In some embodiments, a prime editing system can be composed of a Cas polypeptide having nickase activity, a reverse transcriptase, and a guide molecule. The Cas polypeptide can lack nuclease activity. The guide molecule can include a target binding sequence as well as a primer binding sequence and a template containing the edited polynucleotide sequence. The guide molecule, Cas polypeptide, and/or reverse transcriptase can be coupled together or otherwise associate with each other to form an effector complex and edit a target sequence. In some embodiments, the Cas polypeptide is a Class 2, Type V Cas polypeptide. In some embodiments, the Cas polypeptide is a Cas9 polypeptide (e.g. is a Cas9 nickase). In some embodiments, the Cas polypeptide is fused to the reverse transcriptase. In some embodiments, the Cas polypeptide is linked to the reverse transcriptase.

In some embodiments, the prime editing system can be a PE1 system or variant thereof, a PE2 system or variant thereof, or a PE3 (e.g., PE3, PE3b) system. See e.g., Anzalone et al. 2019. Nature. 576: 149-157, particularly at pgs. 2-3, FIGS. 2a, 3a-3f, 4a-4b, Extended data FIGS. 3a-3b, 4,

The peg guide molecule can be about 10 to about 200 or more nucleotides in length, such as 10 to/or 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69, 70, 71, 72, 73, 74, 75, 76, 77, 78, 79, 80, 81, 82, 83, 84, 85, 86, 87, 88, 89, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 111, 112, 113, 114, 115, 116, 117, 118, 119, 120, 121, 122, 123, 124, 125, 126, 127, 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139, 140, 141, 142, 143, 144, 145, 146, 147, 148, 149, 150, 151, 152, 153, 154, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179, 180, 181, 182, 183, 184, 185, 186, 187, 188, 189, 190, 191, 192, 193, 194, 195, 196, 197, 198, 199, or 200 or more nucleotides in length. Optimization of the peg guide molecule can be accomplished as described in Anzalone et al. 2019. Nature. 576: 149-157, particularly at pg. 3, FIG. 2a-2b, and Extended Data FIGS. 5a-c.

CRISPR Associated Transposase (CAST) Systems

In some embodiments, a polynucleotide of the present invention described elsewhere herein can be modified using a CRISPR Associated Transposase (“CAST”) system. CAST system can include a Cas protein that is catalytically inactive, or engineered to be catalytically active, and further comprises a transposase (or subunits thereof) that catalyze RNA-guided DNA transposition. Such systems are able to insert DNA sequences at a target site in a DNA molecule without relying on host cell repair machinery. CAST systems can be Class1 or Class 2 CAST systems. An example Class 1 system is described in Klompe et al. Nature, doi:10.1038/s41586-019-1323, which is in incorporated herein by reference. An example Class 2 system is described in Strecker et al. Science. 10/1126/science. aax9181 (2019), and PCT/US2019/066835 which are incorporated herein by reference.

Guide Molecules

The CRISPR-Cas or Cas-Based system described herein can, in some embodiments, include one or more guide molecules. The terms guide molecule, guide sequence and guide polynucleotide, refer to polynucleotides capable of guiding Cas to a target genomic locus and are used interchangeably as in foregoing cited documents such as WO 2014/093622 (PCT/US2013/074667). In general, a guide sequence is any polynucleotide sequence having sufficient complementarity with a target polynucleotide sequence to hybridize with the target sequence and direct sequence-specific binding of a CRISPR complex to the target sequence. The guide molecule can be a polynucleotide.

The ability of a guide sequence (within a nucleic acid-targeting guide RNA) to direct sequence-specific binding of a nucleic acid-targeting complex to a target nucleic acid sequence may be assessed by any suitable assay. For example, the components of a nucleic acid-targeting CRISPR system sufficient to form a nucleic acid-targeting complex, including the guide sequence to be tested, may be provided to a host cell having the corresponding target nucleic acid sequence, such as by transfection with vectors encoding the components of the nucleic acid-targeting complex, followed by an assessment of preferential targeting (e.g., cleavage) within the target nucleic acid sequence, such as by Surveyor assay (Qui et al. 2004. BioTechniques. 36(4)702-707). Similarly, cleavage of a target nucleic acid sequence may be evaluated in a test tube by providing the target nucleic acid sequence, components of a nucleic acid-targeting complex, including the guide sequence to be tested and a control guide sequence different from the test guide sequence, and comparing binding or rate of cleavage at the target sequence between the test and control guide sequence reactions. Other assays are possible and will occur to those skilled in the art.

In some embodiments, the guide molecule is an RNA. The guide molecule(s) (also referred to interchangeably herein as guide polynucleotide and guide sequence) that are included in the CRISPR-Cas or Cas based system can be any polynucleotide sequence having sufficient complementarity with a target nucleic acid sequence to hybridize with the target nucleic acid sequence and direct sequence-specific binding of a nucleic acid-targeting complex to the target nucleic acid sequence. In some embodiments, the degree of complementarity, when optimally aligned using a suitable alignment algorithm, can be about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or more. Optimal alignment may be determined with the use of any suitable algorithm for aligning sequences, non-limiting examples of which include the Smith-Waterman algorithm, the Needleman-Wunsch algorithm, algorithms based on the Burrows-Wheeler Transform (e.g., the Burrows Wheeler Aligner), ClustalW, Clustal X, BLAT, Novoalign (Novocraft Technologies; available at www.novocraft.com), ELAND (Illumina, San Diego, CA), SOAP (available at soap.genomics.org.cn), and Maq (available at maq.sourceforge.net).

A guide sequence, and hence a nucleic acid-targeting guide, may be selected to target any target nucleic acid sequence. The target sequence may be DNA. The target sequence may be any RNA sequence. In some embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of messenger RNA (mRNA), pre-mRNA, ribosomal RNA (rRNA), transfer RNA (tRNA), micro-RNA (miRNA), small interfering RNA (siRNA), small nuclear RNA (snRNA), small nucleolar RNA (snoRNA), double stranded RNA (dsRNA), non-coding RNA (ncRNA), long non-coding RNA (lncRNA), and small cytoplasmatic RNA (scRNA). In some preferred embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of mRNA, pre-mRNA, and rRNA. In some preferred embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of ncRNA, and lncRNA. In some more preferred embodiments, the target sequence may be a sequence within an mRNA molecule or a pre-mRNA molecule.

In some embodiments, a nucleic acid-targeting guide is selected to reduce the degree secondary structure within the nucleic acid-targeting guide. In some embodiments, about or less than about 75%, 50%, 40%, 30%, 25%, 20%, 15%, 10%, 5%, 1%, or fewer of the nucleotides of the nucleic acid-targeting guide participate in self-complementary base pairing when optimally folded. Optimal folding may be determined by any suitable polynucleotide folding algorithm. Some programs are based on calculating the minimal Gibbs free energy. An example of one such algorithm is mFold, as described by Zuker and Stiegler (Nucleic Acids Res. 9 (1981), 133-148). Another example folding algorithm is the online webserver RNAfold, developed at Institute for Theoretical Chemistry at the University of Vienna, using the centroid structure prediction algorithm (see e.g., A. R. Gruber et al., 2008, Cell 106(1): 23-24; and PA Carr and GM Church, 2009, Nature Biotechnology 27(12): 1151-62).

In certain embodiments, a guide RNA or crRNA may comprise, consist essentially of, or consist of a direct repeat (DR) sequence and a guide sequence or spacer sequence. In certain embodiments, the guide RNA or crRNA may comprise, consist essentially of, or consist of a direct repeat sequence fused or linked to a guide sequence or spacer sequence. In certain embodiments, the direct repeat sequence may be located upstream (i.e., 5′) from the guide sequence or spacer sequence. In other embodiments, the direct repeat sequence may be located downstream (i.e., 3′) from the guide sequence or spacer sequence.

In certain embodiments, the crRNA comprises a stem loop, preferably a single stem loop. In certain embodiments, the direct repeat sequence forms a stem loop, preferably a single stem loop.

In certain embodiments, the spacer length of the guide RNA is from 15 to 35 nt. In certain embodiments, the spacer length of the guide RNA is at least 15 nucleotides. In certain embodiments, the spacer length is from 15 to 17 nt, e.g., 15, 16, or 17 nt, from 17 to 20 nt, e.g., 17, 18, 19, or 20 nt, from 20 to 24 nt, e.g., 20, 21, 22, 23, or 24 nt, from 23 to 25 nt, e.g., 23, 24, or 25 nt, from 24 to 27 nt, e.g., 24, 25, 26, or 27 nt, from 27 to 30 nt, e.g., 27, 28, 29, or 30 nt, from 30 to 35 nt, e.g., 30, 31, 32, 33, 34, or 35 nt, or 35 nt or longer.

The “tracrRNA” sequence or analogous terms includes any polynucleotide sequence that has sufficient complementarity with a crRNA sequence to hybridize. In some embodiments, the degree of complementarity between the tracrRNA sequence and crRNA sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher. In some embodiments, the tracr sequence is about or more than about 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 40, 50, or more nucleotides in length. In some embodiments, the tracr sequence and crRNA sequence are contained within a single transcript, such that hybridization between the two produces a transcript having a secondary structure, such as a hairpin.

In general, degree of complementarity is with reference to the optimal alignment of the sca sequence and tracr sequence, along the length of the shorter of the two sequences. Optimal alignment may be determined by any suitable alignment algorithm and may further account for secondary structures, such as self-complementarity within either the sca sequence or tracr sequence. In some embodiments, the degree of complementarity between the tracr sequence and sca sequence along the length of the shorter of the two when optimally aligned is about or more than about 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97.5%, 99%, or higher.

In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence can be about or more than about 50%, 60%, 75%, 80%, 85%, 90%, 95%, 97.5%, 99%, or 100%; a guide or RNA or sgRNA can be about or more than about 5, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 35, 40, 45, 50, 75, or more nucleotides in length; or guide or RNA or sgRNA can be less than about 75, 50, 45, 40, 35, 30, 25, 20, 15, 12, or fewer nucleotides in length; and tracr RNA can be 30 or 50 nucleotides in length. In some embodiments, the degree of complementarity between a guide sequence and its corresponding target sequence is greater than 94.5% or 95% or 95.5% or 96% or 96.5% or 97% or 97.5% or 98% or 98.5% or 99% or 99.5% or 99.9%, or 100%. Off target is less than 100% or 99.9% or 99.5% or 99% or 99% or 98.5% or 98% or 97.5% or 97% or 96.5% or 96% or 95.5% or 95% or 94.5% or 94% or 93% or 92% or 91% or 90% or 89% or 88% or 87% or 86% or 85% or 84% or 83% or 82% or 81% or 80% complementarity between the sequence and the guide, with it advantageous that off target is 100% or 99.9% or 99.5% or 99% or 99% or 98.5% or 98% or 97.5% or 97% or 96.5% or 96% or 95.5% or 95% or 94.5% complementarity between the sequence and the guide.

In some embodiments according to the invention, the guide RNA (capable of guiding Cas to a target locus) may comprise (1) a guide sequence capable of hybridizing to a genomic target locus in the eukaryotic cell; (2) a tracr sequence; and (3) a tracr mate sequence. All (1) to (3) may reside in a single RNA, i.e., an sgRNA (arranged in a 5′ to 3′ orientation), or the tracr RNA may be a different RNA than the RNA containing the guide and tracr sequence. The tracr hybridizes to the tracr mate sequence and directs the CRISPR/Cas complex to the target sequence. Where the tracr RNA is on a different RNA than the RNA containing the guide and tracr sequence, the length of each RNA may be optimized to be shortened from their respective native lengths, and each may be independently chemically modified to protect from degradation by cellular RNase or otherwise increase stability.

Many modifications to guide sequences are known in the art and are further contemplated within the context of this invention. Various modifications may be used to increase the specificity of binding to the target sequence and/or increase the activity of the Cas protein and/or reduce off-target effects. Example guide sequence modifications are described in PCT US2019/045582, specifically paragraphs [0178]-[0333]. which is incorporated herein by reference.

Target Sequences, PAMs, and PFSs

Target Sequences

In the context of formation of a CRISPR complex, “target sequence” refers to a sequence to which a guide sequence is designed to have complementarity, where hybridization between a target sequence and a guide sequence promotes the formation of a CRISPR complex. A target sequence may comprise RNA polynucleotides. The term “target RNA” refers to an RNA polynucleotide being or comprising the target sequence. In other words, the target polynucleotide can be a polynucleotide or a part of a polynucleotide to which a part of the guide sequence is designed to have complementarity with and to which the effector function mediated by the complex comprising the CRISPR effector protein and a guide molecule is to be directed. In some embodiments, a target sequence is located in the nucleus or cytoplasm of a cell.

The guide sequence can specifically bind a target sequence in a target polynucleotide. The target polynucleotide may be DNA. The target polynucleotide may be RNA. The target polynucleotide can have one or more (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, etc. or more) target sequences. The target polynucleotide can be on a vector. The target polynucleotide can be genomic DNA. The target polynucleotide can be episomal. Other forms of the target polynucleotide are described elsewhere herein.

The target sequence may be DNA. The target sequence may be any RNA sequence. In some embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of messenger RNA (mRNA), pre-mRNA, ribosomal RNA (rRNA), transfer RNA (tRNA), micro-RNA (miRNA), small interfering RNA (siRNA), small nuclear RNA (snRNA), small nucleolar RNA (snoRNA), double stranded RNA (dsRNA), non-coding RNA (ncRNA), long non-coding RNA (lncRNA), and small cytoplasmatic RNA (scRNA). In some preferred embodiments, the target sequence (also referred to herein as a target polynucleotide) may be a sequence within an RNA molecule selected from the group consisting of mRNA, pre-mRNA, and rRNA. In some preferred embodiments, the target sequence may be a sequence within an RNA molecule selected from the group consisting of ncRNA, and lncRNA. In some more preferred embodiments, the target sequence may be a sequence within an mRNA molecule or a pre-mRNA molecule.

PAM and PFS Elements

PAM elements are sequences that can be recognized and bound by Cas proteins. Cas proteins/effector complexes can then unwind the dsDNA at a position adjacent to the PAM element. It will be appreciated that Cas proteins and systems that include them that target RNA do not require PAM sequences (Marraffini et al. 2010. Nature. 463:568-571). Instead, many rely on PFSs, which are discussed elsewhere herein. In certain embodiments, the target sequence should be associated with a PAM (protospacer adjacent motif) or PFS (protospacer flanking sequence or site), that is, a short sequence recognized by the CRISPR complex. Depending on the nature of the CRISPR-Cas protein, the target sequence should be selected, such that its complementary sequence in the DNA duplex (also referred to herein as the non-target sequence) is upstream or downstream of the PAM. In the embodiments, the complementary sequence of the target sequence is downstream or 3′ of the PAM or upstream or 5′ of the PAM. The precise sequence and length requirements for the PAM differ depending on the Cas protein used, but PAMs are typically 2-5 base pair sequences adjacent the protospacer (that is, the target sequence). Examples of the natural PAM sequences for different Cas proteins are provided herein below and the skilled person will be able to identify further PAM sequences for use with a given Cas protein.

The ability to recognize different PAM sequences depends on the Cas polypeptide(s) included in the system. See e.g., Gleditzsch et al. 2019. RNA Biology. 16(4):504-517. Table A below shows several Cas polypeptides and the PAM sequence they recognize.

TABLE A
Example PAM Sequences
Cas Protein              PAM Sequence
SpCas9                   NGG/NRG
SaCas9                   NGRRT or NGRRN
NmeCas9                  NNNNGATT
CjCas9                   NNNNRYAC
StCas9                   NNAGAAW
Cas12a (Cpf1) (including TTTV
LbCpf1 and AsCpf1)
Cas12b (C2c1)            TTT, TTA, and TTC
Cas12c (C2c3)            TA
Cas12d (CasY)            TA
Cas12e (CasX)            5′-TTCN-3′

In a preferred embodiment, the CRISPR effector protein may recognize a 3′ PAM. In certain embodiments, the CRISPR effector protein may recognize a 3′ PAM which is 5′H, wherein H is A, C or U.

Further, engineering of the PAM Interacting (PI) domain on the Cas protein may allow programing of PAM specificity, improve target site recognition fidelity, and increase the versatility of the CRISPR-Cas protein, for example as described for Cas9 in Kleinstiver B P et al. Engineered CRISPR-Cas9 nucleases with altered PAM specificities. Nature. 2015 Jul. 23; 523(7561):481-5. doi: 10.1038/nature14592. As further detailed herein, the skilled person will understand that Cas13 proteins may be modified analogously. Gao et al, “Engineered Cpf1 Enzymes with Altered PAM Specificities,” bioRxiv 091611; doi: dx.doi.org/10.1101/091611 (Dec. 4, 2016). Doench et al. created a pool of sgRNAs, tiling across all possible target sites of a panel of six endogenous mouse and three endogenous human genes and quantitatively assessed their ability to produce null alleles of their target gene by antibody staining and flow cytometry. The authors showed that optimization of the PAM improved activity and also provided an on-line tool for designing sgRNAs.

PAM sequences can be identified in a polynucleotide using an appropriate design tool, which are commercially available as well as online. Such freely available tools include, but are not limited to, CRISPRFinder and CRISPRTarget. Mojica et al. 2009. Microbiol. 155(Pt. 3):733-740; Atschul et al. 1990. J. Mol. Biol. 215:403-410; Biswass et al. 2013 RNA Biol. 10:817-827; and Grissa et al. 2007. Nucleic Acid Res. 35:W52-57. Experimental approaches to PAM identification can include, but are not limited to, plasmid depletion assays (Jiang et al. 2013. Nat. Biotechnol. 31:233-239; Esvelt et al. 2013. Nat. Methods. 10:1116-1121; Kleinstiver et al. 2015. Nature. 523:481-485), screened by a high-throughput in vivo model called PAM-SCNAR (Pattanayak et al. 2013. Nat. Biotechnol. 31:839-843 and Leenay et al. 2016. Mol. Cell. 16:253), and negative screening (Zetsche et al. 2015. Cell. 163:759-771).

As previously mentioned, CRISPR-Cas systems that target RNA do not typically rely on PAM sequences. Instead, such systems typically recognize protospacer flanking sites (PFSs) instead of PAMs Thus, Type VI CRISPR-Cas systems typically recognize protospacer flanking sites (PFSs) instead of PAMs. PFSs represents an analogue to PAMs for RNA targets. Type VI CRISPR-Cas systems employ a Cas13. Some Cas13 proteins analyzed to date, such as Cas13a (C2c2) identified from Leptotrichia shahii (LShCAsl3a) have a specific discrimination against G at the 3′end of the target RNA. The presence of a C at the corresponding crRNA repeat site can indicate that nucleotide pairing at this position is rejected. However, some Cas13 proteins (e.g., LwaCAsl3a and PspCas13b) do not seem to have a PFS preference. See e.g., Gleditzsch et al. 2019. RNA Biology. 16(4):504-517.

Some Type VI proteins, such as subtype B, have 5′-recognition of D (G, T, A) and a 3′-motif requirement of NAN or NNA. One example is the Cas13b protein identified in Bergeyella zoohelcum (BzCas13b). See e.g., Gleditzsch et al. 2019. RNA Biology. 16(4):504-517.

Overall Type VI CRISPR-Cas systems appear to have less restrictive rules for substrate (e.g., target sequence) recognition than those that target DNA (e.g., Type V and type II).

IscBs

In some embodiments, the nucleic acid-guided nucleases herein may be an IscB protein. An IscB protein may comprise an X domain and a Y domain as described herein. In some examples, the IscB proteins may form a complex with one or more guide molecules. In some cases, the IscB proteins may form a complex with one or more hRNA molecules which serve as a scaffold molecule and comprise guide sequences. In some examples, the IscB proteins are CRISPR-associated proteins, e.g., the loci of the nucleases are associated with an CRISPR array. In some examples, the IscB proteins are not CRISPR-associated.

In some examples, the IscB protein may be homolog or ortholog of IscB proteins described in Kapitonov V V et al., ISC, a Novel Group of Bacterial and Archaeal DNA Transposons That Encode Cas9 Homologs, J Bacteriol. 2015 Dec. 28; 198(5):797-807. doi: 10.1128/JB.00783-15, which is incorporated by reference herein in its entirety.

In some embodiments, the IscBs may comprise one or more domains, e.g., one or more of a X domain (e.g., at N-terminus), a RuvC domain, a Bridge Helix domain, and a Y domain (e.g., at C-terminus). In some examples, the nucleic-acid guided nuclease comprises an N-terminal X domain, a RuvC domain (e.g., including a RuvC-I, RuvC-II, and RuvC-III subdomains), a Bridge Helix domain, and a C-terminal Y domain. In some examples, the nucleic-acid guided nuclease comprises In some examples, the nucleic-acid guided nuclease comprises an N-terminal X domain, a RuvC domain (e.g., including a RuvC-I, RuvC-II, and RuvC-III subdomains), a Bridge Helix domain, an HNH domain, and a C-terminal Y domain.

In some embodiments, the nucleic acid-guided nucleases may have a small size. For example, the nucleic acid-guided nucleases may be no more than 50, no more than 100, no more than 150, no more than 200, no more than 250, no more than 300, no more than 350, no more than 400, no more than 450, no more than 500, no more than 550, no more than 600, no more than 650, no more than 700, no more than 750, no more than 800, no more than 850, no more than 900, no more than 950, or no more than 1000 amino acids in length.

In some examples, the IscB protein shares at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with a IscB protein selected from Table 1.

TABLE 1
No.	Proteins	Sequences
1	IscB(−HNH)	1	mstdatlirt tpshaeadat dtlvatplmp prrvispwpg pgegqslmri pvvdirgmal
	EFH81386	61	mpctpakarh llksgnarpk rnklglfyvq lsyeqepdnq slvagvdpgs kfeglsvvgt
		121	kdtvlnlmve apdhvkgavq trrtmrrarr qrkwrrpkrf hnrlnrmqri ppstrsrwea
		181	karivahlrt ilpftdvvve dvqavtrkgk ggtwngsfsp vqvgkehlyr llramgltlh
		241	lregwqtkel reqhglkktk skskqsfesh avdswvlaas isgaehptct rlwymvpail
		301	hrrqlhrlqa skggvrkpyg gtrslgvkrg tlvehkkygr ctvggvdrkr ntislheyrt
		361	ntrltqaakv etcrvltwls wrswllrgkr tsskgkgshs s (SEQ ID NO: 1)
2	IscB(+HNH)	1	mqpakqqnwv fqingdkqpl dminpgrcre lqnrgklasf rrfpyvviqq qtienpqtke
	TAE54104.1	61	yilkidpgsq wtgfaiqcgn dilfraelnh rgeaikfdlv krawfrrgrr srnlryrkkr
		121	lnrakpegwl apsirhrvlt vetwikrfmr ycpiawieie qvrfdtqkla npeidgveyq
		181	qgelqgyevr eyllqkwgrk caycgtenvp levehiqsks kggssrignl tlachvcnvk
		241	kgnldvrdfl akspdilngv lenstkplkd aaavnstrya ivkmaksice nvkcssgart
		301	kmnrvrqgle kthsldaacv gesgasirvl tdrpllitck ghgsrqsirv nasgfpavkn
		361	aktvfthiaa gdvvrftigk drkkaqagty tarvktptpk gfevlidgar islstmsnvv
		421	fvhrsdgygy el (SEQ ID NO: 2)
3	IscB(+HNH)	1	mavfvidkhk rplmpcsekr arlllergra vvhrqvpfvi rlkdrtvqhs avqplrvald
	WP_038093640.1	61	pgsratgmal vrekntvdtg tgevyreria lnlfelvhrg hrireqldqr rnfrrrrrga
		121	nlryraprfd nrrrppgwla pslqhrvdtt mawvrrlerw apasaigiet vrfdtqrlqn
		181	peisgveyqq galagcevre yllekwgrkc aycgaenvpl eiehivpksr ggsdrvsnla
		241	lacracnqak gnrdvrafla dqperlaril aqakaplkda aavnatrwal yralvdtglp
		301	veagtggrtk wnrtrlglpk thaldalcvg qvdqvrhwrv pvlgircagr gsyrrtrltr
		361	hgfprgyltr nksafgfqtg dliravvtkg kkagtylgri airasgsfni qtpmgvvqgi
		421	hhrfctllqr adgygyfvqp kpteaalssp rlkagvssag n (SEQ ID NO: 3)
4	IscB(+HNH)	1	mttnvvfvid tnqkplqpcs aavarklllr gkaamfrryp aviilkkevd svgkpkielr
	WP_052490348.1	61	idpgskytgf alvdskdnad fiiwgteleh rgaaickelt krsairrsrr nrktryrkkr
		121	ferrkpegwl apslqhrvdt tltwvkrick fvpimsisve qvkfdlqkle nsdiqgieyq
		181	qgtlagytlr eallehwgrk caycdvenvf leiehiypks kggsdkfsnl tlachkcnin
		241	kgnksidefl lsdhkrleqi klhqkktlkd aaavnatrkk lvttlqektf lnvlvsdgas
		301	tkmtrlsssl akrhwidagc vnttlivilk tlqplqvkcn ghgnkqfvtm daygfprksy
		361	epkkvrkdwk agdiirvtkk dgtmlmgrvk kaakklvyip fggkeasfss enakaihrsd
		421	gyrysfaaid sellqkmat (SEQ ID NO: 4)
5	IscB(+HNH)	1	mpnkyafvld skgklldptk skkawylirk gkaslveeyp liiklkrevp kdqvnsdkli
	WP_015325818.1	61	lgiddgtkkv gfalvqkcqt knkvlfkavm eqrqdvskkm eerrgyrryr rshkryrpar
		121	fdnrssskrk grippsilqk kqailrvvnk lkkyiridki vledvsidir kltegrelyn
		181	weyqesnrld enlrkatlyr ddctcqlegt tetmlhahhi mprrdggads iynlitlcka
		241	chkdkvdnne yqykdqflai idskelsdlk sashvmqgkt wlrdklskia qleitsggnt
		301	ankridyeie kshsndaict tgllpvdnid dikeyyikpl rkkskakike lkcfrqrdlv
		361	kytkrngety tgyitslrik nnkynskven fstlkgkifr gygfrnltll nrpkglmiv
			(SEQ ID NO: 5)
6	sp|G3ECR1|CAS9_	1	mlfnkciiis inldfsnkek cmtkpysigl digtnsvgwa vitdnykvps kkmkvlgnts
	STRTR	61	kkyikknllg vllfdsgita egrrlkrtar rrytrrrnri lylqeifste matlddaffq
		121	rlddsflvpd dkrdskypif gnlveekvyh defptiyhlr kyladstkka dlrlvylala
		181	hmikyrghfl iegefnsknn diqknfqdfl dtynaifesd lslenskqle eivkdkiskl
		241	ekkdrilklf pgeknsgifs eflklivgnq adfrkcfnld ekaslhfske sydedletll
		301	gyigddysdv flkakklyda illsgfltvt dneteaplss amikrynehk edlallkeyi
		361	rnislktyne vfkddtkngy agyidgktnq edfyvylknl laefegadyf lekidredfl
		421	rkqrtfdngs ipyqihlqem raildkqakf ypflaknker iekiltfrip yyvgplargn
		481	sdfawsirkr nekitpwnfe dvidkessae afinrmtsfd lylpeekvlp khsllyetfn
		541	vyneltkvrf iaesmrdyqf ldskqkkdiv rlyfkdkrkv tdkdiieylh aiygydgiel
		601	kgiekqfnss lstyhdllni indkefldds sneaiieeii htltifedre mikqrlskfe
		661	nifdksvlkk lsrrhytgwg klsaklingi rdeksgntil dyliddgisn rnfmqlihdd
		721	alsfkkkiqk aqiigdedkg nikevvkslp gspaikkgil qsikivdelv kvmggrkpes
		781	ivvemarenq ytnqgksnsq qrlkrleksl kelgskilke nipaklskid nnalqndrly
		841	lyylqngkdm ytgddldidr lsnydidhii pqaflkdnsi dnkvlvssas nrgksddfps
		901	levvkkrktf wyqllkskli sqrkfdnltk aerggllped kagfiqrqlv etrqitkhva
		961	rlldekfnnk kdennravrt vkiitlkstl vsqfrkdfel ykvreindfh hahdaylnav
		1021	iasallkkyp klepefvygd ypkynsfrer ksatekvyfy snimnifkks isladgrvie
		1081	rplievneet gesvwnkesd latvrrvlsy pqvnvvkkve eqnhgldrgk pkglfnanls
		1141	skpkpnsnen lvgakeyldp kkyggyagis nsfavlvkgt iekgakkkit nvlefqgisi
		1201	ldrinyrkdk lnfllekgyk dieliielpk yslfelsdgs rrmlasilst nnkrgeihkg
		1261	nqiflsqkfv kllyhakris ntinenhrky venhkkefee lfyyilefne nyvgakkngk
		1321	llnsafqswq nhsidelcss figptgserk glfeltsrgs aadfeflgvk ipryrdytps
		1381	slikdatlih qsvtglyetr idlaklgeg (SEQ ID NO: 6)
7	sp|J7RUA5|CAS9_	1	mkrnyilgld igitsvgygi idyetrdvid agvrlfkean vennegrrsk rgarrlkrrr
	STAAU	61	rhriqrvkkl lfdynlltdh selsginpye arvkglsqkl seeefsaall hlakrrgvhn
		121	vneveedtgn elstkeqisr nskaleekyv aelqlerlkk dgevrgsinr fktsdyvkea
		181	kqllkvqkay hqldqsfidt yidlletrrt yyegpgegsp fgwkdikewy emlmghctyf
		241	peelrsvkya ynadlynaln dlnnlvitrd enekleyyek fqiienvfkq kkkptlkqia
		301	keilvneedi kgyrvtstgk peftnlkvyh dikditarke iienaelldq iakiltiyqs
		361	sediqeeltn lnseltqeei eqisnlkgyt gthnlslkai nlildelwht ndnqiaifnr
		421	lklvpkkvdl sqqkeipttl vddfilspvv krsfiqsikv inaiikkygl pndiiielar
		481	eknskdagkm inemqkrnrq tnerieeiir ttgkenakyl iekiklhdmq egkclyslea
		541	ipledllnnp fnyevdhiip rsvsfdnsfn nkvlvkqeen skkgnrtpfq ylsssdskis
		601	yetfkkhiln lakgkgrisk tkkeylleer dinrfsvqkd finrnlvdtr yatrglmnll
		661	rsyfrvnnld vkvksinggf tsflrrkwkf kkernkgykh haedaliian adfifkewkk
		721	ldkakkvmen qmfeekqaes mpeieteqey keifitphqi khikdfkdyk yshrvdkkpn
		781	relindtlys trkddkgntl ivnninglyd kdndklkkli nkspekllmy hhdpqtyqkl
		841	klimeqygde knplykyyee tgnyltkysk kdngpvikki kyygnklnah lditddypns
		901	rnkvvklslk pyrfdvyldn gvykfvtvkn ldvikkenyy evnskcyeea kklkkisnqa
		961	efiasfynnd likingelyr vigvnndlln rievnmidit yreylenmnd krppriikti
		1021	asktqsikky stdilgnlye vkskkhpgii kkg (SEQ ID NO: 7)
8	Streptococcus_	1	kysigldigt nsvgwavitd eykvpskkfk vlgntdrhsi kknligallf dsgetaeatr
	pyogenes_SF370	61	lkrtarrryt rrknricylq eifsnemakv ddsffhrlee sflveedkkh erhpifgniv
		121	devayhekyp tiyhlrkklv dstdkadlrl iylalahmik frghfliegd lnpdnsdvdk
		181	lfiqlvqtyn qlfeenpina sgvdakails arlsksrrle nliaqlpgek knglfgnlia
		241	lslgltpnfk snfdlaedak lqlskdtydd dldnllaqig dqyadlflaa knlsdaills
		301	dilrvnteit kaplsasmik rydehhqdlt llkalvrqql pekykeiffd qskngyagyi
		361	dggasqeefy kfikpilekm dgteellvkl nredllrkqr tfdngsiphq ihlgelhail
		421	rrqedfypfl kdnrekieki ltfripyyvg plargnsrfa wmtrkseeti tpwnfeevvd
		481	kgasaqsfie rmtnfdknlp nekvlpkhsl lyeyftvyne ltkvkyvteg mrkpaflsge
		541	qkkaivdllf ktnrkvtvkq lkedyfkkie cfdsveisgv edrfnaslgt yhdllkiikd
		601	kdfldneene diledivltl tlfedremie erlktyahlf ddkvmkqlkr rrytgwgrls
		661	rklingirdk qsgktildfl ksdgfanrnf mqlihddslt fkediqkaqv sgqgdslheh
		721	ianlagspai kkgilqtvkv vdelvkvmgr hkpeniviem arenqttqkg qknsrermkr
		781	ieegikelgs qilkehpven tqlqneklyl yylqngrdmy vdqeldinrl sdydvdhivp
		841	qsflkddsid nkvltrsdkn rgksdnvpse evvkkmknyw rqllnaklit qrkfdnltka
		901	ergglseldk agfikrqlve trqitkhvaq ildsrmntky dendklirev kvitlksklv
		961	sdfrkdfqfy kvreinnyhh ahdaylnavv gtalikkypk lesefvygdy kvydvrkmia
		1021	kseqeigkat akyffysnim nffkteitla ngeirkrpli etngetgeiv wdkgrdfatv
		1081	rkvlsmpqvn ivkktevqtg gfskesilpk rnsdkliark kdwdpkkygg fdsptvaysv
		1141	lvvakvekgk skklksvkel lgitimerss feknpidfle akgykevkkd liiklpkysl
		1201	felengrkrm lasagelqkg nelalpskyv nflylashye klkgspedne qkqlfveqhk
		1261	hyldeiieqi sefskrvila danldkvlsa ynkhrdkpir eqaeniihlf tltnlgapaa
		1321	fkyfdttidr krytstkevl datlihqsit glyetridls glggd (SEQ ID NO: 8)
No.	Proteins	Domains and amino acid positions
1	IscB(−HNH)	X domain: 51-97
	EFH81386	RuvC-I: 104-118
		Bridge Helix: 140-160
		RuvC-II: 169-212
		RuvC-III: 226-278
2	IscB(+HNH)	X domain: 11-56
	TAE54104.1	RuvC-I: 63-77
		Bridge Helix: 100-121
		RuvC-II: 129-172
		HNH: 211-243
		RuvC-III: 279-321
3	IscB(+HNH)	X domain: 4-50
	WP_038093640.1	RuvC-I: 57-71
		Bridge Helix: 108-129
		RuvC-II: 138-181
		HNH: 220-252
		RuvC-III: 288-330
4	IscB(+HNH)	X domain: 7-52
	WP_052490348.1	RuvC-I: 59-73
		Bridge Helix: 100-121
		RuvC-II: 129-172
		HNH: 211-243
		RuvC-III: 279-322
5	IscB(+HNH)	X domain: 7-52
	WP_015325818.1	RuvC-I: 61-75
		Bridge Helix: 101-121
		RuvC-II: 132-175
		HNH: 215-247
		RuvC-III: 284-327
6	sp|G3ECR1|CAS9_	RuvC-I: 28-42
	STRTR	Bridge Helix: 85-108
		Rec: 118-736
		RuvC-II: 750-799
		HNH: 864-896
		RuvC-III: 957-1019
		PAM Interaction (PI): 1119-1409
7	sp|J7RUA5|CAS9_	RuvC-I: 7-21
	STAAU	Bridge Helix: 49-72
		Rec: 80-433
		RuvC-II: 445-493
		HNH: 553-585
		RuvC-III: 654-709
		PAM Interaction (PI): 789-1053
8	Streptococcus_	RuvC-I: 4-18
	pyogenes_SF370	Bridge Helix: 61-84
		Rec: 94-718
		RuvC-II: 725-774
		HNH: 833-865
		RuvC-III: 926-988
		PAM Interaction (PI): 1099-1365

X Domains

In some embodiments, the IscB proteins comprise an X domain, e.g., at its N-terminal.

In certain embodiments, the X domain include the X domains in Table 1. Examples of the X domains also include any polypeptides a structural similarity and/or sequence similarity to a X domain described in the art. In some examples, the X domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 50%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with X domains in Table 1.

In some examples, the X domain may be no more than 10, no more than 20, no more than 30, no more than 40, no more than 50, no more than 60, no more than 70, no more than 80, no more than 90, or no more than 100 amino acids in length. For example, the X domain may be no more than 50 amino acids in length, such as comprising 2 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50 amino acids in length.

Y Domain

In some embodiments, the IscB proteins comprise a Y domain, e.g., at its C-terminal.

In certain embodiments, the X domain include Y domains in Table 1. Examples of the Y domain also include any polypeptides a structural similarity and/or sequence similarity to a Y domain described in the art. In some examples, the Y domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 5%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with Y domains in Table 1.

RuvC Domain

In some embodiments, the IscB proteins comprises at least one nuclease domain. In certain embodiments, the IscB proteins comprise at least two nuclease domains. In certain embodiments, the one or more nuclease domains are only active upon presence of a cofactor. In certain embodiments, the cofactor is Magnesium (Mg). In embodiments where more than one nuclease domain is present and the substrate is a double-strand polynucleotide, the nuclease domains each cleave a different strand of the double-strand polynucleotide. In certain embodiments, the nuclease domain is a RuvC domain.

The IscB proteins may comprise a RuvC domain. The RuvC domain may comprise multiple subdomains, e.g., RuvC-I, RuvC-II and RuvC-III. The subdomains may be separated by interval sequences on the amino acid sequence of the protein.

In certain embodiments, examples of the RuvC domain include those in Table 1. Examples of the RuvC domain also include any polypeptides a structural similarity and/or sequence similarity to a RuvC domain described in the art. For example, the RuvC domain may share a structural similarity and/or sequence similarity to a RuvC of Cas9. In some examples, the RuvC domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 5%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with RuvC domains in Table 1.

Bridge Helix

The IscB proteins comprise abridge helix (BH) domain. The bridge helix domain refers to a helix and arginine rich polypeptide. The bridge helix domain may be located next to anyone of the amino acid domains in the nucleic-acid guided nuclease. In some embodiments, the bridge helix domain is next to a RuvC domain, e.g., next to RuvC-I, RuvC-II, or RuvC-III subdomain. In one example, the bridge helix domain is between a RuvC-1 and RuvC2 subdomains.

The bridge helix domain may be from 10 to 100, from 20 to 60, from 30 to 50, e.g., 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46 or 47, 48, 49, or 50 amino acids in length. Examples of bridge helix includes the polypeptide of amino acids 60-93 of the sequence of S. pyogenes Cas9.

In certain embodiments, examples of the BH domain include those in Table 1. Examples of the BH domain also include any polypeptides a structural similarity and/or sequence similarity to a BH domain described in the art. For example, the BH domain may share a structural similarity and/or sequence similarity to a BH domain of Cas9. In some examples, the BH domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 5%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with BH domains in Table 1.

HNH Domain

The IscB proteins comprise an HNH domain. In certain embodiments, at least one nuclease domain shares a substantial structural similarity or sequence similarity to a HNH domain described in the art.

In some examples, the nucleic acid-guided nuclease comprises a HNH domain and a RuvC domain. In the cases where the RuvC domain comprises RuvC-I, RuvC-II, and RuvC-III domain, the HNH domain may be located between the Ruv C II and RuvC III subdomains of the RuvC domain.

In certain embodiments, examples of the HNH domain include those in Table 1. Examples of the HNH domain also include any polypeptides a structural similarity and/or sequence similarity to a HNH domain described in the art. For example, the HNH domain may share a structural similarity and/or sequence similarity to a HNH domain of Cas9. In some examples, the HNH domain may have an amino acid sequence that share at least 50%, at least 55%, at least 60%, at least 5%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, or 100% sequence identity with HNH domains in Table 1.

hRNA

In some examples, the IscB proteins capable of forming a complex with one or more hRNA molecules. The hRNA complex can comprise a guide sequence and a scaffold that interacts with the IscB polypeptide. An hRNA molecules may form a complex with an IscB polypeptide nuclease or IscB polypeptide and direct the complex to bind with a target sequence. In certain example embodiments, the hRNA molecule is a single molecule comprising a scaffold sequence and a spacer sequence. In certain example embodiments, the spacer is 5′ of the scaffold sequence. In certain example embodiments, the hRNA molecule may further comprise a conserved nucleic acid sequence between the scaffold and spacer portions.

As used herein, a heterologous hRNA molecule is an hRNA molecule that is not derived from the same species as the IscB polypeptide nuclease, or comprises a portion of the molecule, e.g., spacer, that is not derived from the same species as the IscB polypeptide nuclease, e.g., IscB protein. For example, a heterologous hRNA molecule of a IscB polypeptide nuclease derived from species A comprises a polynucleotide derived from a species different from species A, or an artificial polynucleotide.

Zinc Finger Nucleases

In some embodiments, the polynucleotide is modified using a Zinc Finger nuclease or system thereof. One type of programmable DNA-binding domain is provided by artificial zinc-finger (ZF) technology, which involves arrays of ZF modules to target new DNA-binding sites in the genome. Each finger module in a ZF array targets three DNA bases. A customized array of individual zinc finger domains is assembled into a ZF protein (ZFP).

ZFPs can comprise a functional domain. The first synthetic zinc finger nucleases (ZFNs) were developed by fusing a ZF protein to the catalytic domain of the Type IIS restriction enzyme FokI. (Kim, Y. G. et al., 1994, Chimeric restriction endonuclease, Proc. Natl. Acad. Sci. U.S.A. 91, 883-887; Kim, Y. G. et al., 1996, Hybrid restriction enzymes: zinc finger fusions to Fok I cleavage domain. Proc. Natl. Acad. Sci. U.S.A. 93, 1156-1160). Increased cleavage specificity can be attained with decreased off target activity by use of paired ZFN heterodimers, each targeting different nucleotide sequences separated by a short spacer. (Doyon, Y. et al., 2011, Enhancing zinc-finger-nuclease activity with improved obligate heterodimeric architectures. Nat. Methods 8, 74-79). ZFPs can also be designed as transcription activators and repressors and have been used to target many genes in a wide variety of organisms. Exemplary methods of genome editing using ZFNs can be found for example in U.S. Pat. Nos. 6,534,261, 6,607,882, 6,746,838, 6,794,136, 6,824,978, 6,866,997, 6,933,113, 6,979,539, 7,013,219, 7,030,215, 7,220,719, 7,241,573, 7,241,574, 7,585,849, 7,595,376, 6,903,185, and 6,479,626, all of which are specifically incorporated by reference.

TALE Nucleases

In some embodiments, a TALE nuclease or TALE nuclease system can be used to modify a polynucleotide. In some embodiments, the methods provided herein use isolated, non-naturally occurring, recombinant or engineered DNA binding proteins that comprise TALE monomers or TALE monomers or half monomers as a part of their organizational structure that enable the targeting of nucleic acid sequences with improved efficiency and expanded specificity.

Naturally occurring TALEs or “wild type TALEs” are nucleic acid binding proteins secreted by numerous species of proteobacteria. TALE polypeptides contain a nucleic acid binding domain composed of tandem repeats of highly conserved monomer polypeptides that are predominantly 33, 34 or 35 amino acids in length and that differ from each other mainly in amino acid positions 12 and 13. In advantageous embodiments the nucleic acid is DNA. As used herein, the term “polypeptide monomers”, “TALE monomers” or “monomers” will be used to refer to the highly conserved repetitive polypeptide sequences within the TALE nucleic acid binding domain and the term “repeat variable di-residues” or “RVD” will be used to refer to the highly variable amino acids at positions 12 and 13 of the polypeptide monomers. As provided throughout the disclosure, the amino acid residues of the RVD are depicted using the IUPAC single letter code for amino acids. A general representation of a TALE monomer which is comprised within the DNA binding domain is X_1-11-(X₁₂X₁₃)-X_1-33 or 34 or 35, where the subscript indicates the amino acid position and X represents any amino acid. X₁₂X₁₃ indicate the RVDs. In some polypeptide monomers, the variable amino acid at position 13 is missing or absent and in such monomers, the RVD consists of a single amino acid. In such cases the RVD may be alternatively represented as X*, where X represents X₁₂ and (*) indicates that X₁₃ is absent. The DNA binding domain comprises several repeats of TALE monomers and this may be represented as (X_1-11-(X₁₂X₁₃)-X_14-33 or 34 or 35)_z, where in an advantageous embodiment, z is at least 5 to 40. In a further advantageous embodiment, z is at least 10 to 26.

The TALE monomers can have a nucleotide binding affinity that is determined by the identity of the amino acids in its RVD. For example, polypeptide monomers with an RVD of NI can preferentially bind to adenine (A), monomers with an RVD of NG can preferentially bind to thymine (T), monomers with an RVD of HD can preferentially bind to cytosine (C) and monomers with an RVD of NN can preferentially bind to both adenine (A) and guanine (G). In some embodiments, monomers with an RVD of IG can preferentially bind to T. Thus, the number and order of the polypeptide monomer repeats in the nucleic acid binding domain of a TALE determines its nucleic acid target specificity. In some embodiments, monomers with an RVD of NS can recognize all four base pairs and can bind to A, T, G or C. The structure and function of TALEs is further described in, for example, Moscou et al., Science 326:1501 (2009); Boch et al., Science 326:1509-1512 (2009); and Zhang et al., Nature Biotechnology 29:149-153 (2011).

The polypeptides used in methods of the invention can be isolated, non-naturally occurring, recombinant or engineered nucleic acid-binding proteins that have nucleic acid or DNA binding regions containing polypeptide monomer repeats that are designed to target specific nucleic acid sequences.

As described herein, polypeptide monomers having an RVD of HN or NH preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In some embodiments, polypeptide monomers having RVDs RN, NN, NK, SN, NH, KN, HN, NQ, HH, RG, KH, RH and SS can preferentially bind to guanine. In some embodiments, polypeptide monomers having RVDs RN, NK, NQ, HH, KH, RH, SS and SN can preferentially bind to guanine and can thus allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In some embodiments, polypeptide monomers having RVDs HH, KH, NH, NK, NQ, RH, RN and SS can preferentially bind to guanine and thereby allow the generation of TALE polypeptides with high binding specificity for guanine containing target nucleic acid sequences. In some embodiments, the RVDs that have high binding specificity for guanine are RN, NH RH and KH. Furthermore, polypeptide monomers having an RVD of NV can preferentially bind to adenine and guanine. In some embodiments, monomers having RVDs of H*, HA, KA, N*, NA, NC, NS, RA, and S* bind to adenine, guanine, cytosine and thymine with comparable affinity.

The predetermined N-terminal to C-terminal order of the one or more polypeptide monomers of the nucleic acid or DNA binding domain determines the corresponding predetermined target nucleic acid sequence to which the polypeptides of the invention will bind. As used herein the monomers and at least one or more half monomers are “specifically ordered to target” the genomic locus or gene of interest. In plant genomes, the natural TALE-binding sites always begin with a thymine (T), which may be specified by a cryptic signal within the non-repetitive N-terminus of the TALE polypeptide; in some cases, this region may be referred to as repeat 0. In animal genomes, TALE binding sites do not necessarily have to begin with a thymine (T) and polypeptides of the invention may target DNA sequences that begin with T, A, G or C. The tandem repeat of TALE monomers always ends with a half-length repeat or a stretch of sequence that may share identity with only the first 20 amino acids of a repetitive full-length TALE monomer and this half repeat may be referred to as a half-monomer. Therefore, it follows that the length of the nucleic acid or DNA being targeted is equal to the number of full monomers plus two.

As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), TALE polypeptide binding efficiency may be increased by including amino acid sequences from the “capping regions” that are directly N-terminal or C-terminal of the DNA binding region of naturally occurring TALEs into the engineered TALEs at positions N-terminal or C-terminal of the engineered TALE DNA binding region. Thus, in certain embodiments, the TALE polypeptides described herein further comprise an N-terminal capping region and/or a C-terminal capping region.

An exemplary amino acid sequence of a N-terminal capping region is:

(SEQ ID NO: 9)
MDPIRSRTPSPARELLSGPQPDGVQPTADRGVSPPAGGP
LDGLPARRTMSRTRLPSPPAPSPAFSADSFSDLLRQFDPSLENTS
LFDSLPPFGAHHTEAATGEWDEVQSGLRAADAPPPTMRVAVTA
ARPPRAKPAPRRRAAQPSDASPAAQVDLRTLGYSQQQQEKIKP
KVRSTVAQHHEALVGHGFTHAHIVALSQHPAALGTVAVKYQD
MIAALPEATHEAIVGVGKQWSGARALEALLTVAGELRGPPLQL
DTGQLLKIAKRGGVTAVEAVHAWRNALTGAPLN

An exemplary amino acid sequence of a C-terminal capping region is:

(SEQ ID NO: 10)
RPALESIVAQLSRPDPALAALTNDHLVALACLGGRPAL
DAVKKGLPHAPALIKRTNRRIPERTSHRVADHAQVVRVLGFFQ
CHSHPAQAFDDAMTQFGMSRHGLLQLFRRVGVTELEARSGTLP
PASQRWDRILQASGMKRAKPSPTSTQTPDQASLHAFADSLERD
LDAPSPMHEGDQTRAS

As used herein the predetermined “N-terminus” to “C terminus” orientation of the N-terminal capping region, the DNA binding domain comprising the repeat TALE monomers and the C-terminal capping region provide structural basis for the organization of different domains in the d-TALEs or polypeptides of the invention.

The entire N-terminal and/or C-terminal capping regions are not necessary to enhance the binding activity of the DNA binding region. Therefore, in certain embodiments, fragments of the N-terminal and/or C-terminal capping regions are included in the TALE polypeptides described herein.

In certain embodiments, the TALE polypeptides described herein contain a N-terminal capping region fragment that included at least 10, 20, 30, 40, 50, 54, 60, 70, 80, 87, 90, 94, 100, 102, 110, 117, 120, 130, 140, 147, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240, 250, 260 or 270 amino acids of an N-terminal capping region. In certain embodiments, the N-terminal capping region fragment amino acids are of the C-terminus (the DNA-binding region proximal end) of an N-terminal capping region. As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), N-terminal capping region fragments that include the C-terminal 240 amino acids enhance binding activity equal to the full length capping region, while fragments that include the C-terminal 147 amino acids retain greater than 80% of the efficacy of the full length capping region, and fragments that include the C-terminal 117 amino acids retain greater than 50% of the activity of the full-length capping region.

In some embodiments, the TALE polypeptides described herein contain a C-terminal capping region fragment that included at least 6, 10, 20, 30, 37, 40, 50, 60, 68, 70, 80, 90, 100, 110, 120, 127, 130, 140, 150, 155, 160, 170, 180 amino acids of a C-terminal capping region. In certain embodiments, the C-terminal capping region fragment amino acids are of the N-terminus (the DNA-binding region proximal end) of a C-terminal capping region. As described in Zhang et al., Nature Biotechnology 29:149-153 (2011), C-terminal capping region fragments that include the C-terminal 68 amino acids enhance binding activity equal to the full-length capping region, while fragments that include the C-terminal 20 amino acids retain greater than 50% of the efficacy of the full-length capping region.

In certain embodiments, the capping regions of the TALE polypeptides described herein do not need to have identical sequences to the capping region sequences provided herein. Thus, in some embodiments, the capping region of the TALE polypeptides described herein have sequences that are at least 50%, 60%, 70%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical or share identity to the capping region amino acid sequences provided herein. Sequence identity is related to sequence homology. Homology comparisons may be conducted by eye, or more usually, with the aid of readily available sequence comparison programs. These commercially available computer programs may calculate percent (%) homology between two or more sequences and may also calculate the sequence identity shared by two or more amino acid or nucleic acid sequences. In some preferred embodiments, the capping region of the TALE polypeptides described herein have sequences that are at least 95% identical or share identity to the capping region amino acid sequences provided herein.

Sequence homologies can be generated by any of a number of computer programs known in the art, which include but are not limited to BLAST or FASTA. Suitable computer programs for carrying out alignments like the GCG Wisconsin Bestfit package may also be used. Once the software has produced an optimal alignment, it is possible to calculate % homology, preferably % sequence identity. The software typically does this as part of the sequence comparison and generates a numerical result.

In some embodiments described herein, the TALE polypeptides of the invention include a nucleic acid binding domain linked to the one or more effector domains. The terms “effector domain” or “regulatory and functional domain” refer to a polypeptide sequence that has an activity other than binding to the nucleic acid sequence recognized by the nucleic acid binding domain. By combining a nucleic acid binding domain with one or more effector domains, the polypeptides of the invention may be used to target the one or more functions or activities mediated by the effector domain to a particular target DNA sequence to which the nucleic acid binding domain specifically binds.

In some embodiments of the TALE polypeptides described herein, the activity mediated by the effector domain is a biological activity. For example, in some embodiments the effector domain is a transcriptional inhibitor (i.e., a repressor domain), such as an mSin interaction domain (SID). SID4X domain or a Kruppel-associated box (KRAB) or fragments of the KRAB domain. In some embodiments the effector domain is an enhancer of transcription (i.e., an activation domain), such as the VP16, VP64 or p65 activation domain. In some embodiments, the nucleic acid binding is linked, for example, with an effector domain that includes but is not limited to a transposase, integrase, recombinase, resolvase, invertase, protease, DNA methyltransferase, DNA demethylase, histone acetylase, histone deacetylase, nuclease, transcriptional repressor, transcriptional activator, transcription factor recruiting, protein nuclear-localization signal or cellular uptake signal.

In some embodiments, the effector domain is a protein domain which exhibits activities which include but are not limited to transposase activity, integrase activity, recombinase activity, resolvase activity, invertase activity, protease activity, DNA methyltransferase activity, DNA demethylase activity, histone acetylase activity, histone deacetylase activity, nuclease activity, nuclear-localization signaling activity, transcriptional repressor activity, transcriptional activator activity, transcription factor recruiting activity, or cellular uptake signaling activity. Other preferred embodiments of the invention may include any combination of the activities described herein.

Meganucleases

In some embodiments, a meganuclease or system thereof can be used to modify a polynucleotide. Meganucleases, which are endodeoxyribonucleases characterized by a large recognition site (double-stranded DNA sequences of 12 to 40 base pairs). Exemplary methods for using meganucleases can be found in U.S. Pat. Nos. 8,163,514, 8,133,697, 8,021,867, 8,119,361, 8,119,381, 8,124,369, and 8,129,134, which are specifically incorporated by reference.

Sequences Related to Nucleus Targeting and Transportation

In some embodiments, one or more components (e.g., the Cas protein and/or deaminase, Zn Finger protein, TALE, or meganuclease) in the composition for engineering cells may comprise one or more sequences related to nucleus targeting and transportation. Such sequence may facilitate the one or more components in the composition for targeting a sequence within a cell. In order to improve targeting of the CRISPR-Cas protein and/or the nucleotide deaminase protein or catalytic domain thereof used in the methods of the present disclosure to the nucleus, it may be advantageous to provide one or both of these components with one or more nuclear localization sequences (NLSs).

In some embodiments, the NLSs used in the context of the present disclosure are heterologous to the proteins. Non-limiting examples of NLSs include an NLS sequence derived from: the NLS of the SV40 virus large T-antigen, having the amino acid sequence PKKKRKV (SEQ ID NO: 11) or PKKKRKVEAS (SEQ ID NO: 12); the NLS from nucleoplasmin (e.g., the nucleoplasmin bipartite NLS with the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 13)); the c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 14) or RQRRNELKRSP (SEQ ID NO: 15); the hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 16); the sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 17) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 18) and PPKKARED (SEQ ID NO: 19) of the myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 20) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 21) of mouse c-abl IV; the sequences DRLRR (SEQ ID NO: 22) and PKQKKRK (SEQ ID NO: 23) of the influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 24) of the Hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO: 25) of the mouse Mxl protein; the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 26) of the human poly(ADP-ribose) polymerase; and the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 27) of the steroid hormone receptors (human) glucocorticoid. In general, the one or more NLSs are of sufficient strength to drive accumulation of the DNA-targeting Cas protein in a detectable amount in the nucleus of a eukaryotic cell. In general, strength of nuclear localization activity may derive from the number of NLSs in the CRISPR-Cas protein, the particular NLS(s) used, or a combination of these factors. Detection of accumulation in the nucleus may be performed by any suitable technique. For example, a detectable marker may be fused to the nucleic acid-targeting protein, such that location within a cell may be visualized, such as in combination with a means for detecting the location of the nucleus (e.g., a stain specific for the nucleus such as DAPI). Cell nuclei may also be isolated from cells, the contents of which may then be analyzed by any suitable process for detecting protein, such as immunohistochemistry, Western blot, or enzyme activity assay. Accumulation in the nucleus may also be determined indirectly, such as by an assay for the effect of nucleic acid-targeting complex formation (e.g., assay for deaminase activity) at the target sequence, or assay for altered gene expression activity affected by DNA-targeting complex formation and/or DNA-targeting), as compared to a control not exposed to the CRISPR-Cas protein and deaminase protein, or exposed to a CRISPR-Cas and/or deaminase protein lacking the one or more NLSs.

The CRISPR-Cas and/or nucleotide deaminase proteins may be provided with 1 or more, such as with, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more heterologous NLSs. In some embodiments, the proteins comprises about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the amino-terminus, about or more than about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more NLSs at or near the carboxy-terminus, or a combination of these (e.g., zero or at least one or more NLS at the amino-terminus and zero or at one or more NLS at the carboxy terminus). When more than one NLS is present, each may be selected independently of the others, such that a single NLS may be present in more than one copy and/or in combination with one or more other NLSs present in one or more copies. In some embodiments, an NLS is considered near the N- or C-terminus when the nearest amino acid of the NLS is within about 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50, or more amino acids along the polypeptide chain from the N- or C-terminus. In preferred embodiments of the CRISPR-Cas proteins, an NLS attached to the C-terminal of the protein.

In certain embodiments, the CRISPR-Cas protein and the deaminase protein are delivered to the cell or expressed within the cell as separate proteins. In these embodiments, each of the CRISPR-Cas and deaminase protein can be provided with one or more NLSs as described herein. In certain embodiments, the CRISPR-Cas and deaminase proteins are delivered to the cell or expressed with the cell as a fusion protein. In these embodiments one or both of the CRISPR-Cas and deaminase protein is provided with one or more NLSs. Where the nucleotide deaminase is fused to an adaptor protein (such as MS2) as described above, the one or more NLS can be provided on the adaptor protein, provided that this does not interfere with aptamer binding. In particular embodiments, the one or more NLS sequences may also function as linker sequences between the nucleotide deaminase and the CRISPR-Cas protein.

In certain embodiments, guides of the disclosure comprise specific binding sites (e.g. aptamers) for adapter proteins, which may be linked to or fused to an nucleotide deaminase or catalytic domain thereof. When such a guide forms a CRISPR complex (e.g., CRISPR-Cas protein binding to guide and target) the adapter proteins bind and, the nucleotide deaminase or catalytic domain thereof associated with the adapter protein is positioned in a spatial orientation which is advantageous for the attributed function to be effective.

The skilled person will understand that modifications to the guide which allow for binding of the adapter+nucleotide deaminase, but not proper positioning of the adapter+nucleotide deaminase (e.g., due to steric hindrance within the three dimensional structure of the CRISPR complex) are modifications which are not intended. The one or more modified guide may be modified at the tetra loop, the stem loop 1, stem loop 2, or stem loop 3, as described herein, preferably at either the tetra loop or stem loop 2, and in some cases at both the tetra loop and stem loop 2.

In some embodiments, a component (e.g., the dead Cas protein, the nucleotide deaminase protein or catalytic domain thereof, or a combination thereof) in the systems may comprise one or more nuclear export signals (NES), one or more nuclear localization signals (NLS), or any combinations thereof. In some cases, the NES may be an HIV Rev NES. In certain cases, the NES may be MAPK NES. When the component is a protein, the NES or NLS may be at the C terminus of component. Alternatively, or additionally, the NES or NLS may be at the N terminus of component. In some examples, the Cas protein and optionally said nucleotide deaminase protein or catalytic domain thereof comprise one or more heterologous nuclear export signal(s) (NES(s)) or nuclear localization signal(s) (NLS(s)), preferably an HIV Rev NES or MAPK NES, preferably C-terminal.

Templates

In some embodiments, the composition for engineering cells comprises a template, e.g., a recombination template. A template may be a component of another vector as described herein, contained in a separate vector, or provided as a separate polynucleotide. In some embodiments, a recombination template is designed to serve as a template in homologous recombination, such as within or near a target sequence nicked or cleaved by a nucleic acid-targeting effector protein as a part of a nucleic acid-targeting complex.

In an embodiment, the template nucleic acid alters the sequence of the target position. In an embodiment, the template nucleic acid results in the incorporation of a modified, or non-naturally occurring base into the target nucleic acid.

The template sequence may undergo a breakage mediated or catalyzed recombination with the target sequence. In an embodiment, the template nucleic acid may include sequence that corresponds to a site on the target sequence that is cleaved by a Cas protein mediated cleavage event. In an embodiment, the template nucleic acid may include sequence that corresponds to both, a first site on the target sequence that is cleaved in a first Cas protein mediated event, and a second site on the target sequence that is cleaved in a second Cas protein mediated event.

In certain embodiments, the template nucleic acid can include sequence which results in an alteration in the coding sequence of a translated sequence, e.g., one which results in the substitution of one amino acid for another in a protein product, e.g., transforming a mutant allele into a wild type allele, transforming a wild type allele into a mutant allele, and/or introducing a stop codon, insertion of an amino acid residue, deletion of an amino acid residue, or a nonsense mutation. In certain embodiments, the template nucleic acid can include sequence which results in an alteration in a non-coding sequence, e.g., an alteration in an exon or in a 5′ or 3′ non-translated or non-transcribed region. Such alterations include an alteration in a control element, e.g., a promoter, enhancer, and an alteration in a cis-acting or trans-acting control element.

A template nucleic acid having homology with a target position in a target gene may be used to alter the structure of a target sequence. The template sequence may be used to alter an unwanted structure, e.g., an unwanted or mutant nucleotide. The template nucleic acid may include sequence which, when integrated, results in: decreasing the activity of a positive control element; increasing the activity of a positive control element; decreasing the activity of a negative control element; increasing the activity of a negative control element; decreasing the expression of a gene; increasing the expression of a gene; increasing resistance to a disorder or disease; increasing resistance to viral entry; correcting a mutation or altering an unwanted amino acid residue conferring, increasing, abolishing or decreasing a biological property of a gene product, e.g., increasing the enzymatic activity of an enzyme, or increasing the ability of a gene product to interact with another molecule.

The template nucleic acid may include sequence which results in: a change in sequence of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12 or more nucleotides of the target sequence.

A template polynucleotide may be of any suitable length, such as about or more than about 10, 15, 20, 25, 50, 75, 100, 150, 200, 500, 1000, or more nucleotides in length. In an embodiment, the template nucleic acid may be 20+/−10, 30+/−10, 40+/−10, 50+/−10, 60+/−10, 70+/−10, 80+/−10, 90+/−10, 100+/−10, 1 10+/−10, 120+/−10, 130+/−10, 140+/−10, 150+/−10, 160+/−10, 170+/−10, 1 80+/−10, 190+/−10, 200+/−10, 210+/−10, of 220+/−10 nucleotides in length. In an embodiment, the template nucleic acid may be 30+/−20, 40+/−20, 50+/−20, 60+/−20, 70+/−20, 80+/−20, 90+/−20, 100+/−20, 1 10+/−20, 120+/−20, 130+/−20, 140+/−20, 150+/−20, 160+/−20, 170+/−20, 180+/−20, 190+/−20, 200+/−20, 210+/−20, of 220+/−20 nucleotides in length. In an embodiment, the template nucleic acid is 10 to 1,000, 20 to 900, 30 to 800, 40 to 700, 50 to 600, 50 to 500, 50 to 400, 50 to300, 50 to 200, or 50 to 100 nucleotides in length.

In some embodiments, the template polynucleotide is complementary to a portion of a polynucleotide comprising the target sequence. When optimally aligned, a template polynucleotide might overlap with one or more nucleotides of a target sequences (e.g., about or more than about 1, 5, 10, 15, 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100 or more nucleotides). In some embodiments, when a template sequence and a polynucleotide comprising a target sequence are optimally aligned, the nearest nucleotide of the template polynucleotide is within about 1, 5, 10, 15, 20, 25, 50, 75, 100, 200, 300, 400, 500, 1000, 5000, 10000, or more nucleotides from the target sequence.

The exogenous polynucleotide template comprises a sequence to be integrated (e.g., a mutated gene). The sequence for integration may be a sequence endogenous or exogenous to the cell. Examples of a sequence to be integrated include polynucleotides encoding a protein or a non-coding RNA (e.g., a microRNA). Thus, the sequence for integration may be operably linked to an appropriate control sequence or sequences. Alternatively, the sequence to be integrated may provide a regulatory function.

An upstream or downstream sequence may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp. In some methods, the exemplary upstream or downstream sequence have about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000.

An upstream or downstream sequence may comprise from about 20 bp to about 2500 bp, for example, about 50, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100, 1200, 1300, 1400, 1500, 1600, 1700, 1800, 1900, 2000, 2100, 2200, 2300, 2400, or 2500 bp. In some methods, the exemplary upstream or downstream sequence have about 200 bp to about 2000 bp, about 600 bp to about 1000 bp, or more particularly about 700 bp to about 1000

In certain embodiments, one or both homology arms may be shortened to avoid including certain sequence repeat elements. For example, a 5′ homology arm may be shortened to avoid a sequence repeat element. In other embodiments, a 3′ homology arm may be shortened to avoid a sequence repeat element. In some embodiments, both the 5′ and the 3′ homology arms may be shortened to avoid including certain sequence repeat elements.

In some methods, the exogenous polynucleotide template may further comprise a marker. Such a marker may make it easy to screen for targeted integrations. Examples of suitable markers include restriction sites, fluorescent proteins, or selectable markers. The exogenous polynucleotide template of the disclosure can be constructed using recombinant techniques (see, for example, Sambrook et al., 2001 and Ausubel et al., 1996).

In certain embodiments, a template nucleic acid for correcting a mutation may be designed for use as a single-stranded oligonucleotide. When using a single-stranded oligonucleotide, 5′ and 3′ homology arms may range up to about 200 base pairs (bp) in length, e.g., at least 25, 50, 75, 100, 125, 150, 175, or 200 bp in length.

In certain embodiments, a template nucleic acid for correcting a mutation may be designed for use with a homology-independent targeted integration system. Suzuki et al. describe in vivo genome editing via CRISPR/Cas9 mediated homology-independent targeted integration (2016, Nature 540:144-149). Schmid-Burgk, et al. describe use of the CRISPR-Cas9 system to introduce a double-strand break (DSB) at a user-defined genomic location and insertion of a universal donor DNA (Nat Commun. 2016 Jul. 28; 7:12338). Gao, et al. describe “Plug-and-Play Protein Modification Using Homology-Independent Universal Genome Engineering” (Neuron. 2019 Aug. 21; 103(4):583-597).

RNAi

In some embodiments, the genetic modulating agents may be interfering RNAs. In certain embodiments, diseases caused by a dominant mutation in a gene is targeted by silencing the mutated gene using RNAi. In some cases, the nucleotide sequence may comprise coding sequence for one or more interfering RNAs. In certain examples, the nucleotide sequence may be interfering RNA (RNAi). As used herein, the term “RNAi” refers to any type of interfering RNA, including but not limited to, siRNAi, shRNAi, endogenous microRNA and artificial microRNA. For instance, it includes sequences previously identified as siRNA, regardless of the mechanism of down-stream processing of the RNA (i.e., although siRNAs are believed to have a specific method of in vivo processing resulting in the cleavage of mRNA, such sequences can be incorporated into the vectors in the context of the flanking sequences described herein). The term “RNAi” can include both gene silencing RNAi molecules, and also RNAi effector molecules which activate the expression of a gene.

In certain embodiments, a modulating agent may comprise silencing one or more endogenous genes. As used herein, “gene silencing” or “gene silenced” in reference to an activity of an RNAi molecule, for example a siRNA or miRNA refers to a decrease in the mRNA level in a cell for a target gene by at least about 5%, about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, about 95%, about 99%, about 100% of the mRNA level found in the cell without the presence of the miRNA or RNA interference molecule. In one preferred embodiment, the mRNA levels are decreased by at least about 70%, about 80%, about 90%, about 95%, about 99%, about 100%.

As used herein, a “siRNA” refers to a nucleic acid that forms a double stranded RNA, which double stranded RNA has the ability to reduce or inhibit expression of a gene or target gene when the siRNA is present or expressed in the same cell as the target gene. The double stranded RNA siRNA can be formed by the complementary strands. In one embodiment, a siRNA refers to a nucleic acid that can form a double stranded siRNA. The sequence of the siRNA can correspond to the full-length target gene, or a subsequence thereof. Typically, the siRNA is at least about 15-50 nucleotides in length (e.g., each complementary sequence of the double stranded siRNA is about 15-50 nucleotides in length, and the double stranded siRNA is about 15-50 base pairs in length, preferably about 19-30 base nucleotides, preferably about 20-25 nucleotides in length, e.g., 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 nucleotides in length).

As used herein “shRNA” or “small hairpin RNA” (also called stem loop) is a type of siRNA. In one embodiment, these shRNAs are composed of a short, e.g., about 19 to about 25 nucleotide, antisense strand, followed by a nucleotide loop of about 5 to about 9 nucleotides, and the analogous sense strand. Alternatively, the sense strand can precede the nucleotide loop structure and the antisense strand can follow.

The terms “microRNA” or “miRNA”, used interchangeably herein, are endogenous RNAs, some of which are known to regulate the expression of protein-coding genes at the posttranscriptional level. Endogenous microRNAs are small RNAs naturally present in the genome that are capable of modulating the productive utilization of mRNA. The term artificial microRNA includes any type of RNA sequence, other than endogenous microRNA, which is capable of modulating the productive utilization of mRNA. MicroRNA sequences have been described in publications such as Lim, et al., Genes & Development, 17, p. 991-1008 (2003), Lim et al Science 299, 1540 (2003), Lee and Ambros Science, 294, 862 (2001), Lau et al., Science 294, 858-861 (2001), Lagos-Quintana et al, Current Biology, 12, 735-739 (2002), Lagos Quintana et al, Science 294, 853-857 (2001), and Lagos-Quintana et al, RNA, 9, 175-179 (2003), which are incorporated by reference. Multiple microRNAs can also be incorporated into a precursor molecule. Furthermore, miRNA-like stem-loops can be expressed in cells as a vehicle to deliver artificial miRNAs and short interfering RNAs (siRNAs) for the purpose of modulating the expression of endogenous genes through the miRNA and or RNAi pathways.

As used herein, “double stranded RNA” or “dsRNA” refers to RNA molecules that are comprised of two strands. Double-stranded molecules include those comprised of a single RNA molecule that doubles back on itself to form a two-stranded structure. For example, the stem loop structure of the progenitor molecules from which the single-stranded miRNA is derived, called the pre-miRNA (Bartel et al. 2004. Cell 1 16:281-297), comprises a dsRNA molecule.

Adoptive Cell Transfer

In certain embodiments, non-pathogenic Th1 cells are used to treat autoimmunity by adoptively transferring the cells to a subject in need thereof. In certain embodiments, non-pathogenic Th1 cells are generated by treating Th1 cells or naive CD4 T cells with an agent capable of decreasing expression of IL-23R. In certain embodiments, non-pathogenic Th1 cells are generated by treating Th1 cells or naive CD4 T cells with an agent capable of decreasing expression of one or more of CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW. For example, Th1 cells can be modified ex vivo using a genetic modifying agent (e.g., CRISPR, RNAi). In certain embodiments, pathogenic Th1 cells are used in adoptive cell transfer to treat cancer (e.g., in vitro differentiated Th1 cells, as described herein). In certain embodiments, the Th1 cells are modified ex vivo to express a tumor antigen specific T cell receptor (TCR).

As used herein, “ACT”, “adoptive cell therapy” and “adoptive cell transfer” may be used interchangeably. In certain embodiments, Adoptive cell therapy (ACT) can refer to the transfer of cells, most commonly immune-derived cells, back into the same patient or into a new recipient host with the goal of transferring the immunologic functionality and characteristics into the new host. If possible, use of autologous cells helps the recipient by minimizing GVHD issues. The adoptive transfer of autologous tumor infiltrating lymphocytes (TIL) (Zacharakis et al., (2018) Nat Med. 2018 June; 24(6):724-730; Besser et al., (2010) Clin. Cancer Res 16 (9) 2646-55; Dudley et al., (2002) Science 298 (5594): 850-4; and Dudley et al., (2005) Journal of Clinical Oncology 23 (10): 2346-57.) or genetically re-directed peripheral blood mononuclear cells (Johnson et al., (2009) Blood 114 (3): 535-46; and Morgan et al., (2006) Science 314(5796) 126-9) has been used to successfully treat patients with advanced solid tumors, including melanoma, metastatic breast cancer and colorectal carcinoma, as well as patients with CD19-expressing hematologic malignancies (Kalos et al., (2011) Science Translational Medicine 3 (95): 95ra73). In certain embodiments, allogenic cells immune cells are transferred (see, e.g., Ren et al., (2017) Clin Cancer Res 23 (9) 2255-2266). As described further herein, allogenic cells can be edited to reduce alloreactivity and prevent graft-versus-host disease. Thus, use of allogenic cells allows for cells to be obtained from healthy donors and prepared for use in patients as opposed to preparing autologous cells from a patient after diagnosis.

Aspects of the invention involve the adoptive transfer of immune system cells, such as T cells, specific for selected antigens, such as tumor associated antigens or tumor specific neoantigens (see, e.g., Maus et al., 2014, Adoptive Immunotherapy for Cancer or Viruses, Annual Review of Immunology, Vol. 32: 189-225; Rosenberg and Restifo, 2015, Adoptive cell transfer as personalized immunotherapy for human cancer, Science Vol. 348 no. 6230 pp. 62-68; Restifo et al., 2015, Adoptive immunotherapy for cancer: harnessing the T cell response. Nat. Rev. Immunol. 12(4): 269-281; and Jenson and Riddell, 2014, Design and implementation of adoptive therapy with chimeric antigen receptor-modified T cells. Immunol Rev. 257(1): 127-144; and Rajasagi et al., 2014, Systematic identification of personal tumor-specific neoantigens in chronic lymphocytic leukemia. Blood. 2014 Jul. 17; 124(3):453-62).

In certain embodiments, an antigen (such as a tumor antigen) to be targeted in adoptive cell therapy (such as particularly CAR or TCR T-cell therapy) of a disease (such as particularly of tumor or cancer) may be selected from a group consisting of: MR1 (see, e.g., Crowther, et al., 2020, Genome-wide CRISPR-Cas9 screening reveals ubiquitous T cell cancer targeting via the monomorphic MHC class I-related protein MR1, Nature Immunology volume 21, pages178-185), B cell maturation antigen (BCMA) (see, e.g., Friedman et al., Effective Targeting of Multiple BCMA-Expressing Hematological Malignancies by Anti-BCMA CAR T Cells, Hum Gene Ther. 2018 Mar. 8; Berdeja J G, et al. Durable clinical responses in heavily pretreated patients with relapsed/refractory multiple myeloma: updated results from a multicenter study of bb2121 anti-Bcma CAR T cell therapy. Blood. 2017; 130:740; and Mouhieddine and Ghobrial, Immunotherapy in Multiple Myeloma: The Era of CAR T Cell Therapy, Hematologist, May-June 2018, Volume 15, issue 3); PSA (prostate-specific antigen); prostate-specific membrane antigen (PSMA); PSCA (Prostate stem cell antigen); Tyrosine-protein kinase transmembrane receptor ROR1; fibroblast activation protein (FAP); Tumor-associated glycoprotein 72 (TAG72); Carcinoembryonic antigen (CEA); Epithelial cell adhesion molecule (EPCAM); Mesothelin; Human Epidermal growth factor Receptor 2 (ERBB2 (Her2/neu)); Prostase; Prostatic acid phosphatase (PAP); elongation factor 2 mutant (ELF2M); Insulin-like growth factor 1 receptor (IGF-1R); gplOO; BCR-ABL (breakpoint cluster region-Abelson); tyrosinase; New York esophageal squamous cell carcinoma 1 (NY-ESO-1); κ-light chain, LAGE (L antigen); MAGE (melanoma antigen); Melanoma-associated antigen 1 (MAGE-A1); MAGE A3; MAGE A6; legumain; Human papillomavirus (HPV) E6; HPV E7; prostein; survivin; PCTA1 (Galectin 8); Melan-A/MART-1; Ras mutant; TRP-1 (tyrosinase related protein 1, or gp75); Tyrosinase-related Protein 2 (TRP2); TRP-2/INT2 (TRP-2/intron 2); RAGE (renal antigen); receptor for advanced glycation end products 1 (RAGE1); Renal ubiquitous 1, 2 (RU1, RU2); intestinal carboxyl esterase (iCE); Heat shock protein 70-2 (HSP70-2) mutant; thyroid stimulating hormone receptor (TSHR); CD123; CD171; CD19; CD20; CD22; CD26; CD30; CD33; CD44v7/8 (cluster of differentiation 44, exons 7/8); CD53; CD92; CD100; CD148; CD150; CD200; CD261; CD262; CD362; CS-1 (CD2 subset 1, CRACC, SLAMF7, CD319, and 19A24); C-type lectin-like molecule-1 (CLL-1); ganglioside GD3 (aNeu5Ac(2-8)aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); Tn antigen (Tn Ag); Fms-Like Tyrosine Kinase 3 (FLT3); CD38; CD138; CD44v6; B7H3 (CD276); KIT (CD117); Interleukin-13 receptor subunit alpha-2 (IL-13Ra2); Interleukin 11 receptor alpha (IL-11Ra); prostate stem cell antigen (PSCA); Protease Serine 21 (PRSS21); vascular endothelial growth factor receptor 2 (VEGFR2); Lewis(Y) antigen; CD24; Platelet-derived growth factor receptor beta (PDGFR-beta); stage-specific embryonic antigen-4 (SSEA-4); Mucin 1, cell surface associated (MUC1); mucin 16 (MUC16); epidermal growth factor receptor (EGFR); epidermal growth factor receptor variant III (EGFRvIII); neural cell adhesion molecule (NCAM); carbonic anhydrase IX (CAIX); Proteasome (Prosome, Macropain) Subunit, Beta Type, 9 (LMP2); ephrin type-A receptor 2 (EphA2); Ephrin B2; Fucosyl GM1; sialyl Lewis adhesion molecule (sLe); ganglioside GM3 (aNeu5Ac(2-3)bDGalp(1-4)bDGlcp(1-1)Cer); TGS5; high molecular weight-melanoma-associated antigen (HMWMAA); o-acetyl-GD2 ganglioside (OAcGD2); Folate receptor alpha; Folate receptor beta; tumor endothelial marker 1 (TEM1/CD248); tumor endothelial marker 7-related (TEM7R); claudin 6 (CLDN6); G protein-coupled receptor class C group 5, member D (GPRC5D); chromosome X open reading frame 61 (CXORF61); CD97; CD179a; anaplastic lymphoma kinase (ALK); Polysialic acid; placenta-specific 1 (PLAC1); hexasaccharide portion of globoH glycoceramide (GloboH); mammary gland differentiation antigen (NY-BR-1); uroplakin 2 (UPK2); Hepatitis A virus cellular receptor 1 (HAVCR1); adrenoceptor beta 3 (ADRB3); pannexin 3 (PANX3); G protein-coupled receptor 20 (GPR20); lymphocyte antigen 6 complex, locus K 9 (LY6K); Olfactory receptor 51E2 (OR51E2); TCR Gamma Alternate Reading Frame Protein (TARP); Wilms tumor protein (WTi); ETS translocation-variant gene 6, located on chromosome 12p (ETV6-AML); sperm protein 17 (SPA17); X Antigen Family, Member 1A (XAGEl); angiopoietin-binding cell surface receptor 2 (Tie 2); CT (cancer/testis (antigen)); melanoma cancer testis antigen-1 (MAD-CT-1); melanoma cancer testis antigen-2 (MAD-CT-2); Fos-related antigen 1; p53; p⁵³ mutant; human Telomerase reverse transcriptase (hTERT); sarcoma translocation breakpoints; melanoma inhibitor of apoptosis (ML-IAP); ERG (transmembrane protease, serine 2 (TMPRSS2) ETS fusion gene); N-Acetyl glucosaminyl-transferase V (NA17); paired box protein Pax-3 (PAX3); Androgen receptor; Cyclin B1; Cyclin D1; v-myc avian myelocytomatosis viral oncogene neuroblastoma derived homolog (MYCN); Ras Homolog Family Member C (RhoC); Cytochrome P450 1B1 (CYP1B1); CCCTC-Binding Factor (Zinc Finger Protein)-Like (BORIS); Squamous Cell Carcinoma Antigen Recognized By T Cells-1 or 3 (SART1, SART3); Paired box protein Pax-5 (PAX5); proacrosin binding protein sp32 (OY-TES1); lymphocyte-specific protein tyrosine kinase (LCK); A kinase anchor protein 4 (AKAP-4); synovial sarcoma, X breakpoint-1, -2, -3 or -4 (SSX1, SSX2, SSX3, SSX4); CD79a; CD79b; CD72; Leukocyte-associated immunoglobulin-like receptor 1 (LAIR1); Fc fragment of IgA receptor (FCAR); Leukocyte immunoglobulin-like receptor subfamily A member 2 (LILRA2); CD300 molecule-like family member f (CD300LF); C-type lectin domain family 12 member A (CLECi2A); bone marrow stromal cell antigen 2 (BST2); EGF-like module-containing mucin-like hormone receptor-like 2 (EMR2); lymphocyte antigen 75 (LY75); Glypican-3 (GPC3); Fc receptor-like 5 (FCRL5); mouse double minute 2 homolog (MDM2); livin; alphafetoprotein (AFP); transmembrane activator and CAML Interactor (TACI); B-cell activating factor receptor (BAFF-R); V-Ki-ras2 Kirsten rat sarcoma viral oncogene homolog (KRAS); immunoglobulin lambda-like polypeptide 1 (IGLL1); 707-AP (707 alanine proline); ART-4 (adenocarcinoma antigen recognized by T4 cells); BAGE (B antigen; b-catenin/m, b-catenin/mutated); CAMEL (CTL-recognized antigen on melanoma); CAP1 (carcinoembryonic antigen peptide 1); CASP-8 (caspase-8); CDC27m (cell-division cycle 27 mutated); CDK4/m (cycline-dependent kinase 4 mutated); Cyp-B (cyclophilin B); DAM (differentiation antigen melanoma); EGP-2 (epithelial glycoprotein 2); EGP-40 (epithelial glycoprotein 40); Erbb2, 3, 4 (erythroblastic leukemia viral oncogene homolog-2, -3, 4); FBP (folate binding protein); fAchR (Fetal acetylcholine receptor); G250 (glycoprotein 250); GAGE (G antigen); GnT-V (N-acetylglucosaminyltransferase V); HAGE (helicose antigen); ULA-A (human leukocyte antigen-A); HST2 (human signet ring tumor 2); KIAA0205; KDR (kinase insert domain receptor); LDLR/FUT (low density lipid receptor/GDP L-fucose: b-D-galactosidase 2-a-L fucosyltransferase); L1CAM (L1 cell adhesion molecule); MC1R (melanocortin 1 receptor); Myosin/m (myosin mutated); MUM-1, -2, -3 (melanoma ubiquitous mutated 1, 2, 3); NA88-A (NA cDNA clone of patient M88); KG2D (Natural killer group 2, member D) ligands; oncofetal antigen (h5T4); p190 minor bcr-abl (protein of 190KD bcr-abl); Pml/RARa (promyelocytic leukaemia/retinoic acid receptor a); PRAME (preferentially expressed antigen of melanoma); SAGE (sarcoma antigen); TEL/AML1 (translocation Ets-family leukemia/acute myeloid leukemia 1); TPI/m (triosephosphate isomerase mutated); CD70; and any combination thereof.

In certain embodiments, ACT includes co-transferring CD4+Th1 cells and CD8+CTLs to induce a synergistic antitumour response (see, e.g., Li et al., Adoptive cell therapy with CD4+T helper 1 cells and CD8+ cytotoxic T cells enhances complete rejection of an established tumour, leading to generation of endogenous memory responses to non-targeted tumour epitopes. Clin Transl Immunology. 2017 October; 6(10): e160).

To guard against possible adverse reactions, engineered immunoresponsive cells may be equipped with a transgenic safety switch, in the form of a transgene that renders the cells vulnerable to exposure to a specific signal. For example, the herpes simplex viral thymidine kinase (TK) gene may be used in this way, for example by introduction into allogeneic T lymphocytes used as donor lymphocyte infusions following stem cell transplantation (Greco, et al., Improving the safety of cell therapy with the TK-suicide gene. Front. Pharmacol. 2015; 6: 95). In such cells, administration of a nucleoside prodrug such as ganciclovir or acyclovir causes cell death. Alternative safety switch constructs include inducible caspase 9, for example triggered by administration of a small-molecule dimerizer that brings together two nonfunctional icasp9 molecules to form the active enzyme. A wide variety of alternative approaches to implementing cellular proliferation controls have been described (see U.S. Patent Publication No. 20130071414; PCT Patent Publication WO2011146862; PCT Patent Publication WO2014011987; PCT Patent Publication WO2013040371; Zhou et al. BLOOD, 2014, 123/25:3895-3905; Di Stasi et al., The New England Journal of Medicine 2011; 365:1673-1683; Sadelain M, The New England Journal of Medicine 2011; 365:1735-173; Ramos et al., Stem Cells 28(6):1107-15 (2010)).

In a further refinement of adoptive therapies, genome editing may be used to tailor immunoresponsive cells to alternative implementations, for example providing edited CAR T cells (see Poirot et al., 2015, Multiplex genome edited T-cell manufacturing platform for “off-the-shelf” adoptive T-cell immunotherapies, Cancer Res 75 (18): 3853; Ren et al., 2017, Multiplex genome editing to generate universal CAR T cells resistant to PD1 inhibition, Clin Cancer Res. 2017 May 1; 23(9):2255-2266. doi: 10.1158/1078-0432.CCR-16-1300. Epub 2016 Nov. 4; Qasim et al., 2017, Molecular remission of infant B-ALL after infusion of universal TALEN gene-edited CAR T cells, Sci Transl Med. 2017 Jan. 25; 9(374); Legut, et al., 2018, CRISPR-mediated TCR replacement generates superior anticancer transgenic T cells. Blood, 131(3), 311-322; Georgiadis et al., Long Terminal Repeat CRISPR-CAR-Coupled “Universal” T Cells Mediate Potent Anti-leukemic Effects, Molecular Therapy, In Press, Corrected Proof, Available online 6 Mar. 2018; and Roth, T. L. Editing of Endogenous Genes in Cellular Immunotherapies. Curr Hematol Malig Rep 15, 235-240 (2020)). Cells may be edited using any CRISPR system and method of use thereof as described herein. CRISPR systems may be delivered to an immune cell by any method described herein. In preferred embodiments, cells are edited ex vivo and transferred to a subject in need thereof.

T cells can be obtained from a number of sources, including peripheral blood mononuclear cells (PBMC), bone marrow, lymph node tissue, spleen tissue, and tumors. In certain embodiments of the present invention, T cells can be obtained from a unit of blood collected from a subject using any number of techniques known to the skilled artisan, such as Ficoll separation. In one preferred embodiment, cells from the circulating blood of an individual are obtained by apheresis or leukapheresis. The apheresis product typically contains lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and platelets.

In one embodiment of the invention, the method further comprises expanding the numbers of T cells in the enriched cell population. The numbers of T cells may be increased at least about 3-fold (or 4-, 5-, 6-, 7-, 8-, or 9-fold), more preferably at least about 10-fold (or 20-, 30-, 40-, 50-, 60-, 70-, 80-, or 90-fold), more preferably at least about 100-fold, more preferably at least about 1,000-fold, or most preferably at least about 100,000-fold. The numbers of T cells may be expanded using any suitable method known in the art.

The administration of cells or population of cells, such as immune system cells or cell populations, such as more particularly immunoresponsive cells or cell populations, as disclosed herein may be carried out in any convenient manner, including by aerosol inhalation, injection, ingestion, transfusion, implantation or transplantation. The cells or population of cells may be administered to a patient subcutaneously, intradermally, intratumorally, intranodally, intramedullary, intramuscularly, intrathecally, by intravenous or intralymphatic injection, or intraperitoneally. In some embodiments, the disclosed immune cells may be delivered or administered into a cavity formed by the resection of tumor tissue (i.e., intracavity delivery) or directly into a tumor prior to resection (i.e., intratumoral delivery). In one embodiment, the cell compositions of the present invention are preferably administered by intravenous injection.

The administration of the cells or population of cells can consist of the administration of 10⁴-10⁹ cells per kg body weight, preferably 10⁵ to 10⁶ cells/kg body weight including all integer values of cell numbers within those ranges. The cells or population of cells can be administrated in one or more doses. In another embodiment, the effective amount of cells are administrated as a single dose. In another embodiment, the effective amount of cells are administrated as more than one dose over a period time. Timing of administration is within the judgment of managing physician and depends on the clinical condition of the patient. The cells or population of cells may be obtained from any source, such as a blood bank or a donor. While individual needs vary, determination of optimal ranges of effective amounts of a given cell type for a particular disease or conditions are within the skill of one in the art. An effective amount means an amount which provides a therapeutic or prophylactic benefit. The dosage administrated will be dependent upon the age, health and weight of the recipient, kind of concurrent treatment, if any, frequency of treatment and the nature of the effect desired.

Administration

In certain embodiments, the one or more agents are administered to a subject in a pharmaceutical composition. A “pharmaceutical composition” refers to a composition that usually contains an excipient, such as a pharmaceutically acceptable carrier that is conventional in the art and that is suitable for administration to cells or to a subject.

The pharmaceutical composition according to the present invention can, in one alternative, include a prodrug. When a pharmaceutical composition according to the present invention includes a prodrug, prodrugs and active metabolites of a compound may be identified using routine techniques known in the art. (See, e.g., Bertolini et al., J. Med. Chem., 40, 2011-2016 (1997); Shan et al., J. Pharm. Sci., 86 (7), 765-767; Bagshawe, Drug Dev. Res., 34, 220-230 (1995); Bodor, Advances in Drug Res., 13, 224-331 (1984); Bundgaard, Design of Prodrugs (Elsevier Press 1985); Larsen, Design and Application of Prodrugs, Drug Design and Development (Krogsgaard-Larsen et al., eds., Harwood Academic Publishers, 1991); Dear et al., J. Chromatogr. B, 748, 281-293 (2000); Spraul et al., J. Pharmaceutical & Biomedical Analysis, 10, 601-605 (1992); and Prox et al., Xenobiol., 3, 103-112 (1992)).

The term “pharmaceutically acceptable” as used throughout this specification is consistent with the art and means compatible with the other ingredients of a pharmaceutical composition and not deleterious to the recipient thereof.

As used herein, “carrier” or “excipient” includes any and all solvents, diluents, buffers (such as, e.g., neutral buffered saline or phosphate buffered saline), solubilizers, colloids, dispersion media, vehicles, fillers, chelating agents (such as, e.g., EDTA or glutathione), amino acids (such as, e.g., glycine), proteins, disintegrants, binders, lubricants, wetting agents, emulsifiers, sweeteners, colorants, flavorings, aromatizers, thickeners, agents for achieving a depot effect, coatings, antifungal agents, preservatives, stabilizers, antioxidants, tonicity controlling agents, absorption delaying agents, and the like. The use of such media and agents for pharmaceutical active components is well known in the art. Such materials should be non-toxic and should not interfere with the activity of the cells or active components.

The precise nature of the carrier or excipient or other material will depend on the route of administration. For example, the composition may be in the form of a parenterally acceptable aqueous solution, which is pyrogen-free and has suitable pH, isotonicity and stability. For general principles in medicinal formulation, the reader is referred to Cell Therapy: Stem Cell Transplantation, Gene Therapy, and Cellular Immunotherapy, by G. Morstyn & W. Sheridan eds., Cambridge University Press, 1996; and Hematopoietic Stem Cell Therapy, E. D. Ball, J. Lister & P. Law, Churchill Livingstone, 2000.

The pharmaceutical composition can be applied parenterally, rectally, orally or topically. Preferably, the pharmaceutical composition may be used for intravenous, intramuscular, subcutaneous, peritoneal, peridural, rectal, nasal, pulmonary, mucosal, or oral application. In a preferred embodiment, the pharmaceutical composition according to the invention is intended to be used as an infusion. The skilled person will understand that compositions which are to be administered orally or topically will usually not comprise cells, although it may be envisioned for oral compositions to also comprise cells, for example when gastro-intestinal tract indications are treated. Each of the cells or active components (e.g., immunomodulants) as discussed herein may be administered by the same route or may be administered by a different route. By means of example, and without limitation, cells may be administered parenterally and other active components may be administered orally.

Liquid pharmaceutical compositions may generally include a liquid carrier such as water or a pharmaceutically acceptable aqueous solution. For example, physiological saline solution, tissue or cell culture media, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included.

The composition may include one or more cell protective molecules, cell regenerative molecules, growth factors, anti-apoptotic factors or factors that regulate gene expression in the cells. Such substances may render the cells independent of their environment.

Such pharmaceutical compositions may contain further components ensuring the viability of the cells therein. For example, the compositions may comprise a suitable buffer system (e.g., phosphate or carbonate buffer system) to achieve desirable pH, more usually near neutral pH, and may comprise sufficient salt to ensure isoosmotic conditions for the cells to prevent osmotic stress. For example, suitable solution for these purposes may be phosphate-buffered saline (PBS), sodium chloride solution, Ringer's Injection or Lactated Ringer's Injection, as known in the art. Further, the composition may comprise a carrier protein, e.g., albumin (e.g., bovine or human albumin), which may increase the viability of the cells.

Further suitably pharmaceutically acceptable carriers or additives are well known to those skilled in the art and for instance may be selected from proteins such as collagen or gelatine, carbohydrates such as starch, polysaccharides, sugars (dextrose, glucose and sucrose), cellulose derivatives like sodium or calcium carboxymethylcellulose, hydroxypropyl cellulose or hydroxypropylmethyl cellulose, pregeletanized starches, pectin agar, carrageenan, clays, hydrophilic gums (acacia gum, guar gum, arabic gum and xanthan gum), alginic acid, alginates, hyaluronic acid, polyglycolic and polylactic acid, dextran, pectins, synthetic polymers such as water-soluble acrylic polymer or polyvinylpyrrolidone, proteoglycans, calcium phosphate and the like.

In certain embodiments, a pharmaceutical cell preparation as taught herein may be administered in a form of liquid composition. In embodiments, the cells or pharmaceutical composition comprising such can be administered systemically, topically, within an organ or at a site of organ dysfunction or lesion.

Preferably, the pharmaceutical compositions may comprise a therapeutically effective amount of the specified immune cells and/or other active components (e.g., immunomodulants). The term “therapeutically effective amount” refers to an amount which can elicit a biological or medicinal response in a tissue, system, animal or human that is being sought by a researcher, veterinarian, medical doctor or other clinician, and in particular can prevent or alleviate one or more of the local or systemic symptoms or features of a disease or condition being treated.

It will be appreciated that administration of therapeutic entities in accordance with the invention will be administered with suitable carriers, excipients, and other agents that are incorporated into formulations to provide improved transfer, delivery, tolerance, and the like. A multitude of appropriate formulations can be found in the formulary known to all pharmaceutical chemists: Remington's Pharmaceutical Sciences (15th ed, Mack Publishing Company, Easton, PA (1975)), particularly Chapter 87 by Blaug, Seymour, therein. These formulations include, for example, powders, pastes, ointments, jellies, waxes, oils, lipids, lipid (cationic or anionic) containing vesicles (such as Lipofectin™), DNA conjugates, anhydrous absorption pastes, oil-in-water and water-in-oil emulsions, emulsions carbowax (polyethylene glycols of various molecular weights), semi-solid gels, and semi-solid mixtures containing carbowax. Any of the foregoing mixtures may be appropriate in treatments and therapies in accordance with the present invention, provided that the active ingredient in the formulation is not inactivated by the formulation and the formulation is physiologically compatible and tolerable with the route of administration. See also Baldrick P. “Pharmaceutical excipient development: the need for preclinical guidance.” Regul. Toxicol Pharmacol. 32(2):210-8 (2000), Wang W. “Lyophilization and development of solid protein pharmaceuticals.” Int. J. Pharm. 203(1-2):1-60 (2000), Charman W N “Lipids, lipophilic drugs, and oral drug delivery-some emerging concepts.” J Pharm Sci. 89(8):967-78 (2000), Powell et al. “Compendium of excipients for parenteral formulations” PDA J Pharm Sci Technol. 52:238-311 (1998) and the citations therein for additional information related to formulations, excipients and carriers well known to pharmaceutical chemists.

The medicaments of the invention are prepared in a manner known to those skilled in the art, for example, by means of conventional dissolving, lyophilizing, mixing, granulating or confectioning processes. Methods well known in the art for making formulations are found, for example, in Remington: The Science and Practice of Pharmacy, 20th ed., ed. A. R. Gennaro, 2000, Lippincott Williams & Wilkins, Philadelphia, and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 1988-1999, Marcel Dekker, New York.

Administration of medicaments of the invention may be by any suitable means that results in a compound concentration that is effective for treating or inhibiting (e.g., by delaying) the development of a disease. The compound is admixed with a suitable carrier substance, e.g., a pharmaceutically acceptable excipient that preserves the therapeutic properties of the compound with which it is administered. One exemplary pharmaceutically acceptable excipient is physiological saline. The suitable carrier substance is generally present in an amount of 1-95% by weight of the total weight of the medicament. The medicament may be provided in a dosage form that is suitable for administration. Thus, the medicament may be in form of, e.g., tablets, capsules, pills, powders, granulates, suspensions, emulsions, solutions, gels including hydrogels, pastes, ointments, creams, plasters, drenches, delivery devices, injectables, implants, sprays, or aerosols.

Administration can be systemic or local. In addition, it may be advantageous to administer the composition into the central nervous system by any suitable route, including intraventricular and intrathecal injection. Pulmonary administration may also be employed by use of an inhaler or nebulizer, and formulation with an aerosolizing agent. It may also be desirable to administer the agent locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, by injection, by means of a catheter, by means of a suppository, or by means of an implant.

Various delivery systems are known and can be used to administer the pharmacological compositions including, but not limited to, encapsulation in liposomes, microparticles, microcapsules; minicells; polymers; capsules; tablets; and the like. In one embodiment, the agent may be delivered in a vesicle, in particular a liposome. In a liposome, the agent is combined, in addition to other pharmaceutically acceptable carriers, with amphipathic agents such as lipids which exist in aggregated form as micelles, insoluble monolayers, liquid crystals, or lamellar layers in aqueous solution. Suitable lipids for liposomal formulation include, without limitation, monoglycerides, diglycerides, sulfatides, lysolecithin, phospholipids, saponin, bile acids, and the like. Preparation of such liposomal formulations is within the level of skill in the art, as disclosed, for example, in U.S. Pat. Nos. 4,837,028 and 4,737,323. In yet another embodiment, the pharmacological compositions can be delivered in a controlled release system including, but not limited to: a delivery pump (See, for example, Saudek, et al., New Engl. J. Med. 321: 574 (1989) and a semi-permeable polymeric material (See, for example, Howard, et al., J. Neurosurg. 71: 105 (1989)). Additionally, the controlled release system can be placed in proximity of the therapeutic target (e.g., a tumor), thus requiring only a fraction of the systemic dose. See, for example, Goodson, In: Medical Applications of Controlled Release, 1984. (CRC Press, Boca Raton, Fla.).

The amount of the agents which will be effective in the treatment of a particular disorder or condition will depend on the nature of the disorder or condition, and may be determined by standard clinical techniques by those of skill within the art. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and the overall seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Ultimately, the attending physician will decide the amount of the agent with which to treat each individual patient. In certain embodiments, the attending physician will administer low doses of the agent and observe the patient's response. Larger doses of the agent may be administered until the optimal therapeutic effect is obtained for the patient, and at that point the dosage is not increased further. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems. Ultimately the attending physician will decide on the appropriate duration of therapy using compositions of the present invention. Dosage will also vary according to the age, weight and response of the individual patient.

There are a variety of techniques available for introducing nucleic acids into viable cells. The techniques vary depending upon whether the nucleic acid is transferred into cultured cells in vitro, or in vivo in the cells of the intended host. Techniques suitable for the transfer of nucleic acid into mammalian cells in vitro include the use of liposomes, electroporation, microinjection, cell fusion, DEAE-dextran, the calcium phosphate precipitation method, etc. The currently preferred in vivo gene transfer techniques include transfection with viral (typically retroviral) vectors and viral coat protein-liposome mediated transfection.

Diagnostic Methods

In certain embodiments, detecting pathogenic Th1 cells or a pathogenic Th1 cell immune response can be used to detect Th1 mediated autoimmune diseases. In certain embodiments, detecting pathogenic Th1 cells or a pathogenic Th1 cell immune response can be used to determine whether a treatment is effective in a subject suffering from a disease. In certain embodiments, the disease is an autoimmune and the treatment is any treatment described herein or currently used for treatment. In certain embodiments, a treatment is effective in a subject suffering from an autoimmune disease if the treatment decreases pathogenic Th1 cells or a pathogenic signature described herein. In certain embodiments, the treatment is any treatment as described herein (e.g., a CD160, GPR18 inhibitors). In certain embodiments, the treatment is an IL-23 antagonist. In certain embodiments, the treatment is an IL-12 and IL-23 antagonist. Non-limiting IL-23 antagonists that are approved for use and whose effectiveness can be monitored include the monoclonal antibodies ustekinumab, guselkumab, risankizumab, and tildrakizumab. Ustekinumab targets IL-23 and IL-12 through their shared p40 subunit (see, e.g., Cingoz O. Ustekinumab. MAbs. 2009; 1(3):216-221. doi:10.4161/mabs.1.3.8593). Guselkumab, risankizumab, and tildrakizumab are selective IL-23 inhibitors, which are inhibitors of p19 of IL-23 (see, e.g., Gottlieb A B, Saure D, Wilhelm S, et al. Indirect comparisons of ixekizumab versus three interleukin-23 p19 inhibitors in patients with moderate-to-severe plaque psoriasis—efficacy findings up to week 12. J Dermatolog Treat. 2020; 1-8).

In certain embodiments, an autoimmune response can be detected by detecting pathogenic Th1 cells or non-pathogenic Th1 cells. In certain embodiments, pathogenic Th1 cells can be detected by detecting Th1 cells that express one or markers described herein. For example, Th1 cells that express IL-23R or one or more of IL23R, CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW or a gene program selected from cluster 2 or cluster 9. In certain embodiments, pathogenic Th1 cells are increased. In certain embodiments, non-pathogenic Th1 cells can be detected by detecting Th1 cells expressing a program characterized by cluster 7 genes. In certain embodiments, non-pathogenic Th1 cells are decreased.

The invention provides biomarkers (e.g., phenotype specific or cell type) for the identification, diagnosis, prognosis and manipulation of cell properties, for use in a variety of diagnostic and/or therapeutic indications. Biomarkers in the context of the present invention encompasses, without limitation nucleic acids, proteins, reaction products, and metabolites, together with their polymorphisms, mutations, variants, modifications, subunits, fragments, and other analytes or sample-derived measures. In certain embodiments, biomarkers include the signature genes or signature gene products, and/or cells as described herein.

Biomarkers are useful in methods of diagnosing, prognosing and/or staging an immune response in a subject by detecting a first level of expression, activity and/or function of one or more biomarker and comparing the detected level to a control of level wherein a difference in the detected level and the control level indicates that the presence of an immune response in the subject.

The terms “diagnosis” and “monitoring” are commonplace and well-understood in medical practice. By means of further explanation and without limitation the term “diagnosis” generally refers to the process or act of recognising, deciding on or concluding on a disease or condition in a subject on the basis of symptoms and signs and/or from results of various diagnostic procedures (such as, for example, from knowing the presence, absence and/or quantity of one or more biomarkers characteristic of the diagnosed disease or condition).

The terms “prognosing” or “prognosis” generally refer to an anticipation on the progression of a disease or condition and the prospect (e.g., the probability, duration, and/or extent) of recovery. A good prognosis of the diseases or conditions taught herein may generally encompass anticipation of a satisfactory partial or complete recovery from the diseases or conditions, preferably within an acceptable time period. A good prognosis of such may more commonly encompass anticipation of not further worsening or aggravating of such, preferably within a given time period. A poor prognosis of the diseases or conditions as taught herein may generally encompass anticipation of a substandard recovery and/or unsatisfactorily slow recovery, or to substantially no recovery or even further worsening of such.

The biomarkers of the present invention are useful in methods of identifying patient populations at risk or suffering from an immune response based on a detected level of expression, activity and/or function of one or more biomarkers. These biomarkers are also useful in monitoring subjects undergoing treatments and therapies for suitable or aberrant response(s) to determine efficaciousness of the treatment or therapy and for selecting or modifying therapies and treatments that would be efficacious in treating, delaying the progression of or otherwise ameliorating a symptom. The biomarkers provided herein are useful for selecting a group of patients at a specific state of a disease with accuracy that facilitates selection of treatments.

The term “monitoring” generally refers to the follow-up of a disease or a condition in a subject for any changes which may occur over time.

The terms also encompass prediction of a disease. The terms “predicting” or “prediction” generally refer to an advance declaration, indication or foretelling of a disease or condition in a subject not (yet) having said disease or condition. For example, a prediction of a disease or condition in a subject may indicate a probability, chance or risk that the subject will develop said disease or condition, for example within a certain time period or by a certain age. Said probability, chance or risk may be indicated inter alia as an absolute value, range or statistics, or may be indicated relative to a suitable control subject or subject population (such as, e.g., relative to a general, normal or healthy subject or subject population). Hence, the probability, chance or risk that a subject will develop a disease or condition may be advantageously indicated as increased or decreased, or as fold-increased or fold-decreased relative to a suitable control subject or subject population. As used herein, the term “prediction” of the conditions or diseases as taught herein in a subject may also particularly mean that the subject has a ‘positive’ prediction of such, i.e., that the subject is at risk of having such (e.g., the risk is significantly increased vis-à-vis a control subject or subject population). The term “prediction of no” diseases or conditions as taught herein as described herein in a subject may particularly mean that the subject has a ‘negative’ prediction of such, i.e., that the subject's risk of having such is not significantly increased vis-à-vis a control subject or subject population.

Suitably, an altered quantity or phenotype of the immune cells in the subject compared to a control subject having normal immune status or not having a disease comprising an immune component indicates that the subject has an impaired immune status or has a disease comprising an immune component or would benefit from an immune therapy.

Hence, the methods may rely on comparing the quantity of immune cell populations, biomarkers, or gene or gene product signatures measured in samples from patients with reference values, wherein said reference values represent known predictions, diagnoses and/or prognoses of diseases or conditions as taught herein.

For example, distinct reference values may represent the prediction of a risk (e.g., an abnormally elevated risk) of having a given disease or condition as taught herein vs. the prediction of no or normal risk of having said disease or condition. In another example, distinct reference values may represent predictions of differing degrees of risk of having such disease or condition.

In a further example, distinct reference values can represent the diagnosis of a given disease or condition as taught herein vs. the diagnosis of no such disease or condition (such as, e.g., the diagnosis of healthy, or recovered from said disease or condition, etc.). In another example, distinct reference values may represent the diagnosis of such disease or condition of varying severity.

In yet another example, distinct reference values may represent a good prognosis for a given disease or condition as taught herein vs. a poor prognosis for said disease or condition. In a further example, distinct reference values may represent varyingly favourable or unfavourable prognoses for such disease or condition.

Such comparison may generally include any means to determine the presence or absence of at least one difference and optionally of the size of such difference between values being compared. A comparison may include a visual inspection, an arithmetical or statistical comparison of measurements. Such statistical comparisons include, but are not limited to, applying a rule.

Reference values may be established according to known procedures previously employed for other cell populations, biomarkers and gene or gene product signatures. For example, a reference value may be established in an individual or a population of individuals characterised by a particular diagnosis, prediction and/or prognosis of said disease or condition (i.e., for whom said diagnosis, prediction and/or prognosis of the disease or condition holds true). Such population may comprise without limitation 2 or more, 10 or more, 100 or more, or even several hundred or more individuals.

A “deviation” of a first value from a second value may generally encompass any direction (e.g., increase: first value>second value; or decrease: first value<second value) and any extent of alteration.

For example, a deviation may encompass a decrease in a first value by, without limitation, at least about 10% (about 0.9-fold or less), or by at least about 20% (about 0.8-fold or less), or by at least about 30% (about 0.7-fold or less), or by at least about 40% (about 0.6-fold or less), or by at least about 50% (about 0.5-fold or less), or by at least about 60% (about 0.4-fold or less), or by at least about 70% (about 0.3-fold or less), or by at least about 80% (about 0.2-fold or less), or by at least about 90% (about 0.1-fold or less), relative to a second value with which a comparison is being made.

For example, a deviation may encompass an increase of a first value by, without limitation, at least about 10% (about 1.1-fold or more), or by at least about 20% (about 1.2-fold or more), or by at least about 30% (about 1.3-fold or more), or by at least about 40% (about 1.4-fold or more), or by at least about 50% (about 1.5-fold or more), or by at least about 60% (about 1.6-fold or more), or by at least about 70% (about 1.7-fold or more), or by at least about 80% (about 1.8-fold or more), or by at least about 90% (about 1.9-fold or more), or by at least about 100% (about 2-fold or more), or by at least about 150% (about 2.5-fold or more), or by at least about 200% (about 3-fold or more), or by at least about 500% (about 6-fold or more), or by at least about 700% (about 8-fold or more), or like, relative to a second value with which a comparison is being made.

Preferably, a deviation may refer to a statistically significant observed alteration. For example, a deviation may refer to an observed alteration which falls outside of error margins of reference values in a given population (as expressed, for example, by standard deviation or standard error, or by a predetermined multiple thereof, e.g., ±1×SD or ±2×SD or ±3×SD, or 1×SE or ±2×SE or ±3×SE). Deviation may also refer to a value falling outside of a reference range defined by values in a given population (for example, outside of a range which comprises ≥40%, ≥50%, ≥60%, ≥70%, ≥75% or ≥80% or ≥85% or ≥90% or ≥95% or even ≥100% of values in said population).

In a further embodiment, a deviation may be concluded if an observed alteration is beyond a given threshold or cut-off. Such threshold or cut-off may be selected as generally known in the art to provide for a chosen sensitivity and/or specificity of the prediction methods, e.g., sensitivity and/or specificity of at least 50%, or at least 60%, or at least 70%, or at least 80%, or at least 85%, or at least 90%, or at least 95%.

For example, receiver-operating characteristic (ROC) curve analysis can be used to select an optimal cut-off value of the quantity of a given immune cell population, biomarker or gene or gene product signatures, for clinical use of the present diagnostic tests, based on acceptable sensitivity and specificity, or related performance measures which are well-knownper se, such as positive predictive value (PPV), negative predictive value (NPV), positive likelihood ratio (LR+), negative likelihood ratio (LR−), Youden index, or similar.

In one embodiment, the signature genes, biomarkers, and/or cells may be detected or isolated by immunofluorescence, immunohistochemistry (IHC), fluorescence activated cell sorting (FACS), mass spectrometry (MS), mass cytometry (CyTOF), RNA-seq, single cell RNA-seq (described further herein), quantitative RT-PCR, single cell qPCR, FISH, RNA-FISH, MERFISH (multiplex (in situ) RNA FISH) and/or by in situ hybridization. Other methods including absorbance assays and colorimetric assays are known in the art and may be used herein. detection may comprise primers and/or probes or fluorescently bar-coded oligonucleotide probes for hybridization to RNA (see e.g., Geiss G K, et al., Direct multiplexed measurement of gene expression with color-coded probe pairs. Nat Biotechnol. 2008 March; 26(3):317-25).

In certain embodiments, a tissue sample may be obtained and analyzed for specific cell markers (IHC) or specific transcripts (e.g., RNA-FISH). Tissue samples for diagnosis, prognosis or detecting may be obtained by endoscopy. In one embodiment, a sample may be obtained by endoscopy and analyzed by FACS. As used herein, “endoscopy” refers to a procedure that uses an endoscope to examine the interior of a hollow organ or cavity of the body. The endoscope may include a camera and a light source. The endoscope may include tools for dissection or for obtaining a biological sample.

The present invention also may comprise a kit with a detection reagent that binds to one or more biomarkers or can be used to detect one or more biomarkers.

MS methods

Biomarker detection may also be evaluated using mass spectrometry methods. A variety of configurations of mass spectrometers can be used to detect biomarker values. Several types of mass spectrometers are available or can be produced with various configurations. In general, a mass spectrometer has the following major components: a sample inlet, an ion source, a mass analyzer, a detector, a vacuum system, and instrument-control system, and a data system. Difference in the sample inlet, ion source, and mass analyzer generally define the type of instrument and its capabilities. For example, an inlet can be a capillary-column liquid chromatography source or can be a direct probe or stage such as used in matrix-assisted laser desorption. Common ion sources are, for example, electrospray, including nanospray and microspray or matrix-assisted laser desorption. Common mass analyzers include a quadrupole mass filter, ion trap mass analyzer and time-of-flight mass analyzer. Additional mass spectrometry methods are well known in the art (see Burlingame et al., Anal. Chem. 70:647 R-716R (1998); Kinter and Sherman, New York (2000)).

Protein biomarkers and biomarker values can be detected and measured by any of the following: electrospray ionization mass spectrometry (ESI-MS), ESI-MS/MS, ESI-MS/(MS)n, matrix-assisted laser desorption ionization time-of-flight mass spectrometry (MALDI-TOF-MS), surface-enhanced laser desorption/ionization time-of-flight mass spectrometry (SELDI-TOF-MS), desorption/ionization on silicon (DIOS), secondary ion mass spectrometry (SIMS), quadrupole time-of-flight (Q-TOF), tandem time-of-flight (TOF/TOF) technology, called ultraflex III TOF/TOF, atmospheric pressure chemical ionization mass spectrometry (APCI-MS), APCI-MS/MS, APCI-(MS).sup.N, atmospheric pressure photoionization mass spectrometry (APPI-MS), APPI-MS/MS, and APPI-(MS).sup.N, quadrupole mass spectrometry, Fourier transform mass spectrometry (FTMS), quantitative mass spectrometry, and ion trap mass spectrometry.

Sample preparation strategies are used to label and enrich samples before mass spectroscopic characterization of protein biomarkers and determination biomarker values. Labeling methods include but are not limited to isobaric tag for relative and absolute quantitation (iTRAQ) and stable isotope labeling with amino acids in cell culture (SILAC). Capture reagents used to selectively enrich samples for candidate biomarker proteins prior to mass spectroscopic analysis include but are not limited to aptamers, antibodies, nucleic acid probes, chimeras, small molecules, an F(ab′)₂ fragment, a single chain antibody fragment, an Fv fragment, a single chain Fv fragment, a nucleic acid, a lectin, a ligand-binding receptor, affybodies, nanobodies, ankyrins, domain antibodies, alternative antibody scaffolds (e.g. diabodies etc) imprinted polymers, avimers, peptidomimetics, peptoids, peptide nucleic acids, threose nucleic acid, a hormone receptor, a cytokine receptor, and synthetic receptors, and modifications and fragments of these.

Immunoassays

Immunoassay methods are based on the reaction of an antibody to its corresponding target or analyte and can detect the analyte in a sample depending on the specific assay format. To improve specificity and sensitivity of an assay method based on immunoreactivity, monoclonal antibodies are often used because of their specific epitope recognition. Polyclonal antibodies have also been successfully used in various immunoassays because of their increased affinity for the target as compared to monoclonal antibodies Immunoassays have been designed for use with a wide range of biological sample matrices Immunoassay formats have been designed to provide qualitative, semi-quantitative, and quantitative results.

Quantitative results may be generated through the use of a standard curve created with known concentrations of the specific analyte to be detected. The response or signal from an unknown sample is plotted onto the standard curve, and a quantity or value corresponding to the target in the unknown sample is established.

Numerous immunoassay formats have been designed. ELISA or EIA can be quantitative for the detection of an analyte/biomarker. This method relies on attachment of a label to either the analyte or the antibody and the label component includes, either directly or indirectly, an enzyme. ELISA tests may be formatted for direct, indirect, competitive, or sandwich detection of the analyte. Other methods rely on labels such as, for example, radioisotopes (I¹²⁵) or fluorescence. Additional techniques include, for example, agglutination, nephelometry, turbidimetry, Western blot, immunoprecipitation, immunocytochemistry, immunohistochemistry, flow cytometry, Luminex assay, and others (see ImmunoAssay: A Practical Guide, edited by Brian Law, published by Taylor & Francis, Ltd., 2005 edition).

Exemplary assay formats include enzyme-linked immunosorbent assay (ELISA), radioimmunoassay, fluorescent, chemiluminescence, and fluorescence resonance energy transfer (FRET) or time resolved-FRET (TR-FRET) immunoassays. Examples of procedures for detecting biomarkers include biomarker immunoprecipitation followed by quantitative methods that allow size and peptide level discrimination, such as gel electrophoresis, capillary electrophoresis, planar electrochromatography, and the like.

Methods of detecting and/or quantifying a detectable label or signal generating material depend on the nature of the label. The products of reactions catalyzed by appropriate enzymes (where the detectable label is an enzyme; see above) can be, without limitation, fluorescent, luminescent, or radioactive or they may absorb visible or ultraviolet light. Examples of detectors suitable for detecting such detectable labels include, without limitation, x-ray film, radioactivity counters, scintillation counters, spectrophotometers, colorimeters, fluorometers, luminometers, and densitometers.

Any of the methods for detection can be performed in any format that allows for any suitable preparation, processing, and analysis of the reactions. This can be, for example, in multi-well assay plates (e.g., 96 wells or 384 wells) or using any suitable array or microarray. Stock solutions for various agents can be made manually or robotically, and all subsequent pipetting, diluting, mixing, distribution, washing, incubating, sample readout, data collection and analysis can be done robotically using commercially available analysis software, robotics, and detection instrumentation capable of detecting a detectable label.

Hybridization Assays

Such applications are hybridization assays in which a nucleic acid that displays “probe” nucleic acids for each of the genes to be assayed/profiled in the profile to be generated is employed. In these assays, a sample of target nucleic acids is first prepared from the initial nucleic acid sample being assayed, where preparation may include labeling of the target nucleic acids with a label, e.g., a member of a signal producing system. Following target nucleic acid sample preparation, the sample is contacted with the array under hybridization conditions, whereby complexes are formed between target nucleic acids that are complementary to probe sequences attached to the array surface. The presence of hybridized complexes is then detected, either qualitatively or quantitatively. Specific hybridization technology which may be practiced to generate the expression profiles employed in the subject methods includes the technology described in U.S. Pat. Nos. 5,143,854; 5,288,644; 5,324,633; 5,432,049; 5,470,710; 5,492,806; 5,503,980; 5,510,270; 5,525,464; 5,547,839; 5,580,732; 5,661,028; 5,800,992; the disclosures of which are herein incorporated by reference; as well as WO 95/21265; WO 96/31622; WO 97/10365; WO 97/27317; EP 373 203; and EP 785 280. In these methods, an array of “probe” nucleic acids that includes a probe for each of the biomarkers whose expression is being assayed is contacted with target nucleic acids as described above. Contact is carried out under hybridization conditions, e.g., stringent hybridization conditions as described above, and unbound nucleic acid is then removed. The resultant pattern of hybridized nucleic acids provides information regarding expression for each of the biomarkers that have been probed, where the expression information is in terms of whether or not the gene is expressed and, typically, at what level, where the expression data, i.e., expression profile, may be both qualitative and quantitative.

Optimal hybridization conditions will depend on the length (e.g., oligomer vs. polynucleotide greater than 200 bases) and type (e.g., RNA, DNA, PNA) of labeled probe and immobilized polynucleotide or oligonucleotide. General parameters for specific (i.e., stringent) hybridization conditions for nucleic acids are described in Sambrook et al., supra, and in Ausubel et al., “Current Protocols in Molecular Biology”, Greene Publishing and Wiley-interscience, NY (1987), which is incorporated in its entirety for all purposes. When the cDNA microarrays are used, typical hybridization conditions are hybridization in 5×SSC plus 0.2% SDS at 65 C for 4 hours followed by washes at 25° C. in low stringency wash buffer (1×SSC plus 0.2% SDS) followed by 10 minutes at 25° C. in high stringency wash buffer (0.1SSC plus 0.2% SDS) (see Shena et al., Proc. Natl. Acad. Sci. USA, Vol. 93, p. 10614 (1996)). Useful hybridization conditions are also provided in, e.g., Tijessen, Hybridization With Nucleic Acid Probes”, Elsevier Science Publishers B.V. (1993) and Kricka, “Nonisotopic DNA Probe Techniques”, Academic Press, San Diego, Calif. (1992).

Single Cell Sequencing

In certain embodiments, the invention involves single cell RNA sequencing (see, e.g., Kalisky, T., Blainey, P. & Quake, S. R. Genomic Analysis at the Single-Cell Level. Annual review of genetics 45, 431-445, (2011); Kalisky, T. & Quake, S. R. Single-cell genomics. Nature Methods 8, 311-314 (2011); Islam, S. et al. Characterization of the single-cell transcriptional landscape by highly multiplex RNA-seq. Genome Research, (2011); Tang, F. et al. RNA-Seq analysis to capture the transcriptome landscape of a single cell. Nature Protocols 5, 516-535, (2010); Tang, F. et al. mRNA-Seq whole-transcriptome analysis of a single cell. Nature Methods 6, 377-382, (2009); Ramskold, D. et al. Full-length mRNA-Seq from single-cell levels of RNA and individual circulating tumor cells. Nature Biotechnology 30, 777-782, (2012); and Hashimshony, T., Wagner, F., Sher, N. & Yanai, I. CEL-Seq: Single-Cell RNA-Seq by Multiplexed Linear Amplification. Cell Reports, Cell Reports, Volume 2, Issue 3, p 666-673, 2012).

In certain embodiments, the invention involves plate based single cell RNA sequencing (see, e.g., Picelli, S. et al., 2014, “Full-length RNA-seq from single cells using Smart-seq2” Nature protocols 9, 171-181, doi:10.1038/nprot.2014.006).

In certain embodiments, the invention involves high-throughput single-cell RNA-seq. In this regard reference is made to Macosko et al., 2015, “Highly Parallel Genome-wide Expression Profiling of Individual Cells Using Nanoliter Droplets” Cell 161, 1202-1214; International patent application number PCT/US2015/049178, published as WO2016/040476 on Mar. 17, 2016; Klein et al., 2015, “Droplet Barcoding for Single-Cell Transcriptomics Applied to Embryonic Stem Cells” Cell 161, 1187-1201; International patent application number PCT/US2016/027734, published as WO2016168584A1 on Oct. 20, 2016; Zheng, et al., 2016, “Haplotyping germline and cancer genomes with high-throughput linked-read sequencing” Nature Biotechnology 34, 303-311; Zheng, et al., 2017, “Massively parallel digital transcriptional profiling of single cells” Nat. Commun. 8, 14049 doi: 10.1038/ncomms14049; International patent publication number WO2014210353A2; Zilionis, et al., 2017, “Single-cell barcoding and sequencing using droplet microfluidics” Nat Protoc. Jan; 12(1):44-73; Cao et al., 2017, “Comprehensive single cell transcriptional profiling of a multicellular organism by combinatorial indexing” bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi.org/10.1101/104844; Rosenberg et al., 2017, “Scaling single cell transcriptomics through split pool barcoding” bioRxiv preprint first posted online Feb. 2, 2017, doi: dx.doi.org/10.1101/105163; Rosenberg et al., “Single-cell profiling of the developing mouse brain and spinal cord with split-pool barcoding” Science 15 Mar. 2018; Vitak, et al., “Sequencing thousands of single-cell genomes with combinatorial indexing” Nature Methods, 14(3):302-308, 2017; Cao, et al., Comprehensive single-cell transcriptional profiling of a multicellular organism. Science, 357(6352):661-667, 2017; Gierahn et al., “Seq-Well: portable, low-cost RNA sequencing of single cells at high throughput” Nature Methods 14, 395-398 (2017); and Hughes, et al., “Highly Efficient, Massively-Parallel Single-Cell RNA-Seq Reveals Cellular States and Molecular Features of Human Skin Pathology” bioRxiv 689273; doi: doi.org/10.1101/689273, all the contents and disclosure of each of which are herein incorporated by reference in their entirety.

In certain embodiments, the invention involves single nucleus RNA sequencing. In this regard reference is made to Swiech et al., 2014, “In vivo interrogation of gene function in the mammalian brain using CRISPR-Cas9” Nature Biotechnology Vol. 33, pp. 102-106; Habib et al., 2016, “Div-Seq: Single-nucleus RNA-Seq reveals dynamics of rare adult newborn neurons” Science, Vol. 353, Issue 6302, pp. 925-928; Habib et al., 2017, “Massively parallel single-nucleus RNA-seq with DroNc-seq” Nat Methods. 2017 October; 14(10):955-958; International Patent Application No. PCT/US2016/059239, published as WO2017164936 on Sep. 28, 2017; International Patent Application No. PCT/US2018/060860, published as WO/2019/094984 on May 16, 2019; International Patent Application No. PCT/US2019/055894, published as WO/2020/077236 on Apr. 16, 2020; and Drokhlyansky, et al., “The enteric nervous system of the human and mouse colon at a single-cell resolution,” bioRxiv 746743; doi: doi.org/10.1101/746743, which are herein incorporated by reference in their entirety.

Screening

A further aspect of the invention relates to a method for identifying an agent capable of modulating one or more phenotypic aspects of a pathogenic Th1 cell or cell population comprising Th1 cells. The Th1 cell or population comprising Th1 cells can be Th1 cells differentiated in vitro as described herein. In certain embodiments, the method comprises a) applying a candidate agent to the cell or cell population; b) detecting modulation of one or more phenotypic aspects of the cell or cell population by the candidate agent (e.g., expression of one or more genes or program selected from cluster 2, 9 or 7 in Table 3), thereby identifying the agent. The phenotypic aspects of the cell or cell population that is modulated may be one or more genes or biological program specific to a Th1 cell phenotype (e.g., an inflammatory phenotype or suppressive immune phenotype). In certain embodiments, steps can include administering candidate modulating agents to cells, detecting identified cell (sub)populations for changes in signatures, or identifying relative changes in cell (sub) populations which may comprise detecting relative abundance of particular gene signatures.

The term “modulate” broadly denotes a qualitative and/or quantitative alteration, change or variation in that which is being modulated. Where modulation can be assessed quantitatively—for example, where modulation comprises or consists of a change in a quantifiable variable such as a quantifiable property of a cell or where a quantifiable variable provides a suitable surrogate for the modulation—modulation specifically encompasses both increase (e.g., activation) or decrease (e.g., inhibition) in the measured variable. The term encompasses any extent of such modulation, e.g., any extent of such increase or decrease, and may more particularly refer to statistically significant increase or decrease in the measured variable. By means of example, modulation may encompass an increase in the value of the measured variable by at least about 10%, e.g., by at least about 20%, preferably by at least about 30%, e.g., by at least about 40%, more preferably by at least about 50%, e.g., by at least about 75%, even more preferably by at least about 100%, e.g., by at least about 150%, 200%, 250%, 300%, 400% or by at least about 500%, compared to a reference situation without said modulation; or modulation may encompass a decrease or reduction in the value of the measured variable by at least about 10%, e.g., by at least about 20%, by at least about 30%, e.g., by at least about 40%, by at least about 50%, e.g., by at least about 60%, by at least about 70%, e.g., by at least about 80%, by at least about 90%, e.g., by at least about 95%, such as by at least about 96%, 97%, 98%, 99% or even by 100%, compared to a reference situation without said modulation. Preferably, modulation may be specific or selective, hence, one or more desired phenotypic aspects of an immune cell or immune cell population may be modulated without substantially altering other (unintended, undesired) phenotypic aspect(s).

The term “agent” broadly encompasses any condition, substance or agent capable of modulating one or more phenotypic aspects of a cell or cell population as disclosed herein. Such conditions, substances or agents may be of physical, chemical, biochemical and/or biological nature. The term “candidate agent” refers to any condition, substance or agent that is being examined for the ability to modulate one or more phenotypic aspects of a cell or cell population as disclosed herein in a method comprising applying the candidate agent to the cell or cell population (e.g., exposing the cell or cell population to the candidate agent or contacting the cell or cell population with the candidate agent) and observing whether the desired modulation takes place.

Agents may include any potential class of biologically active conditions, substances or agents, such as for instance antibodies, proteins, peptides, nucleic acids, oligonucleotides, small molecules, or combinations thereof, as described herein.

The methods of phenotypic analysis can be utilized for evaluating environmental stress and/or state, for screening of chemical libraries, and to screen or identify structural, syntenic, genomic, and/or organism and species variations. For example, a culture of cells, can be exposed to an environmental stress, such as but not limited to heat shock, osmolarity, hypoxia, cold, oxidative stress, radiation, starvation, a chemical (for example a therapeutic agent or potential therapeutic agent) and the like. After the stress is applied, a representative sample can be subjected to analysis, for example at various time points, and compared to a control, such as a sample from an organism or cell, for example a cell from an organism, or a standard value. By exposing cells, or fractions thereof, tissues, or even whole animals, to different members of the chemical libraries, and performing the methods described herein, different members of a chemical library can be screened for their effect on immune phenotypes thereof simultaneously in a relatively short amount of time, for example using a high throughput method.

In some embodiments, screening of test agents involves testing a combinatorial library containing a large number of potential modulator compounds. A combinatorial chemical library may be a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis, by combining a number of chemical “building blocks” such as reagents. For example, a linear combinatorial chemical library, such as a polypeptide library, is formed by combining a set of chemical building blocks (amino acids) in every possible way for a given compound length (for example the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks.

In certain embodiments, the present invention provides for gene signature screening. The concept of signature screening was introduced by Stegmaier et al. (Gene expression-based high-throughput screening (GE-HTS) and application to leukemia differentiation. Nature Genet. 36, 257-263 (2004)), who realized that if a gene-expression signature was the proxy for a phenotype of interest, it could be used to find small molecules that effect that phenotype without knowledge of a validated drug target. The signatures or biological programs of the present invention may be used to screen for drugs that reduce the signature or biological program in cells as described herein. The signature or biological program may be used for GE-HTS. In certain embodiments, pharmacological screens may be used to identify drugs that are selectively toxic to cells having a signature.

The Connectivity Map (cmap) is a collection of genome-wide transcriptional expression data from cultured human cells treated with bioactive small molecules and simple pattern-matching algorithms that together enable the discovery of functional connections between drugs, genes and diseases through the transitory feature of common gene-expression changes (see, Lamb et al., The Connectivity Map: Using Gene-Expression Signatures to Connect Small Molecules, Genes, and Disease. Science 29 Sep. 2006: Vol. 313, Issue 5795, pp. 1929-1935, DOI: 10.1126/science.1132939; and Lamb, J., The Connectivity Map: a new tool for biomedical research. Nature Reviews Cancer January 2007: Vol. 7, pp. 54-60). In certain embodiments, Cmap can be used to screen for small molecules capable of modulating a signature or biological program of the present invention in silico.

Further embodiments are illustrated in the following Examples which are given for illustrative purposes only and are not intended to limit the scope of the invention.

EXAMPLES

Example 1—In Vitro Differentiation of Naïve T Cells with IL-12 and IL-21 Induces IL-23R⁺ Th1 Cells

Although it has been shown in vivo that IFN-γ⁺ T cells can express IL-23R, these IFN-γ-producing cells were identified as transdifferentiated Th17 cells using a fate-mapping approach¹⁹. In fact, chronic stimulation of Th17 cells with IL-23 was shown to increase IFN-γ production from Th17 cells and to inhibit IL-17 production¹⁹. However, whether there are bona fide Th1 cells that express IL-23R and thus may be impacted by IL-23 signaling has not been addressed. It has been long established that naïve T cells differentiated in vitro with IL-12 to become Th1 cells express IL-12R but are not known to express IL-23R²⁰. Therefore, Applicants sought to identify whether there are bonafide Th1 cells that express IL-23R and undertook a screen to identify a cytokine that in conjunction with IL-12 would efficiently induce IL-23R in Th1 cells in vitro. Th1 cells express IFN-γ, IL-2, lymphotoxin (LT) and the master transcription factor T-bet but do not produce IL-17A, the signature cytokine of Th17 cells^20,21. Screening different cytokine conditions (FIG. 5), Applicants discovered that culturing naïve CD4+ T cells with IL-12+IL-21 for 5 days induces strong expression of IL-23R, together with IFN-γ expression, the signature cytokine of Th1 cells (FIG. 1a and FIG. 5). The expression of IL-23R in Th1 cells reached similar levels as in pathogenic Th17 cells that were differentiated with the cytokine combination IL-1β+IL-6+IL-23 (FIG. 1a)⁸. When Applicants further added IL-23 to the differentiation condition (IL-12+IL-21+IL-23), it slightly increased the expression of Il23r compared to IL-12+IL-21, and it is known that IL-23 can increase the expression of its own receptor (FIG. 1a and FIG. 5). Differentiation of naïve T cells with IL-12 or IL-18 alone induced minimal expression of IL-23R (FIG. 5). Addition of IL-23 together with IL-12 did also induce Il23r expression, however, the induction of IL-23R and IFN-γ expression was more pronounced with IL-12+IL-21. Applicants also measured the expression of Il23r, Ifng, III7a, Tbx21, Rorc and Stat3 in these in vitro differentiated T cells and could confirm the induction of Il23r together with a Th1 cell transcriptional program (FIG. 1b). In summary, Applicants demonstrate that IL-12+IL-21 strongly induces IL-23R expression in Th1 cells in vitro.

Example 2—Single-Cell RNA-Sequencing Identifies Genes in Th1 Cells that are Expressed in an IL-23R Dependent Manner

It is known that IL-23R signaling induces a set of genes in Th17 cells that makes them pathogenic, therefore, Applicants studied the impact of IL-23R signaling on Th1 cells. Applicants took advantage of a previously described reporter allele for Il23r expression and chose a two-pronged approach: (1) Applicants differentiated naïve T cells from reporter mice that carry an eGFP reporter in their endogenous IL-23R locus (Il23r^eGFP/wt) with IL-12+IL-21+IL-23 for 96 hours. Applicants then isolated IL-23R⁺ (i.e., eGFP⁺) and IL-23R⁻ (i.e., eGFP⁻) cells and conducted scRNAseq of the two populations using Smart-seq2 protocol^22,23. Notably, Applicants added IL-23 to the cytokine combination in this experiment in order to enhance signaling through IL-23R and thus better identify its role in Th1 cells. (2) Secondly, Applicants differentiated naïve T cells from IL-23R-deficient mice (Il23r^eGFP/eGFP) with the same set of cytokines and sorted eGFP⁺ vs. eGFP⁻ cells for the expression analysis by scRNAseq (FIG. 1c).

Applicants analyzed the expression of signature Th1 and Th17 cell genes in these in vitro differentiated cells and confirmed at the single-cell level that IFN-γ-expressing Th1 cells co-express IL-23R but do not express Th17 cell signature genes such as Il17a, Il17f and Ccr6. In addition to Ifng, the cells prominently expressed Th1 cell signature genes including Tbx21 and Cxcr3 (FIG. 1d and FIG. 6). A low frequency of cells expressed Rorc, encoding the transcription factor RORγt associated with Th17 cell differentiation, but the expression of Rorc was minimal when compared to the Th1 cell master transcription factor Tbx21 (FIG. 1d and FIG. 6).

Comparing the IL-23R⁺ vs. the IL-23R⁻ subsets from the wildtype cells (Il23r^eGFP/wt) provided a way to identify genes that may be co-expressed with IL-23R (FIGS. 1e and f). Here, Applicants identified a set of 528 differentially expressed (DE) genes whose expression in Th1 cells is positively or negatively associated with the presence of IL-23R and may be involved in pathogenicity of Th1 cells similar to how IL-23R signaling promotes pathogenicity of Th17 cells^13,24. Indeed, the set of genes that were co-expressed with IL-23R included critical effector molecules and transcription factors including Il18r1 and Stat5a (FIG. 1e and Table 1).

Strikingly, Applicants found that the number of differentially expressed genes between the eGFP⁺ and eGFP⁻ populations in knockout cells (Il23r^eGFP/eGFP) was substantially lower than the IL-23R⁺ vs. IL-23R⁻ comparison in wildtype cells (129 vs 528 at FDR<0.1 with only 33 genes overlapping). These eGFP⁺ knockout cells would reflect differentiation in response to IL-12 plus IL-21 in the absence of IL-23R signaling. This finding suggests that the majority of genes Applicants identified in the wildtype cells as being differentially expressed between the IL-23R⁺ and IL-23R⁻ populations are more likely to be directly affected by IL-23R signaling.

Applicants then undertook a combined analysis of the expression profiles from both wildtype and IL23R-deficient cells to better distinguish genes directly regulated by IL-23R signaling in Th1 cells (FIG. 1g). To this end, Applicants combined the datasets and incorporated model terms for the presence of eGFP, the genotype (wildtype or IL-23R-deficient), and the interaction of eGFP and genotype (see methods for full details). By testing the interaction term, Applicants sought genes whose expression difference between eGFP⁺ and eGFP⁻ cells was dependent on the genotype. In this manner Applicants identified altogether 219 genes where the presence of wildtype IL-23R was associated with an increase in expression in eGFP⁺ cells compared to eGFP⁻ cells. Of those, Dusp2, Gpr18, Trim27, Itgb1, Gzmb, Pde4b, Plek, Thap11, Panx1, Peli1, Rac1 and Lamp1(CD107a) appeared of particular interest as novel candidate genes dependent on IL-23R signaling and potentially important for pathogenicity of Th1 cells (FIG. 1g and Table 1). Some of these genes have been implicated previously in autoimmune inflammation, such as Panx1²⁵ and Rac1²⁶. The finding that these genes are regulated in an IL-23R-dependent manner suggests an important function in Th1 cells.

In summary, in addition to pathogenic Th17 cells, Applicants find that Th1 cells can be induced to express IL-23 receptor in vitro through culture with IL-12+IL-21 and that the single-cell transcriptomic profile corresponds to that of Th1 cells. Through this process, Applicants have further identified a unique gene set associated with IL-23R signaling in Th1 cells.

Example 3—IL-23R⁺ Th1 and IL-23R+Th17 Cells Share Common Gene Signatures but Also Display Subset-Specific Features

To investigate whether IL-23R⁺ Th1 and IL-23R⁺ Th17 cells share common features, Applicants differentiated pathogenic Th17 cells with IL-1β+IL-6+IL-23 and sorted IL-23R⁺ (i.e., eGFP⁺) and IL-23R⁻ (i.e. eGFP⁻) cells for single-cell analysis comparing their transcriptional profiles with those of Th1 cells described above. Interestingly, Applicants find a set of 147 genes whose expression in IL-23R⁺ and IL-23R⁻ cells is shared by Th1 and Th17 cells (FIG. 7a and Table 1). Among the genes highly expressed in both IL-23R⁺ Th1 and Th17 cells, Applicants find Il22, which has been identified previously as a core component of the pathogenicity signature of Th17 cells^9,11. Some genes (179) were expressed only in Th1 cells differentially between IL-23R⁺ and IL-23R⁻ cells such as Il18r1 and Ifng (FIG. 7b and Table 1). Interestingly, 93 genes showed the exact opposite profile in Th1 and Th17 cells, one of which was Il27ra which was highly expressed in IL-23R⁻ Th1 cells (FIG. 7c and Table 1). Finally, Il17a and Il17f were prominently expressed in IL-23R⁺ cells in Th17 cells only and were among 158 genes that were differentially expressed between IL-23R⁺ cells and IL-23R⁻ cells only in Th17 cells (FIG. 7d and Table 1). These results suggest that IL-23R induces a common Th1/Th17 pathogenicity expression profile but also induces a distinct set of genes in Th1 and Th17 cells that likely contribute to their pathogenicity to exert lineage-specific phenotype and function.

Example 4—IL-23R Deficiency Protects from Th1 Cell Adoptive Transfer Colitis

GWAS analysis has implicated IL-23R as a major risk gene for IBD⁵, but the actual mechanism by which IL-23R signaling promotes the disease has not been fully elucidated. It has been known that naïve T cells that lack IL-23R lose the ability to induce adoptive transfer colitis, presumably by not developing Th17 cells and promoting differentiation of FoxP3+Tregs^3,14,18. However, as bonafide Th1 cells elicit adoptive transfer colitis⁷, Applicants assessed the issue of whether IL-23R has a role in these pathogenic Th1 cells to induce colitis. To test the contribution of IL-23R to the pathogenicity of Th1 cells in vivo, Applicants differentiated wildtype (I123^eGFP/wt) and IL-23R-knockout (Il23r^eGFP/eGFP) Th1 cells in vitro with IL-12+IL-21+IL-23 (see methods for details) and then adoptively transferred them to RAG1^−/− recipients (FIG. 2a). Strikingly, Applicants found that Th1 cells that lack IL-23R do not efficiently induce severe colitis, as determined by the histopathological exam of the colon (FIG. 2b). The results therefore establish an important function of IL-23R in the pathogenicity of Th1 cells and their ability to induce colitis.

To test whether the transferred Th1 cells produced IFN-γ or had transdifferentiated into IL-17A-producing Th17 cells, Applicants isolated colonic intraepithelial lymphocytes (IEL) as well as lamina propria lymphocytes (LPL) and tested these cells for the production of IFN-γ, IL-17A and GM-CSF. Animals that received wildtype (Il23r^eGFP/wt) Th1 cells had a dramatically increased frequency of CD4⁺ intraepithelial lymphocytes and lamina propria lymphocytes, up to 60-70% of the entire CD45⁺ population vs. 4%-9% in recipients of knockout (Il23r^eGFP/eGFP) Th1 cells, pointing to the ongoing inflammatory process (FIGS. 8a, d and f). Interestingly, Applicants found that in the animals studied here, the CD4⁺ T cells had largely maintained their production of IFN-γ and had not significantly deviated into IL-17A-producing cells (FIGS. 8b, e and g). Furthermore, a sizable frequency of IFN-γ-producing cells in the colon also produced GM-CSF (FIG. 8c). It is known that both in the EAE model and the colitis model Applicants used here, Th17 cells show extensive plasticity and become IL-17A⁺/IFN-γ⁺ double positive^7,19. The results suggest that at least in these settings, Th1 cells were not plastic and retained a Th1 cell phenotype. Taken together, these data suggest that colitogenic Th1 cells require IL-23R expression in order to induce disease in vivo similar to Th17 cells and that these cells do not transdifferentiate towards a Th17 phenotype. Therefore, pathogenicity mediated by IL-23R signaling is separable and not limited to Th17 cells in vivo.

Example 5—Single-Cell RNA-Sequencing Reveals Transcriptional Signatures of Colitogenic Intestinal Lymphocytes and their Dependence on IL-23R Signaling

To gain a better understanding of the transcriptional programs that may be driven by IL-23R in transferred Th1 cells and therefore associated with pathogenicity, Applicants isolated CD45⁺CD4⁺ infiltrating T cells from the intestinal mucosa (both the intraepithelial lymphocytes, IEL, and the lamina propria lymphocytes, LPL) from animals that received either wildtype or IL-23R KO cells by fluorescence-activated cell sorting (FACS). Applicants then performed massively parallel single-cell transcriptional profiling by 10×technology of 32,763 cells (FIG. 2a).

The cells primarily cluster depending on which tissue they were isolated from, with splenic CD4⁺ T cells segregating from cells of intestinal origin (FIG. 2c). These results confirm previous findings that T cells acquire distinct transcriptional profiles depending on whether they are isolated from secondary lymphoid organs such as the spleen or reside in tissues such as the intestine²⁷. Applicants find the expression of 1224 genes was strongly associated with the tissue of origin (FDR<0.1, |log FC|>0.5), whereas other genes showed a broader expression in cells of all tissue origins (FIG. 2d and Table 2). For instance, CD69 has been proposed as a marker of tissue residency in T cells including in T_RM (tissue resident memory) cells and the precise tissue specific expression of Rgs1 suggests that it could be involved in trafficking and tissue residency as well, in particular in the intestinal mucosa²⁸. Klf2, a transcription factor that is important for the expression of CD62L and S1pr1, and which was shown to direct lymphocyte trafficking was highly upregulated in splenic cells suggesting an antagonistic function to CD69 and potentially Rgs1 as well²⁹. Interestingly, the chemokine Cxcl10 was particularly highly expressed in T cells within the LPL but not IEL (FIG. 2d), suggesting a very specific autocrine/paracrine regulation, in particular since the contribution of Cxc110 to the trafficking and retention of pro-inflammatory Th1 cells expressing the corresponding receptor Cxcr3 has been previously identified^30,31. Overall, multiple chemokine-related transcripts were expressed in a compartment-specific fashion and therefore likely contribute to the trafficking of Th1 cells to the intestine (FIG. 2d).

In terms of their splenic transcriptional profiles, it appeared that the wildtype Th1 cells (Il23r^eGFP/wt) and the knockout cells (Il23r^eGFP/eGFP) isolated from recipient mice were rather uniformly distributed (FIG. 2e). Strikingly, the wildtype and KO cells appeared to instead segregate within the intestinal tissues, suggesting that Th1 cells from the wildtype vs. IL-23R KO mice may attain transcriptionally different expression profiles when they infiltrate the intestine (FIG. 2e). Applicants then asked which genes would be differentially expressed between wildtype and KO cells across the four analyzed tissues (spleen, LPL small intestine (SI), LPL colon and IEL colon) and identified between 84 and 190 genes per tissue (FDR<0.1 and |log FC|>0.5) (Table 2). Applicants identified genes such as Gpr18, Cd160 and Zfp36l2 being differentially expressed dependent on IL-23R signaling in all or most tissues in vivo (FIG. 2f). Interestingly, the chemokine Ccl5 (RANTES), a ligand of Ccr5, exhibited a clear IL-23R dependent expression within the intestine only, suggesting that the regulation of Ccl5 is particularly relevant within the tissue and that IL-23R might contribute to pathogenicity by enabling inflammatory cells to migrate to tissues. Cxcl10 did not show such IL-23R dependent regulation (FIG. 2f). Taken together, the observations support the notion that IL-23R signaling affects the tissue-specific transcriptional expression of novel genes relevant to intestinal inflammation.

Example 6—IL-23R Drives the Expansion of Highly Inflammatory and Colitogenic Th1 Cells in the Lamina Propria as Uncovered by scRNAseq

Lymphocytes residing within the lamina propria exert a critical contribution to elicit intestinal inflammation³². Therefore, Applicants decided to focus on these samples (both from the colon and small intestine) in wildtype (Il23r^eGFP/wt) and IL-23R KO (Il23r^eGFPeGFP) cells (FIG. 3a). Applicants partitioned all cells into clusters and identified a total of 12 distinct clusters with characteristic transcriptional profiles within the LPL (FIG. 3b). Applicants then sought to identify clusters consisting of cells with a highly pro-inflammatory and colitogenic gene signature that may be responsible for mediating colitis. Importantly, Applicants noted differential contribution of wildtype or KO cells to some clusters, especially clusters 2, 8, 9 and 10 were dominated by cells from wildtype animals (Il23r^eGFP/wt) whereas clusters 5 and 7 were dominated by KO cells (Il23r^eGPF/eGFP) (FIG. 3c). Based on their transcriptional profiles, Applicants found that clusters 2 and 9 consisted of cells that exhibited a highly colitogenic gene signature and may have the ability to drive intestinal inflammation which will be highlighted in detail below (FIG. 3d).

Applicants found that the characterizing genes of cluster 9 (one vs. all comparison, FDR<0.1, |log FC|>0.5 and Table 3) encode a wide range of molecules essential for inflammation and colitis. For example, among the most highly expressed genes was Itgae (CD103) which has been shown to enable pathogenic T cells to migrate to their target tissue and is characteristic of pro-inflammatory colonic T cells in ulcerative colitis^33,34. Another highly expressed gene, Ccr9, encodes a gut homing receptor and has been shown to play a crucial role in colitis³⁵. Previously, it was shown that the transmembrane glycoprotein CD38 is important for intestinal inflammation³⁶. Likewise, CD48, a SLAM (signaling lymphocyte activation molecule) family member, is crucial for T cell function in colitis and it has been suggested that CD48 may represent a useful target in human IBD³⁷. Strikingly, an ORF (open reading frame) within the gene AW112010 (encoding a long-noncoding RNA) which was among the top 20 differentially regulated genes within cluster 9 in the data set has been recently shown to be essential in mucosal immunity including colitis³⁸. The expression of this ORF is fairly broad across clusters and the locus appears to be transcribed in the vast majority of cells. However, the expression of AW112010 shows a dramatic increase in expression within the inflammatory cluster 9 (FIG. 3d).

Importantly, in addition to the genes in cluster 9 that have been implicated in the development of colitis, the cluster also contained novel genes not previously associated with the development of colitis. For example, Cd160, the most upregulated gene in cluster 9 encodes an Ig superfamily member³⁹ and has not been assigned a function in colitogenic T cells yet. The gene encoding the nectin receptor family member Cd226 (DNAM-1), was also part of the signature of highly expressed genes in cluster 9. Co-stimulatory receptors such as CD226 play a critical role in T cell activation, autoimmunity and cancer⁴⁰. Previously, CD226 was shown to be crucial for the activation of cytotoxic lymphocytes and Th1 cells and its expression within cluster 9 suggests that it may play an important role in intestinal inflammation^41,42. In summary, the transcriptional analysis of cluster 9 exhibits an entire array of genes critical for intestinal inflammation and identifies novel potential genes important for intestinal inflammation such as Cd160.

Many genes highly expressed in cluster 2 are implicated in IFN-γ signaling (FIG. 3d and Table 3). In fact, IFN-γ signaling has early been identified as being critical for intestinal inflammation in various pre-clinical models of colitis^31,43. For example, top differentially genes in this cluster were Ifitm1 (interferon-inducible transmembrane protein), Ifitm2 and Ifitm3. Members of this family are interferon response genes that have been shown to be entry sites in viral infection⁴⁴. A study in human IBD patients identified IFITM1 as a potential prognostic marker in ulcerative colitis⁴⁵. Interestingly, Applicants identified many integrins as being part of the list of genes highly expressed within cluster 2, with Itgb1 as the second highest differentially expressed gene and which has previously been implicated in colorectal cancer⁴⁶. Two additional integrins highly upregulated in cluster 2 (albeit not among the top 20 differentially expressed genes) were Itga4 (position 101) and Itgb7 (position 32). Strikingly, a recent study demonstrated that targeting the leukocyte integrin a4p₇ with vedolizumab was more effective in moderately to severely active ulcerative colitis than adalimumab (a humanized monoclonal antibody neutralizing TNF)⁴⁷.

The observation, that many genes implicated in IFN-γ signaling and lymphocyte trafficking (integrins) were highly upregulated in cluster 2 suggests that this cluster consisted of inflammatory cells that could potentially represent the cellular phenotype of early potential drivers of the intestinal inflammatory response.

The other two clusters that were enriched in wildtype cells (Il23r^eGFP/wt) were clusters 8 and 10.

Cluster 8 represented a cluster of highly proliferating cells exemplified by the expression of Ki-67 and genes important for cell cycle progression such as Cdc (cell division cycle) genes, including Cdc6 (critical for the initiation of DNA synthesis⁴⁸) and Cdc20, which is known to activate the anaphase promoting complex/cyclosome APC/C⁴⁹ (FIG. 9). The observation that cluster 8 was highly enriched with wildtype cells suggests that these cells were actively proliferating within the tissue to contribute to the inflammatory process.

Cluster 10 on the other hand showed high expression of Ccr7 which is commonly correlated with an ability of T cell trafficking and homing to lymph nodes and Peyer's patches⁵⁰. In addition, cluster 10 cells expressed higher levels of the anti-apoptotic gene bcl2 which is known to be driven by STAT5 signaling and may be an interesting target in IBD as suggested in pre-clinical studies⁵¹.

In summary, using single-cell RNA-sequencing, Applicants identify distinct clusters of T cells within the intestinal mucosa that exhibit a highly inflammatory profile, in particular clusters 2 and 9. Furthermore, the observation that these clusters are dominated by wildtype cells suggests that IL-23R signaling critically contributes to the observed expression of inflammatory genes. Importantly, Applicants succeed in identifying novel genes such as Cd160 that may play an important role for intestinal inflammation and IBD.

Example 7—IL-23R is Implicated in the Reciprocal Regulation of Tr-1 Like Cells and Limits their Expansion

Cluster 7 was particularly interesting as it is strongly enriched with IL-23R KO cells which would suggest that this cluster contains predominantly non-pathogenic T cells (FIG. 3c). The 117 genes that characterize this cluster (one vs. all comparison, FDR<0.1, log FC>0.5) include Eomes, Cd27, Gzmk, Lag3 and Il10 (FIG. 3d and FIGS. 10a and b). This finding was of particular significance as these genes have been recently identified to define a novel human IFN-γ⁺IL-1β+Tr1-like cell type that may be reduced in IBD patients⁵². In fact, Eomesodermin (Eomes) has been shown to be a key transcription factor of a Tr1-like lineage⁵¹. The finding that cluster 7 is predominantly composed of IL-23R KO cells suggests that IL-23R may function as an important gatekeeper and negative regulator for the development of Tr1-like cells in the colonic mucosa. Previously, it was shown that IL-23R is indeed expressed on these IFN-γ⁺IL-1β+Tn-like cells and therefore IL-23 signaling could potentially regulate development and function of this population⁵⁴. To Applicants knowledge, this study is the first to provide functional evidence that IL-23R may act as a negative regulator of such Tr1-like cells. In addition, PD1 was shown to be expressed on human Tn-like cells which is highly consistent with the data presented here⁵⁴ (FIG. 3d). In fact, it was shown that PD1 is implicated in the conversion of human T-BET⁺ Th1 cells to FOXP3⁺ Tregs⁵⁵. Other co-inhibitory molecules such as Lag-3 were also more highly expressed in cluster 7 (FIG. 3d and FIG. 10b). Applicants used a published transcriptional signature that characterizes human Tr-1 like cells and were able to show that it identifies cluster 7 (upregulated compared to other clusters, Wilcoxon rank-sum test p<10⁻²⁰⁰) providing strong evidence that the cells of cluster 7 are the equivalent of these human cells in this study (FIG. 10c)⁵². In summary, the results suggest that IL-23R signaling balances the differentiation of colitogenic Th1 vs. Tr cells and therefore effector vs regulatory arms of the immune response.

Interestingly, comparing WT to KO cells within cluster 7 revealed a set of heat shock protein family members, in particular Hspa1a and Hspa1b (FIG. 10d). Heat shock proteins are implicated in the regulation of T cell responses and specific single nucleotide polymorphisms have recently been identified in HSPA1L that distinguish IBD patients from healthy controls^56,57. The finding suggests that heat shock proteins of the Hsp70 family, in particular Hspa1a and Hspa1b, may be protective in IBD and regulated in an IL-23R dependent manner.

Example 8—Comparative Analysis of Human IBD GWAS with the scRNAseq Study Nominates Genes of Particular Interest for the Function of Colitogenic Th1 Cells in an IL-23R Dependent Manner

It has become clear from genome-wide association studies (GWAS) that IL-23R plays an important role in IBD⁵. To investigate if IL-23R signaling is particularly relevant to the expression of other genes found within human IBD GWAS loci in T cells, Applicants conducted a survey of the roughly 240 IBD risk loci that have been identified so far^58-61 and tallied their associated genes (about 700 genes in total)⁵⁸. Within loci that contain multiple genes, Applicants focused on genes that were found to be implicated, for example, by fine-mapping or by expressed quantitative trait loci (eQTL) analysis which reduced the list of genes that Applicants further investigated to 597. Since Applicants established that clusters 2 and 9 were dominated by wildtype cells with a highly inflammatory transcriptional signature Applicants focused the analysis on these two clusters in addition to cluster 7 which was dominated by KO cells to investigate the potential contribution of genes found in GWAS loci to IL-23R mediated pathogenicity. Applicants used within-cluster comparison of WT vs. KO cells and identified genes found within IBD GWAS loci that were expressed in an IL-23R dependent manner (FIG. 3e and Table 3). This finding suggests that IL-23R signaling in Th1 cells may be relevant to induction of genes implicated through GWAS in the development of IBD.

Among the genes in the set implicated through GWAS were Gpr18, Traf3ip2, Ncf4 and Ets1.

Gpr18 was particularly highly expressed in clusters 2 and 9 in an IL-23R dependent manner. Recently, it was shown that certain mutations are increased in ulcerative colitis including in the gene Traf3ip2 (encoding Act1) which is part of the NFKBIZ pathway⁶². Ncf4 plays an important role in cellular reactive oxygen species (ROS) pathways as part of the NOX2 (NADPH oxidase 2) complex. Ets1 is a transcription factor and essential co-factor of Tbet in Th1 cell-mediated inflammatory responses⁶³

Adhesion and migration regulate major biological outcomes of T cell-mediated autoimmunity. Interestingly, a number of genes implicated in these processes were part of the identified gene signatures of cluster 2, in particular Lsp1, Lpxn (Leupaxin) and Fermt3. Applicants hypothesize that IL-23R signaling may exert pathogenicity also through downstream effects on migration and adhesion.

Notably, some genes were not limited to clusters 2 and 9 in their IL-23R-dependent expression such as Zfp36l2 but exhibited this pattern also across other clusters including cluster 7 suggesting that their genotype-dependent expression may be too dominant than to be confined to a particular cluster (FIG. 3e). Zfp36l2 belongs to a family of RNA binding proteins that have been implicated in Th17 cell biology but their contribution to Th1 cell-mediated autoimmunity remains unknown^11,64.

The findings illuminate genes implicated in cellular pathways ranging from trafficking, cellular adhesion (integrins), metabolic regulators and immune cell interaction identified in GWAS IBD risk loci that may prove critical in their contribution to intestinal inflammation driven by IL-23R in colitogenic T cells. The observation that these genes found in GWAS IBD risk loci are driven by IL-23R in colitogenic Th1 cells may suggest that IL-23R and these genes converge mechanistically in a disease relevant manner.

Example 9—Ranking Identifies Novel Genes as Drivers of Intestinal Inflammation in an IL-23R Dependent Manner

In many cases, the combinatorial analysis of several data sets yields a comprehensive insight into useful targets for further analysis as critical genes may not only emerge as being the top differentially expressed genes in a singular data set. Therefore, Applicants combined both in vitro and in vivo single-cell RNA-sequencing data sets Applicants reported above and included data from human IBD GWAS to rank the genes that may have an impact on the development of colitis.

Applicants postulated the following criteria that were important and queried the data set for genes that would match as many criteria as possible: (1) As Applicants were particularly interested in genes potentially conferring pathogenicity, Applicants focused on genes that were most highly expressed in clusters 2 and 9 in comparison to all other clusters and that were differentially expressed between wildtype and KO cells within either cluster 2 or 9; (2) Genes of particular importance to intestinal inflammation may exhibit a highly tissue specific expression and therefore Applicants evaluated their expression comparing splenic and intestinal samples; (3) Applicants asked which genes showed an TL-23R dependent expression in Th1 cells differentiated under IL-12+IL21+TL-23 in vitro; (4) Applicants incorporated as one criterion whether a given gene was previously identified in human GWAS to confer risk and/or is located within a GWAS risk locus for IBD (FIG. 4a and Table 4, see methods for details of ranking).

Gpr18 scored very highly in all criteria including being located within a GWAS risk locus⁶¹. Interestingly, it was shown that Gpr18 plays a crucial role for CD8aa⁺ intraepithelial T lymphocytes within the intestinal mucosa⁶⁵. The studies suggest it may be a critical mediator of pathogenicity by IL-23R in colitogenic Th1 cells.

The transcription factor NF-fB is critical to T cell function and in particular mutations within the NFKBIZ pathway were recently found to be relevant in ulcerative colitis⁶². Nfkbiz itself scored highly in the ranking data as a target in colitogenic T cells (FIG. 4a).

Example 10—CD160 Plays an Important Role in Colitogenic Th1 Cells

Finally, Applicants sought to provide conclusive evidence of the critical contribution of candidate genes identified in the studies to T cell-driven intestinal inflammation. To this end, Applicants acquired knockout mice for Cd160, the top differentially expressed signature gene of inflammatory cluster 9 and which ranked prominently in the ranking scheme (FIG. 4a)⁶⁶. CD160 is an Ig superfamily member and its function in inducing colitogenic T cells and IBD has not been investigated. It has been shown to be important for IFN-γ production in NK cells and being expressed on intraepithelial CD8⁺ T cells^66,67. Applicants differentiated naïve T cells from these CD160 KO mice to Th1 cells in vitro as described above and tested their ability to elicit adoptive transfer colitis. Applicants did not observe a difference between wildtype and CD160 KO Th1 cells to produce IFN-γ or GM-CSF prior to adoptive transfer in vitro (FIGS. 11a and b). The cells did not express any IL-17A prior to adoptive transfer. Strikingly, the recipient animals that received CD160 deficient Th1 cells showed a strong protection from colonic inflammation as assessed by histopathological examination (FIG. 4b). The decrease of inflammation showed a clear trend in the small intestine and was statistically significant in the colon (FIGS. 4b and c) The histopathological analysis was consistent with the shortening of the colon in recipients of wildtype cells (FIG. 4d). When Applicants isolated T cells from mesenteric lymph nodes from recipients of either wildtype or CD160 knockout cells Applicants did not observe a significant difference in IFN-γ expression which was consistent with the observations in vitro suggesting that it was likely not any lack in the ability to produce IFN-γ that protected recipients of CD160 KO cells from developing severe colitis (data not shown). Previously, it was shown that CD160 is important for Gzmb expression in intestinal CD8+ T cells which helps to clear Listeria monocytogenes infection⁶⁶. Interestingly, this was highly consistent with the observation that CD160 KO cells differentiated in vitro with IL-12+IL+21+IL23 produced less Gzmb compared to wildtype cells which could contribute mechanistically to their diminished colitogenicity in vivo (FIG. 4e). Taken together, the results demonstrate an important function of CD160 to the colitogenicity of Th1 cells in an IL-23R dependent manner.

Example 11—Discussion

IL-23R function has been considered a critical driver of pathogenicity in Th17 cells and important for the regulation of FoxP3⁺ Tregs but not for other T helper cell subsets. However, several experimental and clinical observations have been difficult to reconcile under this assumption. Applicants provide compelling evidence that IL-23R plays an important role in other pathogenic T cell subsets, in particular a subset of IL-23R⁺ Th1 cells.

First, Applicants report that bonafide Th1 cells can be differentiated in vitro with IL-12+IL-21 and express similar levels of IL-23R as pathogenic Th17 cells polarized with IL-1β+IL-6+IL-23. This illustrates how the combinatorial action of cytokines crucially determines the functional outcome since IL-21 has been shown to participate with TGF-β to induce pro-inflammatory Th17 cells, not Th1 cells⁶⁸. In Th17 cells, IL-6 has been shown to induce IL-21 that promoted IL-23R expression in an autocrine manner, and this induction was STAT3 dependent⁶⁹. Which transcription factor mediates the induction of IL-23R in Th1 cells differentiated with IL-12+IL-21 remains to be determined. However, one such transcription factor could be c-MAF that has been shown to bind to the IL-23R promoter and to work in conjunction with IL-21 in some non-Th17 cells, in particular in the setting of autoimmune diabetes which is known to be Th1 cell-driven^70-72.

Applicants continue to show that IL-23R is required in Th1 cells in vivo to acquire full pathogenicity to elicit adoptive transfer colitis. Applicants take advantage of scRNAseq to profile 32,763 cells in a pre-clinical model of colitis including roughly 20000 intestinal T cells and uncover transcriptional signatures that are governed by IL-23R and that are critical to the emergence of pathogenic and colitogenic Th1 cells. The inflammatory signatures of the pre-clinical model were highly reminiscent of human studies in IBD as outlined above. Applicants identify novel candidate genes for T cell-mediated IL-23R dependent pathology and provide a framework of genes identified in previous IBD GWAS as potential drivers in colitogenic Th1 cells. The study therefore contributes to the important effort of identifying and validating genes found within GWAS risk loci having an important function in colonic inflammation and their implication in colitogenic T cells.

Previously, it was shown that Th17 cells show extensive plasticity during an inflammatory response and that Th17 cells eventually may develop features of Th1 cells by upregulating Tbx21 and expressing IFN-γ both in mouse and human¹⁹⁷³,7⁴. IL-23R was shown to play an important role in this lineage plasticity¹⁹ and it was assumed that IL-23R bearing Th cells that express IFN-γ are solely transdifferentiated Th17 cells. Interestingly, it was shown in the adoptive transfer model of colitis that Th17 cells convert to Th1 cells and that this appears to be essential to Th17 cell mediated disease in this model⁷. Importantly, Applicants show that bonafide Th1 cells can be differentiated to express Il23r in vitro and that IL-23R deficient Th1 cells lose their ability to elicit intestinal inflammation. Interestingly, Applicants did not observe extended plasticity in the Th1 cells adoptively transferred in the study towards a Th17 cell phenotype. With the exception of cluster 3 in the LPL that contained cells showing a transcriptional signature of Th17 cells including expression of Ccr6, Il17a, Il22, Il17re and Il17f, however, Applicants did not identify IL-17A⁺ cells by intracellular cytokine when retrieved from the intestinal mucosa in RAG1 KO recipients. Thus, the vast majority of LPL cells showed a strong transcriptional signature of bona fide Th1 cells including expression of Il12rb1, Il12rb2, Cxcr3, Stat1, Stat4, Tbx21 and Ifng.

Applicants speculate that Th1 cells represent a further advanced state of inflammatory trajectory that may be reached with or without transitioning through a Th17 cell state. Strikingly, it has been demonstrated that both Th17 and Th1 cells may ultimately give rise to T cells with regulatory function at the resolution of inflammation^55,75.

Importantly, Applicants describe here a dichotomous function of IL-23R in promoting inflammatory cells on one hand and on the other hand limiting the expansion of Tr cells with a regulatory function, identified by expression of signature genes such as Eomes, Cd27, Il10ra, Il10, Gmzk and co-inhibitory receptors Lag-3 and Pdcd1. A concept is evolving in which IL-23R serves not only as a critical driver of inflammatory T cells but a central integrator of immune responses within the local immunological milieu. In fact, in addition to the emergence of Tr1-like cells in IL-23R deficient cells in the study, it has been shown previously that IL-23R is also expressed on colonic FoxP3⁺ Tregs, making these cells receptive to sudden inflammatory changes that limit their suppressive effector functions in the presence of the pro-inflammatory cytokine IL-23^14,15.

In the setting of Th17 cells, it was shown that the salt-sensing kinase Sgkl is important in regulating their plasticity toward FoxP3⁺ T cells⁷⁶. Which mediators downstream of IL-23R signaling suppress a Tr1 cell fate in Th1 cells remains to be determined.

A ranking scheme combining both in vitro and in vivo transcriptional signatures and their dependence on IL-23R signaling enabled us to identify novel drivers of T cell pathogenicity and Applicants succeeded in validating one of these candidates, CD160. Indeed, CD160 emerged in a recent study profiling the cellular composition and transcriptional signatures of ileal biopsies from Crohn's patients although the functional significance remained unclear⁷⁷. Interestingly, CD160 was shown to be very important for intraepithelial type I ILCs which are amplified in Crohn's disease and was important for the pathogenicity of ILCis in the anti-CD40 colitis model in addition to control of L. monocytogenes infection. These data suggest that CD160 is not only important for CD4⁺ T cells as demonstrated in the study but for other immune cells such as ILC1s and CD8⁺ T cells as well^66,78. To validate that Applicants had not inadvertently included immune cells other than CD3⁺CD4⁺ T cells in the analysis that have been shown to express CD160, Applicants confirmed that the cells sequenced lacked expression of NK cell markers and expression of CD8 (FIG. 12).

Another important candidate that emerged and which scored highly in all categories in the ranking (FIG. 4a) was Gpr18. Interestingly it was identified as a central part of a transcriptional signature in myeloid cells driving a Th1 cell intestinal inflammation triggered by the colonization of germ-free mice with Klebsilla isolated from a Crohn's patient⁷⁹

In summary, Applicants uncouple IL-23R as a purely Th17 cell-specific pathogenicity factor and implicate it in being critical for evoking a pathogenic phenotype in Th1 cells. Furthermore, through the powerful combination of a highly relevant pre-clinical model of colitis with massively parallel single-cell RNA-sequencing and integration of GWAS data from IBD patients, Applicants identify novel potential drivers of IL-23R-mediated T cell pathogenicity and validate one of these candidates. Applicants hope that the discovery of the role of IL-23 in the induction of pathogenic Th1 cells and their contribution to autoimmune disease on one hand and the inhibition of IL-10 producing Tr cells on the other hand may identify novel targets and prove useful for the development of therapeutic intervention in multiple human autoimmune diseases.

Example 12—Materials and Methods

Mice. IL-23R^eGFP reporter mice were described previously (Awasthi et al., 2009). The following strain was purchased from The Jackson Laboratories: B6.129S7-Rag1^tm1Mom/J (known as Rag1^−/−; Stock No.: 002216). CD160^−/− mice were a kind gift of Dr. Arlene Sharpe and previously described (Tan et al., 2018). All animals were bred and maintained under specific-pathogen-free (SPF) conditions. Genotyping was performed with DNA isolated from tail biopsies. All experiments were approved by and carried out in accordance with guidelines of the Institutional Animal Care and Use Committee (IACUC) at Harvard Medical School and Brigham and Women's Hospital.

In vitro T cell differentiation. A single-cell suspension was prepared from spleen and lymph nodes and red blood cells were removed by lysis with ACK buffer (Lonza). CD4⁺ T cells were enriched using microbeads (Miltenyi Biotec, Cat. #.: 130-117-043). Naïve CD4⁺ T cells (CD4⁺CD44^low CD62L^highCD25⁻) were isolated by fluorescence-activated cell sorting (FACS) using a custom-built BD FACSAria instrument. Sorted naïve CD4+ T cells were activated with plate-bound anti-CD3 and anti-CD28 antibodies (1 μg/ml; BioXCell; Clone 145-2C11 and clone PV-1, respectively) in 96-well flat-bottom plates (50-100×10³ cells/per well). Cells were cultured for 5 days (cytokine screen) with the following cytokine concentrations: IL-1β (20 ng/ml); IL-6 (25 ng/ml); IL-23 (20 ng/ml); IL-12 (20 ng/ml); IL-21 (20 ng/ml); TGF-β (2 ng/ml); IL-18 (20 ng/ml). All recombinant cytokines were purchased from Biolegend (IL-21), R&D (IL-12, IL-1β, IL-6, IL-23) and Miltenyi Biotec (hTGF-β).

Flow cytometry and antibodies. Single-cell suspensions were stained with diluted antibodies (1:100) in ice-cold PBS+2% FBS. Dead cells were identified with either 7-AAD (BD Biosciences) or viability dye eFluor 506 (eBioscience). For intracellular cytokine staining (ICC), cells were stimulated for 4 hr at 37° C. with phorbol 12-myristate 13-acetate (PMA, Sigma), ionomycin (Sigma) and monensin (GolgiStop; 1:1000; BD Biosciences). Then, cells were stained for surface markers and viability. Cells were fixed and permabilized according to the manufacturer's instructions (BD Cytofix/Cytoperm kit). All flow cytometric data were acquired with either a BD LSRII or Fortessa instrument and analyzed with FlowJo (BD).

The following antibodies labeled with different fluorophores were purchased from Biolegend unless otherwise indicated: anti-CD4 (RM4-5), anti-CD25 (PC61), anti-CD44 (IM7), anti-CD62L (Mel14), anti-IL-17A (TC11-18H10.1), anti-IFN-7 (XMG1.2), anti-GM-CSF (MP1-22E9, BD), anti-CD45 (30-F11).

Adoptive transfer colitis. Naïve T cells were isolated from donor mice by FACS and differentiated for 6 days prior to adoptive transfer with the following paradigm. Naïve CD4⁺ T cells (in 6 well dishes, 1×10⁶ cells/ml) were cultured for 48 hrs on anti-CD3/anti-CD28 coated plates with the cytokines IL-12 (10 ng/ml)+IL-21 (20 ng/ml). After 48 hrs, the cells were passaged onto non-coated plates and IL-2 (20 ng/ml) was added to the culture. Cells were passaged if needed 1:2. On day 4, IL-23 (20 ng/ml) was added to the culture. During the entire culture, the medium was supplemented with anti-IL-4 antibody (BioXcell; clone 11B11). On day 5, a small sample was taken and used for ICC to determine IFN-γ⁺ cells and cells to be adoptively transferred were re-stimulated by passage onto anti-CD3/anti-CD28-coated plates for at least 24 hrs. After 6 days, cells were harvested, washed in ice-cold PBS and viability was assessed with Typan Blue staining. Cells to be injected were normalized based on IFN-γ expression determined by ICC and 400000 viable IFN-γ⁺ cells were injected intraperitoneally per animal. As recipients, sex-matched RAG1^−/− animals were used. The weight was measured pre-adoptive transfer and routinely over the course of the experiment.

For histopathology, the colon and small intestine were fixed in 10% formalin and processed by the Harvard Medical School rodent histopathology core for H&E staining. The severity of disease was assessed in a blinded manner by an experienced histopathologist. The following scoring system was used: 0 (healthy)-4 (most severe disease).

Isolation of intestinal lymphocytes. Intestinal lymphocytes were isolated from RAG1^−/− recipients using a lamina propria dissociation kit according to the manufacturer's instructions (Miltenyi Biotec, Cat. No.: 130-097-410). Briefly, intestines were isolated and flushed with ice-cold buffer. The small intestine and colon were separated, opened longitudinally with scissors, turned inside-out and then cut into small pieces (<1 cm). Then, the intraepithelial lymphocytes (IEL) were shaken off with buffer containing 1 mM DTT with gentle rotation at 37° C. After the incubation period, the IEL were swiftly filtered (100 μm), washed with complete medium and kept on ice. This step was repeated once followed by a washing step to remove DTT. Then, the procedure was continued to isolate the lamina propria lymphocytes (LPL). For digestion of the intestinal mucosa, the samples were gently incubated with a proprietary enzymatic solution in C-tubes (Miltenyi Biotec, Cat. No.: 130-096-334) at 37° C. for at least 30 minutes using a rotator. After the enzymatic incubation, the samples were homogenized using a gentleMACS (Miltenyi Biotec) and the program m_intestine_01.

For overnight culture, to assess the cytokine profile of intestinal T cells, the cells were further isolated using a Percoll (GE Life Sciences/Cytiva) gradient centrifugation to remove cell debris and fat tissue.

Analysis of ex vivo cytokine production by intestinal lymphocytes. IEL and LPL were cultured overnight in complete medium with IL-7 (20 ng/ml, Biolegend)+IL-23 (20 ng/ml, R&D). The next day, the cells were stimulated with PMA/ionomycin+GolgiStop for 4 hrs as described above. ICC was performed and the cells stained for IL-17A, IFN-γ and GM-CSF.

Single-cell RNA-sequencing (scRNAseq). For full-length scRNAseq, single, viable in vitro differentiated CD4+ T cells were sorted into 96-well plates containing 5 μl TCL Buffer (QIAGEN) with 1% 2-mercaptoethanol, centrifuged and frozen at −80° C. SMART-Seq2 protocol was carried out mainly as previously described (Singer et al., 2016). For droplet-based 3′ end massively parallel single-cell RNA-sequencing, sorted (FACS) CD45+CD4+ intestinal T cells were encapsulated into droplets, and libraries were prepared using Chromium Single Cell 3′ Reagent Kits v2 according to the manufacturer's protocol (10×Genomics). Generated libraries were sequenced on a HiSeq X (Illumina).

RNA isolation and quantitative PCR. Total RNA was isolated with the RNeasy kit according to the manufacturer's instructions (Qiagen). In brief, cells were homogenized with 200μl RLT buffer supplemented with 2-mercaptoethanol by gentle pipetting and then an equal amount of 70% ethanol was added, the samples were mixed by inversion and RNA was captured through a centrifugation step with silica-based columns. Purified RNA was reverse-transcribed using Superscript II enzyme and random hexamer primers (Invitrogen). Taqman probes for genes of interest were purchased from Applied Biosystems. A ViiA7 Real-time PCR system (Applied Biosystems) was used for amplification and data acquisition.

Taqman probes
Taqman assay  Gene
Mm00519943_m1 Il23r
Mm01168134_m1 Ifng
Mm00439618_m1 Il17a
Mm00450960_m1 Tbx21
Mm01261022_m1 Rorc
Mm01219775_m1 Stat3

Statistical analysis. Details regarding the statistical analyses can be found in the figure legends. Statistical analysis was performed using GraphPad Prism 8.0. A p-value p<0.05 was considered significant.

Analysis of in-vitro SmartSeq2 single-cell transcriptional profiles. Sequencing reads were initially filtered with Trimmomatic 0.32⁸⁰ to remove low quality ends and adapter sequences. A combination of Bowtie2 v2.2.9⁸¹ was used to align reads to a reference transcriptome derived from the GRCm38 Mus musculus genome (NCBI Refseq). RSEM 1.2.31⁸² was used to compile the transcriptome and estimate transcript abundance following read alignment. Prior to alignment, the GRCm38 reference was augmented to include the modified eGFP+IL23R functional knockout transcript.

Prior to downstream analysis, cell libraries were excluded if they contained less than 800,000 reads or more than 3 million reads. Additionally, libraries with less than a 40% alignment rate were withheld. Finally, genes detected in less than 5 cell libraries were discarded prior to differential expression.

Initial inspection of the RNA-seq libraries showed that the dominant source of variation between cells could be attributed to differences in cell cycle progression. To reduce the effect of cell cycle on differential expression testing, two cell-cycle ‘scores’ per cell were computed and input as covariates into the differential expression model. To compute these scores, Applicants first subset the expression matrix, retaining only 97 genes identified as G1/S or G2/M enriched genes in a previous study⁸³. Then, PCA was run on the log(TPM+1) expression values and the first two component scores per cell were extracted.

To identify differentially expressed genes, the MAST⁸⁴ R package was used. When fitting the hurdle model, in addition to the covariates of interest both cell cycle components (described above) as well as the number of detected genes per cell were used to reduce false positives due to cycling state or mRNA capture rates. P-values were corrected with the Benjamini Hochberg FDR procedure and genes were accepted at an FDR<0.1 threshold. To identify genes whose expression differed between the GFP⁺ and GFP⁻ subsets in a genotype-dependent manner (and therefore may be perturbed as a consequence of Il-23 receptor signaling), data from all four subsets (Il23R^WT/eGFP and Il23R^eGFP/eGFP, GFP^+/− both) were combined and modeled with categorical covariates for GFP, Genotype, and a GFP:Genotype interaction term (in addition to the cell cycle and detection rate terms). Genes whose expression differed between the FACS sorted GFP subsets were first identified by comparing this full model to a reduced model without the GFP and GFP:Genotype terms, retaining those with FDR<0.1. Then, in this subset, Applicants tested the GFP:Genotype interaction term specifically and retained genes with FDR<0.1.

For visualization, the dataset was reduced using principal components analysis (PCA) followed by tSNE⁸⁵. Prior to running PCA, the log(x+1) transformed TPM expression values were normalized by regressing out three cell-level covariates: the number of detected genes, and both cell-cycle components. The top 30 components from PCA were then used as input to the tSNE procedure (with perplexity=30) to further reduce the data to 2 dimensions.

When comparing the GFP-associated expression between T cells stimulated under Th1 or Th17-producing conditions, an effect was considered “common” using the criteria FDR<0.05 in at least one comparison and (unadjusted) p-value <0.05 in the other with a log fold-change in the same direction. Opposite effects satisfied the same significance criteria but with a log fold-change of opposing signs, and Th1/Th17-specific effects satisfied FDR<0.05 in one group but p-value >0.05 in the other.

Analysis of In-Vivo 10×-Sequenced Single-Cell Libraries

Alignment and Preprocessing. To quantify gene expression, samples were individually aligned to the mm10 Mus musculus genome using CellRanger v2.0.2. In total, 14 samples were collected, however two samples of intraepithelial lymphocytes in the small intestine from batch 1 were discarded as the IL23R knockout sample did not pass quality checks (insufficient barcodes belonging to cells). The remaining 12 samples were used in downstream analysis.

Merging and Filtering. An initial analysis was performed on the concatenation of all samples to identify and remove dying or contaminating cell types. All 12 samples were modeled with scVI⁸⁶, selecting genes expressed in at least 100 cells, using 10 latent components, and encoding each sample ID as a batch variable so as to remove tissue and genotype specific effects.

The resulting latent space was then clustered into 11 clusters using the Louvain algorithm as implemented in SCANPY⁸⁷ with the following settings: n_neighbors=10 and resolution=0.5. Of these four clusters were marked for removal in all subsequent analysis (across all samples), in total consisting of 7.6% of all 32,763 cells.

One cluster, c8, was characterized by low recovered UMI counts, a low proportion of ribosomal coding RNA, a high proportion of mitochondrial RNA, and very few other distinguishing genes. These were removed as being likely low-quality measurements from damaged cells.

Another cluster, c9, was identified as a possible contaminant cell type due to marked lack of CD4 and CD52 expression. Similarly, cluster c10 lacked T cell markers and had high expression of hemoglobin-related genes.

Finally, cluster c6, despite exhibiting Th17-related genes (Ccr6, Il-23r, Rorc, and IL-22), was removed as the lack of CD3 expression, lack of TCR expression, and distinct lack of any IL-23r-eGFP detection (despite significant Il-23r detection), indicated that these were likely LTi ILC3 cells from the recipient mouse and therefore not part of the genotype-perturbed donor cells of interest in this experiment. After this stage of filtering, a total of 30,259 cells remained for downstream analysis.

Between Tissue Analyses. The combined UMAP plots of FIG. 2 were generated by first modeling all cells with scVI⁸⁶, and then running the UMAP⁸⁸ algorithm using SCANPY⁸⁷ with n_neighbors=30. When running scVI, the two experimental batches were encoded as the batch variable and zero-inflation in the model was disabled. Additionally, genes were pre-filtered to retain A) genes expressed in at least 100 cells and B) genes with high fano factor: genes divided into 30 bins based on mean, fano factor computed for each gene—using the UMI-depth normalized counts—and genes retained with a fano factor greater than 2 MAD (median absolute deviations above median) per bin.

For the heatmap in FIG. 2E, edgeR⁸⁹ was run to compute average expression per tissue and to determine the genes with the highest tissue specificity, the top 500 of which were plotted. The model was fit in the form “Batch+Tissue” and the Tissue coefficient was tested with the likelihood ratio test. When computing within-tissue differential expression based on Genotype, edgeR was used to compute differential expression (between control and eGFP/eGFP cells) using the likelihood ratio test.

Within-Tissue Analysis: Lamina Propria Lymphocytes. Samples from the lamina propria (6 total—batch 1: control and knockout in colon and batch: 2 control and knockout in colon and small intestine) were grouped together and modeled with scVI⁸⁶ (8 components, zero-inflation enabled, genes retained that were expressed in 10 cells or more and the Fano filter as described in the previous section). As broad genotype-specific differences in expression (e.g., heat shock proteins), prevented cells from clustering together, Applicants regressed out individual sample differences as if they were batch (i.e., encoded sample ID as the batch variable) and instead assessed the resulting clusters in terms of proportional representation (control vs. knockout) and within-cluster differential expression (control vs knockout). UMAP and Louvain clustering were run on the resulting 8 components as implemented in SCANPY⁸⁷ with the following parameters: n_neighbors=30 and (for Louvain) resolution=0.9.

Changes in cluster composition were adjusted by the number of cells recovered using the following relation:

$\mathrm{Genotype}\mathrm{Ratio}=\left(\frac{\mathrm{Control}\mathrm{Cells}\mathrm{in}\mathrm{Cluster}}{\mathrm{Total}\mathrm{Control}\mathrm{Cells}}\right)/\left(\frac{\mathrm{Knockout}\mathrm{Cells}\mathrm{in}\mathrm{Cluster}}{\mathrm{Total}\mathrm{Knockout}\mathrm{Cells}}\right)$

To identify marker genes per cluster, edgeR⁸⁹ was used to compute log fold-change and significance when comparing cells in the cluster vs all other cells (1 vs. all differential expression). Similarly, edgeR was used to determine differential expression within cluster (control vs. knockout cells).

The Tr1 signature from Gruarin et al., 2019⁵² is composed of the 51 genes differentiated Tr1 cells from other CD4 cells in FIG. 1A of that study. Per-cell signature scores were calculated using VISION⁹⁰ and the expression matrix scaled to the median number of UMIs per cell.

Target Prioritization (Ranking)

For each gene, Applicants computed an overall score with four components. Genes were then ranked by a weighted sum of these components. The components are defined as:

1. In-vivo, Cluster Specific—the maximum of:

• • The log fold-change of genes significant (FDR<0.1) in the cluster 2 vs. all comparison
  • The log fold-change*0.5 of genes significant (FDR<0.1) in the cluster 9 vs. all comparison
  • The log fold-change of genes significant (FDR<0.1) in the within-cluster (cluster 2) control vs. knockout comparison
  • The log fold-change*0.5 of genes significant (FDR<0.1) in the within-cluster (cluster 9) control vs. knockout comparison2. In-vivo, Tissue Specific—the maximum of:
  • The log fold-change for genes significant (FDR<0.1) in the LPL vs. Spleen comparison
  • The log fold-change for genes significant (FDR<0.1) in the within-LPL control vs. knockout comparison

For both the above in-vivo categories, negative log fold-changes were truncated at 0 (to select specifically for genes upregulated in the cluster of interest or in control cells) and the overall score per gene was limited to 2.

3. In-vitro, Summary—the maximum of:

• • The log fold-change for genes with significant (FDR<0.1) genotype-independent differences in the in-vitro GFP+vs. GFP− comparison
  • The log fold-change of the genotype-dependent effect (GFP+×Genotype Ctrl) in the in-vitro linear model

For the above, in-vitro category, the overall score per gene was limited to 3.

4. GWAS:

• • Applicants assigned a GWAS score of 1 for genes within GWAS loci for Ulcerative Colitis or Crohn's Disease (as identified by Jostins et. al., 2012; Liu et. al., 2015; DeLange et. al., 2017^58,60,61 and compiled by DeLange et al., 2017⁵⁸). Alternate genes were discarded for loci in which a specific gene has been confidently implicated by fine-mapping, eQTL, or target sequencing studies (as compiled by DeLange et al. 2017⁵⁸).

The final ranking was determined by combining all four categories using the following weightings:

Overall Score=(In-vivo,Cluster Specific)×2+(In-vivo,Tissue Specific)×1+(In-vitro,Summary)×1+(GWAS)×2

REFERENCES

• 1 Cua, D. J. et al. Interleukin-23 rather than interleukin-12 is the critical cytokine for autoimmune inflammation of the brain. Nature 421, 744-748, doi:10.1038/nature01355 (2003).
• 2 Murphy, C. A. et al. Divergent pro- and antiinflammatory roles for IL-23 and IL-12 in joint autoimmune inflammation. J Exp Med 198, 1951-1957, doi:10.1084/jem.20030896 (2003).
• 3 Ahern, P. P. et al. Interleukin-23 drives intestinal inflammation through direct activity on T cells. Immunity 33, 279-288, doi:10.1016/j.immuni.2010.08.010 (2010).
• 4 Teng, M. W. et al. IL-12 and IL-23 cytokines: from discovery to targeted therapies for immune-mediated inflammatory diseases. Nat Med 21, 719-729, doi:10.1038/nm.3895 (2015).
• 5 Duerr, R. H. et al. A genome-wide association study identifies IL23R as an inflammatory bowel disease gene. Science 314, 1461-1463, doi:10.1126/science.1135245 (2006).
• 6 Hueber, W. et al. Secukinumab, a human anti-IL-17A monoclonal antibody, for moderate to severe Crohn's disease: unexpected results of a randomised, double-blind placebo-controlled trial. Gut 61, 1693-1700, doi:10.1136/gutjnl-2011-301668 (2012).
• 7 Harbour, S. N., Maynard, C. L., Zindl, C. L., Schoeb, T. R. & Weaver, C. T. Th17 cells give rise to Th1 cells that are required for the pathogenesis of colitis. Proc Natl Acad Sci USA 112, 7061-7066, doi:10.1073/pnas.1415675112 (2015).
• 8 Ghoreschi, K. et al. Generation of pathogenic T(H)17 cells in the absence of TGF-beta signalling. Nature 467, 967-971, doi:10.1038/nature09447 (2010).
• 9 Lee, Y. et al. Induction and molecular signature of pathogenic TH17 cells. Nature immunology 13, 991-999, doi:10.1038/ni.2416 (2012).
• 10 Yosef, N. et al. Dynamic regulatory network controlling TH17 cell differentiation. Nature 496, 461-468, doi:10.1038/nature11981 (2013).
• 11 Gaublomme, J. T. et al. Single-Cell Genomics Unveils Critical Regulators of Th17 Cell Pathogenicity. Cell 163, 1400-1412, doi:10.1016/j.cell.2015.11.009 (2015).
• 12 Patel, D. D. & Kuchroo, V. K. Th17 Cell Pathway in Human Immunity: Lessons from Genetics and Therapeutic Interventions. Immunity 43, 1040-1051, doi:10.1016/j.immuni.2015.12.003 (2015).
• 13 McGeachy, M. J. et al. The interleukin 23 receptor is essential for the terminal differentiation of interleukin 17-producing effector T helper cells in vivo. Nature immunology 10, 314-324, doi:10.1038/ni.1698 (2009).
• 14 Izcue, A. et al. Interleukin-23 restrains regulatory T cell activity to drive T cell-dependent colitis. Immunity 28, 559-570, doi:10.1016/j.immuni.2008.02.019 (2008).
• 15 Schiering, C. et al. The alarmin IL-33 promotes regulatory T-cell function in the intestine. Nature 513, 564-568, doi:10.1038/nature13577 (2014).
• 16 Sandborn, W. J. et al. Ustekinumab induction and maintenance therapy in refractory Crohn's disease. N Engl J Med 367, 1519-1528, doi:10.1056/NEJMoa1203572 (2012).
• 17 Sands, B. E. et al. Ustekinumab as Induction and Maintenance Therapy for Ulcerative Colitis. N Engl J Med 381, 1201-1214, doi:10.1056/NEJMoa1900750 (2019).
• 18 Powrie, F. et al. Inhibition of Th1 responses prevents inflammatory bowel disease in scid mice reconstituted with CD45RBhi CD4+ T cells. Immunity 1, 553-562 (1994).
• 19 Hirota, K. et al. Fate mapping of IL-17-producing T cells in inflammatory responses. Nat Immunol 12, 255-263, doi:10.1038/ni.1993 (2011).
• 20 Szabo, S. J. et al. A novel transcription factor, T-bet, directs Th1 lineage commitment. Cell 100, 655-669, doi:10.1016/s0092-8674(00)80702-3 (2000).
• 21 Mosmann, T. R., Cherwinski, H., Bond, M. W., Giedlin, M. A. & Coffman, R. L. Two types of murine helper T cell clone. I. Definition according to profiles of lymphokine activities and secreted proteins. J Immunol 136, 2348-2357 (1986).
• 22 Awasthi, A. et al. Cutting edge: IL-23 receptor gfp reporter mice reveal distinct populations of IL-17-producing cells. J Immunol 182, 5904-5908, doi:10.4049/jimmunol.0900732 (2009).
• 23 Picelli, S. et al. Smart-seq2 for sensitive full-length transcriptome profiling in single cells. Nat Methods 10, 1096-1098, doi:10.1038/nmeth.2639 (2013).
• 24 Lee, Y. et al. Induction and molecular signature of pathogenic TH17 cells. Nat Immunol 13, 991-999, doi:10.1038/ni.2416 (2012).
• Velasquez, S., Malik, S., Lutz, S. E., Scemes, E. & Eugenin, E. A. Pannexin1 Channels Are Required for Chemokine-Mediated Migration of CD4+T Lymphocytes: Role in Inflammation and Experimental Autoimmune Encephalomyelitis. J Immunol 196, 4338-4347, doi:10.4049/jimmunol.1502440 (2016).
• 26 Kurdi, A. T. et al. Tiaml/Rac1 complex controls Il17a transcription and autoimmunity. Nat Commun 7, 13048, doi:10.1038/ncomms13048 (2016).
• 27 DiSpirito, J. R. et al. Molecular diversification of regulatory T cells in nonlymphoid tissues. Sci Immunol 3, doi:10.1126/sciimmunol.aat5861 (2018).
• 28 Masopust, D. & Soerens, A. G. Tissue-Resident T Cells and Other Resident Leukocytes. Annu Rev Immunol 37, 521-546, doi:10.1146/annurev-immunol-042617-053214 (2019).
• 29 Carlson, C. M. et al. Kruppel-like factor 2 regulates thymocyte and T-cell migration. Nature 442, 299-302, doi:10.1038/nature04882 (2006).
• 30 Bonecchi, R. et al. Differential expression of chemokine receptors and chemotactic responsiveness of type 1 T helper cells (Th1s) and Th2s. J Exp Med 187, 129-134, doi:10.1084/jem.187.1.129 (1998).
• 31 Singh, U. P., Singh, S., Taub, D. D. & Lillard, J. W., Jr. Inhibition of IFN-gamma-inducible protein-10 abrogates colitis in IL-10−/− mice. J Immunol 171, 1401-1406, doi:10.4049/jimmunol.171.3.1401 (2003).
• 32 Khor, B., Gardet, A. & Xavier, R. J. Genetics and pathogenesis of inflammatory bowel disease. Nature 474, 307-317, doi:10.1038/nature10209 (2011).
• 33 Annacker, O. et al. Essential role for CD103 in the T cell-mediated regulation of experimental colitis. J Exp Med 202, 1051-1061, doi:10.1084/jem.20040662 (2005).
• 34 Lamb, C. A. et al. alphaEbeta7 Integrin Identifies Subsets of Pro-Inflammatory Colonic CD4+T Lymphocytes in Ulcerative Colitis. J Crohns Colitis 11, 610-620, doi:10.1093/ecco-jcc/jjw189 (2017).
• 35 Johansson-Lindbom, B. & Agace, W. W. Generation of gut-homing T cells and their localization to the small intestinal mucosa. Immunol Rev 215, 226-242, doi:10.1111/j.1600-065X.2006.00482.x (2007).
• 36 Schneider, M. et al. CD38 is expressed on inflammatory cells of the intestine and promotes intestinal inflammation. PLoS One 10, e0126007, doi:10.1371/journal.pone.0126007 (2015).
• 37 Abadia-Molina, A. C. et al. CD48 controls T-cell and antigen-presenting cell functions in experimental colitis. Gastroenterology 130, 424-434, doi:10.1053/j.gastro.2005.12.009 (2006).
• 38 Jackson, R. et al. The translation of non-canonical open reading frames controls mucosal immunity. Nature 564, 434-438, doi:10.1038/s41586-018-0794-7 (2018).
• 39 Anumanthan, A. et al. Cloning of BY55, a novel Ig superfamily member expressed on NK cells, CTL, and intestinal intraepithelial lymphocytes. J Immunol 161, 2780-2790 (1998).
• 40 Zhang, Q. & Vignali, D. A. Co-stimulatory and Co-inhibitory Pathways in Autoimmunity. Immunity 44, 1034-1051, doi:10.1016/j.immuni.2016.04.017 (2016).
• 41 Dardalhon, V. et al. CD226 is specifically expressed on the surface of Th1 cells and regulates their expansion and effector functions. J Immunol 175, 1558-1565, doi:10.4049/jimmunol.175.3.1558 (2005).
• 42 Gilfillan, S. et al. DNAM-1 promotes activation of cytotoxic lymphocytes by nonprofessional antigen-presenting cells and tumors. J Exp Med 205, 2965-2973, doi:10.1084/jem.20081752 (2008).
• 43 Ito, R. et al. Interferon-gamma is causatively involved in experimental inflammatory bowel disease in mice. Clin Exp Immunol 146, 330-338, doi:10.1111/j.1365-2249.2006.03214.x (2006).
• 44 Brass, A. L. et al. The IFITM proteins mediate cellular resistance to influenza A H1N1 virus, West Nile virus, and dengue virus. Cell 139, 1243-1254, doi:10.1016/j.cell.2009.12.017 (2009).
• 45 Roman, J. et al. Evaluation of responsive gene expression as a sensitive and specific biomarker in patients with ulcerative colitis. Inflamm Bowel Dis 19, 221-229, doi:10.1002/ibd.23020 (2013).
• 46 Laudato, S. et al. P53-induced miR-30e-5p inhibits colorectal cancer invasion and metastasis by targeting ITGA6 and ITGB1. Int J Cancer 141, 1879-1890, doi:10.1002/ijc.30854 (2017).
• 47 Sands, B. E. et al. Vedolizumab versus Adalimumab for Moderate-to-Severe Ulcerative Colitis. N Engl J Med 381, 1215-1226, doi:10.1056/NEJMoa1905725 (2019).
• 48 Mailand, N. & Diffley, J. F. CDKs promote DNA replication origin licensing in human cells by protecting Cdc6 from APC/C-dependent proteolysis. Cell 122, 915-926, doi:10.1016/j.cell.2005.08.013 (2005).
• 49 Yu, H. Cdc20: a WD40 activator for a cell cycle degradation machine. Mol Cell 27, 3-16, doi:10.1016/j.molcel.2007.06.009 (2007).
• 50 Forster, R., Davalos-Misslitz, A. C. & Rot, A. CCR7 and its ligands: balancing immunity and tolerance. Nat Rev Immunol 8, 362-371, doi:10.1038/nri2297 (2008).
• 51 Weder, B. et al. BCL-2 levels do not predict azathioprine treatment response in inflammatory bowel disease, but inhibition induces lymphocyte apoptosis and ameliorates colitis in mice. Clin Exp Immunol 193, 346-360, doi:10.1111/cei.13151 (2018).
• 52 Gruarin, P. et al. Eomesodermin controls a unique differentiation program in human IL-10 and IFN-gamma coproducing regulatory T cells. Eur J Immunol 49, 96-111, doi:10.1002/eji.201847722 (2019).
• 53 Zhang, P. et al. Eomesodermin promotes the development of type 1 regulatory T (TR1) cells. Sci Immunol 2, doi:10.1126/sciimmunol.aah7152 (2017).
• 54 Alfen, J. S. et al. Intestinal IFN-gamma-producing type 1 regulatory T cells coexpress CCR5 and programmed cell death protein 1 and downregulate IL-10 in the inflamed guts of patients with inflammatory bowel disease. J Allergy Clin Immunol 142, 1537-1547 e1538, doi:10.1016/j.jaci.2017.12.984 (2018).
• 55 Amarnath, S. et al. The PDL1-PD1 axis converts human TH1 cells into regulatory T cells. Sci Transl Med 3, 111ra120, doi:10.1 126/scitranslmed.3003130 (2011).
• 56 Takahashi, S. et al. De novo and rare mutations in the HSPA1L heat shock gene associated with inflammatory bowel disease. Genome Med 9, 8, doi:10.1186/si3073-016-0394-9 (2017).
• 57 van Eden, W., van der Zee, R. & Prakken, B. Heat-shock proteins induce T-cell regulation of chronic inflammation. Nat Rev Immunol 5, 318-330, doi:10.1038/nri1593 (2005).
• 58 de Lange, K. M. et al. Genome-wide association study implicates immune activation of multiple integrin genes in inflammatory bowel disease. Nat Genet 49, 256-261, doi:10.1038/ng.3760 (2017).
• 59 Huang, H. et al. Fine-mapping inflammatory bowel disease loci to single-variant resolution. Nature 547, 173-178, doi:10.1038/nature22969 (2017).
• 60 Liu, J. Z. et al. Association analyses identify 38 susceptibility loci for inflammatory bowel disease and highlight shared genetic risk across populations. Nat Genet 47, 979-986, doi:10.1038/ng.3359 (2015).
• 61 Jostins, L. et al. Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease. Nature 491, 119-124, doi:10.1038/nature11582 (2012).
• 62 Kakiuchi, N. et al. Frequent mutations that converge on the NFKBIZ pathway in ulcerative colitis. Nature 577, 260-265, doi:10.1038/s41586-019-1856-1 (2020).
• 63 Grenningloh, R., Kang, B. Y. & Ho, I. C. Ets-1, a functional cofactor of T-bet, is essential for Th1 inflammatory responses. J Exp Med 201, 615-626, doi:10.1084/jem.20041330 (2005).
• 64 Wells, M. L., Perera, L. & Blackshear, P. J. An Ancient Family of RNA-Binding Proteins: Still Important! Trends Biochem Sci 42, 285-296, doi:10.1016/j.tibs.2016.12.003 (2017).
• 65 Wang, X., Sumida, H. & Cyster, J. G. GPR18 is required for a normal CD8alphaalpha intestinal intraepithelial lymphocyte compartment. J Exp Med 211, 2351-2359, doi:10.1084/jem.20140646 (2014).
• 66 Tan, C. L. et al. CD160 Stimulates CD8(+) T Cell Responses and Is Required for Optimal Protective Immunity to Listeria monocytogenes. Immunohorizons 2, 238-250, doi:10.4049/immunohorizons.1800039 (2018).
• 67 Tu, T. C. et al. CD160 is essential for NK-mediated IFN-gamma production. J Exp Med 212, 415-429, doi:10.1084/jem.20131601 (2015).
• 68 Korn, T. et al. IL-21 initiates an alternative pathway to induce proinflammatory T(H)17 cells. Nature 448, 484-487, doi:10.1038/nature05970 (2007).
• 69 Zhou, L. et al. IL-6 programs T(H)-17 cell differentiation by promoting sequential engagement of the IL-21 and IL-23 pathways. Nature immunology 8, 967-974, doi:10.1038/ni1488 (2007).
• 70 Hsu, C. Y. et al. SUMO-defective c-Maf preferentially transactivates 1121 to exacerbate autoimmune diabetes. J Clin Invest 128, 3779-3793, doi:10.1172/JCI98786 (2018).
• 71 Sato, K. et al. Marked induction of c-Maf protein during Th17 cell differentiation and its implication in memory Th cell development. J Biol Chem 286, 14963-14971, doi:10.1074/jbc.M111.218867 (2011).
• 72 Iwamoto, T. et al. Interleukin-21-producing c-Maf-expressing CD4+ T cells induce effector CD8+ T cells and enhance autoimmune inflammation in scurfy mice. Arthritis Rheumatol 66, 2079-2090, doi:10.1002/art.38658 (2014).
• 73 Acosta-Rodriguez, E. V., Napolitani, G., Lanzavecchia, A. & Sallusto, F. Interleukins 1beta and 6 but not transforming growth factor-beta are essential for the differentiation of interleukin 17-producing human T helper cells. Nature immunology 8, 942-949, doi:10.1038/ni1496 (2007).
• 74 Becattini, S. et al. T cell immunity. Functional heterogeneity of human memory CD4(+) T cell clones primed by pathogens or vaccines. Science 347, 400-406, doi:10.1 126/science.1260668 (2015).
• 75 Gagliani, N. et al. Th17 cells transdifferentiate into regulatory T cells during resolution of inflammation. Nature 523, 221-225, doi:10.1038/nature14452 (2015).
• 76 Wu, C. et al. SGK1 Governs the Reciprocal Development of Th17 and Regulatory T Cells. Cell Rep 22, 653-665, doi:10.1016/j.celrep.2017.12.068 (2018).
• 77 Uniken Venema, W. T. et al. Single-Cell RNA Sequencing of Blood and Ileal T Cells From Patients With Crohn's Disease Reveals Tissue-Specific Characteristics and Drug Targets. Gastroenterology 156, 812-815 e822, doi:10.1053/j.gastro.2018.10.046 (2019).
• 78 Fuchs, A. et al. Intraepithelial type 1 innate lymphoid cells are a unique subset of IL-12- and IL-15-responsive IFN-gamma-producing cells. Immunity 38, 769-781, doi:10.1016/j.immuni.2013.02.010 (2013).
• 79 Atarashi, K. et al. Ectopic colonization of oral bacteria in the intestine drives TH1 cell induction and inflammation. Science 358, 359-365, doi:10.1126/science.aan4526 (2017).
• 80 Bolger, A. M., Lohse, M. & Usadel, B. Trimmomatic: a flexible trimmer for Illumina sequence data. Bioinformatics 30, 2114-2120, doi:10.1093/bioinformatics/btul70 (2014).
• 81 Langmead, B. & Salzberg, S. L. Fast gapped-read alignment with Bowtie 2. Nat Methods 9, 357-359, doi:10.1038/nmeth. 1923 (2012).
• 82 Li, B. & Dewey, C. N. RSEM: accurate transcript quantification from RNA-Seq data with or without a reference genome. BMC Bioinformatics 12, 323, doi:10.1186/1471-2105-12-323 (2011).
• 83 Kowalczyk, M. S. et al. Single-cell RNA-seq reveals changes in cell cycle and differentiation programs upon aging of hematopoietic stem cells. Genome Res 25, 1860-1872, doi:10.1101/gr.192237.115 (2015).
• 84 Finak, G. et al. MAST: a flexible statistical framework for assessing transcriptional changes and characterizing heterogeneity in single-cell RNA sequencing data. Genome Biol 16, 278, doi:10.1186/s13059-015-0844-5 (2015).
• 85 van der Maaten, L. Accelerating t-SNE using Tree-Based Algorithms. Journal of Machine Learning Research 15, 3221-3245 (2014).
• 86 Lopez, R., Regier, J., Cole, M. B., Jordan, M. I. & Yosef, N. Deep generative modeling for single-cell transcriptomics. Nat Methods 15, 1053-1058, doi:10.1038/s41592-018-0229-2 (2018).
• 87 Wolf, F. A., Angerer, P. & Theis, F. J. SCANPY: large-scale single-cell gene expression data analysis. Genome Biol 19, 15, doi:10.1186/s13059-017-1382-0 (2018).
• 88 Becht, E. et al. Dimensionality reduction for visualizing single-cell data using UMAP. Nat Biotechnol, doi:10.1038/nbt.4314 (2018).
• 89 Robinson, M. D., McCarthy, D. J. & Smyth, G. K. edgeR: a Bioconductor package for differential expression analysis of digital gene expression data. Bioinformatics 26, 139-140, doi:10.1093/bioinformatics/btp616 (2010).
• 90 DeTomaso, D. et al. Functional interpretation of single cell similarity maps. Nat Commun 10, 4376, doi:10.1038/s41467-019-12235-0 (2019).

Tables

Table 1A-1D. Tables related to the Smart-Seq2, in-vitro T cell cytokine stimulation experiments. Includes the results of differential expression comparisons (GFP+ vs GFP− comparisons along with the results of the combined, two-factor model.

Table Heading Descriptions:

Each section represents the output of MAST in computing a differential expression test (See Methods text for full details).

Ctrl GFP+vs GFP−: GFP coefficient (GFP+vs GFP−), only Ctrl cells

KO GFP+vs GFP−: GFP coefficient (GFP+vs GFP−), only KO cells

Combined Model: Analysis of the interaction term (GFP:Genotype) in a combined model with both Ctrl and KO cells.

Coefficient tested is for GFP+:GenotypeCtrl

Th1: Cells stimulated in Th1-polarizing conditions (IL12+IL21+IL23)

Th17: Cells stimulated in Th17-polarizing conditions (IL1+IL6+IL23)

Descriptions for MAST (common) to all sections:

Gene: Gene for which the test was computed

coefC: continuous coefficient in the MAST hurdle model

pvalC: p-value associated with the continuous coefficient

coefD: discrete coefficient in the MAST hurdle model

pvalD: p-value associated with the discrete coefficient

pvalH: overall p-value associated with the MAST hurdle model

log FC: log 2 effect size associated with the tested coefficient

FDR. Benjamini-Hochberg False Discovery Rate

TABLE 1A
Th1 Ctrl GFP+ vs GFP−
Gene	coefC	pvalC	coefD	pvalD	pvalH	logFC	FDR
IL23R	1.61	2.41E−05	4.54E+00	5.84E−27	1.06E−29	4.76	1.38E−25
EGFP_IRES_IL23R	2.40	3.81E−04	4.26E+00	1.69E−25	4.04E−27	3.81	2.62E−23
RPS2	1.00	2.35E−19	−1.20E−16	1.00E+00	2.68E−18	1.00	1.16E−14
H2-T23	−0.96	9.22E−19	−1.20E−16	1.00E+00	1.03E−17	−0.96	3.35E−14
CBX3	−0.77	1.15E−14	−1.20E−16	1.00E+00	1.13E−13	−0.77	2.44E−10
VAPA	1.69	3.39E−14	1.84E+00	1.21E−01	9.86E−14	1.75	2.44E−10
IL4	−3.47	2.74E−03	−2.97E+00	5.21E−12	5.17E−13	−3.13	9.58E−10
RPSA	−0.46	6.37E−14	−1.20E−16	1.00E+00	6.09E−13	−0.46	9.87E−10
RNF187	1.72	4.02E−11	2.07E+00	4.33E−04	6.96E−13	2.44	1.00E−09
ARGLU1	−1.05	1.14E−13	−1.20E−16	1.00E+00	1.08E−12	−1.04	1.40E−09
CLASP2	1.86	1.02E−11	1.61E+00	1.25E−02	3.94E−12	2.05	4.65E−09
RPS12	−0.49	7.22E−13	−1.20E−16	1.00E+00	6.61E−12	−0.49	7.14E−09
TPT1	−0.43	1.48E−12	−1.20E−16	1.00E+00	1.34E−11	−0.43	1.34E−08
LARS2	0.60	7.74E−12	−1.20E−16	1.00E+00	6.77E−11	0.60	6.27E−08
ANXA2	1.11	1.41E−11	7.73E−01	6.73E−01	1.12E−10	1.12	9.67E−08
SMOX	1.55	3.89E−11	9.62E−01	1.97E−01	1.43E−10	1.78	1.16E−07
RPL12	−0.39	2.95E−11	−1.20E−16	1.00E+00	2.51E−10	−0.39	1.92E−07
MAP3K1	−1.20	2.66E−10	−1.66E+00	4.43E−02	2.85E−10	−1.27	2.05E−07
RNH1	0.80	9.93E−11	1.20E+00	3.94E−01	5.73E−10	0.84	3.91E−07
RPS20	−0.39	7.32E−11	−1.20E−16	1.00E+00	6.11E−10	−0.39	3.96E−07
RPL5	−0.31	9.11E−11	−1.20E−16	1.00E+00	7.57E−10	−0.31	4.67E−07
EIF3F	0.76	1.14E−10	−1.20E−16	1.00E+00	9.41E−10	0.76	5.54E−07
PDCD4	−1.10	3.18E−08	−2.96E+00	1.14E−03	1.14E−09	−1.29	6.45E−07
NSUN2	1.15	2.83E−10	−7.08E−01	2.65E−01	1.23E−09	0.88	6.64E−07
TIMP1	1.02	8.98E−02	2.06E+00	1.41E−09	2.60E−09	4.05	1.35E−06
1110008F13RIK	1.43	4.97E−07	1.18E+00	2.86E−04	4.50E−09	2.27	2.24E−06
PHLDA3	1.09	1.14E−03	1.69E+00	2.26E−07	7.61E−09	2.49	3.53E−06
ACTB	−0.45	9.71E−10	−1.20E−16	1.00E+00	7.63E−09	−0.45	3.53E−06
RNR1	0.90	1.61E−09	−1.20E−16	1.00E+00	1.25E−08	0.90	5.48E−06
S1PR1	1.16	9.45E−07	1.74E+00	4.45E−04	1.27E−08	2.07	5.48E−06
ANP32B	1.20	5.36E−09	−1.87E+00	1.36E−01	1.33E−08	1.13	5.56E−06
PSMB9	−0.67	2.45E−09	−1.20E−16	1.00E+00	1.88E−08	−0.67	7.63E−06
SLC4A11	1.32	1.86E−08	8.08E−01	4.93E−02	1.95E−08	1.86	7.68E−06
PELI1	1.22	9.77E−07	2.00E+00	1.38E−03	3.75E−08	1.78	1.43E−05
HSH2D	−0.80	1.29E−01	−2.16E+00	2.04E−08	4.66E−08	−1.36	1.72E−05
LSM4	0.93	1.41E−08	1.48E+00	2.47E−01	5.29E−08	0.97	1.91E−05
RPL30	−0.36	7.69E−09	−1.20E−16	1.00E+00	5.72E−08	−0.36	1.95E−05
H2-Q10	1.07	4.40E−05	1.60E+00	4.35E−05	5.58E−08	2.50	1.95E−05
UCK2	1.31	6.31E−08	1.63E+00	4.46E−02	5.88E−08	1.60	1.95E−05
RPS27A	−0.28	1.08E−08	−1.20E−16	1.00E+00	7.97E−08	−0.28	2.58E−05
KLF6	1.20	8.41E−08	1.07E+00	5.25E−02	8.90E−08	1.59	2.81E−05
CALM2	0.71	1.35E−08	5.59E−01	8.74E−01	9.78E−08	0.72	3.02E−05
SRM	1.24	1.51E−08	−1.45E−02	9.37E−01	1.10E−07	1.12	3.31E−05
ENSA	−1.06	2.93E−05	−1.63E+00	1.55E−04	1.26E−07	−1.82	3.72E−05
CANX	−0.55	2.07E−08	−1.20E−16	1.00E+00	1.50E−07	−0.55	4.31E−05
PAXBP1	−1.00	1.08E−05	−1.57E+00	6.42E−04	1.84E−07	−1.54	5.19E−05
CLPTM1	1.05	1.60E−05	1.36E+00	4.70E−04	2.01E−07	1.73	5.54E−05
DUSP2	1.18	7.41E−04	1.64E+00	1.14E−05	2.22E−07	2.64	5.99E−05
NPTN	−1.09	2.12E−05	−1.43E+00	5.90E−04	3.24E−07	−1.66	8.39E−05
OST4	−0.93	7.14E−08	−1.29E+00	3.51E−01	3.22E−07	−0.96	8.39E−05
TMEM161B	−1.16	6.96E−05	−1.21E+00	2.35E−04	4.23E−07	−0.96	1.07E−04
CSF1	0.26	6.40E−01	1.96E+00	6.85E−08	4.29E−07	1.23	1.07E−04
RBMS1	0.89	4.12E−04	1.87E+00	4.78E−05	5.02E−07	1.90	1.23E−04
GM5111		1.00E+00	3.79E+00	5.48E−07	5.48E−07		1.32E−04
ACTR2	−0.57	9.10E−08	−1.20E−16	1.00E+00	6.30E−07	−0.57	1.48E−04
S100A10	0.66	9.31E−08	−1.20E−16	1.00E+00	6.43E−07	0.66	1.49E−04
CASP6	0.94	1.18E−07	−4.16E−01	6.84E−01	7.43E−07	0.93	1.69E−04
ID2	−1.20	8.17E−07	−8.88E−01	5.25E−02	8.00E−07	−1.69	1.76E−04
TMEM30A	0.86	7.60E−05	3.04E+00	4.20E−04	7.92E−07	1.38	1.76E−04
RALA	0.64	1.56E−04	1.97E+00	2.37E−04	9.11E−07	1.52	1.97E−04
RN7S1	0.55	1.10E−02	1.46E+00	4.22E−06	1.00E−06	1.68	2.03E−04
RN7S2	0.55	1.10E−02	1.46E+00	4.22E−06	1.00E−06	1.68	2.03E−04
RPL7A	−0.27	1.41E−07	−1.20E−16	1.00E+00	9.63E−07	−0.27	2.03E−04
EMB	0.78	1.49E−07	5.59E−01	8.74E−01	1.00E−06	0.79	2.03E−04
RORA	0.71	1.68E−02	.49E+00	3.80E−06	1.31E−06	1.35	2.62E−04
RPS21	−0.33	2.03E−07	−1.20E−16	1.00E+00	1.37E−06	−0.33	2.69E−04
IZUMO1R	−1.27	8.34E−06	−8.83E−01	8.08E−03	1.46E−06	−2.15	2.82E−04
MAPK1	0.96	1.95E−05	1.46E+00	3.78E−03	1.65E−06	1.52	3.14E−04
RORC	0.35	5.10E−01	1.72E+00	3.40E−07	1.81E−06	1.54	3.39E−04
ZFP622	1.36	4.16E−07	2.86E−01	3.77E−01	1.85E−06	0.96	3.39E−04
RPS15	−0.26	2.76E−07	−1.20E−16	1.00E+00	1.84E−06	−0.26	3.39E−04
OSTF1	1.03	9.09E−07	1.19E+00	1.81E−01	2.37E−06	1.24	4.27E−04
GATA3	−0.93	7.00E−03	−1.87E+00	2.01E−05	2.97E−06	−2.13	5.28E−04
ERMN	0.94	7.85E−03	1.87E+00	2.09E−05	3.42E−06	2.39	5.99E−04
TPR	0.76	1.71E−06	1.26E+00	1.39E−01	3.57E−06	0.80	6.18E−04
PPP1R16B	−0.92	2.35E−05	−1.80E+00	7.54E−03	3.68E−06	−1.12	6.28E−04
PRRC2A	0.60	6.75E−06	2.27E+00	3.52E−02	4.34E−06	0.65	7.31E−04
PRKCH	0.97	1.17E−06	5.94E−01	3.08E−01	4.42E−06	1.17	7.35E−04
HSD17B10	0.72	1.00E−06	−6.85E−01	5.01E−01	5.08E−06	0.64	8.34E−04
RPLP2	−0.26	8.06E−07	−1.20E−16	1.00E+00	5.18E−06	−0.26	8.39E−04
WNT10B	0.21	8.48E−01	2.38E+00	8.43E−07	5.30E−06	0.87	8.49E−04
RPL28	−0.26	8.74E−07	−1.20E−16	1.00E+00	5.59E−06	−0.26	8.84E−04
SLC29A2	1.16	1.12E−02	1.40E+00	2.58E−05	5.72E−06	1.54	8.93E−04
PDE4B	1.24	6.38E−05	1.17E+00	4.40E−03	5.85E−06	1.87	9.03E−04
INHBA	0.59	2.70E−01	1.60E+00	1.96E−06	6.63E−06	2.84	1.01E−03
ATP6V0D2	0.35	3.06E−01	1.57E+00	1.94E−06	7.14E−06	2.43	1.08E−03
PSME1	−0.38	1.21E−06	−1.20E−16	1.00E+00	7.63E−06	−0.38	1.14E−03
RBM17	0.82	1.45E−06	1.04E+00	5.84E−01	7.81E−06	0.83	1.15E−03
TMEM160	0.80	3.46E−04	1.33E+00	1.09E−03	8.02E−06	1.76	1.17E−03
LAMA5	−0.75	2.70E−04	−1.48E+00	1.50E−03	8.51E−06	−1.25	1.20E−03
ITSN2	1.33	1.34E−06	−8.48E−03	9.63E−01	8.43E−06	0.96	1.20E−03
CALM1	0.51	1.65E−06	−6.40E−01	5.31E−01	8.46E−06	0.48	1.20E−03
GGNBP2	1.13	1.46E−06	2.60E−01	7.22E−01	8.61E−06	1.14	1.20E−03
PPP4C	0.77	5.51E−06	1.87E+00	1.18E−01	9.66E−06	0.89	1.33E−03
IFI27L2A	−0.74	3.38E−06	−1.60E+00	2.21E−01	9.72E−06	−0.78	1.33E−03
YIPF4	0.76	1.23E−05	1.63E+00	4.93E−02	1.02E−05	1.07	1.38E−03
IIGP1	−0.69	3.46E−02	−1.38E+00	1.79E−05	1.08E−05	−1.99	1.44E−03
UTP18	1.43	2.29E−06	1.96E−01	5.73E−01	1.21E−05	1.14	1.59E−03
D030056L22RIK	1.48	3.74E−03	1.46E+00	1.65E−04	1.24E−05	1.11	1.59E−03
CCDC71L	0.78	9.23E−03	1.30E+00	6.99E−05	1.24E−05	1.23	1.59E−03
USP39	0.78	6.80E−05	1.53E+00	9.48E−03	1.24E−05	1.37	1.59E−03
GTF2A1	−1.08	2.05E−06	6.32E−02	8.89E−01	1.26E−05	−0.77	1.60E−03
BHLHE41	−0.10	2.24E−01	−1.46E+00	4.50E−06	1.29E−05	−0.25	1.62E−03
SUMF1	1.80	1.20E−04	9.46E−01	5.61E−03	1.32E−05	1.03	1.65E−03
LAMP1	0.97	5.72E−05	1.09E+00	1.31E−02	1.40E−05	1.52	1.73E−03
PMM1	0.58	4.63E−03	1.78E+00	1.60E−04	1.46E−05	2.07	1.78E−03
IL27RA	−1.08	1.27E−05	−6.05E−01	7.93E−02	1.56E−05	−1.29	1.90E−03
STOM	0.83	5.92E−02	1.43E+00	1.69E−05	1.61E−05	1.74	1.93E−03
TUSC2	−0.02	9.49E−01	1.55E+00	2.68E−06	1.64E−05	1.83	1.95E−03
SOCS3	0.77	1.61E−03	2.35E+00	5.21E−04	1.68E−05	1.35	1.98E−03
SYNE2	0.46	3.44E−01	2.11E+00	4.47E−06	1.72E−05	0.35	2.01E−03
TSPO	0.48	2.87E−06	−1.20E−16	1.00E+00	1.75E−05	0.48	2.03E−03
6430571L13RIK	−0.88	1.73E−02	−1.31E+00	5.67E−05	1.77E−05	−1.36	2.03E−03
CCDC85B	0.37	8.41E−02	1.72E+00	1.41E−05	1.80E−05	1.12	2.05E−03
RAD23A	−0.82	8.25E−06	−1.07E+00	1.80E−01	1.97E−05	−0.94	2.22E−03
PLBD2	0.57	2.00E−02	1.44E+00	5.74E−05	2.04E−05	1.74	2.26E−03
PTPN1	0.80	3.36E−06	−1.20E−16	1.00E+00	2.04E−05	0.79	2.26E−03
PERP	0.69	8.58E−03	1.38E+00	1.36E−04	2.18E−05	2.20	2.39E−03
RPS13	−0.21	3.68E−06	−1.20E−16	1.00E+00	2.23E−05	−0.21	2.42E−03
ODC1	1.03	5.80E−06	−5.18E−01	4.48E−01	2.58E−05	0.89	2.78E−03
IL22		1.00E+00	3.31E+00	2.59E−05	2.59E−05		2.78E−03
RPS26	−0.22	4.42E−06	−1.20E−16	1.00E+00	2.66E−05	−0.22	2.81E−03
TRP53I11	−0.44	4.95E−02	−1.51E+00	3.35E−05	2.67E−05	−1.73	2.81E−03
BLOC1S4	0.60	1.32E−01	1.47E+00	1.50E−05	2.73E−05	1.51	2.86E−03
CFL1	0.26	4.65E−06	−1.20E−16	1.00E+00	2.79E−05	0.26	2.89E−03
SERBP1	0.36	5.21E−06	−1.20E−16	1.00E+00	3.11E−05	0.36	3.20E−03
MFHAS1	0.88	3.56E−05	9.40E−01	5.66E−02	3.16E−05	1.11	3.22E−03
NOP9	0.71	1.41E−03	1.34E+00	1.20E−03	3.22E−05	1.60	3.27E−03
IL18R1	0.90	2.67E−02	1.27E+00	7.26E−05	3.27E−05	2.03	3.29E−03
STX6	0.71	9.73E−03	1.62E+00	1.92E−04	3.37E−05	1.72	3.36E−03
CSGALNACT1	0.04	9.53E−01	1.99E+00	5.75E−06	3.41E−05	0.82	3.37E−03
TPD52L2	0.67	1.07E−05	1.42E+00	3.15E−01	3.73E−05	0.71	3.67E−03
PLAGL2	0.66	9.73E−06	1.23E+00	3.79E−01	3.84E−05	0.69	3.72E−03
RACK1	−0.25	6.51E−06	−1.20E−16	1.00E+00	3.84E−05	−0.25	3.72E−03
KARS	−0.58	7.74E−06	−1.20E−16	1.00E+00	4.54E−05	−0.58	4.36E−03
RBM43	−0.65	4.35E−03	−1.10E+00	5.87E−04	4.66E−05	−1.67	4.44E−03
RPS10	−0.22	8.08E−06	−1.20E−16	1.00E+00	4.73E−05	−0.22	4.48E−03
SCAND1	0.44	8.89E−02	1.33E+00	3.73E−05	4.77E−05	1.70	4.48E−03
PGS1	0.94	1.10E−05	5.21E−01	4.56E−01	4.81E−05	1.06	4.48E−03
SERPINB5	0.73	1.04E−01	1.35E+00	3.32E−05	4.85E−05	2.06	4.49E−03
YWHAH	0.47	8.68E−06	5.59E−01	8.74E−01	5.00E−05	0.47	4.60E−03
H2−K1	−0.43	9.07E−06	−1.20E−16	1.00E+00	5.28E−05	−0.43	4.79E−03
RBM42	0.78	5.28E−05	1.57E+00	6.67E−02	5.25E−05	1.01	4.79E−03
EIF4B	−0.43	9.16E−06	−1.20E−16	1.00E+00	5.33E−05	−0.43	4.80E−03
MTRF1L	0.69	3.64E−02	1.44E+00	9.34E−05	5.43E−05	1.05	4.86E−03
IFNG	3.15	2.89E−03	1.15E+00	1.12E−03	5.84E−05	2.17	5.19E−03
RBM3	−0.38	1.02E−05	−1.20E−16	1.00E+00	5.88E−05	−0.38	5.19E−03
EEF1A1	−0.27	1.05E−05	−1.20E−16	1.00E+00	6.06E−05	−0.27	5.27E−03
TRAPPC6B	1.14	3.41E−05	5.74E−01	1.33E−01	6.02E−05	1.40	5.27E−03
EIF4A2	−0.51	4.59E−05	−1.98E+00	9.62E−02	6.19E−05	−0.62	5.35E−03
LIN7C	−0.84	7.57E−05	8.60E−01	5.73E−02	6.52E−05	−0.23	5.60E−03
SDHD	−0.66	1.51E−05	5.81E−01	6.10E−01	7.55E−05	−0.57	6.32E−03
TNP2	−0.73	5.20E−03	−1.14E+00	8.27E−04	7.53E−05	−1.89	6.32E−03
POLR2M	0.75	1.30E−05	9.45E−02	9.63E−01	7.41E−05	0.74	6.32E−03
CCNB2	0.92	2.30E−04	−8.67E−01	1.98E−02	7.48E−05	−0.04	6.32E−03
RPGRIP1	−0.38	1.38E−01	−1.40E+00	4.40E−05	7.88E−05	−1.12	6.55E−03
FAM49B	0.67	1.80E−05	4.80E−01	5.01E−01	8.09E−05	0.71	6.64E−03
GPR18	0.66	1.73E−02	1.68E+00	2.83E−04	8.09E−05	1.88	6.64E−03
FURIN	0.99	1.27E−04	−1.88E+00	4.37E−02	8.50E−05	0.75	6.93E−03
ATG3	0.65	1.86E−04	9.67E−01	2.98E−02	8.76E−05	1.32	6.99E−03
HIST1H2AH	1.65	1.56E−02	−2.18E+00	3.40E−04	8.79E−05	−0.39	6.99E−03
SLC15A3	1.10	7.46E−04	1.01E+00	6.83E−03	8.75E−05	1.95	6.99E−03
DONSON	0.77	2.96E−02	1.19E+00	1.87E−04	8.75E−05	1.48	6.99E−03
CD72	−3.12	4.55E−05	−7.32E−01	1.59E−01	9.07E−05	−0.39	7.17E−03
SLC30A9	0.80	7.38E−03	1.11E+00	7.38E−04	9.29E−05	1.42	7.29E−03
THAP11	0.71	6.99E−03	1.11E+00	7.82E−04	9.34E−05	1.79	7.29E−03
RGCC	0.87	3.67E−04	1.33E+00	1.62E−02	9.73E−05	1.62	7.46E−03
ISG20	−0.65	2.10E−01	−1.57E+00	3.89E−05	9.64E−05	−1.69	7.46E−03
ETV6	−0.75	1.73E−05	1.75E−01	9.31E−01	9.74E−05	−0.70	7.46E−03
WIPI2	0.41	3.60E−02	1.92E+00	1.76E−04	9.78E−05	1.30	7.46E−03
ANP32A	0.71	6.21E−05	9.90E−01	1.21E−01	9.92E−05	0.93	7.52E−03
CD81	0.66	2.23E−05	9.84E−01	5.28E−01	1.02E−04	0.67	7.70E−03
RIPK2	0.78	1.51E−02	1.18E+00	4.29E−04	1.06E−04	1.86	7.88E−03
UNC119B	0.54	1.47E−02	2.06E+00	4.38E−04	1.05E−04	1.42	7.88E−03
ATP5G2	−0.33	1.91E−05	−1.20E−16	1.00E+00	1.08E−04	−0.33	7.97E−03
LATS1	−1.13	2.98E−05	2.83E−01	3.75E−01	1.11E−04	−0.34	8.09E−03
RPL23	−0.20	1.98E−05	−1.20E−16	1.00E+00	1.11E−04	−0.20	8.09E−03
RPS16	−0.20	1.98E−05	−1.20E−16	1.00E+00	1.11E−04	−0.20	8.09E−03
RPS28	−0.24	1.99E−05	−1.20E−16	1.00E+00	1.12E−04	−0.24	8.09E−03
KHNYN	−0.98	1.30E−03	−9.04E−01	5.09E−03	1.13E−04	−1.25	8.11E−03
PAIP1	−0.64	7.65E−04	−1.33E+00	8.98E−03	1.14E−04	−0.91	8.19E−03
NMT1	−0.88	3.44E−05	−7.53E−01	3.43E−01	1.20E−04	−0.97	8.54E−03
CDKN1A	0.83	2.20E−05	−1.67E−01	8.66E−01	1.21E−04	0.81	8.58E−03
GAS2L1	0.94	3.38E−02	1.34E+00	2.46E−04	1.27E−04	0.87	8.93E−03
SHROOM3	1.26	3.40E−03	1.11E+00	2.23E−03	1.28E−04	0.75	8.94E−03
2310036022RIK	1.02	6.41E−05	4.41E−01	1.82E−01	1.39E−04	1.03	9.65E−03
CAPZA2	0.39	2.50E−05	−1.20E−16	1.00E+00	1.39E−04	0.39	9.65E−03
IER2	0.81	9.37E−05	9.22E−01	1.17E−01	1.42E−04	1.20	9.81E−03
ATXN2L	0.78	3.23E−05	5.88E−01	5.49E−01	1.48E−04	0.80	1.02E−02
COX15	0.42	1.33E−01	−1.26E+00	9.04E−05	1.52E−04	−0.29	1.03E−02
PLEK	−0.05	8.72E−01	1.48E+00	2.81E−05	1.53E−04	1.74	1.04E−02
ZDHHC7	1.07	9.05E−04	8.42E−01	1.08E−02	1.57E−04	1.38	1.06E−02
TRIM27	0.82	7.52E−04	1.07E+00	1.36E−02	1.63E−04	1.27	1.10E−02
RAC1	0.92	3.66E−05	1.04E+00	5.84E−01	1.72E−04	0.93	1.15E−02
RAPH1	0.42	7.36E−02	1.31E+00	1.72E−04	1.74E−04	0.98	1.15E−02
FBXO2	1.25	6.97E−03	1.22E+00	1.53E−03	1.73E−04	1.02	1.15E−02
UBA5	1.56	4.10E−05	2.17E−01	4.94E−01	1.76E−04	0.83	1.16E−02
FLOT2	0.77	3.31E−03	1.26E+00	3.26E−03	1.77E−04	1.60	1.16E−02
ADIPOR1	0.88	3.72E−05	4.14E−01	6.30E−01	1.80E−04	0.92	1.17E−02
LRRFIP2	0.91	9.21E−04	8.00E−01	1.30E−02	1.88E−04	1.14	1.22E−02
DAXX	−0.07	7.11E−01	−3.18E+00	3.79E−05	1.92E−04	−0.63	1.24E−02
ASB2	−0.30	4.51E−01	−1.34E+00	5.49E−05	2.20E−04	−1.57	1.41E−02
SOX5	0.70	1.75E−02	1.08E+00	8.53E−04	2.29E−04	1.02	1.46E−02
LGALS4	−1.04	3.16E−04	−6.23E−01	5.19E−02	2.30E−04	−0.88	1.46E−02
ACBD6	0.83	8.58E−05	5.19E−01	2.62E−01	2.38E−04	1.09	1.51E−02
FBXL22	−2.22	4.69E−05	1.21E−01	7.89E−01	2.44E−04	−0.24	1.53E−02
ARPC1B	0.29	4.51E−05	−1.20E−16	1.00E+00	2.43E−04	0.29	1.53E−02
MAPK6	0.75	4.44E−04	1.66E+00	3.90E−02	2.49E−04	0.96	1.55E−02
PKIB	1.03	1.04E−01	1.57E+00	1.98E−04	2.63E−04	0.56	1.63E−02
FZR1	0.61	1.38E−02	1.39E+00	1.32E−03	2.78E−04	1.61	1.72E−02
PRKCQ	−0.40	8.76E−02	−1.95E+00	2.54E−04	2.89E−04	−1.41	1.77E−02
SOD1	−0.29	5.47E−05	−1.20E−16	1.00E+00	2.92E−04	−0.29	1.77E−02
ATP6V0B	0.62	3.02E−04	1.49E+00	7.22E−02	2.90E−04	0.88	1.77E−02
UBASH3A	−0.68	1.93E−02	−1.06E+00	1.02E−03	2.93E−04	−1.59	1.77E−02
IL2RA	0.40	5.60E−05	−1.20E−16	1.00E+00	2.99E−04	0.40	1.79E−02
PGP	0.74	5.35E−04	9.02E−01	3.94E−02	2.99E−04	1.47	1.79E−02
NRAS	0.47	5.75E−05	4.70E−01	9.30E−01	3.05E−04	0.47	1.82E−02
SLAMF6	−2.48	2.26E−04	−6.96E−01	1.08E−01	3.06E−04	−0.78	1.82E−02
RAB3GAP1	−0.83	4.38E−04	−7.37E−01	5.15E−02	3.11E−04	−1.15	1.83E−02
BATF	0.71	1.25E−04	9.24E−01	2.29E−01	3.10E−04	1.00	1.83E−02
D17H6S53E	−0.39	6.58E−02	−1.42E+00	3.54E−04	3.11E−04	−0.96	1.83E−02
PITHD1	0.71	5.27E−03	1.07E+00	3.94E−03	3.19E−04	1.70	1.86E−02
CCR3		1.00E+00	3.06E+00	3.30E−04	3.30E−04		1.92E−02
STAT5A	0.74	8.97E−05	8.95E−01	4.22E−01	3.38E−04	0.84	1.95E−02
MLF2	0.54	7.43E−05	−4.14E−01	6.27E−01	3.47E−04	0.49	2.00E−02
ATP5E	−0.31	6.66E−05	−1.20E−16	1.00E+00	3.52E−04	−0.31	2.02E−02
MIDN	0.82	8.04E−05	2.29E−01	5.75E−01	3.59E−04	0.74	2.05E−02
SLC39A8	0.17	5.62E−01	1.29E+00	8.26E−05	3.64E−04	1.44	2.07E−02
RFNG	0.42	1.14E−01	1.20E+00	2.73E−04	3.80E−04	1.53	2.15E−02
TMED2	0.40	7.41E−05	−1.20E−16	1.00E+00	3.89E−04	0.40	2.18E−02
ARID3A	0.76	2.26E−03	7.98E−01	1.15E−02	3.89E−04	0.89	2.18E−02
GAK	0.56	7.57E−05	−1.20E−16	1.00E+00	3.97E−04	0.56	2.20E−02
TTC39C	0.86	1.60E−02	1.02E+00	1.69E−03	3.96E−04	1.62	2.20E−02
VPS37A	0.74	3.73E−03	1.04E+00	7.06E−03	3.96E−04	1.19	2.20E−02
DSTN	0.71	6.43E−04	9.26E−01	4.52E−02	3.98E−04	1.34	2.20E−02
BEND4	0.56	2.03E−02	1.11E+00	1.38E−03	4.07E−04	1.08	2.23E−02
CD3E	0.57	7.91E−05	−1.20E−16	1.00E+00	4.14E−04	0.57	2.26E−02
UPF3A	0.69	2.62E−02	1.05E+00	1.11E−03	4.13E−04	1.31	2.26E−02
MGAT2	0.72	5.77E−03	1.00E+00	4.87E−03	4.20E−04	1.46	2.28E−02
LGALS1	0.42	8.25E−05	−1.20E−16	1.00E+00	4.31E−04	0.42	2.33E−02
GATM	0.39	1.48E−01	1.49E+00	2.53E−04	4.34E−04	1.80	2.34E−02
MDFIC	0.78	5.18E−04	6.89E−01	6.54E−02	4.43E−04	1.07	2.37E−02
RPL31−PS12	−0.02	9.34E−01	−1.30E+00	8.68E−05	4.50E−04	−1.82	2.40E−02
H2−Q7	−0.60	3.03E−03	−2.58E+00	1.02E−02	4.54E−04	−0.93	2.41E−02
RNF115	0.87	5.29E−03	9.11E−01	5.88E−03	4.61E−04	1.49	2.44E−02
FAM174A	0.17	4.67E−01	1.27E+00	1.20E−04	4.70E−04	1.39	2.48E−02
CTBP1	0.91	1.57E−04	3.53E−01	3.17E−01	4.80E−04	0.97	2.52E−02
ZBTB38	0.64	4.65E−02	1.10E+00	7.69E−04	4.81E−04	1.28	2.52E−02
ZFP973	0.41	6.58E−02	−1.17E+00	5.67E−04	4.84E−04	−0.38	2.52E−02
1810026J23RIK	0.02	9.45E−01	1.31E+00	9.47E−05	4.90E−04	1.26	2.54E−02
TDP2	0.72	1.50E−02	1.00E+00	2.31E−03	5.00E−04	1.46	2.58E−02
RPL39	−0.20	9.89E−05	−1.20E−16	1.00E+00	5.11E−04	−0.20	2.63E−02
RAI14	−0.43	3.50E−01	1.43E+00	1.60E−04	5.21E−04	0.60	2.67E−02
ADAMTSL4	−0.60	1.52E−01	−1.20E+00	3.06E−04	5.30E−04	−0.91	2.71E−02
ZFAND6	0.66	1.07E−03	1.41E+00	3.66E−02	5.35E−04	1.05	2.71E−02
MCUR1	0.46	1.15E−01	1.15E+00	3.88E−04	5.35E−04	0.95	2.71E−02
MYLK	0.16	8.03E−01	1.92E+00	1.08E−04	5.39E−04	0.38	2.72E−02
ANKRD13C	1.07	1.97E−03	7.22E−01	1.98E−02	5.52E−04	1.05	2.75E−02
IARS	−0.79	1.11E−04	3.38E−01	7.91E−01	5.50E−04	−0.70	2.75E−02
GBP10	−0.45	2.53E−01	−1.18E+00	2.15E−04	5.52E−04	−1.49	2.75E−02
PSMD3	0.55	1.10E−04	−6.33E−02	9.04E−01	5.59E−04	0.55	2.78E−02
MIR684−2	−1.96	5.81E−02	−1.59E+00	7.60E−04	5.73E−04	−1.46	2.84E−02
ACLY	−0.55	1.12E−04	−1.20E−16	1.00E+00	5.75E−04	−0.55	2.84E−02
CRIP2	−0.25	5.85E−01	1.46E+00	1.36E−04	5.96E−04	0.98	2.93E−02
FRMD6	−0.61	3.62E−02	1.09E+00	1.23E−03	6.00E−04	0.62	2.93E−02
ST3GAL1	0.83	1.79E−03	8.24E−01	2.45E−02	6.09E−04	1.22	2.97E−02
LYSMD2	1.26	1.44E−04	1.87E−01	5.53E−01	6.12E−04	0.72	2.97E−02
PANK4	−0.96	3.79E−04	−4.76E−01	1.48E−01	6.35E−04	−0.96	3.06E−02
CACNB2	1.46	6.17E−03	1.12E+00	7.16E−03	6.33E−04	0.41	3.06E−02
CDCA7	−0.42	7.05E−02	−1.81E+00	7.24E−04	6.43E−04	−1.16	3.09E−02
CRISPLD2	0.34	6.24E−01	1.64E+00	1.45E−04	6.49E−04	0.69	3.10E−02
GM4951	−1.08	1.21E−01	−1.37E+00	4.67E−04	6.59E−04	−0.95	3.14E−02
CHST10	2.47	5.56E−03	1.45E+00	8.48E−03	6.70E−04	0.52	3.18E−02
IFT57	0.71	1.37E−02	9.23E−01	3.52E−03	6.76E−04	1.23	3.19E−02
PCBP3	−1.85	1.12E−03	−1.09E+00	4.59E−02	6.74E−04	−0.27	3.19E−02
GGA3	0.54	8.38E−02	−1.18E+00	6.74E−04	6.93E−04	−0.37	3.24E−02
TESC	0.79	1.22E−02	9.32E−01	4.02E−03	6.90E−04	1.54	3.24E−02
EBF1	0.47	5.34E−02	1.35E+00	1.01E−03	6.94E−04	1.37	3.24E−02
CTSD	0.63	5.01E−04	1.87E+00	1.22E−01	7.10E−04	0.73	3.30E−02
ETNK1	−0.62	2.11E−03	−8.95E−01	2.54E−02	7.28E−04	−1.00	3.37E−02
CBLN3	0.43	5.60E−03	−8.11E−01	9.30E−03	7.32E−04	0.04	3.38E−02
NHLRC2	0.32	3.47E−01	1.16E+00	2.34E−04	7.38E−04	1.14	3.39E−02
S100A11	0.76	1.44E−04	2.05E−01	1.00E+00	7.40E−04	0.78	3.39E−02
DHX57	−1.00	2.05E−04	−2.35E−01	4.44E−01	7.57E−04	−0.59	3.46E−02
E030024N20RIK	−0.38	1.52E−04	−1.20E−16	1.00E+00	7.67E−04	−0.38	3.49E−02
NLRC5	−0.32	1.75E−01	−1.85E+00	4.08E−04	7.71E−04	−0.87	3.49E−02
DTX3L	−0.74	1.74E−04	−3.67E−01	6.39E−01	7.79E−04	−0.76	3.52E−02
EIF4G2	−0.55	1.55E−04	−1.20E−16	1.00E+00	7.83E−04	−0.55	3.52E−02
SLC25A39	0.53	1.74E−04	−2.55E−01	6.76E−01	7.99E−04	0.45	3.53E−02
ISCU	0.57	4.38E−03	1.33E+00	1.31E−02	7.92E−04	1.37	3.53E−02
BACH2	0.73	6.50E−04	9.31E−01	1.04E−01	7.95E−04	0.90	3.53E−02
MGLL	0.44	6.29E−02	1.26E+00	1.01E−03	7.98E−04	1.48	3.53E−02
PTBP2	−1.13	7.27E−04	−5.25E−01	9.03E−02	7.90E−04	−0.85	3.53E−02
APLF	0.37	1.63E−01	−1.33E+00	4.54E−04	8.08E−04	−0.27	3.56E−02
ANXA3	0.60	7.99E−02	−1.14E+00	8.46E−04	8.23E−04	−1.13	3.61E−02
TNFRSF4	−0.45	1.63E−04	−1.20E−16	1.00E+00	8.20E−04	−0.45	3.61E−02
MXD4	3.36	9.34E−03	1.96E+00	6.44E−03	8.34E−04	0.29	3.64E−02
ARHGDIB	−0.32	1.68E−04	−1.20E−16	1.00E+00	8.41E−04	−0.32	3.66E−02
HIST1H1E	0.70	3.16E−03	8.23E−01	1.97E−02	8.46E−04	1.45	3.67E−02
DCTN4	0.65	5.94E−04	1.88E+00	1.26E−01	8.54E−04	0.73	3.68E−02
KIF3A	−0.48	3.43E−02	−1.13E+00	1.90E−03	8.56E−04	−1.23	3.68E−02
GPM6B	−0.78	3.29E−02	−9.69E−01	1.97E−03	8.57E−04	−1.67	3.68E−02
DUSP3	0.69	3.01E−02	1.02E+00	2.16E−03	8.64E−04	1.27	3.69E−02
RPL9	−0.18	1.73E−04	−1.20E−16	1.00E+00	8.67E−04	−0.18	3.70E−02
SEMA7A	0.59	1.32E−01	1.12E+00	5.84E−04	8.71E−04	1.19	3.70E−02
INPP4B	−0.16	5.50E−01	−1.67E+00	2.14E−04	8.86E−04	−1.02	3.75E−02
GNAI2	0.56	2.24E−04	−5.96E−01	5.22E−01	8.99E−04	0.53	3.79E−02
TRIM25	−0.37	5.86E−02	−2.23E+00	1.26E−03	9.21E−04	−0.70	3.87E−02
PRG4	0.53	1.59E−01	−1.44E+00	5.39E−04	9.31E−04	−0.18	3.91E−02
H1F0	0.97	9.21E−04	5.78E−01	8.52E−02	9.38E−04	1.19	3.92E−02
PKNOX1	−0.68	4.56E−02	9.93E−01	1.63E−03	9.50E−04	0.58	3.95E−02
TRIP10	−0.86	2.25E−04	1.95E−01	5.78E−01	9.51E−04	−0.37	3.95E−02
RNF10	0.82	2.43E−04	3.56E−01	5.38E−01	9.84E−04	0.88	3.99E−02
HMGB1	−0.45	1.98E−04	−1.20E−16	1.00E+00	9.85E−04	−0.45	3.99E−02
LMNA	0.52	1.63E−01	1.13E+00	5.57E−04	9.80E−04	1.75	3.99E−02
SOAT2	−0.63	2.91E−02	−1.26E+00	2.56E−03	9.80E−04	−0.94	3.99E−02
HMGN2	−0.73	2.35E−03	−1.27E+00	3.17E−02	9.72E−04	−0.99	3.99E−02
GM20939	−0.57	2.07E−02	−1.52E+00	3.51E−03	9.70E−04	−0.93	3.99E−02
MAX	0.69	2.32E−04	−3.12E−01	5.79E−01	9.79E−04	0.56	3.99E−02
CEBPD	2.35	2.74E−02	1.87E+00	2.68E−03	9.68E−04	0.34	3.99E−02
ARHGAP18	−0.33	1.43E−01	−1.14E+00	6.32E−04	9.93E−04	−1.36	4.01E−02
THY1	0.58	2.06E−04	−1.20E−16	1.00E+00	1.02E−03	0.57	4.10E−02
CNN3	0.31	3.79E−02	2.85E+00	2.12E−03	1.03E−03	0.87	4.14E−02
CPNE8	−0.36	4.91E−02	−1.29E+00	1.68E−03	1.04E−03	−0.96	4.16E−02
HMGCR	−0.83	2.38E−04	−3.12E−01	6.48E−01	1.05E−03	−0.86	4.18E−02
ETS1	−0.74	2.13E−04	−1.20E−16	1.00E+00	1.05E−03	−0.74	4.18E−02
MRPL23	−0.50	4.25E−04	1.07E+00	2.54E−01	1.05E−03	−0.42	4.18E−02
TEFM	−1.01	5.57E−04	−4.25E−01	1.83E−01	1.06E−03	−0.79	4.21E−02
RPLP1	−0.19	2.20E−04	−1.20E−16	1.00E+00	1.08E−03	−0.19	4.27E−02
WASF2	0.52	2.22E−04	−1.20E−16	1.00E+00	1.09E−03	0.52	4.29E−02
NME2	0.34	2.70E−04	9.82E−01	5.46E−01	1.10E−03	0.36	4.30E−02
UBXN2A	1.06	2.55E−04	1.70E−01	6.21E−01	1.10E−03	0.87	4.30E−02
MYO10	0.62	7.30E−03	1.14E+00	1.19E−02	1.15E−03	0.93	4.49E−02
GNPDA2	0.68	4.91E−03	8.88E−01	1.79E−02	1.16E−03	1.50	4.49E−02
PHF2	0.35	7.46E−02	−1.01E+00	1.30E−03	1.16E−03	−0.22	4.49E−02
KDSR	1.07	2.77E−04	−2.18E−01	5.99E−01	1.17E−03	0.77	4.50E−02
RFX3	1.39	2.26E−02	−1.18E+00	3.96E−03	1.17E−03	−0.10	4.50E−02
ILTIFB		1.00E+00	2.89E+00	1.17E−03	1.17E−03		4.50E−02
PNO1	0.60	3.60E−03	1.59E+00	2.54E−02	1.18E−03	1.13	4.53E−02
TIAL1	−0.40	1.33E−01	−1.10E+00	8.10E−04	1.19E−03	−0.82	4.53E−02
MYC	0.79	3.07E−04	−3.76E−01	5.24E−01	1.21E−03	0.61	4.61E−02
RNF214	−0.85	2.53E−04	4.19E−02	9.24E−01	1.23E−03	−0.53	4.66E−02
SLC25A33	1.62	7.18E−04	5.45E−01	1.66E−01	1.26E−03	0.55	4.75E−02
DCLK1	0.71	1.81E−02	9.19E−01	5.40E−03	1.28E−03	1.08	4.82E−02
FUNDC2	−0.46	3.04E−02	−1.03E+00	3.31E−03	1.29E−03	−1.13	4.83E−02
FAU	−0.19	2.68E−04	−1.20E−16	1.00E+00	1.31E−03	−0.19	4.89E−02
RAB24	−0.09	7.96E−01	1.21E+00	2.79E−04	1.31E−03	1.01	4.89E−02
DGAT2	0.90	4.85E−01	−2.43E+00	3.50E−04	1.32E−03	−0.41	4.90E−02
UBE2D3	0.36	5.33E−04	1.43E+00	2.68E−01	1.34E−03	0.40	4.99E−02
SRSF11	0.59	5.36E−04	1.43E+00	2.68E−01	1.35E−03	0.63	5.00E−02
SYVN1	0.62	5.18E−03	9.73E−01	2.04E−02	1.37E−03	0.98	5.04E−02
H2-T22	−0.61	2.81E−04	−1.20E−16	1.00E+00	1.36E−03	−0.61	5.04E−02
IL18BP	−1.87	3.37E−04	−2.30E−01	5.69E−01	1.38E−03	−0.45	5.05E−02
IFT46	0.93	8.85E−04	5.26E−01	1.47E−01	1.39E−03	1.04	5.08E−02
ADAM10	−0.64	1.99E−03	−9.08E−01	5.96E−02	1.43E−03	−0.97	5.21E−02
SLC43A1	1.42	2.36E−01	−2.36E+00	6.39E−04	1.45E−03	−0.32	5.30E−02
DDB2	−1.01	4.65E−03	−7.13E−01	2.48E−02	1.47E−03	−1.26	5.34E−02
H2-Q9	−0.71	2.65E−02	−9.25E−01	4.49E−03	1.50E−03	−1.68	5.44E−02
SSBP4	0.67	1.01E−02	8.65E−01	1.17E−02	1.52E−03	1.36	5.50E−02
ULBP1	0.16	7.02E−01	1.27E+00	3.48E−04	1.55E−03	1.14	5.56E−02
MICU2	0.83	7.01E−04	4.76E−01	2.27E−01	1.55E−03	1.10	5.56E−02
GFPT2	0.57	1.79E−01	1.23E+00	8.55E−04	1.56E−03	0.92	5.60E−02
ROGDI	0.19	6.48E−01	−1.19E+00	3.65E−04	1.57E−03	−1.12	5.62E−02
HIST2H3B	1.06	5.77E−04	3.80E−01	3.05E−01	1.58E−03	0.62	5.62E−02
IRGM1	−0.48	7.39E−02	−1.47E+00	1.86E−03	1.60E−03	−1.20	5.64E−02
GLTSCR2	−0.29	3.34E−04	−1.20E−16	1.00E+00	1.61E−03	−0.29	5.64E−02
CCR8	−0.78	6.94E−03	−8.18E−01	1.81E−02	1.60E−03	−1.57	5.64E−02
IL16	−0.60	2.13E−02	−9.43E−01	5.94E−03	1.61E−03	−1.27	5.64E−02
APOPT1	−0.81	1.00E−03	−6.98E−01	1.52E−01	1.60E−03	−1.07	5.64E−02
FLOT1	0.58	4.20E−03	1.32E+00	3.10E−02	1.62E−03	1.13	5.65E−02
ESYT1	0.57	3.98E−03	1.47E+00	3.26E−02	1.61E−03	0.95	5.65E−02
ATP6V1H	−0.50	3.31E−02	−9.79E−01	3.94E−03	1.62E−03	−1.50	5.65E−02
SEMA4F	0.53	9.72E−02	1.05E+00	1.50E−03	1.64E−03	1.52	5.69E−02
TMEM50A	0.38	3.42E−04	−1.20E−16	1.00E+00	1.64E−03	0.38	5.69E−02
AUP1	−0.41	3.45E−04	−1.20E−16	1.00E+00	1.65E−03	−0.41	5.72E−02
ADAM28	0.41	4.34E−03	6.73E−01	3.13E−02	1.68E−03	0.34	5.80E−02

TABLE 1B
Th1 KO GFP+ vs GFP−
Gene	coefC	pvalC	coefD	pvalD	pvalH	logFC	FDR
IL23R	1.17	1.84E−02	3.63E+00	3.38E−20	2.45E−20	3.97	3.17E−16
EGFP_IRES_IL23R	0.75	2.22E−01	2.77E+00	5.60E−13	2.44E−12	3.48	1.58E−08
GZMB	−1.78	1.06E−03	−1.69E+00	1.27E−06	3.77E−08	−3.93	1.50E−04
CHCHD10	−1.17	1.68E−08	−1.31E+00	1.64E−01	4.64E−08	−1.33	1.50E−04
ARPC3	0.96	1.19E−07	1.73E+00	2.91E−02	7.56E−08	1.32	1.96E−04
TPT1	−0.51	2.53E−08	−3.03E−17	1.00E+00	1.82E−07	−0.51	3.94E−04
TIMP1	0.80	1.14E−01	1.86E+00	1.08E−07	2.13E−07	3.64	3.94E−04
FAM162A	0.93	1.25E−07	1.04E+00	4.91E−01	6.77E−07	0.95	1.10E−03
SMOX	1.10	7.85E−06	2.52E+00	1.22E−02	1.99E−06	1.37	2.87E−03
GM8096		1.00E+00	−3.73E+00	3.81E−06	3.81E−06		4.49E−03
ANP32B	−1.04	8.44E−06	−1.55E+00	2.26E−02	3.67E−06	−1.17	4.49E−03
S100A10	0.73	9.67E−07	−3.03E−17	1.00E+00	6.17E−06	0.73	6.66E−03
PHF11C	−1.84	9.44E−05	−1.16E+00	3.84E−03	7.49E−06	−1.16	7.42E−03
IRF7	−0.62	4.18E−02	−1.51E+00	1.10E−05	8.01E−06	−2.17	7.42E−03
SPHK1	−1.19	2.91E−01	2.67E+00	2.71E−06	9.50E−06	1.22	8.06E−03
TNC	−0.49	5.40E−02	1.66E+00	1.10E−05	9.94E−06	0.29	8.06E−03
RPS6KC1	−1.07	6.49E−02	1.69E+00	1.06E−05	1.12E−05	0.97	8.52E−03
PRDX2	0.65	2.69E−06	−3.03E−17	1.00E+00	1.65E−05	0.65	9.37E−03
TNFRSF8	0.75	2.12E−02	1.60E+00	4.38E−05	1.66E−05	1.92	9.37E−03
EBF1	0.34	3.16E−01	1.66E+00	4.39E−06	1.60E−05	1.57	9.37E−03
BHLHE40	0.99	4.08E−06	1.45E+00	3.30E−01	1.53E−05	1.02	9.37E−03
ATP6V0D2	1.48	2.44E−03	1.24E+00	3.18E−04	1.55E−05	2.42	9.37E−03
H2−Q10	0.99	9.72E−03	1.53E+00	8.35E−05	1.54E−05	2.35	9.37E−03
INSL5	3.64	3.57E−03	2.52E+00	2.57E−04	1.80E−05	0.92	9.72E−03
IFITM2	0.84	2.15E−05	1.48E+00	7.92E−02	2.58E−05	1.12	1.34E−02
SERPINF1	1.36	3.38E−05	8.46E−01	7.16E−02	3.65E−05	1.79	1.82E−02
S1PR1	1.10	9.87E−05	1.25E+00	2.36E−02	3.93E−05	1.44	1.82E−02
P4HA2	1.14	3.09E−03	1.18E+00	7.20E−04	4.12E−05	1.96	1.82E−02
ASS1	−0.95	1.11E−04	−1.05E+00	2.02E−02	3.84E−05	−1.61	1.82E−02
AP1B1	0.39	1.56E−01	2.70E+00	2.05E−05	4.21E−05	1.19	1.82E−02
PDCD1	0.63	6.70E−02	1.52E+00	4.38E−05	4.41E−05	2.17	1.82E−02
RPSA	−0.31	7.66E−06	−3.03E−17	1.00E+00	4.49E−05	−0.31	1.82E−02
AW554918	−2.25	1.02E−05	8.16E−02	8.82E−01	5.86E−05	−0.37	2.23E−02
KCTD11	0.08	9.12E−01	1.84E+00	1.01E−05	5.79E−05	1.24	2.23E−02
MGARP	0.44	9.71E−02	1.70E+00	4.97E−05	6.73E−05	2.03	2.42E−02
AHNAK	1.34	2.86E−05	1.21E+00	1.86E−01	6.58E−05	1.40	2.42E−02
ITFG2	−1.36	1.07E−04	−7.36E−01	4.28E−02	7.06E−05	−0.97	2.47E−02
SLC7A14	−0.44	1.89E−04	−1.90E+00	2.43E−02	7.44E−05	−0.48	2.54E−02
CD200	1.05	4.03E−04	2.51E+00	1.13E−02	7.74E−05	1.24	2.57E−02
NCF4	−0.45	1.09E−01	−1.62E+00	5.74E−05	8.44E−05	−1.74	2.74E−02
GARS	−0.71	5.86E−05	−1.37E+00	1.34E−01	1.01E−04	−0.75	2.87E−02
LAMB3	−1.61	1.67E−01	−2.77E+00	5.05E−05	1.04E−04	−0.48	2.87E−02
VHL	−0.32	3.76E−01	1.44E+00	2.77E−05	1.03E−04	1.37	2.87E−02
CCDC71L	0.43	4.05E−01	1.61E+00	2.58E−05	1.01E−04	1.12	2.87E−02
ARHGEF1	−0.82	1.82E−05	3.31E−01	7.33E−01	9.67E−05	−0.75	2.87E−02
AMDHD1		1.00E+00	−3.43E+00	9.86E−05	9.86E−05		2.87E−02
LUM	1.22	5.18E−01	2.17E+00	2.18E−05	9.89E−05	1.56	2.87E−02
CCDC102A		1.00E+00	3.16E+00	1.22E−04	1.22E−04		3.24E−02
DOCK8	−1.05	4.53E−05	4.39E−01	2.46E−01	1.25E−04	−0.52	3.24E−02
RC3H1	−0.91	4.24E−04	−8.27E−01	1.81E−02	1.22E−04	−1.02	3.24E−02
HVCN1	0.52	6.37E−02	1.43E+00	1.57E−04	1.42E−04	1.88	3.60E−02
RABGAP1	1.46	5.17E−04	7.96E−01	1.98E−02	1.60E−04	1.14	3.98E−02
RORA	0.14	6.69E−01	1.46E+00	3.27E−05	1.64E−04	1.07	4.01E−02
RAC1	−1.00	1.08E−04	−1.94E+00	1.26E−01	1.72E−04	−1.03	4.05E−02
IZUMO1R	−0.89	2.76E−03	−1.02E+00	3.72E−03	1.69E−04	−1.97	4.05E−02
SPTAN1	−1.12	4.17E−05	2.41E−01	5.78E−01	1.93E−04	−0.77	4.41E−02
CD44	0.18	5.40E−01	1.82E+00	4.34E−05	1.94E−04	1.36	4.41E−02
RNH1	0.67	4.22E−05	8.23E−01	7.11E−01	2.13E−04	0.68	4.74E−02
MPHOSPH6	0.84	2.64E−04	−1.07E+00	5.88E−02	2.16E−04	0.63	4.74E−02
SAA4	0.15	4.53E−01	−1.68E+00	5.84E−05	2.34E−04	−0.20	4.97E−02
SLC15A3	0.98	2.93E−02	1.24E+00	5.32E−04	2.31E−04	2.03	4.97E−02
AZIN2	−2.18	6.54E−05	4.58E−01	3.86E−01	2.38E−04	−0.12	4.97E−02
GINM1	0.08	6.96E−01	1.81E+00	4.94E−05	2.45E−04	1.43	5.05E−02
SERPINA3F	−3.97	5.18E−04	−1.37E+00	3.34E−02	2.52E−04	−0.69	5.06E−02
MIR703	0.17	2.73E−01	−1.55E+00	8.91E−05	2.54E−04	−2.61	5.06E−02
TESC	−0.89	1.40E−03	−8.94E−01	1.27E−02	2.72E−04	−1.70	5.16E−02
IER2	−0.98	8.39E−05	−5.54E−01	3.21E−01	2.67E−04	−1.06	5.16E−02
HMGN2	−0.63	1.38E−02	−1.49E+00	1.32E−03	2.79E−04	−1.08	5.16E−02
RNASEK	0.27	2.40E−01	3.28E+00	1.02E−04	2.64E−04	1.09	5.16E−02
SLC7A5	−0.93	3.83E−03	−1.08E+00	4.64E−03	2.78E−04	−1.24	5.16E−02
PGAM1	0.66	5.65E−05	5.86E−01	8.08E−01	2.92E−04	0.67	5.19E−02
MTF2	−0.31	3.26E−01	−1.57E+00	9.07E−05	2.91E−04	−1.24	5.19E−02
YKT6	−0.73	1.43E−03	1.07E+00	1.32E−02	2.87E−04	−0.06	5.19E−02
INPP5B	0.94	8.05E−05	4.90E−01	4.27E−01	3.07E−04	1.03	5.29E−02
ARF6	−0.95	2.72E−04	−8.36E−01	8.95E−02	3.13E−04	−1.05	5.29E−02
CDT1	−0.93	5.72E−04	−8.47E−01	3.73E−02	3.03E−04	−1.52	5.29E−02
TRIM24	−1.17	3.45E−03	−9.70E−01	5.92E−03	3.14E−04	−0.96	5.29E−02
CAMK2B		1.00E+00	3.62E+00	3.37E−04	3.37E−04		5.60E−02
ZC3H12C	−1.13	1.68E−01	2.20E+00	1.77E−04	3.42E−04	0.41	5.61E−02
GABARAPL1	0.41	9.16E−02	3.08E+00	3.13E−04	3.64E−04	0.99	5.77E−02
BNIP3	0.32	2.23E−01	2.05E+00	1.48E−04	3.57E−04	1.66	5.77E−02
TMBIM4	0.06	7.87E−01	3.26E+00	7.20E−05	3.65E−04	1.01	5.77E−02
ETV5	0.23	5.98E−01	1.39E+00	8.49E−05	3.85E−04	1.61	6.01E−02
SERF1	0.86	4.65E−04	6.83E−01	6.59E−02	4.03E−04	1.39	6.07E−02
TRAF3IP3	−0.43	9.12E−02	−2.00E+00	3.47E−04	3.99E−04	−1.18	6.07E−02
KHDRBS1	−0.88	2.32E−04	−7.20E−01	1.46E−01	3.96E−04	−1.01	6.07E−02
GDF3		1.00E+00	−3.20E+00	4.08E−04	4.08E−04		6.08E−02
SLC13A3	0.92	3.81E−01	1.99E+00	1.19E−04	4.16E−04	0.78	6.13E−02
ISG20	−0.74	1.06E−01	−1.37E+00	3.31E−04	4.30E−04	−1.74	6.27E−02
PHPT1	−0.18	5.04E−01	−1.62E+00	1.09E−04	4.47E−04	−1.42	6.43E−02
SLC17A9	0.77	8.71E−03	1.48E+00	3.63E−03	4.66E−04	1.29	6.64E−02
MT1	0.89	3.74E−04	1.16E+00	1.04E−01	4.77E−04	1.12	6.72E−02
SYNGAP1	−0.49	3.12E−01	1.46E+00	1.60E−04	4.83E−04	0.48	6.74E−02
CSNK1G2	−0.99	4.37E−04	5.87E−01	9.77E−02	5.24E−04	−0.11	7.15E−02
PRMT5	−0.83	1.02E−03	−9.03E−01	3.76E−02	5.24E−04	−1.18	7.15E−02
SOX5	0.67	3.12E−02	1.11E+00	1.24E−03	5.35E−04	1.10	7.22E−02
CYBRD1	−0.24	3.12E−02	−1.24E+00	1.36E−03	5.81E−04	−0.35	7.68E−02
CALM2	0.52	1.45E−04	1.10E+00	4.89E−01	5.78E−04	0.54	7.68E−02
TMEM265	0.09	8.93E−01	1.77E+00	1.18E−04	5.99E−04	0.82	7.69E−02
GRINA	−0.82	1.71E−04	−4.37E−01	3.90E−01	5.92E−04	−0.94	7.69E−02
NUDCD1	1.23	4.20E−04	−5.67E−01	1.21E−01	5.97E−04	0.53	7.69E−02
PKIB	0.32	5.35E−01	1.58E+00	1.55E−04	6.46E−04	0.92	8.21E−02
ITGB7	−0.66	9.97E−03	−1.55E+00	4.82E−03	6.80E−04	−1.27	8.45E−02
EDA2R		1.00E+00	3.08E+00	6.74E−04	6.74E−04		8.45E−02
SLFN1	−0.27	3.60E−01	−1.59E+00	2.10E−04	6.85E−04	−1.41	8.45E−02
USP20	−1.25	1.89E−03	8.15E−01	2.71E−02	6.95E−04	0.33	8.46E−02
PERP	0.75	1.25E−02	1.09E+00	4.00E−03	7.05E−04	1.81	8.46E−02
SLC4A7	0.97	7.26E−04	8.29E−01	7.90E−02	7.08E−04	1.19	8.46E−02
MYLK	0.61	4.30E−01	1.70E+00	1.96E−04	7.11E−04	0.58	8.46E−02
GABARAP	0.62	1.44E−04	5.59E−01	8.83E−01	7.20E−04	0.62	8.48E−02
PADI2	−0.20	4.73E−01	−1.53E+00	1.93E−04	7.41E−04	−0.62	8.65E−02
CD74	1.23	3.42E−03	8.19E−01	1.60E−02	7.60E−04	1.64	8.80E−02
ZFP420		1.00E+00	−3.16E+00	7.87E−04	7.87E−04		8.95E−02
AKR1B8	0.31	2.95E−01	1.28E+00	2.78E−04	7.81E−04	1.89	8.95E−02
RPL30	−0.30	1.59E−04	−3.03E−17	1.00E+00	8.01E−04	−0.30	9.03E−02
SHMT2	−0.78	3.82E−03	−1.31E+00	1.61E−02	8.44E−04	−0.97	9.37E−02
RAD23B	−0.61	2.03E−03	−9.57E−01	3.29E−02	8.80E−04	−0.80	9.37E−02
NOL7	−0.70	5.69E−04	−9.39E−01	1.39E−01	8.81E−04	−0.81	9.37E−02
JAK2	−0.89	3.74E−03	8.62E−01	1.68E−02	8.60E−04	0.04	9.37E−02
CHD7	−0.77	1.74E−04	4.52E−02	1.00E+00	8.79E−04	−0.76	9.37E−02
AKNA	−0.73	6.84E−04	−1.18E+00	1.07E−01	8.53E−04	−0.83	9.37E−02
MMP11	1.03	3.94E−01	−2.32E+00	2.57E−04	8.72E−04	−0.45	9.37E−02
LAMP1	−1.10	2.19E−04	−2.71E−01	5.41E−01	8.98E−04	−1.12	9.39E−02
TRIB3	−1.58	1.90E−03	−7.58E−01	3.61E−02	8.94E−04	−1.43	9.39E−02
SGK1	2.86	3.53E−02	−1.63E+00	2.06E−03	9.45E−04	−0.30	9.73E−02
SPIRE1	0.38	4.69E−01	1.47E+00	2.50E−04	9.41E−04	0.92	9.73E−02
CLEC2I	−1.41	1.96E−04	7.37E−02	8.33E−01	9.54E−04	−0.69	9.74E−02
ZFP109	0.12	9.13E−01	−2.22E+00	2.00E−04	9.86E−04	−0.56	9.91E−02
MARK4	−1.43	4.30E−04	4.72E−01	2.28E−01	9.82E−04	−0.07	9.91E−02

TABLE 1C
Th1 Combined Model
Gene	coefC	pvalC	coefD	pvalD	pvalH	logFC	FDR
RPS2	1.32	4.71E−18	2.12E−16	1.00E+00	5.17E−17	1.32	3.66E−14
ANP32B	2.23	1.17E−14	−4.90E−01	6.02E−01	1.00E−13	2.13	3.54E−11
1110008F13RIK	2.33	3.24E−09	1.51E+00	4.38E−04	5.09E−11	3.23	1.20E−08
RNF187	2.11	2.26E−09	2.21E+00	4.97E−03	3.37E−10	2.69	5.96E−08
H2-T23	−1.06	5.68E−11	2.12E−16	1.00E+00	4.77E−10	−1.06	6.74E−08
LSM4	1.53	1.33E−10	1.47E+00	2.88E−01	6.26E−10	1.59	7.37E−08
LAMP1	2.08	4.71E−09	1.06E+00	6.44E−02	6.42E−09	2.38	6.48E−07
LARS2	0.83	9.96E−10	2.12E−16	1.00E+00	7.82E−09	0.83	6.91E−07
RAC1	1.85	4.53E−09	1.91E+00	1.30E−01	1.09E−08	1.88	6.99E−07
IER2	1.72	1.72E−08	1.58E+00	2.61E−02	1.05E−08	2.19	6.99E−07
TESC	1.81	4.78E−06	1.75E+00	6.04E−05	9.17E−09	2.96	6.99E−07
PELI1	1.83	1.25E−07	2.10E+00	5.89E−03	1.92E−08	2.22	1.13E−06
VAPA	1.66	1.43E−08	1.79E+00	1.61E−01	3.91E−08	1.78	2.13E−06
RBMS1	1.18	9.16E−04	2.46E+00	5.99E−06	1.46E−07	2.64	6.44E−06
RN7S1	0.57	3.98E−02	2.26E+00	1.71E−07	1.40E−07	2.08	6.44E−06
RN7S2	0.57	3.98E−02	2.26E+00	1.71E−07	1.40E−07	2.08	6.44E−06
EIF3F	0.98	3.35E−08	2.12E−16	1.00E+00	2.39E−07	0.98	9.94E−06
PPP4C	1.29	6.66E−07	2.10E+00	7.73E−02	9.05E−07	1.47	3.55E−05
LRP10	1.09	6.44E−04	3.07E+00	8.61E−05	1.33E−06	1.82	4.94E−05
TMEM30A	1.11	1.06E−04	3.43E+00	7.12E−04	1.78E−06	1.55	5.76E−05
NOL7	1.42	5.48E−07	1.08E+00	2.14E−01	1.65E−06	1.52	5.76E−05
CLASP2	1.88	1.33E−06	1.48E+00	7.94E−02	1.79E−06	2.00	5.76E−05
TMEM160	1.36	1.86E−05	1.45E+00	5.29E−03	2.14E−06	2.12	6.58E−05
2310036022RIK	1.66	9.17E−06	1.06E+00	1.19E−02	2.25E−06	2.09	6.63E−05
FAM49B	1.22	6.37E−07	5.76E−01	4.62E−01	3.15E−06	1.25	8.90E−05
ARF6	1.60	1.04E−06	7.63E−01	2.44E−01	3.37E−06	1.63	9.17E−05
UCK2	1.47	2.84E−06	1.59E+00	7.81E−02	3.68E−06	1.69	9.63E−05
KHDRBS1	1.31	3.06E−06	1.16E+00	7.71E−02	3.91E−06	1.59	9.87E−05
TMEM161B	−2.04	1.88E−05	−1.11E+00	1.46E−02	5.38E−06	−0.98	1.31E−04
NUBP1	1.36	2.51E−06	7.50E−01	1.55E−01	5.61E−06	1.70	1.32E−04
UTP18	2.04	2.58E−06	5.60E−01	2.04E−01	7.07E−06	1.84	1.61E−04
ESYT1	1.12	5.72E−06	1.44E+00	1.25E−01	1.05E−05	1.32	2.31E−04
ENSA	−1.29	2.71E−04	−1.59E+00	1.98E−03	1.10E−05	−1.88	2.31E−04
STX6	1.27	3.60E−04	1.78E+00	1.50E−03	1.11E−05	2.12	2.31E−04
RALA	0.68	6.00E−03	2.51E+00	1.16E−04	1.37E−05	1.68	2.76E−04
PRKCH	1.27	1.09E−05	1.18E+00	9.69E−02	1.59E−05	1.61	3.12E−04
CBX3	−0.76	2.96E−06	2.12E−16	1.00E+00	1.81E−05	−0.76	3.46E−04
NDFIP2	0.01	9.72E−01	1.98E+00	4.48E−06	2.69E−05	2.05	5.00E−04
PANX1	0.81	4.76E−02	1.74E+00	3.85E−05	2.94E−05	2.42	5.26E−04
PRRC2A	0.88	5.23E−06	7.78E−01	7.56E−01	2.97E−05	0.88	5.26E−04
PHF20L1	0.91	8.52E−03	1.73E+00	2.15E−04	3.33E−05	1.52	5.75E−04
ACBD6	0.93	8.77E−04	1.72E+00	2.18E−03	3.60E−05	2.16	6.05E−04
RBM42	1.20	2.54E−05	1.47E+00	1.07E−01	3.85E−05	1.41	6.34E−04
ITSN2	1.76	6.90E−06	6.62E−02	8.74E−01	4.01E−05	1.41	6.45E−04
EIF4A2	−0.85	2.00E−05	−2.05E+00	1.61E−01	4.20E−05	−0.97	6.59E−04
OPTN	2.39	1.15E−04	1.19E+00	2.29E−02	4.43E−05	1.31	6.81E−04
RBM17	1.01	1.47E−05	1.50E+00	2.76E−01	4.63E−05	1.02	6.96E−04
OST4	−1.17	1.64E−05	−1.21E+00	2.75E−01	5.11E−05	−1.30	7.53E−04
NOP9	0.55	8.29E−02	2.08E+00	5.06E−05	6.03E−05	2.00	8.53E−04
UBA5	2.14	2.02E−05	4.70E−01	2.58E−01	5.98E−05	1.37	8.53E−04
CLPTM1	1.25	2.83E−04	1.24E+00	1.31E−02	6.33E−05	1.80	8.77E−04
GPSM2	2.50	2.30E−04	1.40E+00	1.75E−02	6.72E−05	1.37	9.13E−04
BLOC1S4	1.02	5.50E−02	1.78E+00	8.84E−05	7.29E−05	2.13	9.58E−04
RPL10A	−0.33	1.37E−05	2.12E−16	1.00E+00	7.82E−05	−0.33	9.58E−04
WDR70	1.95	4.88E−05	6.94E−01	1.11E−01	7.34E−05	1.79	9.58E−04
RPL9	−0.29	1.38E−05	2.12E−16	1.00E+00	7.86E−05	−0.29	9.58E−04
THY1	0.93	1.43E−05	7.57E−01	7.48E−01	7.77E−05	0.95	9.58E−04
PGS1	1.29	3.68E−05	9.61E−01	1.67E−01	7.70E−05	1.52	9.58E−04
D030056L22RIK	1.71	1.75E−02	1.75E+00	2.87E−04	8.29E−05	2.06	9.77E−04
CFL1	0.38	1.45E−05	2.00E−01	1.00E+00	8.25E−05	0.38	9.77E−04
AMDHD1		1.00E+00	3.44E+00	8.76E−05	8.76E−05		1.01E−03
DUSP2	1.36	3.83E−03	1.57E+00	1.56E−03	1.02E−04	2.46	1.17E−03
ZFAND5	1.23	8.17E−04	1.12E+00	9.07E−03	1.23E−04	1.43	1.36E−03
POLR2M	1.08	3.84E−05	8.14E−01	3.03E−01	1.23E−04	1.26	1.36E−03
ZFP78	−5.85	5.20E−05	−1.19E+00	2.07E−01	1.26E−04	−0.24	1.37E−03
RPL39	−0.31	2.47E−05	2.12E−16	1.00E+00	1.37E−04	−0.31	1.47E−03
ANKRD49	1.15	5.68E−04	−1.02E+00	1.85E−02	1.64E−04	−0.40	1.73E−03
LRP12	−2.63	3.38E−05	1.45E−01	7.80E−01	1.78E−04	−0.17	1.85E−03
TSEN34	0.98	1.74E−02	1.42E+00	6.80E−04	1.85E−04	2.09	1.86E−03
ZBTB38	1.35	6.47E−03	1.38E+00	1.74E−03	1.82E−04	1.90	1.86E−03
ATXN2L	1.05	6.53E−05	1.10E+00	2.81E−01	1.93E−04	1.10	1.90E−03
TPR	0.93	3.75E−05	4.02E−01	7.25E−01	1.92E−04	0.95	1.90E−03
MGAT2	0.97	9.70E−03	1.50E+00	1.28E−03	1.97E−04	2.07	1.91E−03
CD3E	0.91	3.71E−05	3.72E−02	1.00E+00	2.02E−04	0.91	1.93E−03
MAP3K1	−1.02	1.17E−04	−1.20E+00	1.51E−01	2.13E−04	−1.12	2.01E−03
TMEM55B	1.59	6.60E−04	9.73E−01	2.38E−02	2.36E−04	1.45	2.04E−03
NOMO1	1.01	1.25E−03	1.55E+00	1.24E−02	2.41E−04	1.59	2.04E−03
RPS6KC1	0.76	2.02E−01	−1.74E+00	9.89E−05	2.27E−04	−0.99	2.04E−03
FAHD2A	−1.11	1.15E−02	−1.40E+00	1.36E−03	2.43E−04	−2.02	2.04E−03
SERBP1	0.49	4.06E−05	2.12E−16	1.00E+00	2.20E−04	0.49	2.04E−03
CYB5R4	1.21	4.50E−03	1.22E+00	3.36E−03	2.40E−04	1.86	2.04E−03
SCAND1	0.49	1.66E−01	1.66E+00	1.19E−04	2.32E−04	1.83	2.04E−03
EIF4B	−0.69	4.52E−05	3.61E−01	8.89E−01	2.42E−04	−0.68	2.04E−03
EMC7	0.51	5.74E−03	2.99E+00	2.65E−03	2.41E−04	1.09	2.04E−03
SIRT1	−2.52	6.79E−05	4.37E−01	4.03E−01	2.52E−04	−0.18	2.10E−03
DUS2	1.61	3.53E−04	8.10E−01	5.31E−02	2.61E−04	1.72	2.14E−03
UBE2D3	0.57	5.48E−05	6.10E−01	7.65E−01	2.80E−04	0.57	2.23E−03
STYX	0.82	1.81E−02	1.52E+00	1.01E−03	2.76E−04	1.42	2.23E−03
SDHD	−0.90	5.29E−05	−9.17E−02	9.04E−01	2.81E−04	−0.90	2.23E−03
YKT6	1.05	3.87E−04	−1.05E+00	6.13E−02	3.20E−04	0.48	2.51E−03
GM5111		1.00E+00	2.97E+00	3.54E−04	3.54E−04		2.75E−03
EIF3J1	1.47	1.06E−04	5.25E−01	3.74E−01	3.68E−04	1.54	2.83E−03
E130309D02RIK	1.48	3.46E−04	7.31E−01	8.77E−02	3.86E−04	1.55	2.87E−03
EMC10	0.53	1.17E−01	1.61E+00	2.65E−04	3.79E−04	1.76	2.87E−03
RPS26	−0.26	7.32E−05	2.12E−16	1.00E+00	3.85E−04	−0.26	2.87E−03
CAMK2D	0.95	1.68E−02	1.45E+00	1.65E−03	4.07E−04	1.55	2.97E−03
ITGB1	0.59	1.08E−01	1.84E+00	3.08E−04	4.08E−04	1.57	2.97E−03
ZFP622	1.51	1.77E−04	5.07E−01	2.26E−01	4.25E−04	1.30	3.05E−03
MAPK1	0.97	3.38E−03	1.59E+00	8.51E−03	4.27E−04	1.56	3.05E−03
RFNG	0.47	2.04E−01	1.60E+00	1.94E−04	4.31E−04	1.94	3.05E−03
NPTN	−1.37	3.67E−04	−8.01E−01	9.73E−02	4.43E−04	−1.37	3.10E−03
RPL7A	−0.28	8.68E−05	2.12E−16	1.00E+00	4.52E−04	−0.28	3.13E−03
LYSMD2	1.10	3.47E−03	1.07E+00	9.46E−03	4.82E−04	1.86	3.31E−03
VPS37A	0.90	1.41E−02	1.43E+00	2.70E−03	5.47E−04	1.58	3.67E−03
SLC30A9	1.02	2.92E−02	1.41E+00	1.36E−03	5.51E−04	1.86	3.67E−03
RPS21	−0.35	1.06E−04	2.12E−16	1.00E+00	5.44E−04	−0.35	3.67E−03
POLE4	0.86	8.45E−04	1.60E+00	5.20E−02	5.77E−04	1.09	3.81E−03
IQGAP1	0.95	1.40E−04	−7.52E−01	5.66E−01	6.03E−04	0.93	3.95E−03
MTRF1L	0.61	2.51E−01	1.69E+00	2.40E−04	6.09E−04	1.55	3.95E−03
HDAC9	−4.55	1.23E−04	7.41E−02	1.00E+00	6.31E−04	−0.26	4.05E−03
RPL36A	−0.33	1.29E−04	2.12E−16	1.00E+00	6.55E−04	−0.33	4.17E−03
ANKLE2	1.22	1.88E−03	1.07E+00	2.56E−02	6.61E−04	1.49	4.17E−03
ABHD12	0.16	7.30E−01	1.66E+00	1.42E−04	6.79E−04	1.86	4.24E−03
UBQLN1	0.86	1.16E−02	1.61E+00	4.19E−03	6.83E−04	1.58	4.24E−03
SACS	0.34	6.27E−01	1.91E+00	1.54E−04	6.90E−04	1.06	4.24E−03
YIPF4	0.87	5.63E−04	1.47E+00	1.12E−01	7.41E−04	1.03	4.26E−03
ANXA2	0.77	1.43E−04	4.12E−01	8.60E−01	7.11E−04	0.77	4.26E−03
A530064D06RIK	0.43	2.35E−02	1.47E+00	2.25E−03	7.22E−04	0.38	4.26E−03
ARPC1B	0.43	1.44E−04	2.12E−16	1.00E+00	7.27E−04	0.43	4.26E−03
IFT57	0.97	2.20E−02	1.28E+00	2.44E−03	7.35E−04	1.65	4.26E−03
GTF2H5	0.88	2.01E−04	−6.71E−01	4.17E−01	7.17E−04	0.75	4.26E−03
ATP2B1	1.19	1.44E−04	1.52E−01	7.97E−01	7.06E−04	1.08	4.26E−03
HIST2H2AC	1.63	1.81E−02	1.78E+00	2.94E−03	7.33E−04	1.24	4.26E−03
EEF1A1	−0.30	1.51E−04	2.12E−16	1.00E+00	7.61E−04	−0.30	4.34E−03
DDAH2	2.45	2.60E−03	−1.25E+00	2.17E−02	7.69E−04	−0.21	4.35E−03
AW554918	1.86	1.63E−04	−1.42E−01	8.09E−01	7.94E−04	0.26	4.37E−03
RAB24	0.28	5.86E−01	1.65E+00	1.82E−04	7.82E−04	1.47	4.37E−03
INSL5	−4.06	6.56E−03	−1.73E+00	8.72E−03	7.98E−04	−2.52	4.37E−03
THAP11	0.64	8.01E−02	1.47E+00	8.15E−04	7.97E−04	2.06	4.37E−03
ASF1A	0.68	5.82E−02	1.40E+00	1.15E−03	8.42E−04	1.70	4.58E−03
FAM162A	−0.76	1.73E−04	1.55E−01	9.93E−01	8.65E−04	−0.76	4.63E−03
WRNIP1	1.19	3.37E−02	1.40E+00	1.95E−03	8.64E−04	1.38	4.63E−03
SRM	0.98	2.46E−03	1.37E+00	2.68E−02	8.78E−04	1.96	4.66E−03
GLIS2	4.24	9.05E−04	−1.25E+00	8.07E−02	8.84E−04	0.07	4.66E−03
TRIM27	1.19	7.85E−04	9.23E−01	9.67E−02	8.95E−04	1.47	4.69E−03
ZDHHC7	1.04	2.63E−02	1.29E+00	2.58E−03	9.04E−04	1.85	4.70E−03
CCDC85B	0.64	3.91E−02	1.59E+00	1.82E−03	9.22E−04	1.20	4.73E−03
KARS	−0.76	1.87E−04	4.95E−01	8.53E−01	9.16E−04	−0.73	4.73E−03
ARGLU1	−0.84	1.91E−04	3.61E−01	9.11E−01	9.45E−04	−0.83	4.77E−03
TNP2	−0.74	8.97E−02	−1.45E+00	8.83E−04	9.41E−04	−1.86	4.77E−03
CELF1	0.94	1.99E−04	2.75E−01	8.30E−01	9.64E−04	0.94	4.80E−03
ALDOA	−0.33	1.95E−04	2.12E−16	1.00E+00	9.71E−04	−0.33	4.80E−03
SUMF1	0.95	1.56E−01	1.59E+00	5.67E−04	9.63E−04	1.56	4.80E−03
PDCD4	−0.82	4.50E−03	−2.10E+00	1.61E−02	9.79E−04	−1.33	4.81E−03
MRPL3	0.94	9.30E−04	1.07E+00	9.20E−02	1.01E−03	1.46	4.91E−03
LIMS1	0.66	3.32E−02	1.67E+00	2.36E−03	1.02E−03	1.37	4.93E−03
MLF2	0.72	2.37E−04	−4.48E−01	6.68E−01	1.06E−03	0.64	5.11E−03
RAB33B	1.30	3.19E−04	−4.65E−01	4.41E−01	1.14E−03	0.94	5.46E−03
DBI	0.76	2.41E−04	3.96E−01	8.92E−01	1.17E−03	0.76	5.55E−03
GFER	0.78	3.95E−03	−1.76E+00	2.32E−02	1.19E−03	0.07	5.63E−03
RAP1A	0.88	2.75E−04	7.85E−01	7.26E−01	1.26E−03	0.88	5.90E−03
H1F0	1.32	1.79E−03	8.38E−01	5.89E−02	1.28E−03	1.67	5.96E−03
XDH	2.22	2.08E−02	1.70E+00	4.92E−03	1.32E−03	1.21	6.11E−03
APIP	1.51	5.49E−04	−4.87E−01	2.59E−01	1.35E−03	0.06	6.16E−03
ANKRD13A	0.61	1.41E−01	1.45E+00	8.88E−04	1.35E−03	1.63	6.16E−03
HIST1H3A	−0.73	2.46E−01	2.23E+00	5.88E−04	1.39E−03	0.78	6.28E−03
PAXBP1	−0.94	2.43E−03	−1.11E+00	5.02E−02	1.48E−03	−1.34	6.68E−03
6030458C11RIK	−1.38	3.12E−04	6.07E−02	8.95E−01	1.49E−03	−1.02	6.68E−03
FAU	−0.25	3.17E−04	2.12E−16	1.00E+00	1.53E−03	−0.25	6.79E−03
ERI1	0.58	3.08E−02	1.76E+00	3.98E−03	1.54E−03	1.12	6.79E−03
PRG4	1.02	4.05E−02	−1.57E+00	3.14E−03	1.56E−03	−0.09	6.87E−03
FZR1	0.82	1.77E−02	1.43E+00	6.97E−03	1.57E−03	1.72	6.87E−03
CHD7	0.91	3.47E−04	−2.77E−01	8.59E−01	1.64E−03	0.88	7.10E−03
JUND	0.73	7.14E−04	4.85E−01	2.45E−01	1.66E−03	0.61	7.15E−03
MIDN	1.01	7.18E−04	5.70E−01	2.48E−01	1.68E−03	1.02	7.21E−03
EXOSC6	0.61	2.57E−01	1.56E+00	7.06E−04	1.70E−03	1.50	7.22E−03
RPS15	−0.24	3.61E−04	2.12E−16	1.00E+00	1.72E−03	−0.24	7.30E−03
OCIAD1	0.51	3.81E−04	6.44E−01	7.68E−01	1.74E−03	0.52	7.31E−03
STXBP1	0.96	1.20E−01	1.56E+00	1.34E−03	1.75E−03	1.22	7.32E−03
USP39	0.88	3.80E−03	1.44E+00	3.80E−02	1.76E−03	1.27	7.32E−03
DAXX	0.45	8.40E−02	−2.44E+00	1.93E−03	1.84E−03	−0.97	7.54E−03
RABGAP1	−1.05	1.92E−02	−1.11E+00	7.63E−03	1.83E−03	−1.31	7.54E−03
GLB1L	−1.77	5.95E−03	−1.14E+00	2.60E−02	1.91E−03	−0.75	7.77E−03
HERPUD1	1.22	4.18E−04	1.40E−01	7.78E−01	1.90E−03	1.10	7.77E−03
MARC2	0.62	1.43E−02	−1.54E+00	1.15E−02	2.05E−03	−0.83	8.27E−03
RC3H1	1.10	5.92E−04	3.16E−01	4.61E−01	2.09E−03	0.83	8.38E−03
DONSON	1.03	4.12E−02	1.20E+00	4.27E−03	2.10E−03	1.75	8.39E−03
PDGFB	1.34	4.97E−04	1.88E−01	6.76E−01	2.13E−03	1.02	8.47E−03
RBPJ	−0.66	4.55E−04	9.10E−02	1.00E+00	2.14E−03	−0.66	8.47E−03
SPATA5L1	0.31	6.51E−01	1.66E+00	5.23E−04	2.20E−03	1.30	8.62E−03
CYP4F17	−1.50	6.37E−02	−1.98E+00	3.02E−03	2.21E−03	−0.41	8.62E−03
CHTF18	0.66	1.16E−01	1.66E+00	1.86E−03	2.29E−03	1.32	8.86E−03
HIST1H2AC	4.08	7.12E−04	−6.84E−01	4.01E−01	2.28E−03	0.03	8.86E−03
NSUN2	0.89	1.07E−03	8.23E−01	2.40E−01	2.38E−03	1.21	9.08E−03
MAPK6	0.61	4.22E−02	2.39E+00	4.79E−03	2.38E−03	1.02	9.08E−03
FRMD6	−1.29	5.03E−03	9.28E−01	4.17E−02	2.46E−03	−0.04	9.29E−03
ODC1	1.13	5.40E−04	1.59E−01	8.26E−01	2.45E−03	1.12	9.29E−03
CTBP1	1.09	1.38E−03	5.97E−01	1.86E−01	2.49E−03	1.34	9.38E−03
PITHD1	0.70	5.45E−02	1.37E+00	4.25E−03	2.65E−03	1.81	9.90E−03
SSBP4	0.27	4.49E−01	1.54E+00	7.88E−04	2.68E−03	1.61	9.98E−03
RFX3	1.77	2.63E−03	−9.27E−01	9.65E−02	2.72E−03	−0.02	1.00E−02
TRIM24	1.30	3.48E−03	7.69E−01	6.99E−02	2.71E−03	0.80	1.00E−02
RPS20	−0.30	5.92E−04	2.12E−16	1.00E+00	2.74E−03	−0.30	1.00E−02
TEC	−1.94	6.18E−04	1.22E−01	8.05E−01	2.76E−03	−0.28	1.01E−02
PHLDA3	0.96	4.66E−02	1.24E+00	5.55E−03	2.95E−03	2.09	1.06E−02
TRPM3	−2.12	2.73E−03	1.35E+00	1.03E−01	2.96E−03	−0.01	1.06E−02
TRAPPC6B	1.26	7.22E−04	2.31E−01	6.32E−01	2.94E−03	1.21	1.06E−02
RPL28	−0.27	6.69E−04	2.12E−16	1.00E+00	3.07E−03	−0.27	1.09E−02
1810026J23RIK	0.35	3.71E−01	1.47E+00	1.03E−03	3.06E−03	1.58	1.09E−02
GNAI2	0.73	1.13E−03	−1.28E+00	3.54E−01	3.25E−03	0.69	1.15E−02
MXD4	5.26	4.14E−03	1.78E+00	7.29E−02	3.28E−03	0.74	1.15E−02
HPS6	1.30	1.20E−03	4.22E−01	3.30E−01	3.28E−03	1.08	1.15E−02
PJA1	−1.02	7.27E−04	−1.94E−02	1.00E+00	3.32E−03	−0.82	1.16E−02
TDP2	0.52	2.81E−01	1.41E+00	1.39E−03	3.37E−03	1.84	1.17E−02
DGAT2	1.60	2.17E−01	−2.78E+00	1.79E−03	3.55E−03	−0.35	1.22E−02
TMEM102	−7.18	2.07E−03	1.64E+00	1.92E−01	3.71E−03	−0.01	1.27E−02
FBXO2	1.52	1.66E−02	1.20E+00	1.99E−02	3.78E−03	1.45	1.29E−02
GM4951	−2.97	3.17E−03	−8.57E−01	1.24E−01	3.94E−03	−0.67	1.34E−02
ASPM	1.19	2.17E−03	8.42E−01	2.00E−01	4.01E−03	0.52	1.36E−02
RPL18	−0.22	9.24E−04	2.12E−16	1.00E+00	4.14E−03	−0.22	1.39E−02
ABHD15	4.36	3.50E−03	−1.20E+00	1.24E−01	4.30E−03	0.08	1.44E−02
TUSC2	0.31	5.09E−01	1.41E+00	1.25E−03	4.41E−03	1.64	1.47E−02
ACTB	−0.36	1.00E−03	2.12E−16	1.00E+00	4.46E−03	−0.36	1.48E−02
FBXL22	−2.73	1.06E−03	1.69E−01	7.93E−01	4.54E−03	−0.31	1.50E−02
GTF2A1	−1.18	1.22E−03	2.36E−01	6.17E−01	4.72E−03	−0.75	1.54E−02
CALM1	0.45	1.28E−03	−9.16E−01	5.59E−01	4.71E−03	0.43	1.54E−02
UPF3A	0.68	1.19E−01	1.21E+00	4.08E−03	4.80E−03	1.66	1.56E−02
PIK3C2B	−0.56	3.39E−01	−1.58E+00	1.82E−03	4.91E−03	−0.62	1.59E−02
LRRFIP2	0.99	1.24E−02	8.81E−01	3.71E−02	5.01E−03	1.36	1.62E−02
TAF4	1.14	3.70E−02	−1.14E+00	1.27E−02	5.10E−03	−0.31	1.64E−02
TAF2	−0.20	6.11E−01	1.36E+00	1.35E−03	5.15E−03	0.66	1.65E−02
GGNBP2	1.00	3.18E−03	9.19E−01	1.80E−01	5.25E−03	1.26	1.67E−02
GATAD2A	0.64	2.12E−02	1.87E+00	2.36E−02	5.43E−03	1.05	1.72E−02
GM8096		1.00E+00	2.30E+00	5.49E−03	5.49E−03		1.73E−02
AKR1B3	0.57	5.83E−03	1.51E+00	9.45E−02	5.52E−03	0.82	1.74E−02
LTA	−1.13	1.61E−03	−5.70E−01	5.32E−01	5.69E−03	−1.17	1.78E−02
WDR24	0.81	2.67E−02	1.01E+00	2.07E−02	5.90E−03	1.48	1.84E−02
LAPTM4B	2.03	1.40E−03	−5.19E−02	8.89E−01	6.02E−03	0.52	1.87E−02
MARK4	1.48	2.96E−03	5.64E−01	2.43E−01	6.11E−03	0.78	1.89E−02
MICU2	0.63	3.65E−02	1.26E+00	1.60E−02	6.15E−03	1.53	1.89E−02
RPL12	−0.25	1.43E−03	2.12E−16	1.00E+00	6.18E−03	−0.25	1.89E−02
CCDC12	0.81	1.98E−03	6.55E−01	4.49E−01	6.28E−03	0.93	1.92E−02
CCR3		1.00E+00	3.05E+00	6.51E−03	6.51E−03		1.98E−02
UBXN2A	1.21	3.80E−03	5.67E−01	2.00E−01	6.66E−03	1.33	2.01E−02
CTSF	4.73	6.85E−03	−1.20E+00	1.03E−01	6.84E−03	0.16	2.06E−02
SMARCA5	0.53	1.50E−01	1.36E+00	5.66E−03	7.71E−03	1.36	2.31E−02
PLEK	−0.36	4.84E−01	1.41E+00	2.45E−03	7.95E−03	1.42	2.37E−02
GZMB	1.01	1.28E−01	1.12E+00	6.96E−03	8.21E−03	2.11	2.44E−02
NRM	−1.15	4.65E−03	−5.89E−01	2.14E−01	8.41E−03	−1.43	2.48E−02
BHLHE40	−0.73	2.03E−03	4.47E−01	8.55E−01	8.42E−03	−0.73	2.48E−02
HIST1H2AH	2.10	3.16E−02	−1.81E+00	2.65E−02	8.47E−03	−0.15	2.48E−02
GM5177	0.23	1.44E−02	−7.82E−01	6.02E−02	8.55E−03	−0.03	2.50E−02
PSMD3	0.58	2.69E−03	7.33E−01	4.98E−01	8.80E−03	0.61	2.56E−02
ARID3A	0.75	4.66E−02	9.95E−01	2.02E−02	9.30E−03	1.01	2.69E−02
MRPL11	0.55	2.12E−02	−1.14E+00	4.45E−02	9.32E−03	−0.04	2.69E−02
IL22		1.00E+00	2.80E+00	9.43E−03	9.43E−03		2.71E−02
CANX	−0.44	2.27E−03	2.12E−16	1.00E+00	9.46E−03	−0.44	2.71E−02
TMSB10	0.35	2.34E−03	2.12E−16	1.00E+00	9.76E−03	0.35	2.77E−02
RPGRIP1	−0.59	8.48E−02	−1.09E+00	1.21E−02	9.74E−03	−1.03	2.77E−02
C2CD2L	−1.15	8.56E−03	6.49E−01	1.44E−01	1.09E−02	−0.08	3.07E−02
RPS27A	−0.20	2.84E−03	2.12E−16	1.00E+00	1.16E−02	−0.20	3.28E−02
RPS10	−0.21	2.91E−03	2.12E−16	1.00E+00	1.19E−02	−0.21	3.32E−02
ZBED6	0.67	8.45E−02	−1.05E+00	1.53E−02	1.19E−02	−0.28	3.32E−02
RPL19	−0.17	2.92E−03	2.12E−16	1.00E+00	1.19E−02	−0.17	3.32E−02
GPR18	0.63	5.19E−02	1.50E+00	2.46E−02	1.21E−02	1.34	3.35E−02
GARS	0.59	5.10E−03	1.38E+00	3.25E−01	1.22E−02	0.61	3.35E−02
MAP2K2	0.56	1.37E−02	2.10E+00	9.77E−02	1.22E−02	0.70	3.35E−02
A130010J15RIK	−1.19	1.81E−02	−7.75E−01	7.36E−02	1.23E−02	−1.19	3.35E−02
RBM3	−0.36	3.02E−03	2.12E−16	1.00E+00	1.23E−02	−0.36	3.35E−02
ISCU	0.65	2.38E−02	1.22E+00	5.47E−02	1.23E−02	1.23	3.35E−02
ADIPOR1	0.78	4.40E−03	7.02E−01	4.16E−01	1.25E−02	0.90	3.37E−02
ITFG2	1.22	3.84E−03	2.67E−01	5.33E−01	1.26E−02	0.50	3.40E−02
RPS28	−0.26	3.16E−03	2.12E−16	1.00E+00	1.28E−02	−0.26	3.45E−02
MAX	0.78	3.32E−03	1.53E−01	8.32E−01	1.31E−02	0.77	3.51E−02
CCDC102A		1.00E+00	−1.97E+00	1.35E−02	1.35E−02		3.60E−02
RPL23	−0.18	3.47E−03	2.12E−16	1.00E+00	1.40E−02	−0.18	3.71E−02
GBF1	0.50	1.16E−01	1.19E+00	1.39E−02	1.41E−02	1.05	3.73E−02
ADAM28	0.34	7.76E−02	9.76E−01	2.01E−02	1.41E−02	0.37	3.73E−02
WIPI2	0.70	2.81E−02	1.14E+00	6.75E−02	1.69E−02	1.07	4.43E−02
GRINA	0.62	2.20E−02	−1.30E+00	9.03E−02	1.73E−02	−0.24	4.54E−02
CDH11	0.25	8.19E−02	−1.02E+00	2.46E−02	1.76E−02	−0.05	4.59E−02
ZFP420		1.00E+00	2.22E+00	1.77E−02	1.77E−02		4.59E−02
SLAIN2	1.41	8.38E−03	4.53E−01	2.91E−01	1.77E−02	0.60	4.59E−02
DNA2	−0.97	4.82E−02	−9.50E−01	4.36E−02	1.86E−02	−1.06	4.79E−02
TMEM265	−0.52	5.21E−01	−1.59E+00	6.00E−03	1.87E−02	−0.94	4.80E−02
APLF	−0.09	7.96E−01	−1.34E+00	5.06E−03	1.90E−02	−0.71	4.87E−02
DYNC1LI1	0.86	1.16E−02	9.87E−01	2.17E−01	1.93E−02	1.05	4.92E−02
SLC7A5	0.99	9.53E−03	4.57E−01	3.01E−01	2.04E−02	0.84	5.15E−02
NHLRC2	0.81	8.24E−02	9.32E−01	2.91E−02	2.04E−02	1.28	5.15E−02
CBLN3	0.59	6.31E−03	−2.45E−01	5.69E−01	2.04E−02	0.21	5.15E−02
ZFP109	1.91	1.09E−01	1.49E+00	2.24E−02	2.05E−02	0.36	5.15E−02
MRS2	0.91	1.10E−02	5.15E−01	2.63E−01	2.11E−02	1.08	5.29E−02
CISD3	−0.80	5.54E−03	7.77E−02	9.48E−01	2.13E−02	−0.73	5.32E−02
HSH2D	−0.63	3.75E−01	−1.47E+00	8.74E−03	2.17E−02	−0.53	5.40E−02
RPS13	−0.17	5.72E−03	2.12E−16	1.00E+00	2.20E−02	−0.17	5.45E−02
MTX1	0.52	5.73E−02	−1.38E+00	4.56E−02	2.23E−02	−0.12	5.50E−02
BEND4	1.02	6.41E−03	1.86E−01	6.93E−01	2.25E−02	0.87	5.54E−02
SLC4A11	0.85	8.01E−03	3.68E−01	4.84E−01	2.33E−02	1.00	5.72E−02
NCOA1	1.00	6.14E−03	2.04E−02	9.86E−01	2.34E−02	0.67	5.73E−02
HIST2H3C2	0.77	1.16E−01	1.48E+00	2.53E−02	2.38E−02	1.77	5.80E−02
MTRF1	−0.78	1.16E−01	1.09E+00	2.62E−02	2.45E−02	0.52	5.95E−02
CHCHD10	0.64	8.36E−03	7.25E−01	5.21E−01	2.51E−02	0.74	6.08E−02
EGFP_IRES_IL23R	1.59	8.29E−02	1.35E+00	3.70E−02	2.52E−02	2.43	6.09E−02
MMS22L	0.81	4.38E−02	8.49E−01	7.00E−02	2.54E−02	1.11	6.11E−02
PRDX2	−0.42	6.84E−03	2.12E−16	1.00E+00	2.58E−02	−0.42	6.19E−02
RNR1	0.54	6.98E−03	2.19E−02	1.00E+00	2.63E−02	0.54	6.28E−02
RBM43	−0.48	2.17E−01	−1.01E+00	1.73E−02	2.75E−02	−1.28	6.54E−02
ZFP944	−0.98	9.89E−03	3.41E−01	4.68E−01	2.76E−02	−0.46	6.54E−02
ZC3H12C	2.14	3.34E−02	−1.10E+00	1.11E−01	2.93E−02	−0.01	6.92E−02
PRMT5	0.62	2.34E−02	8.63E−01	1.66E−01	2.94E−02	1.04	6.92E−02
DTD1	0.81	9.24E−03	−2.67E−01	6.19E−01	2.98E−02	0.25	7.01E−02
WDR83	0.91	1.09E−02	−3.24E−01	4.66E−01	3.00E−02	0.14	7.02E−02
KHNYN	−0.52	2.28E−01	−1.02E+00	1.86E−02	3.03E−02	−0.99	7.07E−02
NUDCD1	−1.09	8.33E−03	4.01E−03	9.88E−01	3.08E−02	−0.80	7.11E−02
SAA4	−0.04	8.14E−01	1.36E+00	8.54E−03	3.06E−02	0.14	7.11E−02
PLBD2	0.35	3.00E−01	1.17E+00	1.52E−02	3.08E−02	1.17	7.11E−02
GM20939	−0.80	1.48E−02	−6.14E−01	3.32E−01	3.20E−02	−0.92	7.36E−02
IFITM2	−0.66	9.52E−03	6.88E−01	7.07E−01	3.23E−02	−0.62	7.40E−02
ACTR2	−0.41	8.79E−03	2.12E−16	1.00E+00	3.23E−02	−0.41	7.40E−02
FURIN	0.41	2.08E−01	−2.46E+00	2.19E−02	3.27E−02	0.11	7.44E−02
SKAP1	0.21	4.14E−01	−2.05E+00	1.29E−02	3.26E−02	−0.49	7.44E−02
SYNGAP1	0.81	1.56E−01	−1.00E+00	2.86E−02	3.33E−02	−0.16	7.51E−02
RBFOX2	2.97	1.62E−02	9.60E−01	3.11E−01	3.32E−02	0.50	7.51E−02
PGAM1	−0.44	9.10E−03	5.37E−02	1.00E+00	3.33E−02	−0.43	7.51E−02
GABARAP	−0.49	9.14E−03	3.72E−02	1.00E+00	3.35E−02	−0.49	7.51E−02
ATP6V0D2	−1.33	1.28E−02	3.65E−01	4.44E−01	3.37E−02	−0.33	7.55E−02
TRP53I11	0.13	6.75E−01	−1.21E+00	1.03E−02	3.42E−02	−1.19	7.62E−02
ANKRD46	−0.63	2.10E−02	−7.77E−01	2.36E−01	3.45E−02	−0.85	7.65E−02
P4HA2	−0.92	2.25E−02	−5.29E−01	2.17E−01	3.45E−02	−1.24	7.65E−02
ARL6IP5	−0.45	6.55E−02	−2.03E+00	6.86E−02	3.50E−02	−0.75	7.72E−02
GM10416	1.46	3.85E−02	−9.71E−01	1.21E−01	3.54E−02	−0.08	7.79E−02
TCTEX1D1	−2.53	1.35E−02	6.12E−01	4.52E−01	3.56E−02	−0.05	7.82E−02
PGP	0.73	1.66E−02	5.52E−01	3.39E−01	3.60E−02	0.98	7.87E−02
ATP5G2	−0.29	1.03E−02	2.12E−16	1.00E+00	3.71E−02	−0.29	8.10E−02
GYPC	0.89	1.40E−02	−3.57E−01	4.66E−01	3.73E−02	0.48	8.11E−02
TAGAP	0.93	7.93E−02	−8.82E−01	6.16E−02	3.74E−02	−0.27	8.11E−02
SLC17A9	−0.11	7.46E−01	−1.54E+00	1.12E−02	3.80E−02	−0.78	8.22E−02
COX15	0.22	6.24E−01	−1.11E+00	1.23E−02	3.86E−02	−0.37	8.33E−02
LGALS4	−1.06	1.33E−02	2.38E−01	5.47E−01	3.89E−02	−0.16	8.34E−02
PABPC4	0.71	4.66E−02	−8.71E−01	1.11E−01	3.89E−02	−0.05	8.34E−02
CDCA7	−0.11	7.64E−01	−1.49E+00	1.16E−02	3.96E−02	−1.01	8.46E−02
CTSD	0.57	1.89E−02	1.40E+00	3.33E−01	3.99E−02	0.62	8.49E−02
NCAPH2	−0.24	2.77E−01	−2.29E+00	2.19E−02	4.01E−02	−0.54	8.51E−02
ARPC3	0.54	1.28E−02	8.12E−01	6.35E−01	4.02E−02	−0.51	8.51E−02
STAU1	0.65	2.56E−02	6.46E−01	2.32E−01	4.06E−02	0.90	8.57E−02
RINL	0.74	3.24E−02	−6.96E−01	1.79E−01	4.11E−02	−0.05	8.64E−02
CCDC184	0.48	5.50E−01	−1.22E+00	1.41E−02	4.12E−02	−0.54	8.65E−02
AGPAT5	0.42	1.68E−01	1.24E+00	3.64E−02	4.34E−02	0.45	9.07E−02
PAIP1	−0.51	7.01E−02	−9.91E−01	8.39E−02	4.35E−02	−0.80	9.08E−02
AKNA	0.69	1.39E−02	1.83E−01	7.35E−01	4.58E−02	0.70	9.53E−02
MDFIC	0.79	1.33E−02	2.70E−02	9.58E−01	4.66E−02	0.65	9.65E−02
ZBTB7A	0.74	1.71E−02	−4.46E−01	5.11E−01	4.69E−02	0.62	9.70E−02
KLF6	0.69	3.43E−02	−8.59E−01	2.08E−01	4.83E−02	0.41	9.95E−02
TRAF3IP3	0.44	1.57E−01	1.26E+00	4.43E−02	4.86E−02	1.23	9.98E−02
PDE4B	0.86	4.37E−02	7.72E−01	1.60E−01	4.87E−02	1.17	9.98E−02

TABLE 1D
Th17 Ctrl GFP+ vs GFP−
Gene	coefC	pvalC	coefD	pvalD	pvalH	logFC	FDR
IL23R	1.41	3.62E−02	4.02E+00	3.92E−22	5.36E−22	4.29	7.04E−18
OST4	1.71	3.76E−16	9.93E−01	6.10E−01	3.42E−15	1.74	2.25E−11
EGFP_IRES_IL23R	3.10	1.03E−02	3.77E+00	7.06E−14	2.50E−14	2.90	1.10E−10
LARS2	−0.93	5.68E−15	1.18E−16	1.00E+00	5.65E−14	−0.93	1.86E−10
SDHD	1.48	1.43E−13	1.20E+00	5.22E−01	1.10E−12	1.49	2.90E−09
CALM2	1.06	1.55E−13	1.18E−16	1.00E+00	1.46E−12	1.06	3.20E−09
IZUMO1R	−1.61	5.82E−07	−2.57E+00	4.20E−07	1.05E−11	−3.67	1.96E−08
IL12RB2	1.84	1.27E−08	2.35E+00	4.54E−05	2.29E−11	3.02	3.77E−08
RORA	1.18	2.84E−03	2.25E+00	2.86E−09	2.54E−10	2.30	3.71E−07
NPTN	1.80	2.52E−09	1.33E+00	3.87E−03	2.98E−10	2.18	3.92E−07
PRRC2A	−1.13	1.27E−10	−1.80E+00	1.55E−01	3.80E−10	−1.16	4.54E−07
LSM4	−1.25	1.58E−10	1.08E+00	2.78E−01	7.21E−10	−1.10	7.90E−07
CCDC71L	0.85	3.78E−02	2.34E+00	9.40E−10	8.55E−10	2.12	8.65E−07
CASP6	1.43	5.71E−10	1.20E+00	1.16E−01	1.32E−09	1.71	1.24E−06
RNH1	0.94	1.93E−10	1.18E−16	1.00E+00	1.57E−09	0.94	1.38E−06
COX17	0.93	2.98E−10	5.81E−01	8.63E−01	2.37E−09	0.93	1.95E−06
OSTF1	1.45	1.04E−08	1.87E+00	2.32E−02	5.82E−09	1.86	4.50E−06
EMB	1.22	1.31E−09	1.08E+00	4.87E−01	8.01E−09	1.24	5.85E−06
SMOX	1.66	2.99E−08	1.61E+00	1.60E−02	1.17E−08	2.34	8.13E−06
NCS1	1.49	1.97E−09	−3.45E−01	5.45E−01	1.26E−08	1.32	8.32E−06
TRIP10	1.31	4.41E−06	1.55E+00	1.11E−04	1.51E−08	2.13	9.45E−06
RAD50	−1.26	6.40E−09	−6.14E−01	2.40E−01	2.40E−08	−1.36	1.44E−05
TIAM1	−1.42	2.41E−04	−1.66E+00	4.28E−06	3.04E−08	−1.68	1.74E−05
TIMP1	2.32	3.00E−03	1.83E+00	9.54E−07	7.44E−08	3.87	4.08E−05
HIVEP3	−1.51	1.94E−07	−8.81E−01	1.77E−02	7.87E−08	−1.62	4.14E−05
S1PR1	1.25	1.96E−05	1.58E+00	1.56E−04	8.66E−08	2.33	4.38E−05
ARGLU1	1.09	1.53E−08	1.08E−01	1.00E+00	1.12E−07	1.08	5.46E−05
BHLHE40	1.43	2.00E−07	1.35E+00	6.42E−02	2.43E−07	1.77	1.14E−04
PDGFA	1.46	4.10E−02	2.29E+00	3.65E−07	2.99E−07	2.01	1.31E−04
AHCYL2	−1.13	9.11E−05	−1.73E+00	1.21E−04	2.92E−07	2.05	1.31E−04
IL4	−1.42	1.60E−02	−1.90E+00	9.98E−07	3.50E−07	−2.52	1.48E−04
SBNO2	1.28	1.22E−07	1.70E+00	2.00E−01	3.68E−07	1.34	1.51E−04
NOL7	−1.13	4.33E−06	−1.81E+00	5.20E−03	5.25E−07	−1.69	2.09E−04
H2-Q10	1.84	2.31E−05	1.13E+00	1.40E−03	7.84E−07	2.61	2.79E−04
FLOT1	1.14	3.82E−05	2.08E+00	8.11E−04	7.62E−07	1.92	2.79E−04
LGALS1	0.85	1.12E−07	1.18E−16	1.00E+00	7.71E−07	0.85	2.79E−04
TSPO	0.82	1.44E−07	1.07E+00	4.86E−01	7.71E−07	0.86	2.79E−04
JUNB	0.93	1.46E−07	1.18E−16	1.00E+00	9.95E−07	0.93	3.42E−04
TMEM258	0.70	1.49E−07	1.18E−16	1.00E+00	1.01E−06	0.70	3.42E−04
ACTB	0.53	1.66E−07	1.18E−16	1.00E+00	1.13E−06	0.53	3.70E−04
IL17F	7.41	1.04E−04	1.75E+00	4.86E−04	1.22E−06	2.68	3.92E−04
NPC2	0.82	2.04E−07	1.18E−16	1.00E+00	1.38E−06	0.82	4.31E−04
UBASH3A	−0.85	6.02E−03	−1.59E+00	1.32E−05	1.73E−06	−2.33	4.81E−04
PKIB	1.34	8.54E−02	2.19E+00	1.18E−06	1.70E−06	1.20	4.81E−04
STAT5A	1.11	2.72E−07	8.05E−01	7.53E−01	1.73E−06	1.12	4.81E−04
RPS2	−0.78	2.68E−07	1.18E−16	1.00E+00	1.79E−06	−0.78	4.81E−04
GNB5	0.55	6.89E−02	1.88E+00	1.43E−06	1.72E−06	2.48	4.81E−04
TPT1	−0.39	2.69E−07	1.18E−16	1.00E+00	1.79E−06	−0.39	4.81E−04
RNF187	−1.40	1.45E−06	−1.00E+00	6.32E−02	1.62E−06	−1.82	4.81E−04
INPP5B	1.24	5.23E−07	7.84E−01	2.75E−01	1.88E−06	1.43	4.95E−04
NMT1	1.15	3.77E−06	1.85E+00	2.76E−02	2.02E−06	1.32	5.20E−04
ARHGDIA	0.47	3.30E−07	1.18E−16	1.00E+00	2.19E−06	0.47	5.47E−04
LTB	−1.61	1.35E−06	−7.33E−01	1.01E−01	2.21E−06	−1.95	5.47E−04
TREML2	−1.13	3.47E−05	−1.11E+00	3.46E−03	2.64E−06	−1.84	6.44E−04
PABPC1	−0.55	4.21E−07	1.18E−16	1.00E+00	2.77E−06	−0.55	6.62E−04
SH2D3C	−1.34	7.23E−05	−1.13E+00	1.74E−03	2.83E−06	−1.82	6.64E−04
MT2	1.69	6.27E−06	8.36E−01	2.80E−02	3.32E−06	2.37	7.67E−04
NDUFA1	0.75	9.18E−07	1.36E+00	3.20E−01	3.58E−06	0.80	7.85E−04
TMEM160	−1.20	1.04E−05	−9.29E−01	1.75E−02	3.56E−06	−1.79	7.85E−04
RNF10	−1.21	9.36E−06	−1.25E+00	1.93E−02	3.52E−06	−1.56	7.85E−04
MYCN	−1.36	2.00E−01	2.53E+00	1.36E−06	3.77E−06	1.41	8.00E−04
SMIM3	0.56	1.37E−01	1.76E+00	1.81E−06	3.73E−06	2.64	8.00E−04
ILTIFB		1.00E+00	3.62E+00	4.09E−06	4.09E−06		8.16E−04
MTMR7	0.88	8.76E−03	1.60E+00	2.28E−05	4.09E−06	2.09	8.16E−04
H2-T23	0.68	6.16E−07	1.18E−16	1.00E+00	3.99E−06	0.68	8.16E−04
SUN2	−1.20	3.48E−06	−7.46E−01	7.00E−02	4.08E−06	−1.50	8.16E−04
PTPN14	1.30	1.81E−02	2.10E+00	1.36E−05	4.78E−06	0.75	9.39E−04
SOCS3	1.22	2.93E−04	1.76E+00	7.74E−04	4.99E−06	2.20	9.66E−04
IL22	5.60	6.60E−03	2.47E+00	3.89E−05	5.27E−06	1.93	1.01E−03
ITSN2	−1.03	3.75E−04	−1.43E+00	7.03E−04	5.75E−06	−1.74	1.05E−03
D17H6S53E	1.09	1.12E−05	9.75E−01	2.79E−02	5.77E−06	1.30	1.05E−03
ANXA2	1.18	8.81E−07	1.18E−16	1.00E+00	5.64E−06	1.18	1.05E−03
TUBA1A	0.97	2.13E−06	1.65E+00	2.19E−01	6.19E−06	1.09	1.12E−03
RPS28	0.38	1.02E−06	1.18E−16	1.00E+00	6.46E−06	0.38	1.15E−03
ERMN	1.44	2.99E−04	1.35E+00	1.09E−03	7.00E−06	2.52	1.23E−03
SPHK1	−0.96	3.38E−01	2.32E+00	1.87E−06	7.34E−06	1.08	1.27E−03
SRRM2	−0.76	1.22E−06	1.18E−16	1.00E+00	7.70E−06	−0.76	1.32E−03
TRIM27	−1.39	4.25E−06	−6.99E−01	1.34E−01	8.34E−06	−1.52	1.39E−03
ACSL4	0.98	1.85E−06	−1.16E+00	4.23E−01	8.37E−06	0.94	1.39E−03
CRISPLD2	1.07	2.52E−01	2.14E+00	2.80E−06	8.87E−06	1.47	1.46E−03
MS4A6D	2.75	1.76E−06	2.58E−01	5.34E−01	9.03E−06	0.71	1.47E−03
ADAM8	1.71	1.20E−03	1.35E+00	3.63E−04	9.16E−06	1.66	1.47E−03
PRDX2	0.58	1.54E−06	1.18E−16	1.00E+00	9.64E−06	0.58	1.53E−03
SNAPC1	0.74	1.50E−03	3.11E+00	3.31E−04	1.03E−05	1.42	1.61E−03
HSD17B10	0.82	1.67E−06	3.40E−01	1.00E+00	1.06E−05	0.86	1.62E−03
SEPT2	0.90	2.16E−06	1.08E+00	4.87E−01	1.05E−05	0.92	1.62E−03
CKS2	0.78	4.87E−06	1.82E+00	1.59E−01	1.08E−05	0.90	1.63E−03
CLK4	−0.40	1.53E−01	2.26E+00	5.11E−06	1.10E−05	1.15	1.64E−03
ATXN1	−1.11	1.82E−06	4.97E−02	1.00E+00	1.14E−05	−0.98	1.69E−03
CBX3	0.78	1.89E−06	1.18E−16	1.00E+00	1.17E−05	0.78	1.72E−03
UNC50	1.07	4.64E−06	1.02E+00	1.92E−01	1.19E−05	1.32	1.72E−03
RASGRP1	−0.75	1.73E−02	−1.59E+00	4.30E−05	1.37E−05	−1.63	1.94E−03
TOMM7	0.56	2.22E−06	1.18E−16	1.00E+00	1.37E−05	0.56	1.94E−03
PRPF8	−0.72	2.68E−06	−1.73E−01	8.53E−01	1.61E−05	−0.72	2.26E−03
IL16	−0.11	7.04E−01	−1.83E+00	2.95E−06	1.68E−05	−1.87	2.32E−03
GPR34		1.00E+00	−3.67E+00	1.85E−05	1.85E−05		2.53E−03
S100A10	0.87	3.33E−06	1.18E−16	1.00E+00	2.02E−05	0.87	2.69E−03
FCF1	0.74	1.77E−05	2.10E+00	7.21E−02	1.98E−05	0.96	2.69E−03
WNK1	−0.76	6.78E−06	−1.55E+00	2.41E−01	2.01E−05	−0.79	2.69E−03
SERPINE1	0.62	3.12E−01	1.87E+00	6.49E−06	2.30E−05	1.15	3.02E−03
GIMAP4	−0.78	5.99E−04	−2.61E+00	2.15E−03	2.50E−05	−1.32	3.25E−03
D630039A03RIK	−1.44	1.69E−02	−1.73E+00	9.27E−05	2.77E−05	−1.50	3.57E−03
RAB37	0.48	6.02E−01	−2.32E+00	5.98E−06	3.09E−05	−1.04	3.95E−03
GPBP1L1	−1.16	2.08E−05	7.34E−01	1.20E−01	3.49E−05	−0.67	4.42E−03
ZBTB7C	−0.78	5.08E−01	2.83E+00	8.21E−06	3.85E−05	0.61	4.75E−03
IL1R1	0.76	6.58E−01	2.78E+00	7.17E−06	3.83E−05	0.82	4.75E−03
NOTCH1	−0.86	8.77E−06	−5.79E−01	4.55E−01	3.87E−05	−0.89	4.75E−03
LUM	2.31	1.70E−03	1.27E+00	1.23E−03	3.93E−05	2.08	4.79E−03
NANOG	0.86	1.05E−05	3.80E−01	3.71E−01	4.07E−05	0.82	4.91E−03
LY6A	0.86	7.69E−06	1.18E−16	1.00E+00	4.51E−05	0.85	5.40E−03
IL17A	3.32	3.20E−01	2.57E+00	1.31E−05	4.60E−05	2.42	5.42E−03
RAD23A	0.93	2.81E−05	1.91E+00	1.19E−01	4.62E−05	1.06	5.42E−03
GSK3B	0.87	1.38E−05	1.46E+00	3.15E−01	4.74E−05	0.92	5.52E−03
REST	−1.16	2.55E−05	−5.71E−01	1.44E−01	4.87E−05	−1.21	5.62E−03
WTAP	0.75	7.17E−04	2.79E+00	3.85E−03	5.02E−05	1.10	5.74E−03
CYP11A1	−1.32	3.22E−03	−1.16E+00	8.76E−04	5.14E−05	−2.26	5.75E−03
RPSA	−0.37	8.85E−06	1.18E−16	1.00E+00	5.16E−05	−0.37	5.75E−03
CYSTM1	0.95	6.59E−05	1.16E+00	5.00E−02	5.10E−05	1.46	5.75E−03
TNFSF9	1.64	1.28E−03	1.11E+00	2.26E−03	5.29E−05	1.75	5.84E−03
TNFAIP3	1.07	6.62E−04	1.44E+00	4.54E−03	5.41E−05	1.80	5.93E−03
CD3E	−0.86	9.85E−06	1.18E−16	1.00E+00	5.71E−05	−0.86	6.19E−03
SDF2	0.81	4.79E−04	2.03E+00	6.77E−03	5.74E−05	1.40	6.19E−03
SDC4	0.14	7.01E−01	1.66E+00	1.08E−05	5.81E−05	1.64	6.21E−03
CRIP1	0.77	2.08E−04	2.53E+00	1.76E−02	6.17E−05	1.06	6.49E−03
MYLK	1.04	5.23E−01	2.95E+00	1.32E−05	6.15E−05	0.31	6.49E−03
GATM	1.41	1.91E−04	1.05E+00	2.04E−02	6.45E−05	2.05	6.73E−03
ACTR2	0.50	1.13E−05	1.18E−16	1.00E+00	6.52E−05	0.50	6.75E−03
RPGRIP1	0.56	2.42E−02	1.40E+00	1.67E−04	6.60E−05	1.24	6.78E−03
REPS1	−0.86	1.72E−02	−1.31E+00	2.49E−04	7.13E−05	−1.40	7.27E−03
TNFRSF18	−0.86	1.25E−05	1.18E−16	1.00E+00	7.18E−05	−0.86	7.27E−03
PLAGL2	−0.86	1.47E−05	7.98E−01	6.56E−01	7.56E−05	−0.84	7.59E−03
KHSRP	−0.96	1.61E−05	−2.22E−01	5.67E−01	7.74E−05	−0.76	7.71E−03
GATA3	−1.00	7.13E−04	−2.28E+00	6.31E−03	7.82E−05	−1.45	7.73E−03
TRAT1	−0.68	5.61E−02	−1.42E+00	9.49E−05	7.93E−05	−2.63	7.78E−03
APOA1BP	0.83	1.24E−04	1.27E+00	4.22E−02	8.05E−05	1.34	7.79E−03
ATXN2L	−1.01	1.41E−05	−1.13E−02	9.57E−01	8.05E−05	−1.00	7.79E−03
POU2AF1	−0.39	6.49E−01	−2.32E+00	1.64E−05	8.38E−05	−0.59	8.04E−03
CCR8	−1.04	5.80E−03	−1.52E+00	8.50E−04	8.52E−05	−2.45	8.12E−03
SRRM1	−0.65	1.58E−05	1.18E−16	1.00E+00	8.99E−05	−0.64	8.51E−03
GNGT2	0.89	1.03E−04	9.36E−01	6.18E−02	9.32E−05	1.58	8.76E−03
RERE	−0.45	5.12E−02	−1.76E+00	1.26E−04	9.63E−05	−1.18	8.98E−03
ZFP467	0.60	2.73E−01	−1.77E+00	3.25E−05	9.75E−05	−0.89	9.03E−03
LMNA	0.88	2.02E−02	1.28E+00	3.19E−04	1.03E−04	2.10	9.52E−03
AMICA1	−1.37	1.44E−01	−2.19E+00	5.69E−05	1.04E−04	−1.17	9.52E−03
KLF6	0.68	4.05E−03	1.70E+00	1.52E−03	1.06E−04	1.71	9.57E−03
ASB2	−1.17	3.00E−02	−1.29E+00	2.45E−04	1.14E−04	−1.78	1.03E−02
UBR4	−0.82	3.59E−05	1.45E+00	3.06E−01	1.16E−04	−0.78	1.04E−02
RPS27	0.35	2.09E−05	1.18E−16	1.00E+00	1.17E−04	0.35	1.04E−02
ABCB9	−0.82	1.64E−02	−1.23E+00	4.46E−04	1.18E−04	−1.71	1.04E−02
RORC	0.75	5.29E−02	1.34E+00	1.57E−04	1.22E−04	1.88	1.07E−02
CCDC88C	−0.86	5.25E−05	5.04E−01	2.18E−01	1.31E−04	−0.43	1.14E−02
TRIM56	−0.26	2.35E−01	−1.50E+00	5.28E−05	1.39E−04	−0.63	1.20E−02
LAMA5	−0.90	3.98E−04	−1.16E+00	2.23E−02	1.39E−04	−1.22	1.20E−02
EIF3F	−0.83	2.56E−05	1.18E−16	1.00E+00	1.42E−04	−0.83	1.21E−02
STOM	0.04	9.29E−01	1.56E+00	2.69E−05	1.48E−04	2.01	1.25E−02
BEND4	0.27	4.95E−01	1.50E+00	3.42E−05	1.48E−04	1.17	1.25E−02
ITPRIPL1	0.83	2.84E−05	8.11E−01	7.68E−01	1.50E−04	0.84	1.25E−02
CDKN2D	0.74	5.62E−05	9.31E−01	2.38E−01	1.49E−04	1.00	1.25E−02
CCR4	−0.95	1.33E−04	−9.50E−01	8.34E−02	1.51E−04	−1.32	1.25E−02
KMT2A	−0.77	8.23E−05	−7.95E−01	1.57E−01	1.58E−04	−0.87	1.30E−02
MT1	0.93	2.33E−03	1.66E+00	4.34E−03	1.66E−04	1.64	1.35E−02
NUBP1	−0.89	3.11E−05	−8.06E−02	8.41E−01	1.68E−04	−0.80	1.35E−02
MAP3K1	0.80	2.08E−04	1.12E+00	5.68E−02	1.68E−04	0.98	1.35E−02
RPS12	−0.41	3.11E−05	1.18E−16	1.00E+00	1.71E−04	−0.41	1.37E−02
DTWD1	1.39	3.72E−05	2.58E−01	5.97E−01	1.76E−04	1.23	1.40E−02
GTF2IRD1	−0.14	7.41E−01	−1.56E+00	3.48E−05	1.80E−04	−0.68	1.43E−02
USMG5	0.49	3.33E−05	1.18E−16	1.00E+00	1.82E−04	0.49	1.44E−02
DNMT3A	−0.90	1.41E−04	−8.99E−01	1.02E−01	1.87E−04	−1.05	1.47E−02
PERP	0.68	7.71E−02	1.47E+00	1.86E−04	1.94E−04	2.44	1.51E−02
EGFR	−0.45	3.58E−01	1.47E+00	5.65E−05	1.97E−04	1.39	1.53E−02
ASAH2		1.00E+00	3.37E+00	2.00E−04	2.00E−04		1.53E−02
TNIP2	0.97	3.43E−04	1.28E+00	4.15E−02	2.06E−04	1.42	1.57E−02
RND1	0.83	3.29E−02	1.27E+00	4.41E−04	2.14E−04	1.25	1.62E−02
SYTL1	−0.15	6.14E−01	−1.50E+00	4.64E−05	2.20E−04	−1.96	1.66E−02
TCEB1	0.63	4.33E−05	1.18E−16	1.00E+00	2.34E−04	0.63	1.76E−02
FERMT3	0.66	4.42E−05	1.18E−16	1.00E+00	2.39E−04	0.66	1.78E−02
BYSL	0.71	4.90E−03	2.16E+00	3.08E−03	2.39E−04	1.33	1.78E−02
TWF1	0.85	1.64E−04	1.16E+00	1.16E−01	2.41E−04	1.13	1.78E−02
EIF4EBP2	−0.90	5.11E−03	−1.11E+00	3.03E−03	2.45E−04	−1.71	1.80E−02
DIAPH1	−0.71	5.96E−03	−1.30E+00	2.62E−03	2.46E−04	−1.31	1.80E−02
RPS20	−0.37	4.64E−05	1.18E−16	1.00E+00	2.50E−04	−0.37	1.81E−02
FYB	−0.74	1.07E−04	−1.21E+00	2.11E−01	2.53E−04	−0.85	1.83E−02
EP300	−0.62	5.27E−03	−1.58E+00	3.17E−03	2.62E−04	−1.06	1.88E−02
CHD4	−0.71	6.06E−05	−6.09E−01	5.41E−01	2.67E−04	−0.72	1.89E−02
SETD5	−0.90	1.53E−04	−1.01E+00	1.44E−01	2.66E−04	−1.01	1.89E−02
CAPN3	−3.22	4.49E−02	−2.50E+00	4.20E−04	2.66E−04	−0.62	1.89E−02
FAM60A	1.06	6.50E−05	8.04E−01	4.82E−01	2.68E−04	1.15	1.89E−02
TRBC2	−0.94	6.01E−05	−6.29E−01	5.67E−01	2.71E−04	−1.03	1.89E−02
FAM102A	−0.20	5.55E−01	−1.44E+00	6.60E−05	2.93E−04	−1.44	2.04E−02
KPNA2	0.72	1.33E−04	1.25E+00	1.97E−01	2.95E−04	0.89	2.04E−02
HN1	0.57	5.69E−05	1.18E−16	1.00E+00	3.03E−04	0.57	2.06E−02
CHURC1	0.74	5.63E−05	1.18E−16	1.00E+00	3.00E−04	0.74	2.06E−02
GPR83	−1.30	1.01E−02	−1.10E+00	1.94E−03	3.02E−04	−1.51	2.06E−02
BCL2A1B	−1.05	2.94E−04	−6.65E−01	8.05E−02	3.10E−04	−1.67	2.08E−02
GSG1L		1.00E+00	−3.15E+00	3.11E−04	3.11E−04		2.08E−02
SMG7	−0.76	1.80E−03	−1.42E+00	1.14E−02	3.12E−04	−1.11	2.08E−02
ATRNL1	2.19	1.61E−03	1.24E+00	1.28E−02	3.11E−04	0.48	2.08E−02
MYL12A	0.47	5.92E−05	1.18E−16	1.00E+00	3.15E−04	0.47	2.09E−02
GGNBP2	−0.85	2.13E−04	−9.13E−01	1.22E−01	3.19E−04	−1.05	2.11E−02
VEZT	−0.87	1.85E−04	5.14E−01	1.49E−01	3.26E−04	−0.12	2.14E−02
D930015E06RIK	−0.81	7.05E−03	−1.10E+00	3.04E−03	3.29E−04	−1.30	2.15E−02
LRRC2	0.25	2.79E−02	1.24E+00	8.23E−04	3.32E−04	0.39	2.16E−02
PNO1	0.23	3.17E−01	3.35E+00	1.07E−04	3.35E−04	0.92	2.17E−02
HSF2	0.78	5.33E−03	1.68E+00	4.15E−03	3.39E−04	1.29	2.18E−02
SCOC	0.87	3.39E−04	6.47E−01	7.71E−02	3.41E−04	1.27	2.19E−02
MED12	−0.83	6.61E−05	−5.86E−02	8.75E−01	3.45E−04	−0.79	2.20E−02
COTL1	−0.80	7.53E−05	8.72E−01	6.20E−01	3.49E−04	−0.78	2.22E−02
ATP6V0E	0.56	6.84E−05	5.76E−01	8.26E−01	3.52E−04	0.57	2.23E−02
ZHX1	−0.21	4.28E−01	2.10E+00	9.70E−05	3.67E−04	0.78	2.30E−02
PRPF19	−0.77	1.69E−04	6.25E−01	1.95E−01	3.67E−04	−0.53	2.30E−02
EEF1D	0.47	7.05E−05	1.18E−16	1.00E+00	3.71E−04	0.47	2.30E−02
NUP210	−0.73	3.74E−04	−2.13E+00	7.63E−02	3.71E−04	−0.81	2.30E−02
CHMP5	0.62	1.20E−04	1.49E+00	3.24E−01	3.77E−04	0.70	2.31E−02
SUPT4A	0.60	2.76E−04	−1.76E+00	1.11E−01	3.77E−04	0.52	2.31E−02
NEDD8	0.54	7.51E−05	7.81E−01	7.54E−01	3.75E−04	0.56	2.31E−02
EZH2	−1.08	2.16E−04	−7.60E−01	1.53E−01	3.84E−04	−1.27	2.34E−02
TESC	−0.36	2.94E−01	−1.37E+00	1.41E−04	4.10E−04	−1.94	2.49E−02
DYNLT1C	1.08	8.26E−05	2.83E−01	8.06E−01	4.18E−04	1.11	2.52E−02
BRMS1	0.81	1.82E−04	6.85E−01	2.19E−01	4.27E−04	1.14	2.55E−02
RAB24	−1.12	1.67E−04	−3.93E−01	2.46E−01	4.27E−04	−0.82	2.55E−02
KDELR2	0.77	8.27E−05	1.18E−16	1.00E+00	4.32E−04	0.77	2.57E−02
CDC37	0.35	8.35E−05	1.18E−16	1.00E+00	4.35E−04	0.35	2.58E−02
AKNA	−0.59	1.64E−02	−2.16E+00	1.85E−03	4.40E−04	−1.09	2.60E−02
TUBA1C	0.52	1.23E−02	1.97E+00	2.50E−03	4.51E−04	1.05	2.65E−02
AHCY	−0.73	1.60E−04	−1.46E+00	2.97E−01	4.67E−04	−0.79	2.73E−02
MCTP2	−0.14	7.16E−01	1.49E+00	9.93E−05	4.80E−04	1.06	2.79E−02
NDUFB8	−0.60	1.27E−04	1.15E+00	4.46E−01	4.84E−04	−0.55	2.80E−02
SHTN1	−1.08	5.43E−02	−1.57E+00	7.17E−04	5.13E−04	−0.56	2.96E−02
DPYSL2	0.78	1.59E−04	−1.32E+00	3.48E−01	5.16E−04	0.75	2.96E−02
PLEKHJ1	0.51	1.74E−03	2.47E+00	2.11E−02	5.20E−04	0.77	2.97E−02
MED14	−0.22	5.51E−01	−1.36E+00	1.25E−04	5.34E−04	−1.00	3.04E−02
SNHG11	0.47	6.03E−04	7.75E−01	6.99E−02	5.39E−04	0.48	3.05E−02
H1F0	−1.14	3.26E−04	−5.40E−01	1.47E−01	5.49E−04	−1.24	3.10E−02
AAK1	−0.80	1.08E−04	−1.06E−02	9.64E−01	5.56E−04	−0.63	3.11E−02
ATP1A1	−0.87	1.32E−03	−8.58E−01	3.04E−02	5.54E−04	−1.23	3.11E−02
STXBP3	0.84	5.13E−04	6.72E−01	8.82E−02	5.60E−04	1.30	3.12E−02
SKIV2L	−0.60	2.38E−03	1.21E+00	1.66E−02	5.62E−04	0.15	3.12E−02
TMEM8B	−0.91	2.72E−01	−2.01E+00	2.15E−04	5.80E−04	−0.19	3.18E−02
H2-Q4	−1.06	1.17E−04	2.15E−01	7.99E−01	5.80E−04	−1.02	3.18E−02
HCN3	−0.44	7.55E−01	2.71E+00	1.19E−04	5.80E−04	0.53	3.18E−02
GPR18	0.80	9.91E−03	1.14E+00	4.10E−03	5.84E−04	2.01	3.18E−02
NAA15	−0.81	9.38E−04	−1.14E+00	4.75E−02	5.89E−04	−1.10	3.20E−02
GALE	0.70	9.38E−04	1.11E+00	4.77E−02	5.92E−04	1.34	3.20E−02
SEC61G	0.53	1.16E−04	1.18E−16	1.00E+00	5.94E−04	0.53	3.20E−02
MLLT3	−1.01	1.64E−04	−3.61E−01	4.23E−01	5.97E−04	−0.98	3.20E−02
TRIM28	−0.68	1.40E−03	−1.32E+00	3.17E−02	6.04E−04	−1.06	3.23E−02
CHP1	0.72	1.21E−04	1.95E−01	1.00E+00	6.23E−04	0.73	3.27E−02
ECHDC1	0.82	6.67E−03	1.11E+00	6.45E−03	6.18E−04	1.67	3.27E−02
SLC39A8	0.52	2.11E−01	1.28E+00	2.79E−04	6.20E−04	1.50	3.27E−02
ZFAND5	−0.68	4.48E−02	−1.17E+00	1.05E−03	6.23E−04	−1.09	3.27E−02
ANP32B	−0.93	4.10E−04	−1.18E+00	1.30E−01	6.19E−04	−1.07	3.27E−02
RAP1A	−0.66	1.28E−04	−1.72E−01	8.12E−01	6.33E−04	−0.66	3.29E−02
ZMIZ1	−0.84	1.40E−04	−2.37E−01	6.31E−01	6.33E−04	−0.82	3.29E−02
PLSCR1	0.96	2.18E−04	6.32E−01	3.04E−01	6.36E−04	1.14	3.29E−02
YTHDF3	−1.16	1.38E−04	1.10E−01	7.99E−01	6.76E−04	−0.78	3.48E−02
RAB11FIP4	1.05	9.02E−02	−1.48E+00	6.34E−04	6.94E−04	−0.42	3.57E−02
D830030K20RIK		1.00E+00	−3.19E+00	7.00E−04	7.00E−04		3.58E−02
BC031181	0.68	3.93E−04	1.78E+00	1.63E−01	7.07E−04	0.79	3.61E−02
GNPDA2	1.13	2.65E−04	4.75E−01	2.81E−01	7.21E−04	1.36	3.66E−02
SLC12A7	0.54	8.12E−02	1.18E+00	7.33E−04	7.30E−04	1.26	3.68E−02
MAGED1	1.04	3.85E−02	−1.66E+00	1.44E−03	7.30E−04	−0.54	3.68E−02
ALKBH5	0.77	4.01E−04	1.74E+00	1.72E−01	7.49E−04	0.81	3.76E−02
CYSLTR2	0.83	1.11E−02	1.26E+00	4.91E−03	7.59E−04	1.78	3.78E−02
ZIC5		1.00E+00	3.09E+00	7.59E−04	7.59E−04		3.78E−02
CD209C	−0.29	2.68E−01	1.29E+00	2.92E−04	7.65E−04	0.54	3.78E−02
TNFRSF4	−0.73	5.37E−04	−1.91E+00	1.23E−01	7.62E−04	−0.88	3.78E−02
SLC4A11	0.34	2.54E−01	1.47E+00	3.05E−04	7.70E−04	1.85	3.79E−02
KLHL6	0.94	3.90E−04	9.03E−01	1.87E−01	7.75E−04	1.25	3.81E−02
BCKDHA	0.65	5.10E−03	1.09E+00	1.14E−02	8.03E−04	1.54	3.90E−02
TANGO2	0.92	1.96E−02	1.07E+00	3.00E−03	8.04E−04	1.81	3.90E−02
TREX1	0.55	2.54E−02	1.90E+00	2.33E−03	8.01E−04	1.63	3.90E−02
CTXN1	0.40	7.00E−01	2.16E+00	1.75E−04	8.14E−04	0.74	3.94E−02
ERCC4	0.95	1.85E−03	−8.03E−01	3.37E−02	8.23E−04	0.28	3.96E−02
LFNG	−0.37	6.72E−01	−1.91E+00	1.83E−04	8.36E−04	−0.52	4.01E−02
UCK2	−0.87	1.45E−03	−1.19E+00	4.55E−02	8.48E−04	−1.31	4.05E−02
MRGPRA6	−0.36	1.70E−04	1.18E−16	1.00E+00	8.52E−04	−0.36	4.06E−02
SLAIN1	−1.15	7.18E−03	−9.75E−01	8.68E−03	8.61E−04	−0.96	4.09E−02
EML3	−0.75	6.28E−03	1.15E+00	1.01E−02	8.73E−04	0.11	4.13E−02
ACOT8	0.42	1.14E−01	1.37E+00	6.76E−04	8.90E−04	1.70	4.16E−02
LAMP1	−0.82	4.20E−03	−1.04E+00	1.57E−02	8.98E−04	−1.61	4.16E−02
BRCA2	−0.86	9.09E−03	−1.08E+00	7.19E−03	8.98E−04	−0.76	4.16E−02
RPS6KA4	−0.01	9.74E−01	1.52E+00	1.79E−04	8.93E−04	1.38	4.16E−02
HIST1H1E	−0.71	7.99E−03	−9.86E−01	8.16E−03	8.97E−04	−1.58	4.16E−02
PAPSS2	2.10	2.19E−04	−2.67E−01	5.30E−01	8.88E−04	0.23	4.16E−02
EIF5B	−0.54	1.81E−04	4.15E−01	1.00E+00	9.04E−04	−0.54	4.17E−02
SMC4	−0.86	1.83E−04	1.26E−01	9.93E−01	9.12E−04	−0.83	4.19E−02
TLR7		1.00E+00	−3.06E+00	9.19E−04	9.19E−04		4.21E−02
MTA1	−0.79	6.77E−04	−6.03E−01	1.19E−01	9.23E−04	−0.92	4.21E−02
SEC23B	0.81	1.93E−04	−8.51E−02	8.05E−01	9.32E−04	0.77	4.23E−02
RN7S2	−0.79	2.03E−04	−1.49E−01	7.01E−01	9.35E−04	−0.71	4.23E−02
RN7S1	−0.79	2.03E−04	−1.49E−01	7.01E−01	9.35E−04	−0.71	4.23E−02
CHRNA1	0.45	4.87E−04	5.16E−01	1.82E−01	9.39E−04	0.45	4.23E−02
ANKRD17	−0.79	2.20E−04	−3.57E−01	6.03E−01	9.47E−04	−0.80	4.25E−02
CTS8-PS		1.00E+00	−3.09E+00	9.50E−04	9.50E−04		4.25E−02
HUWE1	−0.64	2.71E−04	−1.16E+00	4.23E−01	9.58E−04	−0.65	4.26E−02
SLC43A1	−3.09	1.49E−01	−2.43E+00	5.84E−04	9.55E−04	−0.50	4.26E−02
SLC43A2	−0.04	9.01E−01	−1.36E+00	1.97E−04	9.71E−04	−0.71	4.30E−02
PRR12	−0.34	2.00E−01	−1.28E+00	4.72E−04	9.77E−04	−0.58	4.31E−02
1110037F02RIK	−0.98	2.90E−04	−3.06E−01	4.04E−01	9.94E−04	−0.86	4.37E−02
ATP10D	0.12	7.14E−01	1.32E+00	2.19E−04	1.01E−03	0.83	4.43E−02
HPCAL4		1.00E+00	3.01E+00	1.03E−03	1.03E−03		4.51E−02
CPSF4	−0.98	2.33E−04	−1.80E−01	6.61E−01	1.04E−03	−0.89	4.53E−02
FGF2	−0.70	7.29E−01	−2.62E+00	2.26E−04	1.05E−03	−0.51	4.54E−02
HNRNPAB	−0.84	6.61E−04	−1.02E+00	1.46E−01	1.05E−03	−1.05	4.55E−02
SOX5	−0.23	4.26E−01	1.35E+00	3.02E−04	1.06E−03	0.62	4.59E−02
ENSA	0.63	2.62E−02	1.48E+00	3.15E−03	1.08E−03	1.25	4.64E−02
DOK2	−0.70	1.51E−02	−1.69E+00	5.36E−03	1.08E−03	−1.45	4.64E−02
ZFP622	−0.97	2.42E−03	−7.35E−01	3.58E−02	1.11E−03	−1.02	4.72E−02
TUBB4B	0.48	2.84E−03	2.37E+00	3.01E−02	1.11E−03	0.74	4.72E−02
PRKCB	−0.24	4.15E−01	−1.33E+00	3.24E−04	1.12E−03	−1.06	4.74E−02
NUDT3	0.51	2.26E−02	2.78E+00	3.77E−03	1.12E−03	0.80	4.74E−02
FABP5	0.77	4.00E−04	−8.10E−01	3.08E−01	1.13E−03	0.62	4.76E−02
SLC15A3	1.09	1.42E−03	9.35E−01	6.62E−02	1.14E−03	1.70	4.78E−02
CCNT1	−0.83	7.75E−04	7.48E−01	1.34E−01	1.14E−03	−0.16	4.78E−02
SYMPK	−0.68	5.07E−03	−1.21E+00	1.70E−02	1.14E−03	−1.02	4.78E−02
STK11	−0.97	5.46E−04	4.53E−01	2.11E−01	1.16E−03	−0.15	4.83E−02
PON3	2.13	8.53E−04	8.38E−01	1.26E−01	1.19E−03	0.35	4.95E−02
PGLYRP2	−1.12	3.78E−02	−1.23E+00	2.50E−03	1.20E−03	−1.15	4.95E−02
VEZF1	−0.84	3.05E−03	−8.57E−01	3.14E−02	1.23E−03	−1.17	5.05E−02
KMO		1.00E+00	−3.13E+00	1.24E−03	1.24E−03		5.08E−02
PAIP1	0.68	1.90E−03	1.14E+00	5.34E−02	1.25E−03	0.96	5.09E−02
LRRN4CL	−0.28	5.48E−02	−1.08E+00	1.86E−03	1.25E−03	−0.42	5.09E−02
CYTIP	0.55	2.56E−04	1.18E−16	1.00E+00	1.25E−03	0.55	5.09E−02
TPST1	−0.71	3.56E−01	−1.63E+00	4.11E−04	1.27E−03	−0.76	5.15E−02
HNRNPU	−0.76	4.24E−04	−9.77E−01	3.40E−01	1.27E−03	−0.80	5.15E−02
CXCR2	0.64	2.68E−04	2.88E−01	8.27E−01	1.28E−03	0.65	5.15E−02
PHGDH	−0.70	2.90E−04	7.78E−01	6.87E−01	1.30E−03	−0.68	5.18E−02
SLAMF6	−0.06	9.38E−01	−1.37E+00	2.67E−04	1.30E−03	−1.39	5.18E−02
DNTTIP1	−1.28	7.47E−04	−5.04E−01	1.65E−01	1.29E−03	−0.71	5.18E−02
GZMB	0.44	5.20E−01	−1.59E+00	3.33E−04	1.30E−03	−0.98	5.19E−02
MRPL27	0.75	2.37E−03	1.44E+00	4.44E−02	1.31E−03	1.10	5.19E−02
FBXO46	−0.90	1.84E−03	7.61E−01	5.92E−02	1.32E−03	−0.15	5.22E−02
CCDC63	−0.46	2.96E−01	1.33E+00	4.91E−04	1.33E−03	0.85	5.26E−02
CELF1	−0.75	3.95E−04	−8.32E−01	4.12E−01	1.34E−03	−0.77	5.28E−02
TCF20	−0.74	8.17E−04	−1.41E+00	1.59E−01	1.37E−03	−0.79	5.37E−02
TRIM17		1.00E+00	−3.03E+00	1.38E−03	1.38E−03		5.40E−02
IL10RA	−0.19	6.76E−01	−1.25E+00	3.13E−04	1.38E−03	−1.39	5.40E−02
TPD52	0.28	1.86E−01	3.03E+00	7.30E−04	1.39E−03	0.90	5.41E−02
PTPN1	0.65	5.36E−04	1.50E+00	2.87E−01	1.42E−03	0.71	5.49E−02
CREBBP	−0.82	5.38E−04	−4.53E−01	2.89E−01	1.43E−03	−0.87	5.53E−02
ZFP704	−0.17	8.59E−01	−2.49E+00	3.01E−04	1.43E−03	−0.05	5.53E−02
MCUR1	−1.13	3.33E−04	−1.34E−01	6.80E−01	1.47E−03	−0.52	5.63E−02
TUBB6	0.76	1.88E−02	1.17E+00	6.06E−03	1.46E−03	1.92	5.63E−02
TAF2	−0.66	1.42E−02	−9.90E−01	8.02E−03	1.47E−03	−1.09	5.64E−02
NT5C	0.55	4.46E−04	1.21E+00	4.06E−01	1.49E−03	0.59	5.64E−02
S100A13	0.51	1.38E−02	2.62E+00	8.34E−03	1.48E−03	0.98	5.64E−02
KMT2C	−0.74	5.12E−04	−4.10E−01	3.30E−01	1.49E−03	−0.72	5.64E−02
PPP6C	0.63	1.71E−03	1.55E+00	7.58E−02	1.51E−03	0.86	5.69E−02
SRGN	0.53	3.13E−04	1.18E−16	1.00E+00	1.51E−03	0.53	5.69E−02
AHDC1	−0.02	9.47E−01	−1.29E+00	3.13E−04	1.51E−03	−0.48	5.69E−02
GDPD2		1.00E+00	3.28E+00	1.52E−03	1.52E−03		5.71E−02
ZFP65	−0.51	3.22E−04	1.18E−16	1.00E+00	1.55E−03	−0.51	5.74E−02
FBXO22	1.18	4.01E−04	3.00E−01	5.23E−01	1.55E−03	1.17	5.74E−02
TRAPPC2L	0.67	5.55E−03	1.10E+00	2.22E−02	1.57E−03	1.60	5.74E−02
EPAS1	−1.29	1.26E−02	−9.26E−01	9.68E−03	1.57E−03	−1.01	5.74E−02
RELT	0.03	9.46E−01	−1.31E+00	3.23E−04	1.55E−03	−1.21	5.74E−02
RXRA	−0.32	5.82E−01	−1.32E+00	3.81E−04	1.56E−03	−0.98	5.74E−02
ZFP41	0.33	4.82E−01	−1.55E+00	4.16E−04	1.54E−03	−0.84	5.74E−02
MYL6	0.35	3.25E−04	1.18E−16	1.00E+00	1.56E−03	0.34	5.74E−02
RPL5	−0.22	3.27E−04	1.18E−16	1.00E+00	1.57E−03	−0.22	5.74E−02
SNX3	−0.39	3.30E−04	1.18E−16	1.00E+00	1.59E−03	−0.39	5.79E−02
CCDC66	−1.26	3.42E−04	8.65E−02	8.23E−01	1.60E−03	−0.70	5.82E−02
DCLRE1C	0.78	5.07E−04	1.21E+00	3.86E−01	1.63E−03	0.80	5.90E−02
BAG6	−0.69	4.49E−04	−3.49E−01	4.72E−01	1.63E−03	−0.75	5.91E−02
NSMCE4A	0.07	8.71E−01	−1.32E+00	3.56E−04	1.68E−03	−1.22	5.94E−02
GOLT1B	0.77	1.12E−03	1.86E+00	1.43E−01	1.69E−03	0.88	5.94E−02
ACSL3	−1.01	4.95E−03	−7.79E−01	2.73E−02	1.69E−03	−1.15	5.94E−02
CLIC5	1.70	2.11E−01	2.27E+00	7.99E−04	1.65E−03	0.25	5.94E−02
UBE3A	−0.68	2.13E−02	−1.18E+00	6.15E−03	1.65E−03	−1.24	5.94E−02

Table 2A-2G. Tables related to the 10×, single-cell sequencing on T cells derived from the in-vivo mouse experiments. Table 2A-2F—results of Tissue vs. Tissue differential expression comparisons (both between-tissue comparisons and within-tissue, genotype comparisons) Table 2G—Tissue combined.

Table Description and Headings:

Spleen Ctrl vs KG: Genotype comparison between cells extracted from the Spleen. Positive log FC associated with higher expression in Ctrl cells (compared with KG Cells).

Colon LPL Ctrl vs KO: Genotype comparison between cells extracted from the Colon Lamina Propria. Positive log FC associated with higher expression in Ctrl cells (compared with KO Cells).

Small Intestine LPL Ctrl vs KO: Genotype comparison between cells extracted from the Small Intestine Lamina Propria. Positive log FC associated with higher expression in Ctrl cells (compared with KO Cells).

Colon IEL Ctrl vs KO: Genotype comparison between cells extracted from the Colon Epithelium. Positive log FC associated with higher expression in Ctrl cells (compared with KO Cells).

LPL vs Spleen: Comparison between cells taken from the Lamina Propria (Colon and Small Intestine) vs. Spleen. Positive log FC associated with higher expression in Lamina Propria.

IEL vs Spleen: Comparison between cells taken from the Colon Epithelium vs. Spleen. Positive log FC associated with higher expression in Colon Epithelium.

Tissue Combined: ANOVA-like test for tissue-specific expression. Tests the inclusion of all tissue coefficients simultaneously. Reference level—Spleen.

GeneID: Unique Ensembl identifier for the gene being tested

GeneSymbol: Common symbol used for this gene

log FC: log 2 coefficient of the linear model

log CPM: log 2 counts-per-million average expression

LR: likelihood ratio from which p-values are derived

PValue: Associated p-value for this gene's coefficient

FDR: Benjamini-Hochberg False Discover Rate

TABLE 2A
Spleen Ctrl vs KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
B2m	−0.394594818	12.75972879	1444.404623	0	0
Rpl8	0.468048248	11.72273016	1161.570028	1.3719E−254	1.0569E−250
Rpl18	0.434763597	11.79581946	1104.869146	2.8881E−242	1.4833E−238
Ifi2712a	−1.367469104	10.39056913	1082.936188	1.689E−237	6.5061E−234
Rpl14	0.467863321	11.90179131	999.0735997	2.8552E−219	8.7985E−216
Rpl18a	0.40844965	12.7923771	976.338732	2.4971E−214	6.4125E−211
Rps5	0.425613673	12.21232007	963.9572813	1.2269E−211	2.7005E−208
Rpl17	0.406079885	12.23488643	922.7043597	1.1382E−202	2.1922E−199
Tmsb10	−0.430569001	12.90243511	917.8571853	1.288E−201	2.2051E−198
Rpl13a	0.318130864	13.07963904	880.2603075	1.9189E−193	2.9566E−190
Rps6	0.387608536	12.2862602	879.5297959	2.766E−193	3.8744E−190
Ubb	−0.427975051	11.87538618	854.4454932	7.8543E−188	1.0085E−184
Rpl3	0.392996062	12.07431934	853.9654869	9.9877E−188	1.1838E−184
Rps18	0.441028555	12.56725217	846.7465436	3.7058E−186	4.0784E−183
Rps3	0.326489663	11.9717569	804.8381021	4.7882E−177	4.9185E−174
Rps14	0.361847774	12.58774591	790.9068962	5.1178E−174	4.9284E−171
Rpl29	0.403548785	11.32743279	789.2408217	1.1785E−173	1.0681E−170
Hbb-bs	−1.322316458	9.139899255	774.1781884	2.2197E−170	1.9001E−167
Rps23	0.366380189	12.42732913	772.3794594	5.4626E−170	4.4298E−167
Rpl32	0.342303232	12.55404626	755.0295723	3.2344E−166	2.4918E−163
Pfn1	−0.384163523	12.60884857	710.1081556	1.8951E−156	1.3905E−153
Rplp0	0.316020006	12.54798341	706.666425	1.0618E−155	7.4367E−153
Rpl24	0.345910071	11.74324764	701.1303805	1.6978E−154	1.1374E−151
Rpl21	0.351304057	11.78074345	696.9180321	1.3993E−153	8.9833E−151
Rpl13	0.383449286	12.64381099	695.1792673	3.342E−153	2.0598E−150
Rps24	0.387091918	11.96746781	683.7521651	1.0208E−150	6.0497E−148
Rpl10a	0.399442811	11.25682159	681.0036857	4.0426E−150	2.307E−147
Il7r	1.03867114	9.716667054	678.6930989	1.2857E−149	7.0749E−147
Rps4x	0.331978848	11.96044745	670.9400055	6.24E−148	3.3154E−145
Rpl19	0.284781004	12.05752888	636.4445613	1.9824E−140	1.0182E−137
AW112010	−0.543245425	11.59018241	633.9186211	7.0236E−140	3.491E−137
Rpl4	0.314340007	11.74124626	627.5348359	1.7178E−138	8.2712E−136
Rps19	0.395757239	12.83023757	615.6591388	6.5748E−136	3.0698E−133
Rps7	0.354149685	12.00850254	606.9322923	5.1998E−134	2.3564E−131
Rps3a1	0.299122173	11.79361689	588.9227548	4.2976E−130	1.8919E−127
Rps9	0.332982718	11.94213912	586.8353858	1.2225E−129	5.2324E−127
Rpl23a	0.320735899	12.0892703	578.7802504	6.9088E−128	2.877E−125
Rpl12	0.50132843	10.9317396	576.0114318	2.7649E−127	1.1211E−124
Tmsb4x	−0.270263653	14.50537537	568.0807108	1.4683E−125	5.8009E−123
Rpl23	0.338209227	11.6086807	556.8680667	4.0357E−123	1.5546E−120
Rps13	0.303056725	11.84034228	550.8608727	8.1793E−122	3.0738E−119
mt-Co1	0.322058669	12.25832103	542.7662554	4.7167E−120	1.7304E−117
Rps10	0.322943166	11.23934257	537.8337752	5.5807E−119	1.9997E−116
Rsrp1	−0.547900074	10.29205708	531.868532	1.1077E−117	3.8791E−115
Rpl26	0.317557283	11.55435837	530.2211529	2.5283E−117	8.657E−115
Rps15a	0.328204873	12.2017224	529.9491858	2.8974E−117	9.7049E−115
Rpl6	0.299225556	11.6914612	522.7460832	1.0693E−115	3.5055E−113
Rpl30	0.376508954	10.91773473	522.2066548	1.4011E−115	4.4974E−113
Rplp1	0.335197804	11.71666386	510.0333892	6.2366E−113	1.9611E−110
Rps2	0.358100913	11.64912595	488.7668525	2.6432E−108	8.1453E−106
Hba-a1	−0.920500794	9.095022031	476.6698426	1.1334E−105	3.4242E−103
Rps8	0.286460085	11.80270255	474.8469891	2.8251E−105	8.3711E−103
Rpsa	0.273857677	11.6751798	471.4739516	1.5312E−104	4.4514E−102
Rps16	0.275293093	12.28556335	448.530665	1.5062E−99	4.29771E−97
Rpl36a	0.442909207	10.94274968	446.158868	4.9438E−99	1.38498E−96
Sh3bgrl3	−0.341561055	11.40559323	440.3930387	8.89009E−98	2.44604E−95
Rpl27a	0.294504688	11.64048213	438.3535946	2.47041E−97	6.67791E−95
Cfl1	−0.314322281	11.4854451	437.6224597	3.56364E−97	9.46699E−95
Sub1	−0.411655331	10.76071441	436.4866305	6.29648E−97	1.64434E−94
Myl6	−0.314779512	11.36366325	433.2092611	3.25386E−96	8.35591E−94
Hspa1a	−1.336716152	9.242931161	430.8805791	1.04527E−95	2.64026E−93
Rpl34	0.278104357	11.77163488	430.4209651	1.31603E−95	3.27054E−93
Hnrnpa3	−0.464034776	10.23003684	427.6656651	5.23551E−95	1.28046E−92
Eef2	0.294044382	11.17784701	424.7944526	2.20745E−94	5.31444E−92
Gnb2l1	0.351421332	10.53545348	417.6969993	7.73971E−93	1.83467E−90
Prdx1	−0.443893585	10.25016103	405.1065332	4.25916E−90	9.9432E−88
Rps12	0.392808532	10.82428255	404.9917445	4.5114E−90	1.03749E−87
Eef1b2	0.464170287	10.11001442	404.8440126	4.85814E−90	1.1008E−87
Rplp2	0.281131176	11.78981311	403.697428	8.63098E−90	1.92734E−87
Rps27a	0.272166684	11.85785907	403.2559785	1.07685E−89	2.37031E−87
Eef1a1	0.230267534	12.30506479	395.0564055	6.56311E−88	1.42429E−85
Serf2	−0.294324233	10.78514217	392.1550889	2.81006E−87	6.01352E−85
Rpl11	0.246557229	11.72200823	387.7373487	2.57314E−86	5.43108E−84
Rps20	0.363934892	11.13696988	381.8405125	4.94601E−85	1.02984E−82
Rps11	0.226974358	12.39603371	378.4530376	2.70247E−84	5.55196E−82
Hspa1b	−0.944735319	9.137289838	356.5410016	1.59507E−79	3.2338E−77
Rpl5	0.359361035	10.54545781	341.8660149	2.50316E−76	5.00892E−74
Ms4a4b	−0.306121376	11.83323511	339.3968419	8.63432E−76	1.70561E−73
Hmgn2	−0.9381794	9.557710879	338.9838185	1.06213E−75	2.07156E−73
S100a11	−0.412995978	10.68782699	337.6388092	2.08498E−75	4.01566E−73
Cd3e	−0.387729698	10.30595328	336.0488677	4.62777E−75	8.80304E−73
Hnrnpa2b1	−0.40798608	10.28844325	326.7138354	4.99493E−73	9.38559E−71
Rps25	0.270160344	11.11755248	325.1522005	1.09312E−72	2.02925E−70
Rpl36	0.292774874	11.53238972	323.7246145	2.23673E−72	4.10281E−70
Rpl9	0.249983812	11.74080817	321.4482229	7.00566E−72	1.26992E−69
Plac8	1.012302318	9.652571139	318.2423485	3.49751E−71	6.26624E−69
Tsc22d3	0.697894281	9.554940607	317.6897125	4.61464E−71	8.17268E−69
Myl12a	−0.335034242	10.60425227	314.7301327	2.03621E−70	3.56521E−68
Bcl2	0.906160685	9.588703364	313.2636118	4.24894E−70	7.35592E−68
Hmgb2	−0.696396429	11.06074981	311.7640665	9.01443E−70	1.54327E−67
Stat1	−0.697258014	9.534895283	306.4652959	1.28603E−68	2.17748E−66
Psme2	−0.393710072	10.13966069	300.8422195	2.15914E−67	3.61609E−65
Hba-a2	−0.676429421	9.081900495	299.835836	3.57715E−67	5.92653E−65
Hspa8	0.261320173	11.52981983	289.4131945	6.67446E−65	1.09404E−62
Tpt1	0.204354222	11.56490731	286.7839208	2.49646E−64	4.04899E−62
Acp5	0.600613336	9.490932375	273.4792682	1.97986E−61	3.17768E−59
Ms4a6b	−0.294195147	10.88050411	272.369232	3.45584E−61	5.48944E−59
Pdia3	−0.40435809	9.947067745	268.7935278	2.07901E−60	3.26871E−58
Cyba	−0.298957075	10.70076607	257.3695116	6.42556E−58	1.00005E−55
Rpl7	0.20397207	11.24994647	255.4080291	1.71985E−57	2.64994E−55
Dusp2	0.695936163	9.421733241	249.5519128	3.25182E−56	4.9608E−54
Calm3	−0.457829973	9.738712517	249.1451719	3.98842E−56	6.02486E−54
Gm9844	−0.598681314	9.498462623	246.8932384	1.23526E−55	1.84785E−53
Cdc42	−0.266127107	10.66030324	245.2729444	2.78624E−55	4.12793E−53
Ppia	−0.24330961	11.96233228	242.3342812	1.21825E−54	1.7877E−52
Hbb-bt	−0.498398902	9.069464739	241.8093712	1.58558E−54	2.30477E−52
Fau	0.185333561	12.0738768	241.4373304	1.9112E−54	2.75213E−52
Rpl7a	0.267864394	10.57501611	239.9695494	3.99342E−54	5.69728E−52
Hsp90b1	−0.491697038	9.746474506	236.6017656	2.16618E−53	3.06206E−51
Eno1	−0.348932991	10.05496627	233.3201331	1.12538E−52	1.57635E−50
Ddit4	0.538960929	9.672816531	233.2496451	1.16592E−52	1.61843E−50
Ptma	−0.370972377	11.21833373	223.7026613	1.40854E−50	1.93775E−48
Ybx1	−0.285294787	10.48744422	222.7185656	2.30893E−50	3.14832E−48
H3f3b	−0.260942477	11.14558946	221.6453302	3.95823E−50	5.34986E−48
Itgb1	−0.666523293	10.23396472	220.1474805	8.39874E−50	1.12529E−47
Fxyd5	0.269233669	10.67479998	216.001067	6.74044E−49	8.95317E−47
Klf2	0.339556672	11.0136358	215.1873446	1.01437E−48	1.33585E−46
Gm10076	−0.558406186	9.458585833	213.9666957	1.87276E−48	2.44538E−46
Eef1g	0.293402137	10.47224312	211.2066869	7.49211E−48	9.70071E−46
Ifngr1	0.49965726	9.929229799	209.6778484	1.61492E−47	2.07355E−45
Ly6a	−0.341921357	10.6371311	209.1069354	2.15134E−47	2.73949E−45
Tmbim6	−0.296577287	10.12994397	206.583007	7.64514E−47	9.65543E−45
Anxa2	−0.517046321	10.04332864	202.0678195	7.38922E−46	9.25635E−44
Cd52	−0.210917208	12.51348717	195.7909614	1.73136E−44	2.15135E−42
Arl6ip1	−0.405136227	10.09908166	195.5723749	1.93238E−44	2.38192E−42
Ndufa3	−0.334866237	9.839878945	195.390331	2.11749E−44	2.58939E−42
Tuba1b	−0.67879043	10.00008493	195.1176906	2.42843E−44	2.94624E−42
Rtp4	−0.793831448	9.147652434	194.6736275	3.03559E−44	3.65409E−42
Capg	−0.495718911	9.935583727	193.4909519	5.50006E−44	6.56937E−42
Hnrnpdl	−0.50199538	9.362300942	193.1180335	6.63376E−44	7.86254E−42
Tma7	−0.269138523	10.19317796	189.7301451	3.64112E−43	4.28262E−41
Eif3f	0.233701824	10.65753688	188.392098	7.1336E−43	8.32686E−41
Lgals1	−0.38078271	12.63361906	187.9718066	8.81159E−43	1.02082E−40
Rbm3	0.277674976	10.70166498	184.7747377	4.39516E−42	5.05378E−40
Uba52	−0.408087039	9.952856342	183.6984284	7.55001E−42	8.61708E−40
Sh2d1a	−0.491016053	9.642697413	179.860533	5.19842E−41	5.88951E−39
Ctla2a	0.588010327	9.748854778	179.6570959	5.75825E−41	6.47614E−39
Tap1	−0.415743191	9.53747222	178.4958846	1.03237E−40	1.15267E−38
Txn1	−0.325654396	10.05357118	176.6338416	2.63285E−40	2.91849E−38
Arl4c	0.407528267	9.783232926	176.3804994	2.99053E−40	3.29129E−38
Gltscr2	0.305069843	10.068061	174.8774404	6.36752E−40	6.95821E−38
Ccng1	−0.542528285	9.308847938	174.5743604	7.41577E−40	8.04663E−38
Cox7c	−0.258404342	10.16243436	174.2395106	8.77566E−40	9.45563E−38
Sec61g	−0.28454506	10.08219258	173.0412387	1.60311E−39	1.71533E−37
Psmb9	−0.349239421	9.782360113	172.413577	2.19805E−39	2.3357E−37
Arhgdib	−0.188477383	11.23130777	172.327412	2.29539E−39	2.42242E−37
Rpl35a	0.170485936	11.73666243	171.8379009	2.93605E−39	3.07746E−37
Wdr1	−0.338161055	9.787807742	171.5059364	3.46947E−39	3.612E−37
Itgb2	−0.319512386	10.05832132	170.556406	5.59298E−39	5.78366E−37
Atp5k	−0.362856145	9.63851564	164.5794993	1.13023E−37	1.16098E−35
Rabac1	0.405039787	9.640125814	162.7941386	2.77456E−37	2.83116E−35
Rps27rt	−0.447016904	10.76991423	162.249778	3.64854E−37	3.69847E−35
Alyref	−0.535399757	9.490162415	162.2144125	3.71404E−37	3.74025E−35
Dtx1	0.560691764	9.35639362	160.7218922	7.86911E−37	7.8732E−35
Ndufa4	−0.312282402	9.983525258	159.2954748	1.6128E−36	1.60323E−34
Lsm5	−0.407548255	9.652256708	159.0796182	1.79781E−36	1.77568E−34
Il17re	0.590542136	9.074926885	158.4513557	2.46614E−36	2.42028E−34
Tpm3-rs7	−0.294787222	9.951730222	158.186127	2.8182E−36	2.74828E−34
Tapbp	−0.360215199	9.633906361	158.1391765	2.88556E−36	2.79627E−34
Rpl27	0.199841065	11.18362874	157.30377	4.39311E−36	4.23057E−34
Tmem258	−0.318818743	9.706925426	157.1801446	4.67505E−36	4.47411E−34
Btg1	0.36057321	10.56026433	157.00365	5.10919E−36	4.85941E−34
mt-Co2	0.178449904	11.53302585	156.9703025	5.19564E−36	4.91132E−34
Tmed2	−0.296688017	9.866059965	156.6971734	5.96104E−36	5.60047E−34
Satb1	0.535626973	9.41396337	154.740485	1.59553E−35	1.48994E−33
Lcp1	−0.251556666	10.3183034	154.3223776	1.96914E−35	1.82774E−33
Dnajc15	0.31387085	9.931084321	153.721031	2.66499E−35	2.45881E−33
Cd7	0.668431811	9.510504639	153.5856393	2.85288E−35	2.6165E−33
Sepw1	−0.27518717	10.11754145	150.0979543	1.65025E−34	1.50456E−32
Ewsr1	−0.345594062	9.627042746	150.0365057	1.70208E−34	1.54269E−32
Cdkn2c	−0.636702077	9.207647914	149.3358462	2.42175E−34	2.18213E−32
Actr2	−0.34076163	9.642504656	148.8367424	3.11334E−34	2.78897E−32
Tubb5	−0.417183951	10.30641471	145.4558067	1.70731E−33	1.52059E−31
Ngp	−0.763681094	9.100007972	145.0011994	2.14634E−33	1.90062E−31
Isg15	−0.719651949	9.17520338	143.8950283	3.74577E−33	3.29799E−31
Tceb2	−0.237515156	10.20307649	142.9938076	5.89637E−33	5.16201E−31
Rps15	0.168454585	11.47619806	142.2891217	8.40744E−33	7.31875E−31
Cytip	0.360334035	9.597191973	142.1887143	8.84338E−33	7.65498E−31
Clic1	−0.218361527	10.68495514	140.1304999	2.49274E−32	2.1457E−30
Ube2s	−0.454337114	9.814291968	137.7313987	8.3432E−32	7.14178E−30
Klf13	0.398593604	9.628466206	137.2456797	1.06552E−31	9.07045E−30
Prr13	−0.278815789	10.28885144	136.8919515	1.27328E−31	1.07795E−29
Cdkn2a	−0.609121377	9.14054978	135.9701759	2.0255E−31	1.7054E−29
Cox17	−0.329594045	9.66363411	135.6492986	2.38076E−31	1.99363E−29
Stmn1	−0.82419623	9.807967069	133.4210017	7.31357E−31	6.09121E−29
Uqcrb	−0.273218922	9.8678254	132.0266827	1.47622E−30	1.22288E−28
Pkm	−0.240731434	10.20918593	131.7398269	1.70571E−30	1.40543E−28
2810417H13Rik	−0.967373055	9.637529027	131.3105515	2.11748E−30	1.73543E−28
Rbm39	0.23545176	10.26100638	130.597203	3.0331E−30	2.4727E−28
Ube2n	−0.31188351	9.608778462	129.8514637	4.41618E−30	3.58129E−28
Ywhah	−0.296531841	9.906272871	129.0537086	6.60079E−30	5.32486E−28
Calm1	−0.188744202	11.10279906	128.1469284	1.04234E−29	8.36476E−28
Lmnb1	−0.553332185	9.492228417	127.3329829	1.57079E−29	1.25403E−27
Pdia4	−0.417941212	9.32860591	126.601842	2.27046E−29	1.80326E−27
Psma2	−0.250801241	9.885834901	126.3445928	2.5847E−29	2.04231E−27
Ppp4c	−0.306484664	9.664046883	125.3439349	4.27957E−29	3.36427E−27
mt-Co3	0.148713029	12.38729466	124.5410801	6.41375E−29	5.0164E−27
Cox6b1	−0.201143661	10.26082572	122.5363554	1.76158E−28	1.37083E−26
Pomp	−0.26160036	9.873253648	122.454949	1.83536E−28	1.42106E−26
Dbi	−0.365045445	9.623042963	121.9090122	2.41671E−28	1.86183E−26
Cox7a2l	0.25365352	10.09942318	121.8347741	2.50885E−28	1.91816E−26
1810037I17Rik	−0.312590156	9.676973201	121.8301355	2.51473E−28	1.91816E−26
Zeb2	−0.774138414	9.127424397	121.6173644	2.79941E−28	2.12479E−26
Atp5j	−0.228873779	10.1072932	121.0463043	3.73316E−28	2.81963E−26
Npm1	0.235150388	10.40971878	119.8911973	6.68273E−28	5.0228E−26
Atp1b3	0.318801787	9.708024434	119.2417087	9.27148E−28	6.93471E−26
Tmem176a	0.763367915	9.182539974	119.1449011	9.73518E−28	7.24636E−26
Pdcd4	0.420098355	9.642492644	118.9155041	1.09287E−27	8.09565E−26
Cd247	−0.333565058	9.579185183	118.7057752	1.21475E−27	8.95546E−26
Rpl22l1	0.208609039	10.83580793	118.6842487	1.22801E−27	9.01007E−26
Hnrnpa1	−0.369311881	9.492414828	118.3490179	1.45412E−27	1.06185E−25
Shfm1	−0.229553147	10.0031327	117.0924606	2.73992E−27	1.99135E−25
Rps21	0.238376482	10.63600103	116.6726207	3.38588E−27	2.44928E−25
Tceb1	−0.31869581	9.529590194	116.660403	3.40681E−27	2.4529E−25
Srrm2	0.30189204	9.744719687	116.4576604	3.7735E−27	2.70428E−25
Canx	−0.374606446	9.405124767	116.1573065	4.39053E−27	3.13191E−25
Cenpa	−0.706828827	9.37944655	115.835444	5.16417E−27	3.6668E−25
Lztfl1	0.577921378	9.128139284	115.7740802	5.32646E−27	3.76468E−25
Pglyrp1	−0.371039398	9.700031151	114.7295603	9.01963E−27	6.34587E−25
Ifi27	−0.367396341	9.485380503	114.4243909	1.05202E−26	7.36797E−25
Cox6c	−0.199529709	10.2464669	114.0849521	1.24844E−26	8.70403E−25
Myl12b	−0.219178436	10.11053816	113.7928401	1.44659E−26	1.00401E−24
Igfbp4	0.750607125	9.125936959	113.3553129	1.80375E−26	1.24628E−24
S100a9	−0.788616203	9.108492579	112.2912902	3.08488E−26	2.12196E−24
Nkg7	−0.352273992	11.35660318	112.1715336	3.27696E−26	2.24406E−24
Wsb1	−0.434373342	9.210910529	110.9196712	6.16175E−26	4.2009E−24
Cox7a2	−0.244165019	9.904372175	110.9093932	6.19378E−26	4.20413E−24
Erh	−0.267511865	9.871191334	110.0778456	9.42172E−26	6.3671E−24
Cks1b	−0.63195329	9.374265449	109.9305553	1.01484E−25	6.82826E−24
Ube2l6	−0.474836411	9.105066783	108.9541719	1.66082E−25	1.1126E−23
Capza1	−0.321589878	9.49698091	108.9198525	1.68982E−25	1.12713E−23
Pik3ip1	0.517288658	9.141032834	108.454519	2.13698E−25	1.41925E−23
S100a10	−0.239806506	11.56390824	107.633748	3.23332E−25	2.13816E−23
Cd160	0.699025169	9.159417004	107.4577704	3.53355E−25	2.32671E−23
Rbx1	−0.227759516	9.906193708	107.2191678	3.98563E−25	2.61322E−23
Gzma	1.120093335	10.5303845	106.7164441	5.13647E−25	3.3535E−23
Camp	−0.466568955	9.07752253	106.5101125	5.70009E−25	3.70578E−23
Ctsb	−0.318746012	9.577536052	106.4526506	5.86779E−25	3.79878E−23
Vcp	−0.290019259	9.600777235	105.6169585	8.94588E−25	5.76729E−23
Ppp1ca	−0.179862972	10.60111574	105.4922694	9.52689E−25	6.11626E−23
Ran	−0.290507861	10.03079907	105.213453	1.09663E−24	6.98217E−23
Zbp1	−0.425278438	9.318275709	105.2157644	1.09535E−24	6.98217E−23
H2-D1	−0.124251699	12.15670663	104.0015903	2.02154E−24	1.2818E−22
Myc	0.512412291	9.116237101	103.4698379	2.64389E−24	1.66955E−22
Atp8a2	0.33886315	9.069620419	101.2967204	7.91868E−24	4.98004E−22
Use1	0.333960173	9.51419359	100.7604386	1.03809E−23	6.502E−22
Iigp1	−0.614742376	9.132296579	100.6538941	1.09546E−23	6.83355E−22
Eif4g2	−0.258455174	9.738725432	100.5005074	1.18367E−23	7.354E−22
Cdk1	−0.677159182	9.209723077	100.3484505	1.27812E−23	7.90893E−22
Pttg1	−0.428228606	9.427760824	100.0562925	1.48127E−23	9.12934E−22
Tomm7	−0.264886375	9.683676151	99.52716681	1.93491E−23	1.18777E−21
Ubl5	−0.217789014	9.954866528	98.70357382	2.93272E−23	1.79315E−21
Gnb1	−0.310852241	9.598111237	98.56239704	3.14943E−23	1.91804E−21
Hnrnpl	−0.318458149	9.458965323	98.41828059	3.38718E−23	2.05471E−21
Tecpr1	0.380153257	9.37320746	98.26258599	3.66424E−23	2.21406E−21
Hprt	−0.296022775	9.583675978	97.63539867	5.02967E−23	3.02723E−21
Tmem176b	0.699466756	9.197393426	97.44004885	5.55118E−23	3.32812E−21
Ywhaq	−0.251767896	9.876197724	97.04439604	6.77901E−23	4.04849E−21
Tmem234	0.291933521	9.600002857	96.25813041	1.0084E−22	5.99902E−21
Cd3g	−0.157389506	10.99201317	95.96100216	1.17169E−22	6.94361E−21
Arpc5	−0.208198677	10.28464975	95.71542866	1.32643E−22	7.83049E−21
Lockd	−0.440867625	9.277369705	95.06964861	1.83803E−22	1.08093E−20
Ctsd	−0.266169224	10.13340333	94.71984408	2.19329E−22	1.28495E−20
Atp5j2	−0.19242437	10.13808543	94.60218126	2.32762E−22	1.35848E−20
Pyhin1	−0.418379849	9.287028936	92.6509167	6.23817E−22	3.62708E−20
Tox	−0.508928639	9.127330992	92.52335084	6.65351E−22	3.85403E−20
Gnai2	−0.206265604	10.42766401	92.48466885	6.78484E−22	3.91538E−20
ler2	0.319611087	9.601826126	92.17549933	7.93207E−22	4.56035E−20
Erdr1	0.464102541	9.15671915	91.25689209	1.2618E−21	7.22743E−20
Polr2k	−0.3265931	9.353097422	91.23516042	1.27573E−21	7.28017E−20
Hspa5	−0.281941206	9.834386077	90.86640181	1.53708E−21	8.73921E−20
Calr	−0.270251962	9.906445352	90.85450983	1.54634E−21	8.75957E−20
Hnrnpc	−0.276698646	9.578766056	90.02748793	2.34874E−21	1.32562E−19
Ccnb1	−0.644827058	9.19263149	88.81860324	4.32727E−21	2.43338E−19
Ubc	−0.215315232	10.26377247	88.71348916	4.56343E−21	2.55685E−19
Gltp	−0.291647317	9.558026501	88.50731529	5.06472E−21	2.82744E−19
Lyz2	−0.428623551	9.078273475	88.19924611	5.91825E−21	3.292E−19
Usmg5	−0.24683068	9.690988814	87.30309401	9.31021E−21	5.16014E−19
Top2a	−0.71236757	9.359267312	86.94889885	1.11362E−20	6.15004E−19
Prc1	−0.564899799	9.171688394	86.75767354	1.22667E−20	6.75019E−19
Mcm4	−0.46256567	9.182537346	86.62660008	1.31072E−20	7.18705E−19
Fkbp5	0.406142801	9.186149988	86.58136614	1.34105E−20	7.32726E−19
Nebl	0.450513843	9.267107621	86.56702713	1.35081E−20	7.3545E−19
Ube2c	−0.742287675	9.351481647	86.45041123	1.43285E−20	7.77374E−19
Serinc3	−0.415468602	9.341672534	86.3641674	1.49672E−20	8.06347E−19
Zfos1	0.384189119	9.321085288	86.37049565	1.49194E−20	8.06347E−19
Atp5b	−0.177130163	10.37817024	86.3041995	1.54281E−20	8.28277E−19
Hn1	−0.246470949	9.902695291	85.15461992	2.75922E−20	1.47618E−18
Sumo2	−0.192747248	10.32612922	85.14414532	2.77388E−20	1.47889E−18
Kpna2	−0.504832734	9.174376154	84.76049621	3.36786E−20	1.78938E−18
Nrp1	−0.485433003	9.201842589	84.64158269	3.57663E−20	1.89377E−18
Cd48	−0.2378112	10.47381146	84.55076715	3.74475E−20	1.976E−18
Sec11c	−0.261864887	9.668953903	84.28019512	4.29395E−20	2.25806E−18
Psma1	−0.24204948	9.631502029	84.05535049	4.81115E−20	2.52143E−18
Pdia6	−0.351868353	9.419021935	83.95203204	5.06926E−20	2.6477E−18
Il2rg	−0.24963658	9.757825523	83.84407232	5.35379E−20	2.78686E−18
Gstp1	−0.388378062	9.150648089	83.63583556	5.94849E−20	3.08601E−18
Phf11b	−0.316529852	9.423111324	83.42271577	6.62563E−20	3.42576E−18
Lsp1	−0.184489544	10.86029924	83.39875856	6.70641E−20	3.45593E−18
Eif1	−0.129281955	11.09222913	83.30726216	7.02411E−20	3.60758E−18
Cd82	−0.251979593	9.997069085	83.03896084	8.0452E−20	4.11829E−18
Cox6a1	−0.18589785	10.09965413	82.98347132	8.27424E−20	4.2215E−18
Mcm6	−0.434741928	9.318941361	82.92037214	8.54262E−20	4.34405E−18
Klrg1	−0.66112222	9.201832156	82.30022292	1.16909E−19	5.92544E−18
Tpx2	−0.545063238	9.154537098	82.14046294	1.26751E−19	6.40321E−18
Gm4955	−0.422636634	9.199318312	82.10881749	1.28797E−19	6.48529E−18
Birc5	−0.689978042	9.419044284	82.03479723	1.33712E−19	6.71085E−18
Bcl2a1d	−0.405058381	9.237077308	81.62305429	1.64682E−19	8.21171E−18
Arpc3	−0.180051392	10.13466789	81.62580935	1.64452E−19	8.21171E−18
Pim1	0.390466534	9.465218659	80.9601044	2.30321E−19	1.14477E−17
Ly6c1	0.593973796	9.127161031	80.76900017	2.53707E−19	1.25695E−17
Irf9	−0.394471258	9.19085953	80.46333485	2.96149E−19	1.46252E−17
H2-Ke6	0.382623802	9.247819067	80.1878396	3.40456E−19	1.67596E−17
Rrm2	−0.775593179	9.444956821	80.1075085	3.54582E−19	1.73994E−17
Gm12840	0.522105321	9.292404221	80.07311968	3.60808E−19	1.76486E−17
Reep5	−0.24357654	9.869875747	80.00448864	3.7356E−19	1.82146E−17
Ghitm	−0.274937749	9.459227183	79.78746135	4.1693E−19	2.02652E−17
Ltf	−0.187637988	9.059775685	79.75490723	4.23857E−19	2.05371E−17
Gbp4	−0.389063896	9.207766155	79.50041075	4.82125E−19	2.32871E−17
Glrx	−0.340129563	9.454384182	79.40690341	5.05492E−19	2.43394E−17
Kif20a	−0.451598251	9.112260701	79.35667874	5.18507E−19	2.48883E−17
Psmb2	−0.226426476	9.718811454	79.29191389	5.35785E−19	2.56378E−17
mt-Atp6	0.121761131	12.70239722	78.91658426	6.47886E−19	3.0906E−17
Smc4	−0.3872419	9.525409897	78.88407307	6.58636E−19	3.13218E−17
Gpr183	0.431381035	9.245014018	78.76805609	6.98474E−19	3.31141E−17
Ifit1	−0.619753615	9.092845233	78.68290656	7.29238E−19	3.44666E−17
Mad2l1	−0.454685107	9.179564856	78.45025661	8.20383E−19	3.86558E−17
Ccna2	−0.640701651	9.236667297	78.27864952	8.94838E−19	4.20356E−17
Tacc3	−0.502848596	9.173056684	77.6145441	1.25244E−18	5.86555E−17
Hnrnpk	−0.164547584	10.2842712	77.29445282	1.47279E−18	6.8766E−17
Klrc1	−0.449082904	9.467992396	77.21304596	1.53476E−18	7.1443E−17
H2afx	−0.539317748	9.440262415	76.90569528	1.79319E−18	8.32214E−17
Lcn2	−0.206390753	9.061453383	76.82683074	1.86625E−18	8.63518E−17
Rpa3	−0.380997971	9.230128239	76.68099999	2.00927E−18	9.26912E−17
Rpl35	−0.158961239	11.13831905	76.53702308	2.16123E−18	9.94037E−17
Fkbp2	−0.362439923	9.306762226	76.51376299	2.18684E−18	1.00282E−16
Slc25a5	0.166065043	10.50386566	76.50621506	2.19521E−18	1.00367E−16
Cks2	−0.49697529	9.402047794	76.41366059	2.30054E−18	1.04872E−16
Atp5e	−0.167024801	10.21622649	76.28704667	2.45288E−18	1.11486E−16
Banf1	−0.308953202	9.400476146	75.55734849	3.54946E−18	1.60853E−16
Emb	0.269409659	9.697311771	75.23259584	4.18402E−18	1.89054E−16
Gbp2	−0.415666499	9.261598091	74.89491319	4.96447E−18	2.23663E−16
Cenpe	−0.487374968	9.137306059	74.4729421	6.14751E−18	2.76154E−16
Nusap1	−0.72741448	9.229804121	74.10995709	7.38847E−18	3.30935E−16
0610010K14Rik	−0.344310005	9.213495182	73.8659897	8.36044E−18	3.73385E−16
Cdc20	−0.647281342	9.224041274	73.85642712	8.40104E−18	3.74113E−16
Capza2	−0.218860051	9.723851677	73.74804301	8.87522E−18	3.94091E−16
Gramd3	0.340204113	9.380450868	73.42778822	1.04386E−17	4.62178E−16
Sept7	−0.235753818	9.711512245	73.25364665	1.14014E−17	5.03362E−16
Actn2	0.525915728	9.209592958	73.0212856	1.28259E−17	5.64633E−16
Fbxo5	−0.558938262	9.177037636	72.85443826	1.39573E−17	6.12691E−16
Kif22	−0.493813608	9.15961124	72.47963983	1.68764E−17	7.38727E−16
Xaf1	−0.393829891	9.158800712	72.38895324	1.767E−17	7.71274E−16
2700094K13Rik	−0.315350601	9.485438786	71.71621114	2.48483E−17	1.08153E−15
Ranbp1	−0.272803989	9.7032701	71.66786291	2.54646E−17	1.10524E−15
Ssbp2	0.400331997	9.148764243	71.61265527	2.61872E−17	1.1334E−15
S100a8	−0.942163941	9.144819806	71.51122989	2.75685E−17	1.18985E−15
Rbbp7	−0.324552015	9.3940054	71.46912886	2.8163E−17	1.21211E−15
Rpl22	0.157903002	10.51485597	71.45778022	2.83255E−17	1.21571E−15
Rbbp4	−0.279482571	9.494526185	71.18615873	3.25061E−17	1.39126E−15
Emp3	−0.193585605	10.48526769	71.03770835	3.50462E−17	1.49582E−15
Rpl31	0.137375726	10.8998412	70.82973716	3.89423E−17	1.65752E−15
Dek	−0.326257475	9.575932497	70.56532173	4.45276E−17	1.89003E−15
Pdcd1	−0.412579078	9.161776078	70.07124061	5.72009E−17	2.42129E−15
Pde2a	0.378065671	9.096741072	69.85305389	6.38911E−17	2.69708E−15
Timp2	0.426434752	9.155914851	69.76664138	6.67523E−17	2.81016E−15
Car5b	−0.401522657	9.137375624	69.60125161	7.25908E−17	3.04763E−15
Spc25	−0.494263147	9.140489027	69.5855285	7.31718E−17	3.06367E−15
Nap1l1	−0.297646823	9.452697682	69.31010443	8.41374E−17	3.51325E−15
Ifng	−0.470155564	9.195873407	69.27531811	8.56346E−17	3.5661E−15
Plscr1	−0.366671337	9.165831717	69.15277185	9.11242E−17	3.78448E−15
Ncapg	−0.441222811	9.11714452	69.07600109	9.47412E−17	3.92412E−15
Capzb	−0.165768529	10.32096611	68.88018602	1.04631E−16	4.32212E−15
Mrps21	−0.244713874	9.534978075	68.45138093	1.30045E−16	5.35756E−15
Ccnb2	−0.590482352	9.326857307	68.23617077	1.45041E−16	5.95943E−15
Rpl39	0.126575039	11.54192101	68.06484771	1.58206E−16	6.48308E−15

TABLE 2B
Colon LPL Ctrl vs KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Hsp90aa1	−1.296438691	10.855082	1796.189057	0	0
Rpl35	0.579539672	11.07230469	1743.711997	0	0
Dnaja1	−1.10964182	10.81123241	1596.155309	0	0
Dnajb1	−2.33531776	10.34134508	2179.594615	0	0
Hsp90ab1	−0.982797393	11.27051881	2052.383487	0	0
Ubb	−0.694803098	12.95887764	2028.318147	0	0
Hspa8	−0.737680613	12.41996892	1606.669603	0	0
Hspa1a	−3.015660998	11.06978681	1470.85346	0	0
Gm8730	0.693343323	10.36024832	1323.369049	9.437E−290	1.6608E−286
Malat1	−0.593417954	14.67213889	1137.684854	2.1302E−249	3.374E−246
Hspe1	−1.038624464	10.30562386	1074.381316	1.2219E−235	1.7594E−232
Rbm3	0.546053782	10.66488443	928.3699119	6.678E−204	8.8144E−201
Gm10076	0.869179815	9.517410456	890.0933345	1.3977E−195	1.703E−192
Chchd2	−0.492618776	10.4561239	823.1952025	4.8876E−181	5.5296E−178
Hsph1	−1.267762622	9.425286154	757.4238333	9.7545E−167	1.03E−163
Jund	−0.668130275	11.8228244	748.5293847	8.3785E−165	8.2942E−162
Rplp0	0.268693712	12.37075798	671.3237314	5.1491E−148	4.7975E−145
Hspa1b	−1.599727007	9.248134998	620.7646715	5.0985E−137	4.4864E−134
Ddx5	−0.386151289	11.1817586	603.7799595	2.5213E−133	2.1019E−130
H2-D1	−0.247894687	12.34520231	546.2254928	8.3388E−121	6.6039E−118
H2-K1	−0.323864629	11.66121845	544.5044601	1.9747E−120	1.4894E−117
Hspd1	−0.837182162	9.767644293	537.1408453	7.8966E−119	5.6852E−116
Fosb	−1.164635491	9.364618516	517.7187705	1.327E−114	9.1381E−112
H2-Q7	−0.422171081	10.64378871	516.4435666	2.5136E−114	1.6589E−111
Eef2	0.274087183	11.28374076	505.1485441	7.2071E−112	4.5661E−109
mt-Co1	0.272956043	12.17896251	503.0154954	2.0983E−111	1.2783E−108
Eno1	0.551566329	9.902385531	499.021854	1.5517E−110	9.1025E−108
Rpl32	0.22194434	12.42741546	492.9658819	3.2246E−109	1.8241E−106
Rgcc	−1.118136609	9.550274028	486.3554888	8.8475E−108	4.8323E−105
Rpl6l	0.478179424	10.15590832	484.5969007	2.1354E−107	1.1274E−104
Fth1	−0.335462508	11.63346883	472.0661866	1.138E−104	5.8146E−102
B2m	−0.19628426	12.80490735	466.5540764	1.8015E−103	8.9168E−101
Rpl29	0.283720025	11.21054861	459.7879827	5.346E−102	2.5659E−99
Arhgdib	0.386013595	10.67695562	447.048832	3.165E−99	1.47443E−96
Lmna	−0.94001507	9.757618312	441.2087912	5.90701E−98	2.67317E−95
Crem	−0.759239846	10.12298761	430.3980194	1.33125E−95	5.85713E−93
Ubald2	−0.477416083	10.61574622	420.040934	2.39076E−93	1.02344E−90
Eif1	−0.24664365	11.86551627	418.9616487	4.10635E−93	1.71159E−90
Odc1	−0.632215319	10.52031093	405.1128919	4.24561E−90	1.72426E−87
Rpl3	0.197968255	12.08615037	391.114481	4.73428E−87	1.87466E−84
Gm2000	0.620129441	9.580454828	389.15096	1.26682E−86	4.89394E−84
Gm11808	0.472407768	10.12797784	386.6017314	4.54666E−86	1.71463E−83
Hspa5	−0.400182424	11.01753787	383.96611	1.70407E−85	6.27694E−83
Coro1a	0.372189609	10.69909524	376.690267	6.53959E−84	2.3541E−81
Prr7	−0.593803345	9.822329769	370.3859824	1.54225E−82	5.42837E−80
Rps11	0.197413243	12.24071835	370.1436999	1.74143E−82	5.9962E−80
Limd2	0.478902583	9.998680235	369.6083445	2.27756E−82	7.67538E−80
Bin2	0.616456928	9.522717136	361.9853895	1.04058E−80	3.43369E−78
Rpl22l1	0.33367178	10.80916121	354.53505	4.361E−79	1.40967E−76
Eif2s3y	0.846852212	9.189708727	353.9086731	5.97013E−79	1.89122E−76
Cd52	0.329531615	11.76968202	350.1895093	3.85364E−78	1.19682E−75
Gm9493	0.397130464	10.27648549	349.5148795	5.40483E−78	1.64629E−75
Cdkn1a	−0.794410975	9.655752351	348.30647	9.90677E−78	2.96063E−75
Junb	−0.439739713	11.78308969	344.4692692	6.78518E−77	1.9902E−74
Rpl27-ps3	0.564371664	9.812969165	341.4961833	3.01322E−76	8.67752E−74
Slc25a5	0.356515832	10.33629693	334.2365652	1.14835E−74	3.24799E−72
Klf2	0.966338109	9.87646467	331.2250796	5.19954E−74	1.44483E−71
Rac2	0.275882336	11.06163595	325.2530092	1.03923E−72	2.83799E−70
Rpl15	0.276369843	10.68387878	321.477891	6.90219E−72	1.85295E−69
Gm9844	0.5647633	9.461659088	318.7422393	2.72189E−71	7.18533E−69
Ptprcap	0.476661033	9.942632577	318.6711031	2.82076E−71	7.32426E−69
Rpl24	0.194887307	11.7645521	317.3192251	5.55699E−71	1.41963E−68
Fus	−0.428773907	9.866010533	316.630995	7.84794E−71	1.97307E−68
Rpl13-ps3	0.525225173	9.582684681	312.3660701	6.66497E−70	1.64948E−67
S100a6	0.525962148	11.03347261	310.3419701	1.83962E−69	4.48274E−67
Eif3f	0.27112225	10.61842693	309.6198908	2.64259E−69	6.34181E−67
H2-Q6	−0.488240508	9.705178604	307.3949645	8.06718E−69	1.90711E−66
Eif5	−0.462609431	9.797249973	305.4905297	2.09703E−68	4.88455E−66
Apobec3	0.625969666	9.401539187	304.9819365	2.70648E−68	6.21274E−66
Gm9843	0.405097402	10.47924093	303.2731905	6.37773E−68	1.4431E−65
H1f0	0.85409956	9.356160563	303.2280563	6.52377E−68	1.45535E−65
Cnn2	0.459644323	9.811452628	296.4205581	1.98439E−66	4.36538E−64
Sertad1	−0.717279998	9.235302519	293.8116324	7.34606E−66	1.59389E−63
Lsp1	0.381730916	10.25962615	291.7842784	2.03134E−65	4.34789E−63
Rpl9-ps6	0.500123891	9.813279691	290.7553132	3.40393E−65	7.18865E−63
Rpl10-ps3	0.553256709	9.514158932	289.0389389	8.05312E−65	1.67833E−62
Ubc	−0.375514664	10.9972925	286.6902384	2.6166E−64	5.38238E−62
Zfp3612	0.599554856	9.691467426	281.0413259	4.45323E−63	9.0429E−61
Pycard	0.595529185	9.493681974	279.3579798	1.03634E−62	2.0778E−60
Gm10073	0.522116351	9.637520171	278.0697639	1.97803E−62	3.91625E−60
Rgs2	−0.635850555	10.09899367	276.0893809	5.34329E−62	1.04484E−59
Rpl23a-ps3	0.343715493	10.69786568	274.1111792	1.44185E−61	2.78506E−59
S100a4	0.738831043	9.845301206	271.3430121	5.78373E−61	1.10372E−58
Epsti1	0.443939453	9.867770305	266.4193722	6.84401E−60	1.2905E−57
Ifrd1	−0.474596587	10.00161652	262.3022178	5.40376E−59	1.00694E−56
Cacybp	−0.560229675	9.442844244	260.8502655	1.1199E−58	2.06257E−56
Uba52	0.356717075	10.18138302	260.7323335	1.18819E−58	2.16319E−56
Arf4	−0.398360184	9.945640276	259.6927564	2.00211E−58	3.60357E−56
Mat2a	−0.579951827	9.446706214	253.6395059	4.17847E−57	7.43626E−55
Cd7	0.9863336	9.31700291	253.534729	4.40411E−57	7.75074E−55
Lcp1	0.350365569	10.21732737	253.1792183	5.26452E−57	9.16315E−55
Gm10020	0.626059668	9.179717204	250.3467675	2.18193E−56	3.75648E−54
Saraf	−0.367375045	10.20218079	248.9026846	4.50471E−56	7.67205E−54
Pglyrp1	0.745685753	9.248613864	248.7407525	4.88618E−56	8.23322E−54
Hmha1	0.4442368	9.65919282	245.5542415	2.4193E−55	4.03361E−53
Tbc1d10c	0.555749736	9.412018375	245.2494518	2.8193E−55	4.65155E−53
Il21r	−0.437344694	10.2017939	235.2828562	4.20044E−53	6.85885E−51
Got1	−0.578693665	9.873061625	227.775993	1.82126E−51	2.94356E−49
Id2	−0.428153652	10.67713064	227.1293055	2.52005E−51	4.03183E−49
Gzma	1.097864847	10.4314706	224.6382402	8.80465E−51	1.39457E−48
Ass1	0.551203488	9.461406247	224.0954108	1.1564E−50	1.81348E−48
Atf3	−0.847490224	9.233159259	220.5128652	6.99061E−50	1.08553E−47
Gnai2	0.343784913	10.10321215	218.455168	1.96497E−49	3.02167E−47
Vgll4	−0.495246625	9.708628848	217.328475	3.46041E−49	5.21994E−47
Gm10036	0.488692316	9.447957927	217.3445053	3.43266E−49	5.21994E−47
Vps37b	−0.356521425	10.62817923	213.0553128	2.96009E−48	4.42311E−46
Ctla4	−0.425992423	10.1474776	212.5306436	3.85271E−48	5.70309E−46
Pfn1	0.240155328	12.08589684	211.5092731	6.43562E−48	9.43832E−46
Gm6133	0.385457869	9.838579615	210.5516257	1.04116E−47	1.51293E−45
Rgs10	0.482419062	9.543994531	209.2301427	2.02222E−47	2.91181E−45
Dgat1	−0.509721261	9.781782774	202.6225445	5.59181E−46	7.97916E−44
Calm2	−0.288834956	10.41747073	201.1940212	1.14623E−45	1.621E−43
Klf4	−0.805778426	9.163911069	198.5381953	4.35348E−45	6.10219E−43
Gstp1	0.560007281	9.167288045	197.5281815	7.23193E−45	1.00479E−42
Clic1	0.288038175	10.28204409	197.2507071	8.31399E−45	1.14509E−42
Hmgb2	0.354889486	10.66675652	196.7520978	1.06813E−44	1.45846E−42
Il7r	0.473145073	9.661302261	195.7526991	1.76497E−44	2.38934E−42
Gm10250	0.518735292	9.261259604	193.764279	4.79415E−44	6.43513E−42
Cd48	0.460544257	9.63721787	192.5550895	8.80297E−44	1.17168E−41
Nmrk1	−0.588456161	9.417758277	192.2468691	1.02779E−43	1.35659E−41
Rps18-ps3	0.492924084	9.426467835	191.4030749	1.57064E−43	2.05598E−41
Gmfg	0.288142784	10.16792471	190.062755	3.08058E−43	3.99946E−41
Cd160	0.772172194	9.171269402	187.9194935	9.04635E−43	1.16492E−40
Fos	−0.848606018	9.403276926	187.6453713	1.03827E−42	1.32623E−40
Calr	−0.332836814	10.00618833	187.4552473	1.14239E−42	1.44755E−40
Ltb	0.435310874	10.06047948	187.4344179	1.15441E−42	1.45117E−40
Sptssa	0.443750066	9.506220885	187.1311408	1.34451E−42	1.67683E−40
Rps19	0.163786035	12.56834608	186.4521678	1.8914E−42	2.34046E−40
Nop56	−0.471203711	9.397440468	185.7941949	2.63281E−42	3.23265E−40
Cox4i1	0.202013585	10.64833002	185.2586938	3.44606E−42	4.19863E−40
Cnbp	−0.263558911	10.22998911	181.685277	2.07714E−41	2.51143E−39
Lck	0.257552685	10.24063704	179.7802094	5.41265E−41	6.49477E−39
AY036118	0.563399136	9.204622057	178.8367065	8.69799E−41	1.03585E−38
Itgae	0.682063184	9.148814961	178.4772671	1.04208E−40	1.23176E−38
Phlda1	−0.673473912	9.377283171	178.2435364	1.17203E−40	1.37509E−38
Stat3	−0.443604694	9.594221317	177.9403458	1.36502E−40	1.58975E−38
Cd47	0.266539976	10.2319394	176.5081391	2.80463E−40	3.24252E−38
Rpl18	0.144665747	11.79456362	175.0801355	5.75052E−40	6.60018E−38
Nr3c1	−0.516138019	9.401251838	174.75596	6.7686E−40	7.7128E−38
Lrrc58	0.46964707	9.349073684	171.1319595	4.18736E−39	4.7374E−37
Isg15	−0.670410352	9.423880415	169.027457	1.20665E−38	1.35548E−36
Dnaja4	−0.644926354	9.231175487	168.0185211	2.00427E−38	2.23561E−36
Gramd1a	0.466406544	9.358991876	166.9212357	3.48044E−38	3.85502E−36
Satb1	0.439489127	9.719193943	166.7565659	3.78098E−38	4.15881E−36
Pitpna	0.435855152	9.418669714	166.5808975	4.13025E−38	4.51165E−36
Lmnb1	−0.393042571	9.763928547	164.0771622	1.45514E−37	1.57863E−35
Rab8a	0.415127367	9.432790068	164.0612625	1.46683E−37	1.58048E−35
Rpl36-ps3	0.441944981	9.423156321	163.8405856	1.63903E−37	1.75409E−35
Dnajb6	−0.293570643	10.00275021	162.2193209	3.70488E−37	3.93836E−35
Zyx	0.538469116	9.22950728	162.1601301	3.81685E−37	4.03034E−35
Gm42418	0.493993592	9.306589985	161.57956	5.11145E−37	5.3616E−35
Rpl13a	0.119258065	13.13921041	161.206428	6.16686E−37	6.42612E−35
Tpt1	−0.145383512	11.80754119	160.7269708	7.84903E−37	8.12554E−35
Bag3	−0.659792855	9.118691017	159.9745004	1.14609E−36	1.17876E−34
Ccnd2	−0.396544062	9.784153549	159.2696002	1.63393E−36	1.66967E−34
Arhgap9	0.438276791	9.35894319	157.7278258	3.54905E−36	3.60343E−34
Glipr2	0.446096284	9.423554685	157.1318986	4.78992E−36	4.83233E−34
Fam110a	−0.472890454	9.453583185	157.1015845	4.86354E−36	4.87554E−34
Selplg	0.274720161	10.17793864	156.6736327	6.03206E−36	6.00892E−34
Cycs	−0.32552726	9.75607587	156.6281029	6.17184E−36	6.10974E−34
Il4ra	−0.452891333	9.452897121	156.4370671	6.79453E−36	6.68439E−34
Emp3	0.353071287	9.834646436	156.2537044	7.45123E−36	7.28518E−34
Rpl4	0.134730304	11.68362122	155.6700537	9.99467E−36	9.712E−34
Hnrnpa3	0.266912928	10.08163683	155.1519983	1.29711E−35	1.25274E−33
Rpsa	0.151911683	11.60418555	154.4391519	1.85677E−35	1.78238E−33
Sec62	−0.329708774	9.701018261	152.843486	4.14456E−35	3.95456E−33
BC021614	0.531468977	9.186997015	152.6941588	4.46801E−35	4.23766E−33
Hnrnpf	0.226485212	10.3476999	152.4248087	5.1166E−35	4.82392E−33
Btf3	0.174817152	10.69728489	150.1944197	1.57204E−34	1.47335E−32
Tuba4a	−0.500013194	9.3182479	149.6257279	2.09299E−34	1.95005E−32
Rplp2	−0.144805547	11.92184821	149.256893	2.51993E−34	2.3341E−32
Gch1	−0.466693357	9.423417801	148.6833891	3.36316E−34	3.09704E−32
Arpc1b	0.211873522	10.49392739	148.4554378	3.77203E−34	3.45348E−32
Stk17b	0.281362595	10.00322266	148.0916995	4.52987E−34	4.12349E−32
Ppp1ca	0.240424662	10.26494776	148.060095	4.60251E−34	4.16567E−32
Rpl7a-ps5	0.486459932	9.2808747	148.0086319	4.72329E−34	4.25069E−32
Cyp51	−0.517971726	9.223050414	146.0605091	1.25925E−33	1.12685E−31
Sub1	−0.214884457	11.18398687	145.3238318	1.82458E−33	1.62357E−31
Actr3	0.249028441	10.16798322	145.0491999	2.0951E−33	1.85387E−31
Ms4a6b	0.294576449	10.12969439	144.501494	2.76025E−33	2.42886E−31
Tubb4b	−0.459637938	9.394536981	144.3920797	2.91655E−33	2.55222E−31
Eif3h	0.208541804	10.26895897	144.1508682	3.29311E−33	2.86591E−31
Coq10b	−0.411794907	9.435490542	144.0065092	3.54134E−33	3.0651E−31
Atp5c1	0.269041545	9.839431013	142.7411254	6.69627E−33	5.76425E−31
Rps18	0.122847279	12.46503118	139.9990592	2.6633E−32	2.28021E−30
Nr4a2	−0.513897887	9.457054691	139.5805932	3.28798E−32	2.79991E−30
Calm1	−0.187542883	10.85460141	139.4756112	3.46647E−32	2.93612E−30
Rpl13	0.114773349	12.62813742	138.4213697	5.89437E−32	4.966E−30
Ict1	0.423189272	9.30361635	138.3204015	6.20181E−32	5.19738E−30
Hmgn2	0.550119942	9.341504132	138.1803419	6.65501E−32	5.54783E−30
Lef1	0.504911527	9.197619018	137.0327804	1.18611E−31	9.836E−30
Grk6	0.422500161	9.358866658	136.6318883	1.45146E−31	1.19738E−29
Gm10263	0.500153042	9.186742654	136.3215546	1.69699E−31	1.39267E−29
Gem	−0.660716773	9.293071626	134.6824614	3.8743E−31	3.16314E−29
Klhl6	0.483227269	9.233459769	133.712411	6.31515E−31	5.12952E−29
Cd27	−0.611171828	9.270411364	133.5494989	6.85521E−31	5.53978E−29
Rpl10a	0.159600898	11.11793653	133.4138158	7.34009E−31	5.90151E−29
Xbp1	−0.375600558	9.506719641	132.8318821	9.84016E−31	7.87163E−29
Actb	0.349014866	13.2991423	132.5191377	1.15191E−30	9.16838E−29
Shisa5	0.187947346	10.97087	132.4670563	1.18253E−30	9.36503E−29
Dnajc15	0.287104543	9.848245672	132.2517602	1.31799E−30	1.03859E−28
Fmnl1	0.429752574	9.260548258	129.9782686	4.14289E−30	3.24847E−28
Cdkn2d	0.464791922	9.29200856	129.2330519	6.03052E−30	4.70529E−28
Fxyd5	0.182264591	10.89173272	128.760728	7.65071E−30	5.94018E−28
Arpc5	0.249915994	10.04618205	128.6880991	7.93585E−30	6.13151E−28
Tob1	−0.446983839	9.361751749	128.221138	1.00408E−29	7.72024E−28
Sp100	0.378951326	9.450532416	127.737472	1.28117E−29	9.80309E−28
Cox7a2l	0.233483798	10.08201636	127.107975	1.75936E−29	1.33974E−27
Xist	−0.56767985	9.970373424	126.6271392	2.2417E−29	1.69887E−27
Hist1h1c	0.557306764	9.489015558	126.3156087	2.62273E−29	1.97816E−27
Pgk1	0.418281433	9.112923746	125.3115168	4.35006E−29	3.26543E−27
Actg1	0.182969375	12.14233273	125.146896	4.72632E−29	3.53114E−27
Mtch1	0.458946966	9.20177114	124.5864031	6.26892E−29	4.66166E−27
Atp2b1	−0.38615604	9.501506429	124.1820724	7.68576E−29	5.68854E−27
Ncl	−0.245541061	10.05061385	123.9476575	8.64954E−29	6.3721E−27
S1pr1	0.528441748	9.211582313	123.7386899	9.61016E−29	7.04701E−27
Slc25a4	0.348268536	9.539790652	123.6240204	1.01819E−28	7.43185E−27
Tmem234	0.309086225	9.603992608	123.5902044	1.03569E−28	7.52492E−27
Ahsa1	−0.373673862	9.394169648	123.4119192	1.13306E−28	8.19477E−27
Oat	−0.435562041	9.261683421	123.1811798	1.27279E−28	9.16353E−27
Eif4a1	−0.209870948	10.40687573	123.0223878	1.37884E−28	9.88212E−27
Srsf5	−0.243227861	10.03951019	121.6337503	2.77639E−28	1.98086E−26
Rasal3	0.417194458	9.277924457	121.128153	3.58228E−28	2.54438E−26
Txn1	−0.257078553	9.989683557	120.9745987	3.87056E−28	2.73687E−26
Dusp5	−0.290377017	9.972912538	120.6642471	4.526E−28	3.18611E−26
Mrfap1	−0.307122783	9.592747399	120.576342	4.73107E−28	3.31572E−26
Srsf2	−0.297033097	9.8103015	120.5673514	4.75256E−28	3.31611E−26
Sfn	−0.630910469	9.178735424	120.3008256	5.43595E−28	3.77632E−26
Rps12-ps3	0.308504409	9.879369687	120.1649948	5.82119E−28	4.02373E−26
Ccdc85b	0.376786261	9.099879984	120.1576082	5.84291E−28	4.02373E−26
Eif3e	0.216240052	10.08436298	119.78202	7.06084E−28	4.84141E−26
Smox	−0.474515311	9.123010044	119.5466722	7.95026E−28	5.42777E−26
Prelid1	0.300888669	9.653107806	119.1448432	9.73547E−28	6.61803E−26
Socs1	−0.469790829	9.336838521	117.5893552	2.13272E−27	1.4436E−25
Gpi1	0.268069428	9.724725928	117.3315071	2.42881E−27	1.63702E−25
Gm8186	0.400557572	9.271352225	117.0049248	2.86356E−27	1.92186E−25
Gm26917	0.355608704	9.439877032	116.7023452	3.33552E−27	2.22917E−25
Kdm6b	−0.474669899	9.658683083	116.14973	4.40733E−27	2.9331E−25
Morf4l2	−0.385016023	9.334072103	115.2078964	7.08649E−27	4.69635E−25
mt-Atp6	0.13109516	12.41359392	114.2993627	1.12049E−26	7.39475E−25
Rps21	−0.181566483	10.91649475	114.161468	1.20118E−26	7.8944E−25
Traf1	−0.259615851	10.09188115	113.4484171	1.72101E−26	1.12641E−24
Hmgb1	0.245489958	10.23428059	113.378642	1.78265E−26	1.16195E−24
Rps27	−0.126585153	13.17754164	113.3397676	1.81794E−26	1.1801E−24
Gimap4	0.215414428	10.44074796	113.191718	1.95888E−26	1.2664E−24
Gnb2	0.258833488	9.763400839	112.9354823	2.22912E−26	1.43524E−24
Itgb7	0.274275587	9.895610202	112.219657	3.19837E−26	2.05097E−24
Kcnab2	0.416180538	9.204098465	110.340368	8.25308E−26	5.27099E−24
Rps6	0.103817085	12.19422287	109.8318232	1.06667E−25	6.78514E−24
Itpkb	−0.372082819	9.445651895	108.7449466	1.84571E−25	1.16937E−23
Kxd1	0.377030142	9.31810604	108.4195949	2.17497E−25	1.37248E−23
Gm5424	0.355390948	9.09348985	108.2876044	2.32474E−25	1.46117E−23
Ctsw	0.281167862	9.869959927	106.8287454	4.85349E−25	3.03852E−23
Qrfp	0.243034806	9.076767353	106.3828523	6.07814E−25	3.79022E−23
Capzb	0.213939408	10.11156981	106.153532	6.82381E−25	4.23853E−23
Tpgs1	0.420110336	9.169815546	105.7409159	8.40342E−25	5.19929E−23
Itga4	0.412518622	9.298709558	105.4396292	9.78336E−25	6.02952E−23
Ankrd11	0.350142771	9.482587467	104.8812954	1.29676E−24	7.96102E−23
Pkp3	0.331642575	9.632608745	104.763521	1.37618E−24	8.41594E−23
Znrf1	0.393356078	9.30009727	104.5615058	1.52389E−24	9.28341E−23
Gpsm3	0.273081602	9.652489804	103.3850532	2.75949E−24	1.67462E−22
Csrp1	−0.407937762	9.37033353	103.2949394	2.8879E−24	1.74586E−22
Ier5l	−0.547686053	9.138751627	102.9398289	3.45484E−24	2.08065E−22
Vasp	0.227570734	9.975852973	102.8106476	3.68762E−24	2.21243E−22
Rbm39	−0.167004852	10.64268875	102.3487305	4.65597E−24	2.78286E−22
Pnrc1	−0.206120221	10.52842542	101.7477551	6.30616E−24	3.75501E−22
Arpc3	−0.186319393	10.54396257	101.3233979	7.81274E−24	4.63468E−22
Lrch4	0.386196626	9.117920834	101.0593439	8.92685E−24	5.27583E−22
Tnfsf11	−0.479155286	9.528185643	100.5769031	1.13888E−23	6.70585E−22
Ms4a4b	0.224364573	10.74767447	100.0145775	1.51279E−23	8.8745E−22
Wsb1	−0.383939877	9.299259433	99.70808238	1.76599E−23	1.03216E−21
Cox17	−0.255036164	9.759086926	99.34607039	2.12018E−23	1.23038E−21
Rps26-ps1	0.376422445	9.302607157	99.34560267	2.12068E−23	1.23038E−21
Aprt	0.302163807	9.570312455	97.89843718	4.40401E−23	2.54581E−21
Commd8	0.340663528	9.362522227	97.69437133	4.88208E−23	2.8119E−21
Cmtm7	0.347833176	9.445414037	97.66881931	4.94549E−23	2.8381E−21
Cdk2ap1	0.40313369	9.207010836	97.41784043	5.61379E−23	3.21E−21
Nhp2l1	−0.25771889	9.660380552	97.18476802	6.31506E−23	3.59799E−21
Arhgap15	0.345069342	9.353711095	97.13997149	6.45956E−23	3.66713E−21
Ikzf1	0.364959967	9.314515256	97.12258211	6.51654E−23	3.68627E−21
Mrps6	−0.445518043	9.167109148	97.06634456	6.70428E−23	3.77897E−21
Pdlim2	0.398459075	9.182597688	96.96123973	7.06979E−23	3.97086E−21
Hspa2	−0.459505667	9.124122695	96.94098529	7.14248E−23	3.99752E−21
Vim	0.262752919	10.51559022	96.26760304	1.00359E−22	5.59713E−21
Traf4	−0.411142056	9.288678658	96.17375062	1.05231E−22	5.84825E−21
Coro1b	0.359271007	9.291592437	95.80235442	1.26945E−22	7.03034E−21
Litaf	−0.434433383	9.369696159	95.74269972	1.30828E−22	7.22016E−21
Ier5	−0.332369309	9.648355931	95.20641105	1.71534E−22	9.43377E−21
Cxcr6	0.285170249	10.38589926	94.75608108	2.15351E−22	1.18026E−20
Gyg	0.404072997	9.169055117	94.60060052	2.32948E−22	1.2723E−20
Gngt2	−0.414175481	9.266095139	94.22857227	2.81113E−22	1.53009E−20
Srgn	−0.156866717	11.40960169	94.22033317	2.82286E−22	1.53121E−20
Traf3ip3	0.398126336	9.211377897	94.14101487	2.93827E−22	1.58837E−20
Slc25a3	−0.223869744	9.929245406	93.89114737	3.33362E−22	1.79596E−20
C1d	0.358002392	9.257445341	93.60629381	3.84962E−22	2.06692E−20
Taf10	0.329789291	9.42027031	93.17625006	4.78387E−22	2.55986E−20
Rrad	−0.422165808	9.481942925	92.71155163	6.04994E−22	3.22643E−20
Myo1f	0.386024191	9.211461927	90.89289789	1.51663E−21	8.06104E−20
Hsd11b1	0.410088948	9.207302928	90.62179281	1.73934E−21	9.21385E−20
Ctla2a	−0.340237861	10.39420628	90.54680962	1.80652E−21	9.53783E−20
Tubb5	0.33277636	9.951843603	90.14093695	2.21785E−21	1.16706E−19
Gramd3	0.284054197	10.20990355	90.01056232	2.36892E−21	1.24243E−19
Jun	−0.655178909	9.472386028	89.47089847	3.11182E−21	1.62667E−19
Fam169b	0.401940452	9.20492433	89.45833686	3.13165E−21	1.63165E−19
Fermt3	0.346761961	9.277314729	89.42967881	3.17734E−21	1.65003E−19
Ikzf3	−0.43554387	9.229056647	89.22703786	3.52005E−21	1.82203E−19
Caprin1	0.362718036	9.222741789	89.18692735	3.59215E−21	1.85329E−19
Bola2	−0.279074797	9.545437178	89.07835747	3.7948E−21	1.95149E−19
1700097N02Rik	0.426479844	9.138943007	88.54524555	4.96853E−21	2.54682E−19
Akt1	0.388322632	9.186110081	88.23288633	5.81845E−21	2.97285E−19
Set	0.275235713	9.68026491	87.87236611	6.98173E−21	3.55574E−19
Lcn4	0.386003461	9.104970691	87.03518994	1.06607E−20	5.41203E−19
Ptpn6	0.374733064	9.254685928	86.45613527	1.42871E−20	7.20681E−19
Tmem71	0.392168946	9.18300717	86.45911911	1.42656E−20	7.20681E−19
Prkcq	0.385697348	9.187898023	86.1059948	1.70545E−20	8.57544E−19
Rps3a1	0.101927456	11.66239034	86.05600387	1.74911E−20	8.76715E−19
Hilpda	−0.363494493	9.621933344	85.85753408	1.93377E−20	9.66215E−19
Rpl13a-ps1	0.369121872	9.125886702	85.80554006	1.98529E−20	9.88838E−19
Cotl1	0.189250759	10.42452425	85.51065232	2.30457E−20	1.14426E−18
Kpna1	−0.370106801	9.300870038	85.23248687	2.65268E−20	1.31299E−18
Gabpb1	−0.35309655	9.443575937	85.20182613	2.69413E−20	1.32936E−18
Fosl2	−0.360285481	9.496287214	85.06065057	2.89352E−20	1.42331E−18
mt-Nd2	−0.223466869	9.877039562	84.76700348	3.3568E−20	1.64608E−18
Ctbp1	0.291313018	9.41304975	84.69950904	3.47337E−20	1.69798E−18
Stat4	−0.316811236	9.451262982	84.38770905	4.06668E−20	1.98191E−18
Lgals1	0.205366044	11.71367544	84.2394234	4.38342E−20	2.12972E−18
Def6	0.357773345	9.254739348	84.07852182	4.75509E−20	2.30324E−18
Plscr1	−0.37206631	9.476236025	83.60981525	6.02731E−20	2.91056E−18
Gltscr2	0.174676511	10.26087104	83.346365	6.88653E−20	3.31537E−18
Pik3ip1	0.330447087	9.095932723	83.00333665	8.1915E−20	3.93167E−18
Naca	0.132857132	10.78159304	82.76181285	9.2561E−20	4.41914E−18
Lbr	0.318806475	9.348045598	82.76035438	9.26293E−20	4.41914E−18
Ly6e	−0.164934597	10.75197012	82.47918371	1.06789E−19	5.07937E−18
Ubxn4	−0.283952138	9.497877918	82.09781857	1.29515E−19	6.1419E−18
Maff	−0.449911666	9.211492069	81.93490116	1.40644E−19	6.64972E−18
Slc5a3	−0.383528621	9.112932121	81.55251603	1.70666E−19	8.04516E−18
Ywhah	0.252414688	9.657038205	81.37024179	1.87155E−19	8.79628E−18
Susd3	0.35903436	9.274618606	81.24943703	1.98952E−19	9.29559E−18
Snhg12	−0.372153059	9.217070705	81.25063679	1.98832E−19	9.29559E−18
Pim3	−0.419460628	9.239693094	81.10803033	2.1371E−19	9.95573E−18
Sema4d	0.336007509	9.272910863	81.03992068	2.21204E−19	1.02746E−17
Nrip1	−0.351147226	9.518465731	80.79922139	2.49856E−19	1.15716E−17
Errfi1	−0.415709417	9.203060475	80.77279894	2.5322E−19	1.16931E−17
Adora2a	−0.337733868	9.371066602	80.11544679	3.53161E−19	1.62608E−17
Rps15a	−0.091705836	12.40648985	80.05818453	3.63545E−19	1.66904E−17
Tcf7	0.361212693	9.327301692	79.84620757	4.04716E−19	1.85269E−17
Klrb1f	0.310571128	9.09219065	79.5343695	4.73909E−19	2.16318E−17
Rpl23a	−0.093737153	12.18419476	79.4984072	4.82614E−19	2.19659E−17
Atp5l	0.148555301	10.43217254	79.40175043	5.06812E−19	2.30011E−17
Rps27rt	0.194128581	11.15059622	79.12000934	5.84493E−19	2.64508E−17
Hist1h2ap	0.371210153	9.098222032	79.03133498	6.11326E−19	2.75863E−17
Dad1	−0.188540821	9.987070117	78.99222215	6.23549E−19	2.8058E−17
Pdia6	−0.305181564	9.433423543	78.96680159	6.31625E−19	2.83408E−17
Dedd2	−0.361161452	9.208472136	78.60470661	7.58684E−19	3.39458E−17
Capza1	0.275051341	9.421084656	78.45568471	8.18131E−19	3.65025E−17
Whsc1l1	0.286256556	9.465405344	77.97147828	1.04539E−18	4.65111E−17
Dusp14	−0.490461557	9.164191183	77.49990377	1.32729E−18	5.88878E−17
Pabpc1	0.128653685	10.80961358	77.10286727	1.62282E−18	7.17983E−17
Flt3l	0.342999594	9.248983424	76.47498946	2.2302E−18	9.83958E−17
Arrb2	0.323205878	9.299307513	76.15477607	2.6228E−18	1.15396E−16
mt-Co3	0.113435634	12.04559976	76.05277042	2.76185E−18	1.21177E−16
Sept9	0.288906266	9.423194345	76.02239789	2.80465E−18	1.22715E−16
2810001G20Rik	0.388632897	9.147759194	75.85013039	3.06032E−18	1.33533E−16
1600014C10Rik	0.376989592	9.154287123	75.75980593	3.20356E−18	1.39399E−16
Tmem30a	0.308038318	9.310066934	75.25148409	4.14419E−18	1.79835E−16
Nfkbie	−0.336107134	9.343303521	75.20801706	4.23643E−18	1.83336E−16
Gpx4	−0.205314323	10.06582643	75.20257186	4.24813E−18	1.83341E−16
Gm42726	0.320348649	9.104150123	75.1172932	4.43564E−18	1.90913E−16
Ramp3	−0.440634397	9.976673631	75.0436194	4.60429E−18	1.97635E−16
Ifitm3	0.451646848	9.710327146	74.9885843	4.73444E−18	2.02672E−16
Cisd3	0.352850049	9.208350817	74.66564795	5.57579E−18	2.38046E−16
Top1	−0.28395075	9.452133131	74.61436731	5.72252E−18	2.43653E−16
Sppl3	0.331427267	9.125075068	73.91656836	8.14895E−18	3.46035E−16
Usmg5	−0.19994212	10.00954642	73.69959983	9.09573E−18	3.85207E−16
Bst2	−0.31574848	9.349556332	73.67662979	9.2022E−18	3.88676E−16
Gm26740	−0.290618009	9.614149283	73.6072547	9.53137E−18	4.01509E−16

TABLE 2C
Small Intestine LPL Ctrl vs KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Malat1	−1.270390299	14.65408192	1391.007551	1.8902E−304	2.5698E−300
Dnajb1	−2.989003621	10.24133724	1248.384643	1.8627E−273	1.2662E−269
Ubb	−0.928036045	12.68983308	1129.213594	1.4776E−247	6.6959E−244
Hsp90aa1	−1.73334477	10.38503603	848.7603464	1.3523E−186	4.5961E−183
Hsp90ab1	−1.124878483	10.88661857	744.3402084	6.8242E−164	1.8555E−160
Hspa1a	−3.477661443	10.7136333	610.5048084	8.6886E−135	1.9687E−131
Hspe1	−1.481859098	10.17562846	609.4431434	1.4787E−134	2.8718E−131
Hspa1b	−2.45826073	9.673476745	541.557568	8.6415E−120	1.4685E−116
Hspa8	−0.733021848	11.94760636	536.6824715	9.9348E−119	1.5007E−115
Dnaja1	−1.142985442	10.58020182	500.7270965	6.6034E−111	8.9774E−108
Hsph1	−1.674119669	9.693521287	391.0098358	4.98925E−87	6.16626E−84
Pfn1	0.556969656	12.36179331	354.5323953	4.36681E−79	4.94723E−76
Ifi27l2a	−1.526203755	10.06603444	308.5419345	4.53792E−69	4.74562E−66
Ddx5	−0.569218691	11.28301838	295.0912662	3.86588E−66	3.75404E−63
Crip1	1.063247863	11.26439747	275.0510604	8.99683E−62	8.15413E−59
Ubc	−0.684801113	11.25718429	269.2572026	1.6474E−60	1.39978E−57
Jun	−1.621216633	10.08346217	267.8801831	3.28792E−60	2.62937E−57
Lgals1	1.123792206	11.27737133	266.4474621	6.7482E−60	5.09677E−57
Cd52	0.579508154	11.896613	259.9242984	1.78245E−58	1.27539E−55
Hspd1	−1.123244696	9.873827325	248.7759061	4.80071E−56	3.26328E−53
Cd160	1.612792846	9.910004584	244.9841777	3.2209E−55	2.08515E−52
Rbm3	0.606449645	10.9936177	229.5941443	7.30892E−52	4.51658E−49
S100a6	1.204174767	10.87443069	219.9356841	9.34141E−50	5.52159E−47
Gzma	1.993209068	11.53461012	215.7661412	7.58466E−49	4.29639E−46
Rps29	−0.33975966	12.45913805	214.1327455	1.72289E−48	9.3691E−46
Slc25a5	0.672711688	10.63606639	207.9571703	3.83322E−47	2.00433E−44
Cd7	1.532985299	10.09719296	198.2226571	5.10148E−45	2.56869E−42
Fos	−1.555883912	9.951733106	191.3239371	1.63437E−43	7.93543E−41
Junb	−0.603167841	12.24822312	187.5138271	1.10924E−42	5.20006E−40
Vim	0.928746254	10.32884884	180.8919276	3.09513E−41	1.40261E−38
S100a4	1.526515304	9.992761306	176.514377	2.79585E−40	1.22611E−37
Klf6	−0.926855403	10.30217968	170.4261312	5.97167E−39	2.53703E−36
AY036118	−1.061137817	9.604280179	168.5762641	1.51402E−38	6.23731E−36
Eif4a2	−0.786277362	10.01209351	167.6815977	2.37437E−38	9.49399E−36
Rplp0	0.305778795	12.4630419	163.5750167	1.87328E−37	7.27635E−35
Zfp36l2	0.955324495	10.26398104	162.744194	2.84515E−37	1.07444E−34
Gm42418	−1.048481014	9.719045857	160.8447438	7.3975E−37	2.71808E−34
Eif3f	0.463631301	10.85999602	157.5770827	3.8287E−36	1.36977E−33
Gadd45b	−1.017411734	9.987572676	156.6695014	6.04462E−36	2.10709E−33
Dusp1	−0.925508201	10.28518602	154.6952798	1.63224E−35	5.54759E−33
Ier5	−0.849926882	9.977632158	153.3008753	3.29244E−35	1.09172E−32
Rpl24	0.336154281	11.8173782	153.1549619	3.54329E−35	1.14693E−32
Itgb7	0.730684655	10.21660441	145.9816063	1.31027E−33	4.1426E−31
Ppp1r15a	−0.850080959	9.962305144	145.3477627	1.80274E−33	5.57004E−31
mt-Nd2	−0.666229752	10.16694083	142.9422572	6.0514E−33	1.8282E−30
Rps27	−0.280332283	13.43297512	140.2437348	2.35459E−32	6.95883E−30
Emp3	0.853721822	10.01923353	138.8508125	4.74812E−32	1.37342E−29
Jund	−0.511687126	11.88052936	138.1873795	6.63147E−32	1.87823E−29
Arpc5	0.641891287	10.33312177	137.1516697	1.11718E−31	3.0996E−29
Prkca	−0.936438709	9.803809383	135.1375687	3.08067E−31	8.37635E−29
Tagln2	0.728752002	10.27956689	132.3672087	1.24352E−30	3.31485E−28
Cacybp	−0.820907994	9.761275879	127.6377263	1.3472E−29	3.52215E−27
Itgae	1.141170294	9.754012995	127.2951357	1.60103E−29	4.10679E−27
Cd47	0.621464194	10.28476905	123.8215437	9.21714E−29	2.3205E−26
Rpl23a-ps3	−0.389746504	10.83309006	119.834953	6.87492E−28	1.69935E−25
H2afz	0.681004033	10.6429052	118.7869428	1.16605E−27	2.83079E−25
S100a10	0.525127377	10.79175384	117.9491163	1.77894E−27	4.24292E−25
Fosb	−1.063020116	9.629543946	117.8377317	1.88169E−27	4.41063E−25
Cox5a	0.592668928	10.24515525	115.5012812	6.11196E−27	1.40234E−24
Rpl38	−0.268147527	11.78716014	115.4764231	6.18905E−27	1.40234E−24
Ptprcap	0.548197307	10.41240534	109.6451952	1.17198E−25	2.61197E−23
Arhgdib	0.404256062	10.95537113	109.2336833	1.44238E−25	3.16277E−23
Rpl37a	−0.219867372	12.67658574	108.9253496	1.68514E−25	3.63643E−23
Rps27rt	−0.377704095	11.22532454	107.7024833	3.12311E−25	6.63417E−23
Atf3	−0.833608127	9.564432286	107.484863	3.48557E−25	7.29021E−23
Rpl32	0.234928384	12.53119065	107.2016913	4.02093E−25	8.28252E−23
Rpl29	0.348661409	11.2510885	106.283271	6.39137E−25	1.29688E−22
Zfp36	−1.069360095	9.720937454	105.7272946	8.46138E−25	1.69165E−22
Nfkbia	−0.548369836	11.02410921	105.552441	9.24194E−25	1.82093E−22
Tnfaip3	−0.556203662	10.4976442	105.1592788	1.12702E−24	2.18884E−22
Rpl3	0.23946729	12.12971157	103.4841404	2.62487E−24	5.02607E−22
Lcp1	0.476475494	10.58352627	101.648977	6.62859E−24	1.25161E−21
Dnaja4	−0.883775551	9.627504548	101.2617633	8.05967E−24	1.50097E−21
Fus	−0.583225585	10.0621585	100.5551387	1.15146E−23	2.11543E−21
Eef2	0.30089659	11.36578563	98.60722272	3.07894E−23	5.5811E−21
Gm10073	−0.587468651	9.971221351	98.04010631	4.09994E−23	7.33404E−21
H2-Q6	−0.666621999	9.913841776	96.58296852	8.55813E−23	1.51101E−20
Lsp1	0.478483224	10.575597	96.3577739	9.58906E−23	1.67132E−20
Cxcr6	0.682928486	10.4358259	95.40449085	1.55201E−22	2.67084E−20
Rplp1	−0.248800579	11.77289572	95.07571795	1.83241E−22	3.0755E−20
Itpkb	−0.755356088	9.788344057	95.07750247	1.83076E−22	3.0755E−20
Bag3	−0.73666804	9.556132624	92.98437325	5.27089E−22	8.73875E−20
H2-Q4	−0.600298455	10.03136803	92.46838803	6.84088E−22	1.1205E−19
Cd69	−0.675277132	10.22899337	91.3465498	1.2059E−21	1.95169E−19
Son	−0.580002512	9.985249388	89.75818	2.69123E−21	4.30439E−19
Gm8797	−0.760754138	9.695703486	89.16169111	3.63827E−21	5.75142E−19
Reep5	0.715048932	9.86923952	89.08940618	3.77366E−21	5.89689E−19
Ermn	0.936240345	9.607995489	88.5867298	4.86542E−21	7.51652E−19
Cyba	0.440199696	10.55096537	86.79334234	1.20474E−20	1.84028E−18
Emp1	−0.831580324	9.618680989	86.48342872	1.40913E−20	2.12857E−18
Hnrnpf	0.389350328	10.63476331	86.40296267	1.46765E−20	2.1926E−18
Capzb	0.449426755	10.36936752	85.10253926	2.83287E−20	4.18617E−18
Arpc2	0.346828272	10.81151028	84.90559109	3.12957E−20	4.57489E−18
Cd48	0.616642092	10.0606017	83.06747655	7.92997E−20	1.14689E−17
Clic1	0.426604672	10.51946677	82.45485129	1.08112E−19	1.54713E−17
Actn2	0.736387991	10.03167641	81.77982597	1.52123E−19	2.15429E−17
Atp51	0.360702257	10.67458586	80.93617442	2.33127E−19	3.26738E−17
Dedd2	−0.731727354	9.632338182	79.43149123	4.9924E−19	6.92568E−17
Ltb4r1	0.814916101	9.601858422	78.85441688	6.68598E−19	9.1814E−17
Ctsw	0.566396655	10.24368719	78.62204359	7.52055E−19	1.02242E−16
Prelid1	0.656109752	9.891171439	78.22322584	9.20301E−19	1.23876E−16
Tra2b	−0.488661709	10.19577356	78.08892868	9.85045E−19	1.31291E−16
AA467197	0.877651163	9.704984918	77.24922157	1.50691E−18	1.98897E−16
Pycard	0.6838354	9.919490954	77.04275231	1.67297E−18	2.18693E−16
Rac2	0.29382085	11.24349839	76.89574027	1.80225E−18	2.31148E−16
Pim1	−0.515291779	11.06070107	76.91273522	1.78681E−18	2.31148E−16
H2-Q7	−0.386384264	10.55176719	76.55241546	2.14445E−18	2.72465E−16
Sdhb	0.633252714	9.861109849	76.36407516	2.35904E−18	2.96955E−16
Ctla4	−0.596909051	10.20745116	75.50013879	3.65381E−18	4.55721E−16
Clk1	−0.544683385	10.07692244	75.47808739	3.69485E−18	4.56649E−16
Gngt2	−0.726299968	9.753641865	74.79477041	5.22279E−18	6.39674E−16
Ltb	0.532854208	10.5105756	74.55802359	5.8882E−18	7.14732E−16
Nkg7	0.509213128	11.37225605	74.38601574	6.42425E−18	7.729E−16
Maff	−0.79964788	9.685276468	73.36704807	1.07648E−17	1.28375E−15
Uba52	−0.358108045	10.48612483	72.43979314	1.72206E−17	2.03578E−15
Cyb5a	0.670808798	9.838120266	72.29714293	1.85115E−17	2.16952E−15
Hmgb2	0.48219955	10.90748683	71.21488181	3.20363E−17	3.7225E−15
Ccl5	0.756221662	13.88516502	71.19613316	3.23421E−17	3.7262E−15
Gm9843	−0.351089612	10.56964271	70.95037373	3.66324E−17	4.18502E−15
Rbm39	−0.311869482	10.84233663	70.52963247	4.53405E−17	5.1367E−15
Myl12a	0.366072373	10.71572431	70.13817584	5.52925E−17	6.21241E−15
Dnajb4	−0.770020972	9.617001768	70.05549857	5.76592E−17	6.42522E−15
Gm11808	−0.372654204	10.38068834	69.90975696	6.20806E−17	6.86167E−15
Fyn	−0.550598359	9.891289908	69.7258551	6.8147E−17	7.47143E−15
Actg1	0.324605067	11.94604458	69.47463064	7.74037E−17	8.41843E−15
Itm2b	0.314557643	11.12684555	69.30828715	8.4215E−17	9.08653E−15
Ap2s1	0.644724334	9.796122343	68.94810314	1.01089E−16	1.08213E−14
Ass1	0.738922713	9.844567328	68.21415472	1.46669E−16	1.55779E−14
Btf3	0.303005054	10.81309008	67.9718735	1.65844E−16	1.74779E−14
Glipr2	0.730000014	9.753269937	67.88661614	1.73173E−16	1.81099E−14
Avl9	−0.653986116	9.731535525	67.59763449	2.00508E−16	2.08084E−14
Ccr9	0.832857974	9.857154544	66.4667878	3.55839E−16	3.66487E−14
Phlda1	−0.788431684	9.719239609	66.02764339	4.44643E−16	4.54505E−14
Tcf7	−0.644655858	9.792717352	65.67511056	5.31732E−16	5.39469E−14
Selplg	0.423459877	10.38010922	65.19224058	6.79365E−16	6.84146E−14
mt-Atp8	−0.67106869	9.60986082	65.17736304	6.84513E−16	6.84262E−14
Rps15	−0.216414105	11.50041078	64.92079989	7.79697E−16	7.73721E−14
mt-Nd4	−0.330338383	10.75014686	64.82286657	8.19427E−16	8.07254E−14
Anxa2	0.722644648	9.881882506	64.73674853	8.56034E−16	8.3725E−14
Cmtm7	0.647790672	9.807118552	64.60455779	9.15434E−16	8.88951E−14
Tnfsf8	0.902577267	10.03565206	64.1198142	1.17078E−15	1.12885E−13
Eno1	0.487848032	10.1319159	64.08709309	1.19039E−15	1.13967E−13
Nfkbiz	−0.574034994	9.90564368	62.46141902	2.71716E−15	2.5832E−13
Fxyd5	0.312416423	10.90172663	62.20646567	3.09271E−15	2.91982E−13
Eif3h	0.357810898	10.43681116	60.86483882	6.1131E−15	5.73156E−13
Epsti1	0.463984054	10.26085662	60.42054667	7.66091E−15	7.13357E−13
Cdc42	0.336991213	10.5652973	59.55545044	1.18896E−14	1.09959E−12
Oas1a	−0.500430515	9.548339965	59.48066541	1.23502E−14	1.13446E−12
Tox	−0.678206587	9.574160554	59.40704481	1.28209E−14	1.1698E−12
Eif1	−0.213223134	11.84549357	58.9703578	1.60065E−14	1.45072E−12
Rsrp1	0.438310679	10.37261005	58.78113414	1.76223E−14	1.58659E−12
Mbd2	−0.588160192	9.73972323	58.59763888	1.93448E−14	1.73022E−12
Sumo2	0.349177283	10.46272601	58.53783873	1.99419E−14	1.77196E−12
Rpl13a	0.155012279	13.10930771	58.46581604	2.06854E−14	1.82609E−12
Tm2d2	0.70831406	9.63412223	58.26594334	2.28974E−14	2.00832E−12
Fam101b	−0.645014148	9.557985731	58.10375522	2.48651E−14	2.16693E−12
Cotl1	0.387933321	10.63154185	57.52288348	3.3407E−14	2.87448E−12
Anxa6	0.529264421	9.947806186	57.53218843	3.32493E−14	2.87448E−12
Ppp1ca	0.358071833	10.45650421	57.42631271	3.50882E−14	3.00015E−12
Lat	0.30090055	10.83480524	57.38755335	3.57865E−14	3.04073E−12
Dusp10	−0.701807188	9.734497108	57.23375587	3.86972E−14	3.26763E−12
Plac8	0.676955079	10.50997571	56.88041406	4.63136E−14	3.88662E−12
Rasgrp1	−0.606007374	9.755482259	56.82249163	4.7698E−14	3.97824E−12
Ostf1	0.446931969	10.18723338	56.7994366	4.82605E−14	4.00062E−12
Coro1a	0.296036382	11.05941162	56.57479441	5.41009E−14	4.45759E−12
3830403N18Rik	0.585483615	9.565458172	56.42066917	5.85121E−14	4.792E−12
Lncpint	−0.683465689	9.609082259	56.32648915	6.13829E−14	4.99701E−12
Uhrf2	−0.636453151	9.805742233	56.23935181	6.41644E−14	5.19235E−12
Slc5a3	−0.573447632	9.553448168	56.14658929	6.72642E−14	5.41099E−12
Dnajc15	0.456892242	10.09941767	55.77454562	8.12771E−14	6.49978E−12
Rpsa	0.216885157	11.60513144	55.21856755	1.07845E−13	8.57401E−12
Arpc1b	0.273302652	10.796252	55.10881601	1.14038E−13	9.01366E−12
Cxcr5	−0.518113656	9.543138573	54.75402302	1.36599E−13	1.07345E−11
Klf4	−0.752577219	9.566058556	54.6749753	1.42206E−13	1.11108E−11
Rpl4	0.194418668	11.72659741	54.3921545	1.64217E−13	1.27573E−11
Ifngr1	0.390565787	10.81929358	54.24193902	1.77263E−13	1.36925E−11
Ifng	−0.868111197	9.899362081	54.09247489	1.91272E−13	1.46802E−11
Rps6	0.165515494	12.27313172	54.08288209	1.92208E−13	1.46802E−11
Rhoh	−0.534449576	9.837142269	54.02000635	1.98459E−13	1.50729E−11
Cfl1	0.250192333	11.29422153	53.90728076	2.10177E−13	1.58742E−11
Sptssa	0.543646713	9.96326749	53.71520935	2.31762E−13	1.74078E−11
mt-Cytb	−0.262082792	11.3111964	53.61065466	2.4443E−13	1.82584E−11
Rps16	−0.163309899	12.29143504	53.35615702	2.78238E−13	2.06702E−11
Bcl2	−0.704176859	9.768025777	52.18045653	5.06275E−13	3.74066E−11
Txk	−0.607016555	9.712272046	52.10336758	5.26546E−13	3.8694E−11
Acp5	0.578040126	9.78903337	51.61203372	6.76258E−13	4.94287E−11
Tspo	0.428503603	10.1185085	51.38616936	7.58712E−13	5.51588E−11
Ccl20	−0.810411094	9.550654384	51.08543215	8.84322E−13	6.39487E−11
Rpl22l1	0.261648578	11.13468717	50.8848051	9.79489E−13	7.04558E−11
Ywhah	0.468443163	10.00113273	50.82097896	1.01186E−12	7.24015E−11
Srrm2	−0.411464931	10.16628193	50.49824308	1.19272E−12	8.45462E−11
Cox4i1	0.260656313	10.85377808	50.49607584	1.19403E−12	8.45462E−11
AW112010	0.291301825	11.71248698	50.43757707	1.23016E−12	8.6653E−11
Pnrc1	−0.326990414	10.78196761	50.29780369	1.32097E−12	9.25702E−11
mt-Nd1	−0.2653544	11.28494672	50.0634124	1.48857E−12	1.0378E−10
Saraf	−0.365543292	10.30384933	49.9328995	1.59095E−12	1.10352E−10
Ppib	0.404822673	10.10011401	49.89019449	1.62595E−12	1.12207E−10
Pgls	0.555219426	9.786227624	49.5295049	1.95411E−12	1.34172E−10
Dusp2	0.724800828	9.811340529	49.34390873	2.148E−12	1.46744E−10
Plp2	0.604877901	9.591056513	49.25934175	2.24263E−12	1.52443E−10
Chst12	0.650249975	9.626540055	48.68536907	3.005E−12	2.03249E−10
Ldha	0.363117284	10.40180441	48.62626572	3.09694E−12	2.0843E−10
Fcer1g	−0.360864211	9.537643508	48.33462077	3.59351E−12	2.40659E−10
Actr3	0.317519138	10.50564793	47.9423529	4.38937E−12	2.92517E−10
Lpxn	0.464741167	9.978535981	47.92799909	4.42162E−12	2.93229E−10
Ybx3	0.60013217	9.599423261	47.61601782	5.18432E−12	3.4214E−10
mt-Nd4l	−0.576765365	9.612318145	47.30905404	6.06315E−12	3.98163E−10
Ccnl1	−0.505607902	9.806469989	47.29981488	6.0918E−12	3.98163E−10
Tmed2	0.388398507	10.11413497	47.23996875	6.28066E−12	4.08543E−10
Hnrnpk	0.324953239	10.40058528	46.9167236	7.4068E−12	4.79502E−10
Gpr171	0.492019928	9.992435057	46.74373012	8.09034E−12	5.21271E−10
Ifi27	−0.48213806	9.837918078	46.66378408	8.42721E−12	5.40415E−10
Rpl8	0.187142948	11.68698224	46.50058276	9.15912E−12	5.84593E−10
Furin	−0.58250301	10.5517053	46.2400125	1.04618E−11	6.64621E−10
Chd3	−0.531844197	9.761077098	46.22174406	1.05599E−11	6.67726E−10
Socs3	−0.606438847	9.77952663	45.945977	1.21559E−11	7.65092E−10
Klrd1	0.740622758	9.641291475	45.83007932	1.28968E−11	8.07981E−10
Atp5f1	0.407703841	10.0510207	45.80329176	1.30744E−11	8.15349E−10
mt-Co1	0.185405435	12.35512272	44.9562193	2.01489E−11	1.2508E−09
Vasp	0.352930373	10.31326066	44.93521323	2.03662E−11	1.25854E−09
Mxd1	−0.513254014	9.919607654	44.40709369	2.66719E−11	1.64074E−09
Lgals3	0.683541289	10.03825331	44.0922441	3.1326E−11	1.91836E−09
Sh2d1a	−0.486118075	9.853138169	44.01761352	3.25434E−11	1.98398E−09
Srsf5	−0.338591946	10.31310722	43.5233511	4.1893E−11	2.54257E−09
Ywhae	0.464501426	9.922516842	43.45147215	4.34605E−11	2.61436E−09
Adam8	0.535877549	9.576468918	43.45269502	4.34333E−11	2.61436E−09
Hmgb1	0.323083852	10.55704335	43.41280646	4.43278E−11	2.65478E−09
Cisd3	0.602086754	9.632969394	43.28209301	4.73901E−11	2.82574E−09
Ccdc117	−0.570173683	9.594031621	42.87429725	5.83726E−11	3.46539E−09
Ubald2	−0.36571417	10.66143541	42.56689302	6.83058E−11	4.03747E−09
Tram1	0.459368816	9.883728186	42.3939177	7.46217E−11	4.3917E−09
Ddx60	−0.373678564	9.541837476	41.90575092	9.57805E−11	5.61266E−09
Rpl18	0.16500821	11.86839686	41.52080501	1.16623E−10	6.80469E−09
Ftl1	−0.254126258	11.02867874	41.24955394	1.33982E−10	7.78415E−09
Cnn2	0.351443965	10.25976365	41.23898797	1.34709E−10	7.79304E−09
Arf5	0.335902191	10.19854297	41.17413621	1.39253E−10	8.0218E−09
Rps28	−0.17669445	11.84765533	41.03874747	1.49241E−10	8.56089E−09
Nrip1	−0.533322514	9.859993551	40.99470604	1.52642E−10	8.7192E−09
Uqcrfs1	0.407154567	9.966955579	40.84086269	1.65144E−10	9.3547E−09
Ddx24	−0.456807659	9.828797982	40.84178616	1.65066E−10	9.3547E−09
Spcs3	0.558898275	9.669879283	40.41720553	2.05127E−10	1.15714E−08
Psmd13	0.539440109	9.697470476	40.40366824	2.06553E−10	1.16037E−08
Sdcbp	0.448461817	9.891466083	40.3625637	2.10945E−10	1.18016E−08
Rtp4	−0.563163546	9.565691325	39.98728135	2.55622E−10	1.42425E−08
Cd28	−0.364314583	10.50430705	39.97688609	2.56986E−10	1.42601E−08
Gm10076	−0.363789063	10.01444869	39.8563226	2.73348E−10	1.51064E−08
1500009L16Rik	0.542202591	9.583684757	39.7287938	2.91792E−10	1.60604E−08
S100a13	0.386023024	10.11272451	39.59415967	3.12617E−10	1.71372E−08
Tprgl	0.439315767	9.937270565	39.49031889	3.2969E−10	1.80005E−08
Uqcrh	0.258509129	10.66055691	39.26239503	3.70509E−10	2.01483E−08
Hnrnpdl	−0.425883748	9.851559277	39.24467677	3.73886E−10	2.02509E−08
Trps1	−0.581094547	9.593491566	39.22474925	3.77722E−10	2.03775E−08
Sh3bgrl3	0.234852888	11.18097545	39.21492611	3.79627E−10	2.03993E−08
Nr4a1	−0.490052945	9.985650751	39.19056878	3.84393E−10	2.05741E−08
Zfand2a	−0.537861078	9.566631043	39.02336362	4.18764E−10	2.23259E−08
Irf1	−0.514113223	9.768522493	38.96928106	4.30527E−10	2.28633E−08
Limd2	0.322761237	10.43727909	38.93205538	4.38815E−10	2.31229E−08
Zbtb20	−0.581062467	9.584425294	38.93617746	4.3789E−10	2.31229E−08
Asb2	−0.544248262	9.850342678	38.84496818	4.58835E−10	2.40844E−08
Tiparp	−0.580123163	9.609123279	38.4953443	5.48845E−10	2.86982E−08
Isg15	−0.584150245	9.800573377	38.45870296	5.59246E−10	2.91301E−08
Csrnp1	−0.517948042	9.779414893	38.26534917	6.17494E−10	3.20414E−08
Tmem50a	0.386836955	10.00814313	38.15703896	6.52738E−10	3.37414E−08
Actn1	−0.533996189	9.567435546	38.08192888	6.78355E−10	3.49327E−08
Psmd8	0.424531567	9.892382532	38.00538221	7.05497E−10	3.60573E−08
Gm26699	−0.473480345	9.765120668	38.00550982	7.05451E−10	3.60573E−08
Cd244	0.388278993	9.55144543	37.91921304	7.37355E−10	3.75444E−08
Rps11	0.141420944	12.35636328	37.86091045	7.59723E−10	3.85173E−08
Ilk	0.536823666	9.680259126	37.85474135	7.62129E−10	3.85173E−08
Sdcbp2	−0.542086538	9.622445807	37.59342632	8.71377E−10	4.38754E−08
Ahr	−0.59092619	9.672948429	37.54436013	8.93574E−10	4.48271E−08
Rps21	−0.21136896	10.97596554	37.1282141	1.10612E−09	5.52855E−08
Plin2	−0.537264515	9.575959069	37.10475461	1.1195E−09	5.57497E−08
Rpl10a	0.200698396	11.2570968	37.0300252	1.16324E−09	5.77163E−08
Sdf2l1	0.529962562	9.709620662	37.00327913	1.17931E−09	5.83007E−08
Cox5b	0.305999662	10.32202341	36.9673266	1.20125E−09	5.91705E−08
Apobec3	0.437401019	9.902621042	36.93631025	1.22052E−09	5.99022E−08
Rpl9-ps6	−0.351320591	9.989161867	36.53264344	1.50131E−09	7.34183E−08
Gem	−0.682793999	9.688105676	36.46631611	1.55327E−09	7.56873E−08
Eprs	0.53788575	9.694503208	36.43986079	1.5745E−09	7.64476E−08
Gstp1	−0.504141129	9.64657452	36.38114233	1.62266E−09	7.85054E−08
Trp53inp1	−0.513550556	9.595006556	36.2425247	1.74227E−09	8.39935E−08
Ahnak	0.498211225	9.785411173	36.12837239	1.84737E−09	8.87458E−08
Arpc4	0.366807267	10.06345714	36.05320569	1.92003E−09	9.19111E−08
Rap1b	0.315806112	10.27367424	36.01786076	1.95517E−09	9.32651E−08
Kcnk5	−0.515305339	9.574931238	35.71192387	2.2876E−09	1.08741E−07
Cd9	−0.471749722	9.565476632	35.54177757	2.49639E−09	1.18252E−07
Ostc	0.453743376	9.79984885	35.34117534	2.7672E−09	1.30625E−07
Gnai2	0.271442641	10.46001918	35.19685572	2.98004E−09	1.40186E−07
Npm3	0.426799674	9.885664227	34.91904872	3.43702E−09	1.61125E−07
Hif1a	−0.430822834	9.908262886	34.69387483	3.85844E−09	1.80259E−07
Spcs2	0.323040264	10.17009625	34.61830814	4.01116E−09	1.86752E−07
Ap2m1	0.423344592	9.842161501	34.58702108	4.07615E−09	1.89101E−07
Edf1	0.331625317	10.10367538	34.58068966	4.08943E−09	1.89101E−07
Izumo1r	−0.621017876	9.606866954	34.41958125	4.44231E−09	2.0462E−07
Manf	0.417472957	9.905200221	34.41397814	4.45512E−09	2.0462E−07
Tgfb1	0.456071377	9.908533916	34.35865156	4.58358E−09	2.09811E−07
Rps3	0.136732909	11.97017084	34.23146089	4.89315E−09	2.22666E−07
Degs1	0.499847178	9.710625605	34.22985792	4.89718E−09	2.22666E−07
Ciapin1	0.505447675	9.69209499	33.8265408	6.02513E−09	2.73039E−07
Btg2	0.338891136	10.81509287	33.75955166	6.23621E−09	2.81665E−07
Hint1	0.319099291	10.22665553	33.64099662	6.6281E−09	2.9711E−07
Casp4	−0.476037532	9.726331048	33.63641218	6.64373E−09	2.9711E−07
Anxa11	0.487304216	9.703047741	33.64158832	6.62608E−09	2.9711E−07
Rnf115	0.477692622	9.719266495	33.60418158	6.75474E−09	3.01084E−07
Coq10b	−0.435536512	9.823130381	33.38844922	7.54709E−09	3.35303E−07
Gltscr2	0.281894891	10.46438057	33.12678111	8.63413E−09	3.82348E−07
Ero1l	0.519056603	9.611552364	33.00007472	9.21553E−09	4.0677E−07
Tomm7	−0.313476679	10.05823488	32.94049529	9.50232E−09	4.18071E−07
Ywhaq	0.413376988	9.880284734	32.91496101	9.62795E−09	4.22232E−07
Psmb8	0.247937082	10.58696086	32.69682093	1.07713E−08	4.70856E−07
Rhob	−0.466893188	9.565551549	32.68298283	1.08483E−08	4.727E−07
Rps10	0.169459818	11.27074258	32.67170702	1.09114E−08	4.73931E−07
Cd82	0.343430004	10.23707609	32.59801177	1.13331E−08	4.90678E−07
Abcb1a	−0.490964544	9.634618666	32.5330167	1.17185E−08	5.05754E−07
Ecm1	−0.428948374	9.548168048	32.5121924	1.18447E−08	5.09585E−07
Chchd2	−0.242250124	10.4145197	32.4935448	1.19589E−08	5.12875E−07
Stmn2	0.31474375	9.547934398	32.44033935	1.22908E−08	5.25453E−07
Ptprk	0.322461174	9.547124172	32.39925874	1.25534E−08	5.34997E−07
Zfp280d	−0.455933504	9.577105785	32.39298477	1.2594E−08	5.3505E−07
RP24-48411.3	0.45581967	9.573621121	32.28892999	1.32868E−08	5.62724E−07
Vps37b	−0.330737492	10.53077373	32.22402668	1.37381E−08	5.80031E−07
Tuba4a	−0.495588026	9.695802967	32.05135878	1.5015E−08	6.31978E−07
Cd27	−0.623155836	9.654241658	31.96170218	1.57242E−08	6.59787E−07
Rps19	0.147463744	12.62869486	31.76897993	1.73644E−08	7.26366E−07
Ndufa11	0.395844467	9.869001574	31.75589903	1.74817E−08	7.29032E−07
Pglyrp1	0.554448261	9.675823263	31.7328135	1.76908E−08	7.35493E−07
Gpr132	−0.347377843	10.08111363	31.62652046	1.8686E−08	7.74501E−07
Dnajb2	−0.398965682	9.552710551	31.53488229	1.9589E−08	8.09458E−07
Sfr1	0.436841829	9.79905978	31.52744207	1.96642E−08	8.10103E−07
Stmn1	0.869255435	9.718320163	31.23884134	2.28155E−08	9.3709E−07
Chn2	0.50726472	9.602283449	31.11036095	2.43767E−08	9.98195E−07
Atp8a2	0.515838144	9.630965479	30.97464046	2.61422E−08	1.06728E−06
Cd40lg	−0.471028099	9.806462091	30.89285541	2.72674E−08	1.10895E−06
Cxcl10	−0.727462227	9.649729541	30.88867223	2.73262E−08	1.10895E−06
Egr1	−0.58434076	9.573320341	30.82712287	2.82068E−08	1.14128E−06
Nubp1	0.473403814	9.680677072	30.783805	2.88435E−08	1.16358E−06
Eif3m	0.33858974	10.03086842	30.533751	3.28108E−08	1.31971E−06
Gm26917	−0.386612599	9.867968155	30.27290912	3.75332E−08	1.5052E−06
Atp5a1	0.330745474	10.05398237	30.25219304	3.79362E−08	1.51689E−06
Sytl1	0.450310542	9.57672802	30.16768361	3.96258E−08	1.5798E−06
Mier1	0.429759379	9.849073912	29.99380834	4.33428E−08	1.71869E−06
Tagap	−0.481023723	9.753295815	29.99293376	4.33624E−08	1.71869E−06
Ahsa1	−0.415991957	9.7343473	29.8494272	4.66935E−08	1.84534E−06
Acot9	0.486670609	9.629157206	29.79529145	4.80157E−08	1.8921E−06
Rps3a1	0.144785051	11.73486958	29.76024635	4.88915E−08	1.92104E−06
Serinc3	0.488696277	9.653334653	29.75265681	4.90833E−08	1.92302E−06
Rplp2	−0.134128458	11.87909328	29.57476782	5.38008E−08	2.10179E−06
Eif5a	0.271331035	10.45412985	29.306058	6.18022E−08	2.40745E−06
Tmem176a	0.659501681	9.760786899	29.24814254	6.36772E−08	2.47341E−06
Sh2d2a	0.372695089	10.07434142	29.15725241	6.67355E−08	2.58481E−06
Prmt1	0.433541135	9.752599757	29.09939463	6.87585E−08	2.64808E−06
Wdr89	−0.260435474	10.29803674	29.10467471	6.85713E−08	2.64808E−06
Msn	0.303992139	10.11460226	28.9457299	7.44347E−08	2.85859E−06
Ict1	0.436674726	9.753338871	28.93128095	7.4992E−08	2.87188E−06
Ythdc1	−0.434898908	9.695559663	28.82288915	7.93083E−08	3.02864E−06
Rpl13-ps3	−0.319707654	9.989340753	28.73260083	8.30931E−08	3.16429E−06
Gimap6	−0.244548357	10.59710866	28.72414041	8.34569E−08	3.16926E−06
Tmem30a	0.437623733	9.744492786	28.69389532	8.47705E−08	3.21018E−06
Rac1	0.311594293	10.06053352	28.63136373	8.75526E−08	3.29865E−06
Sesn1	−0.368525972	9.551406608	28.63049009	8.75921E−08	3.29865E−06
4930503L19Rik	−0.444136554	9.569307661	28.62410095	8.78815E−08	3.30041E−06
Gramd3	0.454475792	10.22334111	28.60513397	8.87466E−08	3.32372E−06
Nt5c	0.418853625	9.783355854	28.57256775	9.02518E−08	3.3708E−06
Zyx	0.49949057	9.653615873	28.51246827	9.3097E−08	3.46755E−06
Jmjd1c	−0.470611575	9.671839485	28.41495083	9.79063E−08	3.63671E−06
Oaz1	0.157157942	11.32703266	28.22495552	1.08003E−07	4.00082E−06
Atp5o	0.340449858	9.966789533	28.09237029	1.15661E−07	4.27285E−06
Slc25a4	0.403613648	9.854301686	28.07715311	1.16574E−07	4.29491E−06
2810417H13Rik	0.864238455	9.675098575	28.05895758	1.17675E−07	4.32377E−06
Cmpk1	0.392640439	9.806513171	27.94059504	1.25098E−07	4.5841E−06
Stat3	−0.40036914	9.799207752	27.92008019	1.26431E−07	4.6205E−06
Tmem160	0.361394762	9.896444569	27.89373698	1.28164E−07	4.67128E−06
Atf4	−0.416309212	9.732097606	27.83823326	1.31894E−07	4.79437E−06
Zfp706	0.377304609	9.852188098	27.77685472	1.36145E−07	4.93572E−06
Prr13	0.259162854	10.44540802	27.68287373	1.42922E−07	5.16764E−06

TABLE 2D
Colon IEL Ctrl vs KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Hspa1a	−4.912418231	10.69640911	4353.406085	0	0
Ubb	−0.77403293	12.42365996	2268.704696	0	0
Malat1	−0.969266612	14.67682077	2468.851731	0	0
Rbm3	0.950879034	10.81487562	1615.458299	0	0
Dnajb1	−2.106865401	9.893638618	1434.569266	0	0
Jun	−2.095847257	10.05710788	1333.458514	6.0574E−292	1.4803E−288
Fos	−2.354918413	10.11294467	1287.060873	7.3297E−282	1.5354E−278
Ubc	−0.885778987	10.8737827	1160.271008	2.6281E−254	4.8169E−251
Hspa1b	−1.572519816	9.464180989	1005.757106	1.0067E−220	1.6401E−217
Rps27rt	−0.855944525	10.45058647	960.5894229	6.6203E−211	9.7073E−208
Rps27	−0.456664488	12.77091707	884.4000389	2.416E−194	3.2205E−191
Rsrp1	−0.7538665	10.47574847	825.1217025	1.8632E−181	2.2767E−178
Rpl38	−0.450854758	11.36672195	727.8453794	2.6346E−160	2.9716E−157
S100a4	1.196877127	10.20124983	675.3497526	6.858E−149	7.1828E−146
Hsp90ab1	−0.625671337	10.70244953	672.3653519	3.0564E−148	2.9878E−145
Rplp0	0.358265483	12.22246018	637.178858	1.3725E−140	1.2578E−137
Rpl37a	−0.341973881	12.31974039	618.461248	1.616E−136	1.3938E−133
Asb2	−1.087110199	9.986148994	587.987702	6.8646E−130	5.592E−127
Dusp2	1.140087471	10.1241259	564.8664371	7.3454E−125	5.6687E−122
Hsp90aa1	−0.884650897	10.03922356	545.7934307	1.0354E−120	7.5908E−118
Uba52	−0.715686894	10.02413792	535.1932376	2.0948E−118	1.4627E−115
Rps29	−0.3494107	11.76226086	526.5778531	1.5684E−116	1.0453E−113
S100a6	0.665033272	11.40505169	473.014171	7.0773E−105	4.5119E−102
Rpl22l1	0.492941427	10.81346165	469.0919932	5.0508E−104	3.0858E−101
Slc25a5	0.48478658	10.63486828	453.0258552	1.5835E−100	9.28738E−98
Ass1	1.043502352	9.681786921	439.9535277	1.10805E−97	6.24899E−95
Rpl32	0.270960395	12.3093303	421.5380521	1.12894E−93	6.131E−91
Tmsb10	−0.379217961	12.59401337	403.7190476	8.53796E−90	4.47115E−87
Dynll1	0.539955191	10.37288347	403.0311001	1.20534E−89	6.09443E−87
Rps28	−0.361971479	11.20834805	399.8352948	5.98121E−89	2.92342E−86
Rpl3	0.251619694	12.09990026	380.8827502	7.99417E−85	3.78124E−82
H2-K1	−0.345378791	11.57577177	372.4393757	5.50898E−83	2.52432E−80
H2-D1	−0.260139164	12.2312739	355.6894705	2.44458E−79	1.08621E−76
Rpl29	0.374981802	11.0435012	354.0148476	5.66062E−79	2.44122E−76
Mptx1	−0.940597371	9.428866314	349.7728959	4.74892E−78	1.95256E−75
Gngt2	−0.855819774	9.686351451	349.7541182	4.79384E−78	1.95256E−75
Gm10076	−0.737584834	9.708049893	340.536643	4.87528E−76	1.93206E−73
Fosb	−0.857299353	9.419033424	337.6702214	2.05239E−75	7.91953E−73
H2-Q7	−0.485711612	10.45033154	337.4095826	2.33896E−75	8.79391E−73
Rpl24	0.274190325	11.71749233	330.3088265	8.23237E−74	3.01778E−71
Rpl41	−0.209689141	12.53198319	315.3142841	1.51906E−70	5.43268E−68
Plac8	0.788837939	10.43214592	307.2290402	8.76735E−69	3.06085E−66
Rps2	0.31789432	11.392	298.9635462	5.54091E−67	1.88945E−64
Klf6	−0.788289496	10.16162079	294.3554236	5.59207E−66	1.86356E−63
BC021614	0.881668333	9.536127554	287.8216032	1.48325E−64	4.8331E−62
Stat1	−0.701927733	9.831890541	283.3313126	1.41143E−63	4.4991E−61
Ifngr1	0.611436865	10.15474423	279.8164944	8.23351E−63	2.56868E−60
Crip1	0.445133772	11.63845182	278.3682928	1.70285E−62	5.20186E−60
B2m	−0.192178232	12.76962568	273.0340514	2.47551E−61	7.40783E−59
Rpsa	0.27943496	11.44702036	271.2401369	6.09017E−61	1.786E−58
Gm11808	−0.543144555	9.925523693	269.4920183	1.46427E−60	4.20993E−58
Eif4a2	−0.603016602	9.902866294	267.009303	5.09016E−60	1.43533E−57
Tomm7	−0.49876914	9.956780815	256.1536398	1.18292E−57	3.27266E−55
Vim	0.478069679	10.67155362	255.4815988	1.6575E−57	4.50071E−55
Rps3a1	0.242880798	11.51721161	254.1602609	3.21732E−57	8.57738E−55
Rps11	0.21510739	12.18975268	245.7818357	2.15808E−55	5.65071E−53
Cox17	−0.476013244	10.03899143	243.7133207	6.09623E−55	1.56823E−52
Rpl8	0.248159642	11.41010456	240.8276921	2.59557E−54	6.56187E−52
Ptprcap	0.389634275	10.51759166	240.350875	3.29761E−54	8.1954E−52
Dusp1	−0.904271717	10.0322272	236.1269017	2.74943E−53	6.71914E−51
Pycard	0.564371274	9.949662724	231.922578	2.27022E−52	5.45709E−50
Bhlhe40	0.630615216	9.942561935	230.8478654	3.89438E−52	9.21022E−50
Rcbtb2	−0.742317781	9.655868727	229.5682165	7.4047E−52	1.72342E−49
Rps6	0.203977864	12.02748398	229.4067809	8.02998E−52	1.83974E−49
Rpl10a	0.28962533	11.05684293	227.5062085	2.0855E−51	4.70456E−49
Wdr89	−0.524129877	9.860629364	225.9165989	4.63338E−51	1.02938E−48
Ccnd2	−0.468969455	10.33483348	218.2900005	2.13493E−49	4.67232E−47
Rps21	−0.33368489	10.56800568	217.5306651	3.12624E−49	6.74118E−47
Eif3f	0.304579066	10.76016509	214.3927099	1.51198E−48	3.21307E−46
H2afz	0.505010513	10.64921003	214.215217	1.65298E−48	3.46252E−46
Gm9843	−0.436865437	10.06758138	211.9041073	5.27779E−48	1.08998E−45
Neat1	0.7478016	9.746628843	210.8010385	9.18551E−48	1.87066E−45
Rpl18	0.221574798	11.68576023	209.1814055	2.07234E−47	4.16257E−45
Ltb	0.524512641	10.49312487	205.1159497	1.59766E−46	3.16575E−44
Phlda1	−0.955844714	9.533129244	202.73707	5.27912E−46	1.0321E−43
Cd160	0.733852101	9.934715958	202.6916375	5.40102E−46	1.04204E−43
Actg1	0.281414796	12.31487365	196.162142	1.43674E−44	2.73596E−42
Eif2s3y	0.687418848	9.547993406	195.8072505	1.71724E−44	3.22819E−42
Satb1	0.751494377	9.529465747	194.8575828	2.76754E−44	5.13677E−42
Serf2	−0.250130527	10.9456737	193.9668336	4.33015E−44	7.93662E−42
Ccl4	1.485785617	11.36531232	192.365257	9.68418E−44	1.75308E−41
Ldha	0.357711111	10.5986605	192.321415	9.89993E−44	1.77028E−41
Ndufa3	−0.395696872	10.08011666	190.6069001	2.34347E−43	4.14003E−41
Jund	−0.387305885	11.36254002	189.980835	3.21007E−43	5.60348E−41
Emp3	0.438130914	10.18357209	189.0713646	5.07031E−43	8.74659E−41
Cd52	0.210775009	12.64363478	184.4061463	5.28984E−42	9.01918E−40
Cd47	0.384229869	10.24153152	181.0529042	2.85451E−41	4.81101E−39
Bola2	−0.500931151	9.816144873	180.209206	4.36257E−41	7.26913E−39
Nop10	−0.447267852	9.964174868	178.3896367	1.08902E−40	1.79419E−38
Cotl1	0.347861789	10.82474878	177.3790784	1.81008E−40	2.94901E−38
Gpr18	0.707432613	9.62318615	176.8067404	2.41364E−40	3.88914E−38
Cbx4	−0.657383357	9.485214987	175.6581823	4.3001E−40	6.85351E−38
Rps10	0.235850397	11.06031224	174.7426765	6.81396E−40	1.07433E−37
Alyref	0.562801095	9.80640343	173.2604322	1.4358E−39	2.2397E−37
Hspe1	−0.498929135	9.822812601	172.3436082	2.27677E−39	3.51413E−37
Mif4gd	0.596663991	9.624117642	171.0774302	4.30377E−39	6.57356E−37
Btg1	0.33237651	11.54672282	170.0633984	7.16671E−39	1.08335E−36
Ywhae	0.451607278	9.886722446	169.5446464	9.30296E−39	1.39193E−36
Fgl2	−0.599214624	9.754853926	167.848361	2.18335E−38	3.23378E−36
Abi3	−0.514355959	9.839809501	166.8618241	3.58601E−38	5.25817E−36
Cox7c	−0.295724359	10.44152118	166.0753922	5.32595E−38	7.73213E−36
S100a11	−0.296848696	10.91816565	165.5905177	6.79695E−38	9.77095E−36
Coro1a	0.233952804	11.24278869	161.3819745	5.64562E−37	8.03706E−35
Zyx	0.598281587	9.607741404	160.0838661	1.08474E−36	1.52938E−34
Rad23a	−0.620382828	9.457741846	156.8432936	5.5385E−36	7.73439E−34
Gmfg	0.341067596	10.34860251	155.1988037	1.26692E−35	1.75253E−33
Hmgb2	0.55422263	10.54001319	154.9366563	1.44556E−35	1.96262E−33
Snrpg	−0.37093984	10.05500868	154.9375473	1.44491E−35	1.96262E−33
Cd247	−0.484714034	9.801664107	154.4549065	1.84211E−35	2.47806E−33
Icos	0.610190592	9.74486266	153.8284708	2.52473E−35	3.33515E−33
Gapdh	0.301102423	10.80087158	153.8412635	2.50853E−35	3.33515E−33
Rgs10	0.478781426	9.963476703	153.4973144	2.98254E−35	3.90473E−33
Lpar6	−0.636355346	9.566478995	153.46167	3.03652E−35	3.94022E−33
Klf2	0.990778098	10.07901749	150.7316392	1.19962E−34	1.54298E−32
Ifi27	−0.461697659	9.803250594	149.8692448	1.85157E−34	2.36083E−32
H2afy	−0.325716736	10.24951783	147.3520485	6.57313E−34	8.30878E−32
Rasgrp4	−0.504364183	9.405509348	147.1171723	7.39804E−34	9.27158E−32
Limd2	0.371058117	10.22214485	146.6145931	9.52761E−34	1.18393E−31
mt-Co1	0.202675662	12.19348251	143.8546255	3.82274E−33	4.71032E−31
Btf3	0.238036805	10.77125033	143.4716622	4.63559E−33	5.66431E−31
Grcc10	−0.537895935	9.60614827	143.4452179	4.69772E−33	5.69278E−31
Lax1	0.604314275	9.491039638	142.4955928	7.57737E−33	9.10713E−31
Tpm4	0.511683249	9.75042318	142.4364652	7.80633E−33	9.30603E−31
Rpl4	0.175431416	11.61378607	142.0480365	9.49244E−33	1.12248E−30
Gm9844	−0.536348989	9.601478567	141.5180167	1.23957E−32	1.45406E−30
Gm8797	−0.579685824	9.452636417	138.8347619	4.78665E−32	5.57037E−30
Txnip	−0.547016389	9.661178104	137.4469207	9.62828E−32	1.11165E−29
Pglyrp1	0.644569275	9.565961199	135.9739899	2.02161E−31	2.31585E−29
Gm42418	−0.592774056	9.478911026	134.3456302	4.59061E−31	5.218E−29
Ost4	−0.422518077	9.806199001	133.7229779	6.28163E−31	7.08519E−29
Atp5e	−0.277541227	10.36033547	133.4118899	7.34721E−31	8.22383E−29
Dkkl1	−0.607062031	9.511202131	132.8270224	9.86427E−31	1.09576E−28
Ifi27l2a	−0.682729091	9.830872885	132.0563095	1.45435E−30	1.60339E−28
PISD	−0.578023174	9.545282024	131.4161277	2.00781E−30	2.19705E−28
Usmg5	−0.349820825	9.9964598	130.3323663	3.46601E−30	3.7646E−28
Gpr171	0.438173645	9.903960288	127.5732549	1.39168E−29	1.50046E−27
Rgs1	0.397257884	11.60966783	125.5147395	3.92663E−29	4.20264E−27
Fxyd5	0.228232386	10.90619274	125.1071312	4.82199E−29	5.12354E−27
Ppp3r1	−0.54142838	9.487871313	124.5160325	6.49522E−29	6.85176E−27
Rpl37	−0.161343968	11.81568565	124.1329903	7.87824E−29	8.25133E−27
Cmtm7	0.454020607	9.769874757	122.7886537	1.55123E−28	1.61317E−26
Prelid1	0.389762152	9.89081496	122.7394091	1.59021E−28	1.64206E−26
Cox5a	0.261555498	10.46343799	122.650577	1.66303E−28	1.70524E−26
Cd4	−0.379389302	9.985453892	121.4080927	3.11084E−28	3.16766E−26
H3f3b	0.195676561	11.62147274	120.5475044	4.80034E−28	4.8543E−26
Sfpq	0.426928473	9.766528868	119.9027458	6.64394E−28	6.67261E−26
Rpl23a-ps3	−0.284048391	10.26446957	118.2728016	1.51108E−27	1.50728E−25
Ctsw	0.287951157	10.51671124	118.1709245	1.59072E−27	1.576E−25
Il27ra	−0.536474502	9.51098448	116.3402136	4.00371E−27	3.94003E−25
Nab1	0.501005233	9.58946001	115.9990896	4.75515E−27	4.64832E−25
Rpl39	−0.176812196	11.51658061	115.8551826	5.11303E−27	4.96505E−25
Esm1	0.580091419	9.435676786	115.739511	5.42012E−27	5.22864E−25
Rpl31	0.236225624	10.69362592	113.5096718	1.66865E−26	1.59918E−24
Glipr2	0.451381886	9.775168242	113.0218075	2.13415E−26	2.02059E−24
Rps26	0.232520083	10.83772226	113.0201539	2.13593E−26	2.02059E−24
Rps5	0.148067744	11.95622251	112.7529071	2.44413E−26	2.29732E−24
S1pr1	0.588401834	9.457285155	112.1393936	3.33051E−26	3.11053E−24
Sh3bgrl3	−0.168091093	11.68103931	112.1252361	3.35438E−26	3.11299E−24
Slc25a4	0.38380581	9.862505837	111.5888161	4.39661E−26	4.05456E−24
Rps19	0.154571784	12.45475351	111.1783432	5.40801E−26	4.9561E−24
Lgals1	0.264441023	11.89998374	111.0088631	5.89068E−26	5.3649E−24
Psmb9	−0.328731197	9.976063465	108.9172043	1.69208E−25	1.53154E−23
Gnai2	0.222498644	10.64920018	108.8441011	1.75565E−25	1.57934E−23
Mir142hg	0.551042944	9.496107108	108.2667593	2.34932E−25	2.10049E−23
Cd3e	−0.223197162	10.83627589	107.8485188	2.90126E−25	2.57826E−23
Fus	−0.355382378	9.87695395	107.2238774	3.97617E−25	3.51221E−23
Ppm1h	−0.510426159	9.531317964	106.7556798	5.03577E−25	4.42153E−23
Rpl36	−0.169365981	11.60496907	106.6065855	5.42925E−25	4.73864E−23
Ppp1r15a	−0.547132695	9.584142239	106.4313775	5.93112E−25	5.14603E−23
Ahrr	−0.268421399	9.388438844	104.7234475	1.40429E−24	1.21124E−22
Erdr1	0.54023863	9.475463995	104.6521757	1.45573E−24	1.24826E−22
Atp5k	−0.358970242	9.829102548	103.4309785	2.69626E−24	2.29856E−22
Shisa5	0.218856868	11.19765366	103.3840867	2.76083E−24	2.34001E−22
Eif3h	0.242394534	10.41255751	102.9208658	3.48806E−24	2.9394E−22
Mmp9	−0.359554026	9.392330763	102.2123398	4.98782E−24	4.17923E−22
Ubl3	0.463107639	9.607014043	102.0906527	5.30382E−24	4.41875E−22
Pet100	−0.433689861	9.632374387	101.939089	5.72555E−24	4.74315E−22
Capzb	0.223546007	10.5338718	101.9175981	5.788E−24	4.76795E−22
Rpl26	0.158164308	11.42098645	101.7241051	6.3819E−24	5.22781E−22
Reg3b	−0.500721243	9.406631246	101.3406774	7.74489E−24	6.30907E−22
Ub15	−0.252423517	10.30008476	99.79503049	1.69014E−23	1.3692E−21
Ptpn22	0.348842201	10.01581807	98.94795597	2.59225E−23	2.08847E−21
Bst2	−0.480431543	9.573589557	98.81392257	2.77378E−23	2.22251E−21
Ptp4a2	0.336132395	9.932198353	98.33705988	3.52899E−23	2.81226E−21
Ndufa5	−0.391689506	9.697497933	97.92740041	4.34006E−23	3.43991E−21
Fam189b	−0.444063386	9.678923066	97.73586286	4.78085E−23	3.7689E−21
Pim1	0.475298479	10.00737164	97.41181842	5.63089E−23	4.41528E−21
Hilpda	0.552369546	9.501052392	97.15607765	6.40723E−23	4.9973E−21
Fth1	−0.182222184	11.1646769	96.91852629	7.22396E−23	5.60449E−21
Bcl2a1b	0.376789448	10.02781406	96.24135593	1.01698E−22	7.84843E−21
Psme2	−0.259919999	10.31903574	96.15844171	1.06048E−22	8.14125E−21
Rps3	0.130737293	11.81737892	95.9917874	1.15361E−22	8.76445E−21
Rps16	−0.128415044	12.15232601	95.99483852	1.15183E−22	8.76445E−21
Bin2	0.33387622	9.94413916	95.89670834	1.21036E−22	9.14824E−21
Timp2	0.500779729	9.554063201	95.71940824	1.32376E−22	9.95402E−21
Rps4x	0.141401747	11.71126116	95.58313032	1.4181E−22	1.0609E−20
Agr2	−0.405588336	9.399615257	95.57125335	1.42663E−22	1.06186E−20
Ly6e	−0.239270346	10.72940372	95.54576674	1.44512E−22	1.07019E−20
2010107E04Rik	−0.282366294	10.06037516	95.05323724	1.85333E−22	1.3656E−20
Ywhah	0.314522758	10.03215277	94.92177622	1.98059E−22	1.45207E−20
S1pr4	0.461593658	9.637339017	94.89959417	2.00291E−22	1.46113E−20
Atf7ip	−0.497497145	9.522767261	94.00649346	3.1449E−22	2.28286E−20
Hnrnpf	0.206540192	10.67023919	93.76002102	3.56194E−22	2.57284E−20
Cxcr3	0.411891354	9.824285959	93.20771164	4.70843E−22	3.3843E−20
Rps15	−0.157626985	11.27418535	92.7653109	5.88782E−22	4.21137E−20
Rps18	0.12718884	12.37845441	92.51742519	6.67346E−22	4.75014E−20
Map2k3	0.484872054	9.558650852	91.50771196	1.11158E−21	7.87397E−20
Romo1	−0.364175595	9.742699809	90.79819383	1.59099E−21	1.12157E−19
Hic1	−0.486819612	9.58081968	90.32504307	2.02079E−21	1.41774E−19
Spink4	−0.422462121	9.400067934	90.00579616	2.37463E−21	1.65806E−19
Ang4	−0.232083493	9.386587169	89.63651639	2.86193E−21	1.98884E−19
Muc3	−0.250250477	9.387731659	88.43624664	5.24999E−21	3.63116E−19
1500009L16Rik	0.542706342	9.449829859	88.40371265	5.33705E−21	3.67405E−19
Mien1	−0.347724265	9.765232979	88.18655845	5.95633E−21	4.0812E−19
Gramd3	0.55125369	9.499432993	88.06414473	6.33659E−21	4.32155E−19
Pkm	0.240126678	10.49678124	88.04399147	6.40148E−21	4.3456E−19
Rpl27	−0.157552345	11.22543808	87.99513948	6.56155E−21	4.43373E−19
Dpm3	−0.360538159	9.721395651	87.74227048	7.45637E−21	5.01527E−19
Rhob	−0.532371904	9.442446398	87.18704808	9.87282E−21	6.61028E−19
Cxcr6	0.260123251	11.11844547	86.10298628	1.70805E−20	1.13841E−18
Sec61g	−0.221864807	10.42657775	86.01134149	1.78907E−20	1.18702E−18
Rps8	0.157110222	11.43109006	85.75218409	2.03959E−20	1.34714E−18
Cox7a2	−0.253012989	10.14397168	85.33018222	2.5248E−20	1.66014E−18
Il2rb	0.4060724	9.69063229	85.14880794	2.76735E−20	1.8115E−18
Cox14	−0.351555119	9.765850837	84.88340428	3.16488E−20	2.06252E−18
Srsf3	0.313008472	9.979900806	84.60915088	3.63579E−20	2.35892E−18
Tagln2	0.299483696	10.35627371	84.45265033	3.93527E−20	2.54198E−18
H2-Q6	−0.394471662	9.687987566	83.5063727	6.35109E−20	4.08448E−18
Arpc1b	0.173890126	10.87245212	83.26504726	7.17572E−20	4.59466E−18
Krt8	−0.403281524	9.403467815	82.98133851	8.28317E−20	5.2807E−18
Rps15a	−0.124996535	12.34731808	82.92709526	8.51362E−20	5.40412E−18
Wbscr16	−0.410455344	9.411788422	82.02708053	1.34235E−19	8.48399E−18
Rpl7	0.154932946	11.11907579	81.95526321	1.39202E−19	8.76017E−18
Penk	1.313010388	9.664975606	81.20109876	2.03879E−19	1.27755E−17
Rps7	0.129528661	11.72687307	80.86606628	2.41546E−19	1.50714E−17
Hsd11b1	0.447395686	9.606894656	80.84119223	2.44606E−19	1.51977E−17
Naca	0.178706035	10.80182933	80.33963058	3.15282E−19	1.95062E−17
Fcgbp	−0.217260104	9.386487028	80.30030325	3.2162E−19	1.98147E−17
Gltscr2	0.258412919	10.25123713	79.51651322	4.78212E−19	2.9339E−17
Socs3	0.641425478	9.534871697	79.32402869	5.27147E−19	3.22065E−17
Rpl10	0.162358681	11.36672343	79.30037032	5.33497E−19	3.24592E−17
Arpc2	0.162260977	10.92620521	79.11050195	5.87313E−19	3.55858E−17
Gstp1	−0.434068798	9.504080093	79.07810684	5.97023E−19	3.60253E−17
Krt19	−0.391532021	9.402773272	78.95610969	6.35052E−19	3.8163E−17
Itm2c	−0.366659839	9.727481117	78.79268166	6.89821E−19	4.12851E−17
Itga4	0.470754127	9.548703143	78.60469602	7.58688E−19	4.52222E−17
mt-Co2	0.156269384	11.43908237	78.49872805	8.00498E−19	4.7521E−17
Lamtor2	−0.320200859	9.784237142	78.001988	1.02937E−18	6.08614E−17
Rplp2	−0.128947756	11.60786585	77.94171939	1.06126E−18	6.2495E−17
Eif3e	0.229380939	10.26281367	77.57368334	1.27862E−18	7.48572E−17
Atp5c1	0.238726429	10.16724288	77.56940157	1.2814E−18	7.48572E−17
Il7r	0.426216078	9.82476784	77.38599496	1.40609E−18	8.18153E−17
Acot9	0.433260317	9.502553768	76.63286792	2.05884E−18	1.19323E−16
Epsti1	0.290518536	10.14939008	76.08122385	2.72234E−18	1.57156E−16
Pitpna	0.304228394	9.828351065	75.94567837	2.91577E−18	1.67662E−16
Lgals4	−0.431804311	9.417498631	75.87867365	3.0164E−18	1.72772E−16
Ccl3	1.454717185	9.969073606	75.79213983	3.15153E−18	1.79809E−16
Son	−0.321404034	9.820683121	75.4525749	3.7429E−18	2.12721E−16
Nfkb1	0.419614213	9.561478136	75.28061286	4.0835E−18	2.31183E−16
Tgoln1	−0.393359511	9.57609321	75.24554336	4.15668E−18	2.3442E−16
Atp5j2	−0.213360835	10.28220098	75.01663083	4.66766E−18	2.62229E−16
Car1	−0.319128886	9.392996933	75.00343268	4.69896E−18	2.62981E−16
Hnrnpdl	−0.372863275	9.619707402	74.56253495	5.87476E−18	3.27534E−16
Pfn1	0.121037041	12.58660393	74.20797213	7.03058E−18	3.9049E−16
Uqcrb	−0.231417337	10.14719696	73.86549321	8.36255E−18	4.62717E−16
Clca1	−0.232891953	9.388355562	73.82187536	8.54939E−18	4.71277E−16
ler5	−0.353397065	9.877196287	73.48444421	1.01432E−17	5.54964E−16
Stk17b	0.287659497	10.00946148	73.4861738	1.01344E−17	5.54964E−16
Rpia	−0.369007261	9.412241636	73.08643749	1.24094E−17	6.76429E−16
Syce1	−0.185525854	9.385331258	72.9581642	1.32427E−17	7.19179E−16
Tox	−0.427585214	9.428121663	72.61849444	1.57298E−17	8.47964E−16
H2-T23	−0.40377288	9.555965873	72.62324991	1.56919E−17	8.47964E−16
Cd44	−0.364888789	9.66492874	72.55033094	1.62826E−17	8.74548E−16
Atp1b3	0.41433275	9.580707758	72.36048167	1.79268E−17	9.59346E−16
Muc2	−0.224942562	9.387606097	72.28636024	1.86129E−17	9.92442E−16
Swt1	−0.41385543	9.494442155	71.64189782	2.58019E−17	1.37077E−15
Mpv17	−0.378283479	9.414892521	71.13939089	3.32858E−17	1.76198E−15
Xcl1	1.410763345	9.9045535	71.09150442	3.41035E−17	1.79878E−15
Gimap6	−0.242600873	10.32529467	71.01180327	3.55094E−17	1.86622E−15
mt-Atp6	0.124721425	12.48272412	70.91305335	3.7332E−17	1.955E−15
Slc3a2	0.341605532	9.804740905	70.51801022	4.56084E−17	2.37747E−15
Pigr	−0.280051952	9.389838816	70.51302832	4.57237E−17	2.37747E−15
Os9	−0.333807082	9.73183663	70.40523305	4.82917E−17	2.50212E−15
Gpr55	−0.377093893	9.4164776	70.06607575	5.73508E−17	2.96104E−15
Hist1h1e	0.382731133	9.412783797	69.86440121	6.35246E−17	3.26829E−15
Usp50	−0.40726079	9.47788197	69.75271034	6.72254E−17	3.4466E−15
Ifng	0.586034647	10.08145339	68.9524593	1.00866E−16	5.15329E−15
Chmp4b	0.279912699	9.888899548	68.63971522	1.182E−16	6.01792E−15
Marcksl1	0.566499192	9.462957421	68.27387403	1.42294E−16	7.21956E−15
Arf5	0.21433798	10.20061958	68.25797953	1.43445E−16	7.2529E−15
Ets1	−0.265183278	10.06484846	68.00483487	1.63095E−16	8.21809E−15
Errfi1	−0.506623695	9.438930011	67.59798357	2.00472E−16	1.00669E−14
Plp2	0.413929934	9.492940408	67.57578957	2.02742E−16	1.01461E−14
Rcn1	−0.40907025	9.519216091	66.03242907	4.43565E−16	2.20474E−14
Rtp4	−0.379831897	9.409532416	66.03488329	4.43013E−16	2.20474E−14
5430421N21Rik	0.469971619	9.44775018	65.67951525	5.30545E−16	2.62817E−14
Tpi1	0.400390794	9.596173139	65.25696016	6.57416E−16	3.24569E−14
Grb2	0.295777902	9.791814485	65.08737903	7.16495E−16	3.52549E−14
Arpc5	0.205320349	10.43833468	64.93908067	7.72497E−16	3.78834E−14
Gm20069	−0.42431626	9.468444875	64.77221814	8.40762E−16	4.10937E−14
Gm27166	−0.395023504	9.408886931	64.69484784	8.74432E−16	4.25973E−14
Atp6v0e	−0.220993968	10.11729457	64.50744858	9.61681E−16	4.66925E−14
Pkp3	0.260630633	10.14960699	64.12737993	1.16629E−15	5.64402E−14
Gm8186	−0.384808147	9.50310457	64.06797442	1.202E−15	5.77968E−14
Rbms1	0.355457007	9.624050922	64.06762225	1.20221E−15	5.77968E−14
Mns1	−0.413951384	9.50381656	64.02853318	1.2263E−15	5.87623E−14
Toporsos	−0.40742359	9.471023228	64.01861969	1.23249E−15	5.88664E−14
Tspan31	−0.373860991	9.600422269	63.53853721	1.5726E−15	7.4867E−14
Tyrobp	−0.256002079	9.38856945	63.32068377	1.7565E−15	8.33514E−14
Smim11	−0.348900564	9.59541229	62.78883943	2.30099E−15	1.08837E−13
Dusp5	0.43286125	9.605908356	62.67423675	2.43885E−15	1.14735E−13
Gnb2l1	0.185704553	10.46584315	62.67223491	2.44133E−15	1.14735E−13
Hspa8	0.143712814	11.71849799	62.55214913	2.59482E−15	1.21559E−13
3830403N18Rik	0.406986395	9.402762899	62.5092234	2.652E−15	1.23842E−13
Cd200r4	−0.437039881	9.478380078	61.39944901	4.65941E−15	2.16892E−13
Flna	0.405123767	9.466784234	61.36779384	4.73493E−15	2.1971E−13
Vasp	0.208908637	10.30936964	61.32523678	4.83839E−15	2.23802E−13
Sub1	0.172336396	10.71571666	61.2872353	4.93268E−15	2.27446E−13
Slc16a3	0.361619599	9.420568619	61.03912894	5.59516E−15	2.57185E−13
Phf11b	0.377804723	9.570888004	60.72994541	6.54667E−15	2.99981E−13
Ostf1	0.226133252	10.18287746	60.70239948	6.63892E−15	3.0326E−13
Vimp	0.357852382	9.630389398	60.39765297	7.75053E−15	3.52938E−13
Lypd8	−0.390113249	9.406877274	60.34483363	7.96132E−15	3.61415E−13
Mrpl52	−0.280626279	9.865813964	60.25390377	8.33773E−15	3.77334E−13
Gbp9	−0.384088329	9.438016299	60.13147871	8.87279E−15	4.00313E−13
Gnb2	0.225652666	10.06366194	60.06352254	9.18448E−15	4.13104E−13
Prkca	−0.382483897	9.504593373	59.99856572	9.49265E−15	4.2566E−13
Nudt21	0.308378932	9.720296786	59.88459376	1.00586E−14	4.49661E−13
1700025G04Rik	0.352987835	9.414190726	59.85240893	1.02244E−14	4.55686E−13
Cd3c	−0.153434384	10.94640525	59.77094849	1.06565E−14	4.73503E−13
Arhgdib	0.152619993	11.04633827	59.54265492	1.19672E−14	5.30136E−13
Ppp1cc	0.238784091	10.02736042	59.42918784	1.26775E−14	5.59909E−13
Eif1ax	0.353361615	9.588431037	59.17084112	1.4456E−14	6.36542E−13
Fau	−0.098888973	12.14505857	59.09913899	1.49925E−14	6.58188E−13
Rhoc	−0.387685476	9.453376689	58.34747412	2.19679E−14	9.61536E−13
Metap2	0.320908991	9.689184268	58.25059244	2.30767E−14	1.00707E−12
Sumo3	0.363648648	9.56114032	58.19517047	2.37361E−14	1.03277E−12
Gm12840	0.529072179	9.692861276	58.17118308	2.40273E−14	1.04234E−12
Tmem258	−0.239649837	9.950028733	57.86056954	2.81371E−14	1.21373E−12
Cytip	0.291537672	9.828704032	57.86012562	2.81435E−14	1.21373E−12
Selplg	0.207253382	10.43074656	57.58231875	3.24126E−14	1.39374E−12
Napsa	0.378797818	9.426630211	57.53254537	3.32433E−14	1.42528E−12
Rps17	0.195072222	10.51281529	57.36114851	3.62702E−14	1.55052E−12
Fas	0.397724601	9.519041189	56.98223888	4.39766E−14	1.8745E−12
Tbc1d10c	0.239368702	10.02017144	56.89287049	4.60211E−14	1.95596E−12
Rpl36-ps3	−0.368028492	9.521129953	56.68238187	5.12204E−14	2.17065E−12
Cox5b	0.205874088	10.23822956	56.60953206	5.31536E−14	2.24608E−12
Wbp1	−0.35246475	9.588426001	56.54338706	5.49719E−14	2.31625E−12
Gm8730	0.208874873	10.17481148	56.32847716	6.13208E−14	2.57635E−12
Tmbim6	−0.186680089	10.30239205	56.20299569	6.53619E−14	2.73829E−12
Rpl28	0.170032447	10.65239961	55.96849437	7.36417E−14	3.07638E−12
Ptpn1	0.303817614	9.726537881	55.73155029	8.30743E−14	3.46056E−12
Dnajb4	−0.355898832	9.426224573	55.55704902	9.07857E−14	3.77108E−12
Rap1a	0.229851445	10.02152566	55.44147997	9.62831E−14	3.98813E−12
Clec12a	0.407493649	9.44431809	55.2921659	1.03882E−13	4.29076E−12
Cirbp	−0.294228645	9.79666609	55.26784248	1.05175E−13	4.32478E−12
Zfp207	0.298332611	9.707086273	55.26559828	1.05295E−13	4.32478E−12
Nkg7	0.161386214	11.93144149	55.10052132	1.14521E−13	4.69054E−12
Ybx3	0.37881093	9.487988706	55.03788543	1.18229E−13	4.82894E−12
AY036118	−0.290741331	9.40297876	54.54808416	1.5169E−13	6.17844E−12
1110008F13Rik	0.315450921	9.63797391	54.46226129	1.58462E−13	6.43636E−12
Akt1	0.337984736	9.572351874	54.42636768	1.61383E−13	6.5369E−12
Klf10	−0.383277795	9.492201262	54.33969083	1.68661E−13	6.81286E−12
Gpr183	0.432865552	9.527212243	54.26631414	1.75078E−13	7.05264E−12
Rps27l	0.285042685	9.82708366	54.23787371	1.7763E−13	7.13586E−12
Zbtb20	−0.398415973	9.422971	54.10646146	1.89916E−13	7.60856E−12
Tpgs1	0.351098997	9.528091017	53.97780948	2.02767E−13	8.10128E−12
Hpgds	−0.332016761	9.41069171	53.93805376	2.06911E−13	8.2444E−12
Ppp3cc	−0.357588437	9.462008133	53.67190385	2.36927E−13	9.41481E−12
Skap1	−0.217904307	10.0596894	53.6434695	2.40381E−13	9.52625E−12
Sepw1	−0.202083637	10.28598242	53.38429242	2.74281E−13	1.08404E−11
Dapk2	−0.346083162	9.615406468	53.30411175	2.85708E−13	1.12617E−11
Il12rb2	−0.419238551	9.511930592	53.19792577	3.01577E−13	1.18553E−11
Cd53	0.216440054	10.33331217	52.86673853	3.56964E−13	1.39811E−11
Rps12	0.175598473	10.54841503	52.86346056	3.5756E−13	1.39811E−11
Cers4	−0.370534066	9.475950653	52.85080455	3.59871E−13	1.4034E−11

TABLE 2E
LPL vs Spleen
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Vps37b	4.009558718	10.15969053	23880.81061	0	0
Plac8	1.581001007	10.261266	2298.679714	0	0
Arl4c	−1.096267234	9.613739122	2298.057615	0	0
Gch1	1.451694506	9.324851002	2284.134024	0	0
Hspe1	1.120375739	10.04122428	2264.096349	0	0
Rps27	0.45403743	13.06487318	2254.517103	0	0
Vcpkmt	1.340902143	9.338076923	2247.925659	0	0
Zfp36l2	1.282113838	9.632863878	2245.382999	0	0
Clic1	−0.600757562	10.48551744	2235.204657	0	0
S1pr4	−1.034174133	9.576670552	2210.175336	0	0
Ehd1	1.34833462	9.340919328	2195.710203	0	0
Vgll4	1.246877772	9.565538844	2194.672026	0	0
Relb	1.295849411	9.344579138	2181.915352	0	0
Rpl41	0.311798353	12.67215529	2161.526683	0	0
Chd2	1.272965567	9.362981374	2130.251594	0	0
Psmb8	−0.521650348	10.57770041	2126.610125	0	0
Emb	0.955845249	10.04817873	2119.007483	0	0
Ninj1	1.323056016	9.256191245	2095.293443	0	0
Birc3	1.298784799	9.307476648	2040.969039	0	0
Anxa1	−1.543033853	9.396439695	2030.512514	0	0
Hsp90ab1	0.695394356	10.97592722	2021.815733	0	0
Nrp1	−1.298891806	9.180343991	1989.469145	0	0
Gm26532	1.340633117	9.201977563	1986.395582	0	0
Nr3c1	1.335661273	9.320572183	1975.598067	0	0
Fos	1.939072126	9.356513533	1949.123994	0	0
Ptpn7	−1.098586112	9.378744957	1946.818351	0	0
Herpud1	1.160978832	9.421398845	1921.000688	0	0
Lpxn	0.972160773	9.577823699	1912.201507	0	0
Dusp10	1.450167924	9.339187515	1910.235573	0	0
Cebpb	1.354746762	9.345842525	1906.273395	0	0
Cfl1	−0.480630683	11.2788147	2308.202655	0	0
Snx18	1.251604623	9.230155635	1884.711722	0	0
Cnbp	0.723097233	10.09221857	2327.043345	0	0
Smim3	1.463749514	9.239342615	2362.38165	0	0
Serpinb9	1.701828092	9.633156639	2778.027215	0	0
Nmrk1	1.703580609	9.325880651	2775.614	0	0
Lmna	1.988196567	9.500793605	2775.326852	0	0
Kcnn4	−1.280719622	9.426740809	2763.826967	0	0
Cnn2	−0.796651795	10.07688931	2733.152098	0	0
Ets1	0.865935776	10.06873785	2730.781656	0	0
Ifnar1	1.394023698	9.39348068	2702.666246	0	0
Nfkb2	1.416451857	9.378018127	2696.575281	0	0
Rpl38	0.479291508	11.50231551	2689.835505	0	0
Kdm2b	1.49910175	9.314276976	2668.313076	0	0
Hist1h1c	1.899413675	9.376902339	2666.207296	0	0
Tnfrsf1b	1.486664627	9.318747024	2637.622067	0	0
Fosb	1.843370572	9.275443905	2631.524006	0	0
Pfn1	−0.471336396	12.35410724	2630.65958	0	0
Ly6c2	−2.353611076	9.526958136	2598.695467	0	0
Tnfsf11	1.874016005	9.378727031	2597.403773	0	0
Rac2	−0.470957461	11.26305817	2586.49052	0	0
Per1	1.427684134	9.218646505	2584.621529	0	0
Rrad	1.697678281	9.38211759	2577.710629	0	0
Ddit4	−1.378670763	9.499428949	2548.030456	0	0
Nrip1	1.534927003	9.422635525	2531.038897	0	0
Dennd4a	1.439765985	9.24072726	2516.239312	0	0
Map3k8	1.567239393	9.298416412	2506.429161	0	0
Maff	1.476351404	9.20355435	2486.721122	0	0
Gpr183	1.345546371	9.514196163	2445.661726	0	0
Anxa6	−0.826956439	9.887832738	2436.02059	0	0
Litaf	1.609729506	9.308467153	2431.541523	0	0
Tbc1d10c	−0.950810827	9.643337868	2373.820075	0	0
Rpl37a	0.39133888	12.46681026	2368.041434	0	0
Rbm39	0.607400682	10.52053927	2327.915783	0	0
Actr3	−0.664337821	10.4077094	2779.972955	0	0
Plcxd2	1.339741239	9.251069352	1883.281793	0	0
Tspo	−0.647613294	10.04645974	1882.222917	0	0
Cdc42	−0.463632709	10.51588855	1603.493133	0	0
Selk	0.625079555	9.913225022	1602.885033	0	0
Zfp3611	1.170501061	9.40624196	1597.645418	0	0
Nr4a3	1.016389034	9.172429909	1596.136019	0	0
Cxcl10	1.598883919	9.240851428	1591.202272	0	0
Zyx	−1.045672086	9.373220658	1590.948124	0	0
Lin54	1.190845071	9.222484632	1579.909581	0	0
Rpl37	0.321884655	11.9503646	1579.248798	0	0
mt-Cytb	−0.421897009	11.23550207	1579.172468	0	0
Hnrnpf	−0.455123386	10.52390819	1578.292187	0	0
Peli1	0.916803098	9.61652175	1577.029497	0	0
Malat1	0.546709942	14.46716245	1575.560381	0	0
Insig1	1.23314691	9.265929909	1572.809776	0	0
Ppp1r16b	1.143580107	9.365739316	1572.696243	0	0
Reep5	−0.746733789	9.737965346	1566.865393	0	0
Gpx4	0.724736901	9.927359165	1560.006316	0	0
Ifng	1.694424607	9.500982203	1559.868513	0	0
Fkbp1a	−0.649924112	9.83535715	1555.689567	0	0
Stx11	1.159910256	9.327908379	1555.317141	0	0
Socs3	1.280365319	9.361846802	1552.722296	0	0
Phlda1	1.392376646	9.315470837	1528.438748	0	0
Mfsd6	1.164224359	9.264014917	1526.311577	0	0
Gzmb	1.732500572	10.06757702	1511.117786	0	0
Hbp1	1.068823826	9.308365307	1505.133032	0	0
Traf4	1.168895052	9.255444042	1498.895049	0	0
Ddit3	1.179486367	9.269696228	1491.285564	0	0
Dtx4	1.034303937	9.178017295	1490.811143	0	0
Sik1	1.038369744	9.179583562	1489.469987	0	0
AB124611	−1.056831806	9.18576542	1487.66957	0	0
Cdc42se1	−0.903345939	9.439589721	1606.39814	0	0
Gabpb1	1.275991664	9.34485467	1882.835108	0	0
Kpna1	1.188926205	9.266532319	1609.29646	0	0
Ldlrad4	1.213360812	9.205367734	1622.44325	0	0
Sp100	−0.864441892	9.662295373	1868.043867	0	0
Gpr171	1.021072703	9.57636816	1834.625452	0	0
Atf3	1.325297273	9.196373801	1802.980884	0	0
Tnfaip8l2	−1.05719081	9.395004626	1800.880544	0	0
Spn	−0.928132208	9.500542247	1791.461043	0	0
Plscr1	1.309849059	9.383402199	1789.387598	0	0
Aebp2	1.116047127	9.343970926	1785.470204	0	0
Dnajb9	1.24033724	9.281272707	1779.954261	0	0
Arl6ip5	−0.682541103	9.890325667	1770.083233	0	0
Tob2	1.323296597	9.313589329	1750.65385	0	0
Ppp1ca	−0.517869863	10.43097858	1746.20318	0	0
Ifi27l2a	−1.251027487	10.08297152	1740.339055	0	0
Crip1	−0.764501171	11.97479307	1738.170641	0	0
Wdr1	−0.778630406	9.661982528	1729.765806	0	0
Stat3	1.077543403	9.486265548	1729.317606	0	0
Nabp1	1.103465745	9.487243674	1721.614948	0	0
Arpc3	0.554163297	10.38658938	1713.609041	0	0
Hk2	1.233253218	9.197875054	1701.077294	0	0
Prkcq	−1.046433802	9.3213095	1691.976912	0	0
Areg	1.913703104	9.255472455	1691.701767	0	0
Rgcc	1.578501766	9.406425986	1661.879727	0	0
Bcl2l11	1.250982211	9.230833464	1657.235805	0	0
Uhrf2	1.180900948	9.419077555	1649.885224	0	0
Prdx1	−0.634280751	10.07947019	1648.801939	0	0
Jun	1.867730862	9.427464308	1639.113455	0	0
Ywhaq	−0.743677921	9.740986041	1631.460167	0	0
Nfkbie	1.19011788	9.287419751	1627.853905	0	0
Fut7	−1.062699209	9.158108524	1627.249297	0	0
Rpl36	0.367174335	11.74359785	1627.246697	0	0
Txndc5	−1.090326933	9.243654724	1617.22599	0	0
Ppia	−0.511777146	11.74358668	2794.793642	0	0
Sema4a	−1.424308061	9.241797243	2470.2212	0	0
S100a6	−1.045197044	11.39764863	2830.471179	0	0
Itgb1	−2.897673381	9.764726657	7266.956354	0	0
Nr4a1	2.692070423	9.419456526	7059.962503	0	0
Btg2	1.671637356	10.22813028	7057.938285	0	0
Ifrd1	2.113629694	9.751098304	6942.518787	0	0
Slc3a2	1.818065901	9.824654011	6939.012246	0	0
Rnf157	1.564061754	9.236925083	2811.277242	0	0
Cd48	−1.552731996	10.08313072	6733.969626	0	0
Orai1	2.031182755	9.642689825	6709.374791	0	0
Ms4a6b	−1.10429405	10.51708752	6525.231353	0	0
Mxd1	2.454007515	9.403127833	6451.949777	0	0
Gpr132	1.862994857	9.638154261	6304.793777	0	0
Prdx6	1.568918578	9.939310118	6301.185371	0	0
Nfkbiz	2.356142607	9.431478134	6262.978333	0	0
Fth1	0.904024109	11.31936277	6242.555727	0	0
Bcl2a1d	2.042665993	9.693840798	6226.697766	0	0
Ddx5	0.952948791	10.94169958	6176.842997	0	0
Neurl3	2.291995793	9.422883382	6083.82123	0	0
Pde4b	2.141569839	9.459117556	6048.258702	0	0
Ramp3	2.930687962	9.642864931	5988.463883	0	0
Cd52	−0.796245466	12.13359984	5974.617413	0	0
Kdm6b	2.638646687	9.504202492	5850.261738	0	0
Coro1a	−0.838091837	11.0659365	5816.078249	0	0
Fosl2	2.335832539	9.352839289	5695.725353	0	0
Got1	2.334162607	9.599631296	5680.076036	0	0
Gramd3	1.916759134	9.918543027	5620.679858	0	0
Zc3h12a	2.176380795	9.362848531	5610.099047	0	0
Klf2	−1.767005406	10.48569203	5373.578517	0	0
Gadd45b	2.426306327	9.500826601	5239.796282	0	0
Hif1a	1.780128237	9.565953875	5140.654989	0	0
Nfkbia	2.074463071	10.45274542	7539.224662	0	0
Emp3	−1.213102789	10.15411072	5128.633776	0	0
Traf1	1.897847312	9.834035476	7663.691793	0	0
Akap13	1.663872351	10.02648752	8049.393054	0	0
Junb	2.921231675	11.34612064	21369.42787	0	0
Btg1	2.116029741	11.76687431	18450.45163	0	0
Tnfaip3	3.546622186	9.77629499	17313.81847	0	0
Ubald2	2.898183798	10.20759585	16609.50842	0	0
Rgs1	3.741819446	10.58284028	16488.72974	0	0
H3f3b	1.419705723	11.96347813	16463.45133	0	0
Bhlhe40	2.475029045	10.31956761	15891.72535	0	0
Jund	2.107406468	11.36637401	15261.14463	0	0
Ctla4	3.553585624	9.803253865	14522.85331	0	0
Pnrc1	2.15434723	10.22062858	13387.98624	0	0
Pim1	2.650738825	10.39640396	12688.13388	0	0
Odc1	3.273282194	10.05458095	12438.55364	0	0
Ms4a4b	−1.388879734	11.2982785	12023.83633	0	0
Hspa5	1.762426402	10.61032756	10372.84498	0	0
Dusp5	2.558389281	9.706009226	10293.91778	0	0
Crem	3.182372679	9.742097098	10249.83742	0	0
Tnfrsf4	2.842699768	10.21808516	9824.168095	0	0
Ifngr1	1.731994699	10.73718794	9664.17174	0	0
Eif1	0.89426742	11.59142126	9507.112454	0	0
Furin	3.228695217	9.993985472	9448.5407	0	0
Ubb	1.103098222	12.5650094	9356.998296	0	0
Dusp1	3.172241508	9.640554712	9051.339287	0	0
Bcl2a1b	2.039441995	10.06905308	8924.378246	0	0
Rgs2	3.216003123	9.735808693	8865.377702	0	0
Tgif1	2.669467418	9.488421786	8609.872205	0	0
Icos	2.257604109	9.939093266	8555.625143	0	0
Gna13	2.210200992	9.714523893	8465.331307	0	0
Il21r	2.276530222	9.883875602	8187.01809	0	0
Prr7	2.588699784	9.57070472	8146.897164	0	0
Srgn	1.128130336	11.07156455	8022.942843	0	0
Nr4a2	2.380718393	9.345009261	5127.819344	0	0
Dgat1	2.502339096	9.536306398	6766.351571	0	0
Lilr4b	2.068066286	9.554402213	5105.653595	0	0
Pglyrp1	−1.578157174	9.494896552	3736.717229	0	0
Clk1	1.412333559	9.582346831	3707.927922	0	0
Hsp90aa1	1.398095596	10.45163337	3583.071262	0	0
S100a10	−0.838341879	11.23216634	3576.86891	0	0
Srsf5	1.06692542	9.897475047	3538.850894	0	0
AI467606	−1.477840682	9.366543594	3529.615644	0	0
D16Ertd472e	1.538790532	9.456346393	3480.361308	0	0
Pycard	−1.186370114	9.771692598	3477.954478	0	0
Ptpn22	1.180249407	9.888180464	3456.544416	0	0
Il4ra	1.73212666	9.347559129	3449.594642	0	0
Hsd11b1	−1.455842293	9.399808528	3413.567354	0	0
Cirbp	1.295170619	9.642760985	3349.752172	0	0
Dnaja1	1.152714388	10.49300516	3345.386455	0	0
Myl6	−0.594146002	11.12573097	3316.559472	0	0
Fasl	1.646552093	9.427586977	3258.871927	0	0
Cd28	1.075016619	10.15896389	3221.672715	0	0
Csrnp1	1.751004019	9.322536386	3211.316895	0	0
Sqstm1	1.424220111	9.492387286	3195.177459	0	0
Klf6	1.575786258	9.681592634	3153.720756	0	0
Ptprcap	−0.830524912	10.24764013	3140.577969	0	0
Dnajb6	1.025227273	9.838018226	3095.166709	0	0
Coq10b	1.529034118	9.363466488	3063.979793	0	0
Rel	1.688619703	9.305031672	3052.495801	0	0
Itgb2	−1.323533083	9.794213175	5122.905985	0	0
Rnf125	1.43084709	9.410691476	3015.190192	0	0
Atp1b3	−1.188356367	9.541177167	2959.565466	0	0
Crbn	1.35989983	9.537037527	2862.044372	0	0
Lilrb4a	1.62136421	9.469548765	2849.108644	0	0
Tnfsf8	2.003699437	9.748893292	2841.22511	0	0
Fam110a	1.855968483	9.339616307	3742.547868	0	0
Lsp1	−0.85697683	10.56861487	3749.810676	0	0
Ccnd3	−1.115585967	9.67648159	3025.973562	0	0
Stk17b	1.121601456	9.887717235	3796.865615	0	0
Hilpda	2.295082881	9.459740509	5096.687516	0	0
P2ry10	2.00384552	9.406978436	5064.082883	0	0
Skil	2.104468774	9.381816818	5012.624057	0	0
Itgb7	−1.084543942	10.22214203	4961.314584	0	0
Ubc	1.107062199	10.77239943	4775.13384	0	0
Hspa8	0.861483141	12.05339949	4723.217104	0	0
Arf4	1.361714648	9.759651944	4573.762943	0	0
S100a4	−1.822225081	10.3993079	4512.496598	0	0
Lgals1	−1.14532414	12.13039325	4400.084682	0	0
Samsn1	1.812848974	9.577321817	4380.19289	0	0
Rora	1.625105758	9.750458338	4279.038537	0	0
Cd69	1.956584843	9.648469291	4244.509669	0	0
Itk	1.558211507	9.611291599	4240.243249	0	0
Arid5a	1.670309896	9.477417365	4224.262832	0	0
Dnajb1	2.4916257	9.971238873	4317.921832	0	0
Arhgap31	1.920161613	9.463440841	4211.687512	0	0
Tnfrsf18	1.32855039	9.848184871	3814.199865	0	0
Gm12840	2.186828689	9.862794257	3868.008163	0	0
Ctsd	−1.262237547	9.86539271	4217.656935	0	0
Sh2d2a	1.535581984	9.642030852	4029.081971	0	0
Cytip	1.135941313	9.972903526	4032.840636	0	0
Hspa1a	3.929295111	10.49028171	3753.849294	0	0
Ptp4a1	1.541286869	9.515613922	4057.508994	0	0
Cdkn1a	2.230173637	9.480758236	3950.6614	0	0
Arhgdib	−0.675912229	10.95838921	4102.421066	0	0
Tspan32	−1.853896914	9.311138568	4112.407261	0	0
Bin2	−1.121802636	9.796752534	4061.613939	0	0
Glipr2	−1.355596511	9.677643142	4113.247068	0	0
Rasgrp2	−1.490656382	9.547266701	4194.458667	0	0
Ppp1r15a	1.921918974	9.417222937	4206.958192	0	0
Rps27l	−0.790585793	9.634266967	1451.086527	0	0
Lztfl1	1.239473856	9.305427356	1450.149784	0	0
Tmem123	0.845950877	9.530098905	1448.989968	0	0
Actn2	1.250413478	9.425542778	1448.693327	0	0
Ndufa4	−0.671796207	9.843210891	1446.791341	0	0
Vim	−0.707157046	10.6775884	1442.832741	0	0
Arpc1b	−0.403868405	10.67217992	1440.52746	0	0
Phf11b	−0.946380058	9.358275331	1438.351162	0	0
Capn2	−0.91793996	9.369740513	1428.333582	0	0
Mxi1	1.087678308	9.216625774	1426.267933	0	0
Tgif2	1.040060076	9.18888498	1415.219631	0	6.605E−308
Apobec3	−0.782739383	9.585116167	1403.461263	3.7178E−307	2.3626E−305
Tnfrsf9	1.369904528	9.278619133	1396.683257	1.1045E−305	6.9933E−304
Esyt1	−0.897252948	9.384944625	1382.905158	1.0894E−302	6.8727E−301
Flna	−0.978570065	9.307490367	1380.264205	4.084E−302	2.5671E−300
Usmg5	0.63064033	9.923002096	1378.078435	1.2192E−301	7.6359E−300
Adora2a	1.059391205	9.316041201	1370.747214	4.7772E−300	2.9814E−298
D8Ertd738e	0.617633538	9.895276459	1370.032005	6.8326E−300	4.2489E−298
Id3	−1.333328527	9.200499915	1367.64552	2.2552E−299	1.3974E−297
Prdx4	−1.059670059	9.193532854	1363.160708	2.127E−298	1.3133E−296
Sdf4	0.70306217	9.785099467	1362.622111	2.7849E−298	1.7134E−296
Nfil3	1.075323099	9.192168652	1362.527538	2.9198E−298	1.7901E−296
Il2rg	0.652629336	9.986962428	1360.726772	7.1891E−298	4.3921E−296
H2-Q4	0.817421022	9.616635172	1357.777577	3.1445E−297	1.9144E−295
Gimap6	0.618227968	10.30516051	1355.495711	9.8496E−297	5.9756E−295
Zeb1	1.106302599	9.265995084	1354.501578	1.6198E−296	9.7928E−295
Avl9	1.038144975	9.286737515	1345.10992	1.7796E−294	1.0722E−292
Rps27rt	0.555934358	11.01209013	1344.386415	2.556E−294	1.5346E−292
Btg3	1.056866822	9.23085599	1337.533638	7.8836E−293	4.7172E−291
Rsrp1	−0.606429022	10.12693264	1333.093968	7.2695E−292	4.3348E−290
Gngt2	1.116293195	9.262770571	1332.833959	8.2796E−292	4.9203E−290
Gm20186	1.128143873	9.208968634	1331.733776	1.4358E−291	8.5034E−290
Lck	−0.448015594	10.43154115	1327.416216	1.2455E−290	7.3514E−289
Zcchc11	1.033365137	9.25900753	1326.729463	1.7562E−290	1.0331E−288
Dtx1	−1.112944741	9.293744389	1324.589255	5.1247E−290	3.0044E−288
Polg2	1.008383697	9.189277582	1324.203906	6.2146E−290	3.6311E−288
Pde4d	0.978758479	9.184653426	1318.71138	9.7051E−289	5.6517E−287
Il22	2.340701289	9.319200911	1307.314053	2.9092E−286	1.6885E−284
Ms4a4c	−1.131637582	9.194976637	1297.197315	4.595E−284	2.6581E−282
Map3k14	1.068225388	9.243899938	1290.032314	1.6571E−282	9.5541E−281
Dusp4	0.943758908	9.167405616	1289.59139	2.0662E−282	1.1873E−280
Hexb	−0.955449076	9.253917287	1284.064918	3.2821E−281	1.8799E−279
Calm1	−0.398344969	10.95709394	1280.097217	2.39E−280	1.3644E−278
S100a13	−0.556791844	9.994311271	1273.779414	5.6411E−279	3.2099E−277
Lfng	−0.911433167	9.448019615	1270.087278	3.5788E−278	2.0298E−276
Abcb1a	1.030096997	9.210772627	1262.459651	1.6269E−276	9.1972E−275
Cyba	−0.443659225	10.54811046	1258.623632	1.1092E−275	6.2501E−274
Tmsb4x	−0.267366545	14.35989227	1257.793098	1.6807E−275	9.4401E−274
Ccr5	1.14137339	9.386994832	1254.698733	7.906E−275	4.4263E−273
Dynll1	−0.533721052	10.16004138	1245.450142	8.0885E−273	4.514E−271
Cdc25b	−1.011124608	9.240089381	1241.171393	6.8823E−272	3.8286E−270
Itpkb	0.954598204	9.393345749	1231.44857	8.9273E−270	4.9504E−268
Ifi47	−1.019302639	9.324191671	1226.120429	1.2843E−268	7.0989E−267
Pim3	1.120079893	9.232710072	1223.737702	4.2313E−268	2.3315E−266
Mir142hg	1.002778292	9.203588598	1221.931528	1.0447E−267	5.7384E−266
Slc38a2	0.980080989	9.356984714	1217.969539	7.5865E−267	4.154E−265
Add3	−0.936691018	9.260409169	1206.100053	2.8813E−264	1.5727E−262
H2-Q6	0.761009186	9.610491146	1203.68587	9.644E−264	5.2475E−262
Asb2	1.117112448	9.36183005	1199.915336	6.3635E−263	3.4518E−261
Sesn3	0.935543404	9.346703299	1196.855271	2.9426E−262	1.5912E−260
Fus	0.646782373	9.766633699	1195.296437	6.4197E−262	3.4607E−260
Myo1f	−0.873721079	9.342854295	1195.091822	7.1119E−262	3.822E−260
Hsph1	1.166689856	9.349269322	1192.706446	2.3464E−261	1.2571E−259
Ptpn6	−0.882603255	9.388975554	1187.971213	2.509E−260	1.3401E−258
Def6	−0.806896845	9.38910456	1185.235824	9.8624E−260	5.2515E−258
Sub1	0.452332616	11.00148656	1179.659467	1.6066E−258	8.5285E−257
Abcb1b	1.031343273	9.207220814	1177.281825	5.28E−258	2.7944E−256
4930523C07Rik	0.720136823	9.698992642	1167.683789	6.4357E−256	3.3957E−254
Traf3ip3	−0.853000826	9.34798616	1163.769696	4.5631E−255	2.4004E−253
Ube2b	0.610256432	9.791411125	1160.573155	2.2593E−254	1.1849E−252
Sytl3	0.90845429	9.39100109	1157.949128	8.3997E−254	4.392E−252
Smad7	0.993817761	9.276173853	1155.62533	2.6872E−253	1.4009E−251
Casp4	0.970497764	9.304035945	1150.905397	2.8518E−252	1.4822E−250
Cxcr3	−0.782625551	9.636541469	1140.943197	4.1712E−250	2.1616E−248
Zc3hav1	0.783012423	9.545786673	1139.080842	1.0593E−249	5.4732E−248
Prkar1a	0.51534633	9.989784924	1129.99109	1.0013E−247	5.1583E−246
Stat4	0.87162553	9.393938041	1124.641897	1.456E−246	7.4785E−245
Pabpc1	0.354811986	10.74945661	1118.678903	2.8785E−245	1.4741E−243
Tpst2	−0.683138851	9.562387953	1118.595548	3.0011E−245	1.5324E−243
Camk2n1	1.044877893	9.246195314	1099.512516	4.2154E−241	2.1461E−239
Rcsd1	−0.841278225	9.314558222	1097.472831	1.1699E−240	5.9389E−239
Irf4	0.93980886	9.17631645	1097.239553	1.3148E−240	6.6549E−239
Fam65b	−0.901719998	9.278382726	1091.496759	2.3282E−239	1.175E−237
Lbr	−0.742593678	9.489271039	1091.478886	2.3491E−239	1.1822E−237
Apbb1ip	−0.734076752	9.476988831	1091.350028	2.5056E−239	1.2573E−237
Ctla2a	0.918347724	10.12270773	1087.781562	1.4945E−238	7.4778E−237
Ndfip1	0.723456574	9.542168744	1087.435345	1.7773E−238	8.867E−237
Ubl5	0.460259851	10.14988664	1085.990773	3.6621E−238	1.8218E−236
Fam46a	1.216427371	9.373607718	1084.141952	9.2377E−238	4.5825E−236
Kcnab2	−0.822790253	9.316762961	1080.193997	6.6626E−237	3.2957E−235
Ahr	1.055054007	9.234738845	1079.788424	8.1619E−237	4.0259E−235
Hbb-bs	−0.875475832	9.153071488	1078.386874	1.646E−236	8.0958E−235
Osgin1	0.942209138	9.166127069	1076.502703	4.2261E−236	2.0728E−234
Il12rb2	1.030381194	9.249916639	1075.546924	6.8183E−236	3.3348E−234
Fau	0.234758491	12.21265562	1071.940035	4.146E−235	2.0221E−233
Mier1	0.825393149	9.428014107	1070.148889	1.0161E−234	4.942E−233
mt-Co3	−0.275253772	12.22313569	1069.075336	1.7389E−234	8.4338E−233
Rasa3	−0.903689186	9.255738017	1058.61195	3.2696E−232	1.5814E−230
E2f2	−0.8392467	9.159524644	1053.99296	3.2995E−231	1.5914E−229
Ptp4a2	0.574398647	9.844619398	1050.023682	2.4054E−230	1.157E−228
Rpl27	0.281823678	11.36103815	1048.388203	5.4533E−230	2.6158E−228
Pomp	−0.550362574	9.774637428	1047.45567	8.6966E−230	4.16E−228
Ube2j1	0.830125377	9.345358827	1046.789853	1.2136E−229	5.7893E−228
Dbi	−0.752178664	9.531198139	1041.960926	1.3604E−228	6.4718E−227
Rbpj	0.922052977	9.288273063	1040.747485	2.4969E−228	1.1846E−226
Racgap1	−1.030040933	9.267128908	1032.284027	1.7258E−226	8.1657E−225
Rinl	−0.701653781	9.499382409	1031.73747	2.2688E−226	1.0706E−224
Map1lc3a	0.930943669	9.222575159	1025.770847	4.4945E−225	2.1151E−223
Stk38	−0.839920214	9.310126564	1016.59735	4.4323E−223	2.0802E−221
Rom1	−0.922814364	9.186853274	1016.525731	4.5941E−223	2.1503E−221
Ier5l	0.849227509	9.153032957	1016.270631	5.2197E−223	2.4366E−221
Atic	−0.890335932	9.211770003	1015.191565	8.9576E−223	4.1703E−221
Bcl2l1	0.976985439	9.276721393	1013.469591	2.1207E−222	9.8469E−221
Abracl	−0.493515818	10.02337263	1012.64476	3.2046E−222	1.484E−220

TABLE 2F
IEL vs Spleen
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Rgs1	4.262079706	10.67767028	16605.4657	0	0
Cd160	1.993212278	9.512810414	2102.741037	0	0
Actn2	1.659090902	9.531861239	2089.000144	0	0
Pglyrp1	−1.501489373	9.640341062	2053.499203	0	0
Gngt2	1.675642097	9.359655682	1985.016955	0	0
Ifng	2.245135482	9.611310602	1971.078308	0	0
Atp1b3	−1.310004856	9.650252258	1944.791465	0	0
Osgin1	1.626820627	9.262214394	1937.431479	0	0
Ubc	0.849179414	10.53817088	1905.724403	0	0
Ckb	1.739428091	9.348935381	1902.202899	0	0
Ly6c2	−2.504398179	9.67510089	2151.306825	0	0
Rps19	−0.525105269	12.68187153	1875.342571	0	0
mt-Cytb	−0.557479877	11.32634498	1739.463783	0	0
Litaf	1.571091076	9.323626777	1730.972116	0	0
Lgals1	−0.864462482	12.37139459	1689.543998	0	0
Dapk2	1.539044461	9.314819002	1679.288972	0	0
Ms4a4b	−0.585021214	11.67414781	1629.224356	0	0
Emp3	−0.828192522	10.36526113	1589.900258	0	0
Rplp0	−0.402486196	12.41844544	1541.987891	0	0
Ddx5	0.577762999	10.6942535	1491.549434	0	0
Gpr34	1.45129199	9.307758489	1483.078432	0	0
Rps8	−0.501436752	11.65645422	1855.710838	0	0
Tspan32	−1.857483249	9.43206433	2309.54436	0	0
Ubb	0.587733421	12.12717783	2159.371295	0	0
Btg2	1.389291695	10.01747436	2562.865196	0	0
Junb	2.384505986	10.73966867	7545.660651	0	0
Dusp1	3.030607317	9.53465407	4234.923152	0	0
Itgb1	−2.870641087	9.973925881	4205.16325	0	0
Cd69	2.283758528	9.690665292	4092.761065	0	0
Abi3	2.236724652	9.438058313	4047.605221	0	0
Jund	1.265368178	10.81995682	3897.741946	0	0
Fos	3.359701466	9.582648832	3867.81214	0	0
Klf2	−1.774396751	10.69289158	3810.169639	0	0
Jun	2.95696533	9.570921865	3765.507669	0	0
Ms4a6b	−0.806571053	10.73301473	2352.116967	0	0
Btg1	1.17808929	11.04741079	3248.989903	0	0
Cxcr6	1.462933277	10.57309895	3323.908054	0	0
Hspa1a	3.860361274	9.996281107	3132.38968	0	0
Ctsw	1.202949028	10.10085922	2877.890061	0	0
Rasgrp2	−1.634496669	9.675037233	2872.189184	0	0
Klf6	1.892054861	9.70857084	2829.292235	0	0
Asb2	2.111944299	9.548775661	2817.279328	0	0
Amica1	1.953284071	9.478445084	2779.961972	0	0
Furin	2.413436865	9.609122409	2776.783836	0	0
Itm2b	0.705576535	11.21870081	2774.794338	0	0
Cd3g	0.678489262	11.28334695	2737.378773	0	0
Itgae	2.265437232	9.373851416	3164.762104	0	0
Crip1	−0.770514594	12.07555511	1477.500162	0	0
mt-Atp6	−0.388845529	12.61166871	1444.234208	0	0
S100a4	−1.18365345	10.66366393	1435.922499	0	0
Rpl8	−0.45414365	11.59716841	1428.757788	0	0
mt-Co3	−0.393548607	12.29236826	1428.055822	0	0
Skil	1.402316776	9.30797085	1426.937262	0	0
Ifi2712a	−1.450531959	10.18524586	1396.949077	9.6694E−306	3.1179E−303
Gadd45b	1.580780927	9.341379728	1381.831612	1.8641E−302	5.9015E−300
Ccl4	3.686687264	10.50318841	1373.907492	9.8271E−301	3.0555E−298
AW112010	0.590006061	11.88680588	1344.968361	1.9103E−294	5.8353E−292
Hic1	1.42721533	9.293785776	1341.859244	9.0517E−294	2.7174E−291
Ly6g5b	1.413897369	9.280717651	1325.037738	4.0946E−290	1.2084E−287
Bcl2a1d	1.240479361	9.479817541	1319.618632	6.1637E−289	1.7887E−286
Dusp2	1.29812206	9.739066913	1311.780358	3.1131E−287	8.8861E−285
S1pr4	−1.041809426	9.681229931	1297.038961	4.9739E−284	1.3969E−281
Sgk1	−1.39232095	9.335085016	1280.164904	2.3104E−280	6.3856E−278
Mapkapk3	1.160234155	9.443868055	1274.296635	4.3548E−279	1.1848E−276
Rps3a1	−0.385150761	11.68169968	1260.878972	3.5881E−276	9.6118E−274
Glipr2	−0.940668004	9.853250247	1246.002646	6.1347E−273	1.6185E−270
Rps20	−0.56020392	10.99041833	1243.157128	2.5479E−272	6.6216E−270
Rps17	−0.563047054	10.69497822	1233.249546	3.6252E−270	9.2825E−268
Malat1	0.588800482	14.37997813	1223.18936	5.5673E−268	1.4049E−265
Tnfaip3	1.426715741	9.302203564	1222.117432	9.5192E−268	2.3678E−265
Slamf6	−1.452746909	9.424776552	1207.916821	1.1608E−264	2.8467E−262
Lag3	1.863437794	9.404044177	1184.663271	1.3135E−259	3.1764E−257
Rps6	−0.367229946	12.18088129	1181.87815	5.2931E−259	1.2625E−256
Bcl2a1b	1.013192394	9.692981785	1171.176339	1.1209E−256	2.6373E−254
S100a10	−0.611743271	11.3818739	1171.100606	1.1641E−256	2.7027E−254
Ehd1	1.245626999	9.349651414	1170.157928	1.8659E−256	4.2748E−254
H2afz	−0.815169676	10.88644706	1166.361727	1.2472E−255	2.8202E−253
Apol9b	1.139074323	9.225731368	1166.140287	1.3933E−255	3.1103E−253
Cd38	1.278780699	9.321520345	1155.58763	2.7384E−253	6.0356E−251
Rpl29	−0.451553781	11.21299617	1154.787878	4.0861E−253	8.8935E−251
Rbpj	1.213743294	9.354366621	1142.009944	2.4458E−250	5.2575E−248
Gpr171	0.992352465	9.586322101	1112.18461	7.4241E−244	1.5764E−241
Dnajb1	1.309635611	9.56298969	1106.132968	1.5343E−242	3.2188E−240
Plac8	1.290227127	10.01229068	1102.413441	9.8705E−242	2.046E−239
Aldoa	0.640398084	10.2226702	1095.154589	3.7326E−240	7.6461E−238
Rps5	−0.368948183	12.10797403	1089.924265	5.1144E−239	1.0355E−236
Anxa1	−1.436448141	9.514591367	1086.543383	2.7773E−238	5.5584E−236
Rgs2	1.44060445	9.304465505	1075.968262	5.522E−236	1.0926E−233
Rgs10	1.055568254	9.634558763	1068.444474	2.3845E−234	4.665E−232
Rplp1	−0.407337669	11.58510276	1067.917965	3.1033E−234	6.0039E−232
Rpl21	−0.372542865	11.67596432	1061.07808	9.5166E−233	1.8209E−230
Camk2n1	1.271116935	9.309540856	1052.321018	7.6181E−231	1.4418E−228
Arhgdib	−0.41229592	11.15444337	1045.725621	2.0672E−229	3.8703E−227
Neat1	1.195998299	9.446396783	1025.145275	6.1469E−225	1.1386E−222
Rpl32	−0.325305646	12.45425636	1010.039595	1.1804E−221	2.1635E−219
Mxd1	1.25624995	9.266182111	1003.274001	3.4883E−220	6.327E−218
mt-Nd4	−0.510585429	10.65212475	996.4531242	1.0598E−218	1.9024E−216
Ctla4	1.2913399	9.290657695	984.1703115	4.9556E−216	8.8048E−214
Rps4x	−0.339096552	11.85896399	976.6294311	2.159E−214	3.7972E−212
Hbb-bs	−1.006330094	9.230738885	976.6079899	2.1823E−214	3.7997E−212
Cd3e	0.493125143	10.54127341	975.2453323	4.3162E−214	7.441E−212
Srgn	0.536001419	10.69028649	969.6923156	6.9529E−213	1.1869E−210
Rps7	−0.361780836	11.89493797	958.9162718	1.5296E−210	2.5858E−208
Smim3	1.114768141	9.249649885	955.3599849	9.0702E−210	1.5186E−207
Fasl	1.135893724	9.368313371	945.8583186	1.0545E−207	1.7487E−205
Nr4a1	1.432783006	9.262165007	943.1908477	4.0077E−207	6.5831E−205
Lpxn	0.860705006	9.573491654	939.7712079	2.2194E−206	3.6117E−204
Nrp1	−1.151078008	9.269548869	922.0870285	1.5504E−202	2.4995E−200
Hcst	0.587237628	10.53140426	918.4462426	9.5912E−202	1.5321E−199
Cd9	−1.245593031	9.317378372	913.1639268	1.3495E−200	2.1361E−198
Susd3	0.938349002	9.478294991	907.2901186	2.553E−199	4.0047E−197
Rpl38	0.391339203	11.2758405	896.3541086	6.0869E−197	9.4629E−195
Itgb7	−0.559510469	10.45112407	894.290745	1.7098E−196	2.6346E−194
Bin2	−0.632699558	9.986168083	887.0930266	6.2757E−195	9.5853E−193
Rps11	−0.292018742	12.31112894	886.2098796	9.7646E−195	1.4784E−192
Neurl3	1.119559655	9.280786296	858.9627424	8.1858E−189	1.2287E−186
Hmgb2	−0.947980515	10.87140735	857.9515297	1.358E−188	2.021E−186
Tnfrsf25	−1.141346675	9.325984856	852.1182469	2.518E−187	3.7155E−185
Il21r	0.94141111	9.484637076	838.9198588	1.8639E−184	2.7273E−182
H3f3b	0.374221947	11.35853232	838.6673109	2.1151E−184	3.069E−182
Ccr7	−1.230256877	9.274847488	834.9590376	1.3537E−183	1.9481E−181
Sh2d1a	−0.93528822	9.633910801	834.4242155	1.7693E−183	2.5252E−181
Fam65b	−1.061529155	9.353791259	831.196016	8.9052E−183	1.2606E−180
Rpsa	−0.326786093	11.58222174	826.7117255	8.4056E−182	1.1803E−179
S1pr1	−1.045505474	9.378176807	823.4981118	4.1999E−181	5.8503E−179
Ldlrad4	1.006112174	9.235552707	809.9266305	3.7484E−178	5.18E−176
Prdx4	−1.066608254	9.276690245	808.031196	9.6816E−178	1.3274E−175
AB124611	−1.023170957	9.268582849	807.8449459	1.0628E−177	1.4457E−175
Klf3	−1.186891126	9.31685725	805.2114908	3.9719E−177	5.3611E−175
Nedd9	0.99989357	9.334070971	800.3269765	4.5811E−176	6.1359E−174
Ppp1r15a	1.114264497	9.318633918	796.3865749	3.2937E−175	4.3779E−173
Ahr	1.105381504	9.279326539	796.2018926	3.6128E−175	4.7656E−173
Rps2	−0.38282646	11.545051	795.678974	4.6939E−175	6.1451E−173
Rpl35a	−0.310787517	11.63257095	791.8001781	3.2724E−174	4.2521E−172
Gzmb	1.515904822	9.944249279	782.411994	3.598E−172	4.6406E−170
Cish	0.979424054	9.414754089	780.9865643	7.3449E−172	9.4036E−170
Akap13	0.752120035	9.708953687	778.3867251	2.6993E−171	3.4307E−169
Gzma	1.951748481	11.34314196	773.458912	3.1819E−170	4.0148E−168
Gadd45g	1.350903661	9.293836915	771.2493214	9.6188E−170	1.2049E−167
Ccr5	1.055098668	9.400279713	767.3790788	6.6776E−169	8.305E−167
Ccl5	1.208924468	13.67587951	757.739843	8.3271E−167	1.0283E−164
Limd2	−0.586230549	10.26889424	757.5864436	8.9918E−167	1.1026E−164
Plekhf1	1.019330549	9.263192932	728.2887944	2.11E−160	2.5692E−158
Rpl28	−0.391130178	10.77653256	726.4014939	5.4284E−160	6.5639E−158
Nkg7	0.578359003	11.62073593	723.3444287	2.5085E−159	3.0123E−157
Sema4a	−1.025446315	9.351055105	722.8049034	3.2865E−159	3.9195E−157
Rps12	−0.454488734	10.7143326	716.5056658	7.7001E−158	9.1207E−156
Mir142hg	0.981584406	9.249452604	714.3596403	2.255E−157	2.653E−155
Nr4a2	1.310458939	9.245298726	710.3616104	1.6693E−156	1.9507E−154
Plk3	1.067784554	9.346984393	699.4513487	3.9356E−154	4.5685E−152
Rps27a	−0.296136488	11.76900547	698.3920575	6.689E−154	7.7132E−152
Bhlhe40	0.858136819	9.662074795	696.7934058	1.4894E−153	1.7061E−151
Ms4a4c	−1.088441443	9.282107963	693.3564808	8.3251E−153	9.4743E−151
mt-Nd1	−0.380326867	11.2629884	690.4436462	3.5795E−152	4.0471E−150
Med10	0.73641002	9.523002102	687.5656361	1.5124E−151	1.699E−149
Rpl10a	−0.355092665	11.17378178	687.3757938	1.6632E−151	1.8564E−149
S100a6	−0.583209178	11.66425634	676.2798097	4.3047E−149	4.7741E−147
Flna	−0.915188626	9.394672482	676.1026688	4.704E−149	5.1839E−147
Slc3a2	0.786942874	9.537633493	675.8712633	5.2819E−149	5.7841E−147
Fth1	0.349796278	10.96871293	669.4836567	1.2939E−147	1.4081E−145
Pim1	0.899833541	9.699776734	669.2064071	1.4866E−147	1.6077E−145
Ermn	1.063075406	9.259478586	668.7191115	1.8974E−147	2.0394E−145
Rps18	−0.298129514	12.48866118	668.1114963	2.5722E−147	2.7476E−145
Pnrc1	0.704253854	9.692827582	667.913303	2.8405E−147	3.0158E−145
Hist1h1c	1.172958994	9.29446422	656.8278894	7.3146E−145	7.7189E−143
Pdlim1	−0.922335931	9.370260078	656.2072833	9.9807E−145	1.0469E−142
Rnf149	0.917040109	9.334081045	653.6098152	3.6648E−144	3.8211E−142
Tff1	1.026000433	9.22546748	648.9038566	3.8681E−143	4.009E−141
Hsd11b1	−0.77670808	9.561647283	629.6623451	5.9191E−139	6.0985E−137
Cd47	−0.476883342	10.29751655	617.2298436	2.994E−136	3.0666E−134
Rpl31	−0.363933126	10.81463059	616.0827323	5.3181E−136	5.4151E−134
Gpr18	0.981990926	9.352283484	615.5237916	7.0359E−136	7.1227E−134
Pycard	−0.59566406	9.979121804	610.9981535	6.7865E−135	6.8305E−133
Runx3	0.728527491	9.562720515	609.0561824	1.7949E−134	1.7961E−132
Ubac2	0.756993118	9.471979592	604.7793569	1.5285E−133	1.5208E−131
Gimap7	0.557513099	10.02409941	604.3949278	1.853E−133	1.8332E−131
Cd27	−1.036859444	9.404666177	603.3770562	3.0851E−133	3.0349E−131
Fut7	−0.813298011	9.241991725	601.2763096	8.8347E−133	8.6421E−131
Cd7	1.054957536	9.801914175	598.3586942	3.8089E−132	3.705E−130
Hspa8	0.305700865	11.60840881	597.894494	4.8058E−132	4.6488E−130
Coro1a	−0.302618405	11.3347192	596.775756	8.4159E−132	8.096E−130
Cdc25b	−0.926265339	9.328139226	594.1243079	3.1756E−131	3.0381E−129
Gramd3	−0.898686441	9.420567345	593.3827375	4.6038E−131	4.3804E−129
Ccl3	2.761276819	9.496917967	588.348771	5.729E−130	5.4213E−128
Nsg2	−0.821700106	9.230550514	581.3504475	1.9069E−128	1.7948E−126
Prdx6	0.617318162	9.661183975	580.9418509	2.34E−128	2.1905E−126
Dok2	−0.748098844	9.542583178	575.0766093	4.416E−127	4.1118E−125
Apol9a	0.687625082	9.203228477	574.0747894	7.2937E−127	6.7552E−125
Mptx1	0.725791051	9.203528419	573.8140249	8.3113E−127	7.6569E−125
Ptpn22	0.614248744	9.745489627	570.9953324	3.4104E−126	3.1254E−124
Gm26532	0.863998792	9.218766316	567.0071602	2.5139E−125	2.2917E−123
Adgrg1	0.666167406	9.202504636	561.9069435	3.2344E−124	2.9332E−122
Prdx5	0.626969797	9.618053492	558.211872	2.0587E−123	1.8573E−121
Rps3	−0.233251504	11.90667401	557.2016632	3.4147E−123	3.0648E−121
Ypel3	0.698378192	9.67572785	555.8482393	6.7262E−123	6.006E−121
Pmepa1	0.722569784	9.209646525	555.5816234	7.6873E−123	6.8291E−121
P2rx7	0.872094397	9.290334827	553.6533556	2.0195E−122	1.7849E−120
Rftn1	0.780530727	9.38529654	553.5817803	2.0932E−122	1.8408E−120
Rps15	−0.281171407	11.39272392	550.2446875	1.1137E−121	9.7444E−120
Ier2	0.664096741	9.809742381	549.9735323	1.2757E−121	1.1106E−119
Cotl1	0.432498996	10.57561017	548.7207422	2.3894E−121	2.0698E−119
Rpl14	−0.278682856	11.83763413	544.6000766	1.8824E−120	1.6226E−118
Id2	0.489582245	10.94720261	538.5213781	3.9546E−119	3.392E−117
Nabp1	0.775579548	9.441457345	538.4457335	4.1073E−119	3.5057E−117
Serpina3g	0.932154861	9.583786505	537.5406431	6.4634E−119	5.4675E−117
Ywhaq	−0.525927234	9.879377712	537.5390489	6.4686E−119	5.4675E−117
mt-Nd2	−0.534446067	9.939205918	537.222614	7.5797E−119	6.3757E−117
Cpd	0.725500446	9.212757368	536.6810278	9.942E−119	8.3226E−117
Samhd1	−0.727184214	9.58455645	535.8115532	1.5368E−118	1.2804E−116
Prkcg	−0.768998828	9.429526956	533.8722419	4.06E−118	3.3663E−116
Slc9a3r1	0.50081584	9.871867879	531.9985034	1.0379E−117	8.5651E−116
Prdx1	−0.436919808	10.23820402	515.5474221	3.9379E−114	3.2343E−112
Cd2	−0.451491441	10.25558839	514.4176199	6.9355E−114	5.6695E−112
Ly6c1	−0.845983228	9.223958343	514.1576066	7.9003E−114	6.4281E−112
Rom1	−0.874065681	9.273403894	511.8000784	2.5738E−113	2.0844E−111
Aim2	0.8277845	9.261912654	504.4701056	1.0125E−111	8.1526E−110
Sec61g	0.400877072	10.22586732	504.4630547	1.016E−111	8.1526E−110
Gstm5	0.902058784	9.230637004	503.3328649	1.7898E−111	1.4296E−109
mt-Co2	−0.264507091	11.49074591	502.8822201	2.2432E−111	1.7835E−109
Tspo	−0.42076822	10.19442167	501.8646488	3.7348E−111	2.9559E−109
Map3k8	0.886100204	9.270683592	501.6110699	4.2407E−111	3.3411E−109
St6galnac3	0.883785968	9.281772021	499.8464583	1.0265E−110	8.0514E−109
Ucp2	0.468618682	10.01352738	497.1644322	3.9349E−110	3.0724E−108
Lsp1	−0.374419062	10.79768635	495.9820381	7.1155E−110	5.531E−108
Hba-a1	−0.61069366	9.205576591	495.0296708	1.1466E−109	8.8734E−108
Fgl2	0.806015418	9.503341859	493.6372642	2.3035E−109	1.7747E−107
Efhd2	0.593457057	9.629719472	493.1402658	2.9548E−109	2.2665E−107
Stk17b	0.544966261	9.749708021	491.2101692	7.7713E−109	5.9348E−107
Cd4	0.566897576	9.757520572	491.0179769	8.5568E−109	6.5062E−107
1600014C10Rik	0.804522875	9.336807011	490.7645054	9.7155E−109	7.355E−107
Cmah	−0.647892227	9.221071111	490.4164898	1.1566E−108	8.7182E−107
Wbp1	0.78371793	9.336308361	483.5355138	3.6344E−107	2.7277E−105
Smad7	0.824276691	9.295734689	482.9761258	4.81E−107	3.5945E−105
5430421N21Rik	0.787547001	9.216296912	482.101492	7.4553E−107	5.5475E−105
Igfbp4	−0.890958237	9.223424268	479.0282947	3.4768E−106	2.5761E−104
Rhob	0.762632846	9.215115957	477.1124388	9.0798E−106	6.699E−104
Rpl4	−0.233195869	11.68632408	476.3582095	1.3249E−105	9.7341E−104
Ccl1	3.115968281	9.596379606	475.9162433	1.6534E−105	1.2096E−103
Gramd1a	0.681833843	9.490134539	474.69533	3.0482E−105	2.2207E−103
Prkar1a	0.427630344	9.98187113	474.2673884	3.7771E−105	2.7403E−103
Lilrb4a	0.909524168	9.363990735	472.8669947	7.6189E−105	5.5046E−103
Kcnn4	−0.660071444	9.574572775	471.6792428	1.3815E−104	9.94E−103
Rps26	−0.315405888	10.92694571	470.3775483	2.6522E−104	1.9004E−102
Isg20	0.825783773	9.282559299	468.9706448	5.3674E−104	3.8302E−102
Tnfsf11	0.884737646	9.274816839	466.9953633	1.4441E−103	1.0263E−101
Cd82	0.481854251	10.17845419	466.5620801	1.7943E−103	1.27E−101
Tpm4	−0.612729082	9.709350388	466.1516286	2.204E−103	1.5537E−101
2810474O19Rik	−0.765852699	9.427307461	464.4024391	5.2949E−103	3.7175E−101
Gcnt2	0.670930148	9.208179265	463.4609738	8.4865E−103	5.9344E−101
Dusp5	0.823340659	9.351651501	459.0693513	7.6633E−102	5.3373E−100
Dok1	0.747411005	9.32999967	458.9167176	8.2724E−102	5.7386E−100
Tmem256	0.61810974	9.531009831	458.096344	1.2478E−101	8.622E−100
Adgrg5	0.685604528	9.212262974	457.8845661	1.3875E−101	9.5494E−100
Pfdn5	0.361119936	10.44951346	454.7727164	6.5986E−101	4.5234E−99
Traf1	0.665520256	9.518543672	454.3640596	8.0981E−101	5.5296E−99
Rps10	−0.264905947	11.16449461	454.1113701	9.1913E−101	6.2515E−99
Itga1	0.74909445	9.228969457	453.097764	1.5274E−100	1.03485E−98
Lilr4b	0.858881674	9.344215918	451.2048016	3.9438E−100	2.66163E−98
Rasa3	−0.781161253	9.347767194	450.5315409	5.5263E−100	3.71524E−98
Izumo1r	−1.216792535	9.314620339	448.5664961	1.4794E−99	9.90745E−98
Rpl12	−0.365836896	10.8499333	448.4935947	1.5344E−99	1.02367E−97
Tnfaip8l2	−0.656173911	9.525752027	444.3087909	1.24939E−98	8.30319E−97
Txndc5	−0.757766414	9.346388362	443.7890437	1.62111E−98	1.07326E−96
Lef1	−0.800271093	9.363794019	442.1237796	3.7345E−98	2.46307E−96
Prrt1	0.602550339	9.204288164	440.8898295	6.93083E−98	4.55395E−96
St6galnac2	0.639011431	9.20894446	436.5796195	6.00979E−97	3.93393E−95
Tcf7	−0.852294436	9.454127633	429.8926644	1.71494E−95	1.11837E−93
Frmd4b	0.73174728	9.22917364	425.8933346	1.27266E−94	8.26851E−93
Bcl2	−0.888178196	9.591081981	423.7626419	3.7023E−94	2.39645E−92
Rpl10	−0.249865961	11.48093566	423.7211872	3.78002E−94	2.43769E−92
Penk	1.86460897	9.328467588	423.0442881	5.30673E−94	3.40962E−92
Rps24	−0.243016167	11.88186655	420.8311132	1.60896E−93	1.02997E−91
Dgka	−0.685020808	9.458704546	420.0237087	2.41149E−93	1.53805E−91
Cox17	0.477747199	9.819102932	418.0059291	6.62952E−93	4.21289E−91
Nt5e	0.784054933	9.259960638	417.8805506	7.05947E−93	4.4698E−91
Plcxd2	0.772699883	9.245478992	414.2485755	4.35845E−92	2.74961E−90
Reep5	−0.488697469	9.868713475	412.7987005	9.01418E−92	5.66624E−90
Cd244	0.705384043	9.214900481	411.9645549	1.36929E−91	8.57629E−90
Ifitm3	−1.027216242	9.940629422	411.873886	1.43295E−91	8.94286E−90
Arid5a	0.713220342	9.354599172	411.1681094	2.04108E−91	1.26926E−89
Myl6	−0.261289897	11.30790412	409.3658743	5.03686E−91	3.12106E−89
Ppp2r2c	0.519156642	9.197405353	408.2335859	8.88447E−91	5.48569E−89
Ly6e	−0.333786835	10.78770429	406.6496223	1.96528E−90	1.20917E−88
Sike1	−0.692535807	9.394852686	405.2866661	3.89146E−90	2.38585E−88
Ndufa4	−0.441522604	9.985023527	404.1704464	6.80914E−90	4.16003E−88
1500009L16Rik	−0.898102208	9.364736674	404.1467767	6.89041E−90	4.19496E−88
Nt5c	−0.559849517	9.571043992	402.8215085	1.33885E−89	8.12269E−88
Icam2	−0.738300082	9.298358105	401.7927545	2.24221E−89	1.3556E−87
Id3	−0.987410593	9.302895586	399.6777741	6.47261E−89	3.89969E−87
Znrf1	0.698891421	9.390734877	399.2341991	8.08426E−89	4.8539E−87
Kcnab2	−0.660175762	9.41152398	398.2712409	1.30998E−88	7.83829E−87
Satb1	−0.760996699	9.4527421	396.169245	3.75709E−88	2.24036E−86
Ccdc107	0.654848921	9.378243207	393.4693721	1.45412E−87	8.64132E−86
Add3	−0.706199058	9.360336043	393.3945083	1.50972E−87	8.94125E−86
Ppia	−0.251687631	11.88768862	392.2838879	2.63436E−87	1.5549E−85
Tnf	0.969127686	9.271925014	391.1558162	4.6372E−87	2.7278E−85
Fkbp1a	−0.411230721	9.974773786	389.5576999	1.03316E−86	6.05702E−85
Ppp1r16b	0.748777981	9.348007448	389.2877898	1.18284E−86	6.91129E−85
Acot7	0.540236341	9.607603124	387.5039543	2.8925E−86	1.68442E−84
Rps25	−0.258837917	11.05911713	387.094298	3.55188E−86	2.06151E−84
Gfi1	0.715163437	9.250672945	386.1958488	5.57257E−86	3.22358E−84
Plscr1	0.753523551	9.338606765	381.7694026	5.12551E−85	2.95514E−83
Gm10076	0.602471507	9.555749844	380.8630837	8.07337E−85	4.63939E−83
Ubl5	0.359954618	10.09812301	377.4561365	4.45456E−84	2.55141E−82
Capg	0.525034521	10.11973006	375.9622763	9.41997E−84	5.37772E−82
Xcl1	2.334924237	9.473572265	373.6035421	3.07328E−83	1.74875E−81
Hemk1	0.683812596	9.224911739	373.2693929	3.63374E−83	2.06094E−81
Fam101b	−0.826001151	9.238078205	371.9127234	7.17361E−83	4.05542E−81
Sub1	−0.312398738	10.73812115	371.8733076	7.31678E−83	4.12297E−81
Tnfrsf1b	0.703666663	9.266812765	370.9442092	1.16577E−82	6.54784E−81
Arl4c	0.52714599	9.791946773	366.58533	1.03677E−81	5.80458E−80
Hba-a2	−0.455920224	9.198210536	366.2675731	1.21582E−81	6.78522E−80
AU020206	0.673883407	9.367737735	365.5506469	1.74169E−81	9.68894E−80
Hnrnpf	−0.273127308	10.67200379	365.2988081	1.97609E−81	1.09579E−79
Hilpda	0.741609608	9.26631349	364.3414744	3.19342E−81	1.7652E−79
Il12rb2	0.780042435	9.272220666	363.7489147	4.29814E−81	2.36833E−79
Cd200r4	0.745073965	9.245788536	363.332146	5.29697E−81	2.90949E−79
Selm	0.724967002	9.255274695	362.2132873	9.2822E−81	5.08244E−79
Rpl13	−0.20692553	12.59341642	358.9936129	4.66361E−80	2.54554E−78
Itga4	−0.709429771	9.457128938	355.272428	3.01313E−79	1.63952E−77
Eef1b2	−0.395983278	10.08532252	354.6347115	4.14843E−79	2.25023E−77
Rps27rt	0.40920376	10.6486322	352.6986737	1.09514E−78	5.92194E−77
Zap70	0.480186036	9.677477571	352.1255183	1.45976E−78	7.86915E−77
Rpl26	−0.219220515	11.49710179	350.9988084	2.56824E−78	1.38019E−76
Ass1	−0.614408133	9.641662833	348.5785901	8.64318E−78	4.63062E−76
Gm26740	−0.613073552	9.548079775	348.4571538	9.18583E−78	4.90625E−76
Zfp36	0.755036205	9.294838731	346.525669	2.41955E−77	1.28836E−75
Csrnp1	0.702657077	9.254044021	346.1586592	2.90843E−77	1.54395E−75
Cd226	0.652794243	9.387067308	345.9790994	3.18245E−77	1.68428E−75
Gpr68	0.666874983	9.328829504	344.9771686	5.25962E−77	2.77517E−75
Pabpc1	0.253543554	10.71757424	344.7679366	5.84144E−77	3.07284E−75
Gm12840	0.891047188	9.457231655	344.4593021	6.81918E−77	3.57637E−75
Cd48	−0.38459015	10.43479465	343.3816553	1.17062E−76	6.12098E−75
Sh2d2a	0.579542848	9.466676588	343.2133641	1.2737E−76	6.64001E−75
Cxcr5	−0.530471666	9.20561145	343.1932453	1.28661E−76	6.68732E−75
Il6ra	−0.569058542	9.20917833	342.7785351	1.58403E−76	8.20865E−75
Rpl37a	0.203138206	12.26116013	342.1077689	2.21738E−76	1.14567E−74
Lypd8	0.44842715	9.193249939	340.9066075	4.04975E−76	2.08622E−74
H2afy	0.371108067	10.00724113	340.4917522	4.98627E−76	2.56109E−74
Vmp1	0.567628617	9.458764331	339.5017466	8.19184E−76	4.19519E−74
Sh3bgrl3	0.23283736	11.52323202	339.0176875	1.04424E−75	5.33207E−74
Gzmm	−0.713492859	9.237177807	338.9103634	1.10198E−75	5.61045E−74
Pld3	0.591215902	9.428245291	335.7969448	5.25095E−75	2.66558E−73
Rpl7	−0.20865182	11.19387534	329.5334866	1.21449E−73	6.14731E−72
Sephs2	0.578851155	9.452454792	328.8405202	1.71919E−73	8.6767E−72
Sepp1	−0.737185666	9.351250863	328.6008691	1.93875E−73	9.75651E−72
Eef1g	−0.318644983	10.44466423	328.1917319	2.38031E−73	1.19441E−71
Anxa6	−0.378854677	10.05966028	327.9775338	2.65025E−73	1.32604E−71
Rps16	−0.187940518	12.22909973	325.4524705	9.40299E−73	4.69126E−71
Rhoh	0.549715634	9.52013598	325.1010815	1.12151E−72	5.57934E−71
Pelo	0.667576923	9.295180382	324.3424209	1.64077E−72	8.13934E−71
Rpl15	−0.29061008	10.58474029	322.6470854	3.83987E−72	1.89942E−70
Klrg1	−0.895311661	9.277471359	322.4765157	4.18282E−72	2.06321E−70
Tmem71	−0.63467876	9.368776477	322.1358738	4.96211E−72	2.44069E−70
Ier5	0.533178217	9.643609832	320.6619551	1.03923E−71	5.09723E−70
Hspa5	0.441769561	9.991491978	320.244836	1.28106E−71	6.2657E−70
Gm27166	0.478783135	9.194488904	319.8860088	1.53367E−71	7.48017E−70
2310001H17Rik	−0.69570124	9.36500569	319.8349174	1.57347E−71	7.65289E−70
Fam3c	0.611290084	9.369315527	319.6288024	1.74484E−71	8.46273E−70
Rpl18	−0.200629143	11.74785	317.5684137	4.9041E−71	2.37195E−69
Reg3b	0.438054199	9.193236754	314.9256552	1.846E−70	8.90373E−69
Ran	−0.432537043	10.02805166	314.4525328	2.34041E−70	1.12573E−68
Tesc	0.585196699	9.463706763	310.4006473	1.78627E−69	8.56818E−68
Nrgn	0.67256668	9.21031371	310.1873651	1.98796E−69	9.50946E−68
E2f2	−0.632366672	9.24570481	309.703225	2.5344E−69	1.20901E−67
Sidt1	−0.607133596	9.231615429	309.1636563	3.32214E−69	1.58047E−67
Metrnl	0.670144523	9.278658789	307.297602	8.47095E−69	4.01897E−67
Ddit4	−0.556082538	9.690594056	307.1181298	9.26894E−69	4.38562E−67
Itgb2	−0.379932245	10.0524446	306.9472813	1.00983E−68	4.7651E−67
Ptk2b	0.589498004	9.37852549	304.9252424	2.78455E−68	1.3104E−66
Stk38	−0.601169306	9.410018622	302.5222046	9.29556E−68	4.36265E−66
Krt8	0.394913343	9.191735533	301.4893461	1.56061E−67	7.29917E−66
Asap1	−0.713638856	9.28327877	301.4854993	1.56363E−67	7.29917E−66
Glrx	0.526069658	9.6245233	301.1671216	1.83441E−67	8.54031E−66
Cd96	0.50746649	9.566029171	300.5855052	2.4559E−67	1.14032E−65
Msn	−0.354638678	9.969662732	300.3359931	2.78336E−67	1.28893E−65
Mmd	0.683389713	9.258719061	299.6070719	4.01215E−67	1.85304E−65
Rpl30	−0.249820608	10.85133779	297.5170069	1.14483E−66	5.27347E−65
Car5b	−0.612063244	9.237859904	296.8403488	1.60755E−66	7.38541E−65
Crbn	0.554618233	9.427304818	296.368566	2.03683E−66	9.33296E−65
Phlda1	0.803113616	9.291148392	296.236558	2.17628E−66	9.94579E−65
Ggt1	−0.702663215	9.290810258	295.9132706	2.55948E−66	1.16664E−64
Atic	−0.635349325	9.302037984	295.1729731	3.71062E−66	1.68693E−64
Rgs16	0.765148476	9.216610114	293.8288353	7.28293E−66	3.30235E−64
Csnk2b	0.416324203	9.685639631	290.8795747	3.1982E−65	1.44642E−63
Gm9843	0.381109199	10.19320765	290.8378149	3.26592E−65	1.47322E−63
Rps271	−0.43391813	9.777142341	290.2792293	4.3223E−65	1.9447E−63
Iqgap2	−0.638076071	9.307359719	289.8537682	5.3508E−65	2.40124E−63
Cirbp	0.504746243	9.53720808	289.2138674	7.37646E−65	3.30177E−63
Cd200r1	0.672026366	9.260019867	288.664971	9.71515E−65	4.33744E−63
Btla	−0.591546048	9.228534142	286.415877	3.00276E−64	1.33719E−62
Phfl1b	−0.53811808	9.475914441	284.1505726	9.35702E−64	4.15624E−62
Gng2	0.468934308	9.57488742	282.8266548	1.81815E−63	8.05538E−62
Lztfl1	0.726684698	9.295833236	281.3215644	3.86907E−63	1.70985E−61
Scn1b	0.440541002	9.1964611	280.6666827	5.37422E−63	2.36901E−61
Rpl17	−0.180962475	12.17902552	279.7927545	8.33218E−63	3.66363E−61
Tgfb1	0.484671853	9.622712466	279.7162695	8.65817E−63	3.79738E−61
Ikzf3	0.655518838	9.312842571	279.698909	8.73392E−63	3.82098E−61
Sdf4	0.413417447	9.734416359	279.5030756	9.63574E−63	4.20154E−61
2900026A02Rik	0.349760831	9.191105265	279.4997042	9.65205E−63	4.20154E−61
Calm1	−0.231941553	11.07867785	278.0942215	1.9539E−62	8.48413E−61

TABLE 2G
Tissue Combined
GeneSymbol	logFC.TissueColon_IEL	logFC.TissueColon_LPL	logFC.TissueSI_LPL
Vps37b	0.777474128	3.99446302	3.903208385
Rps8	−0.462894732	−0.282560786	−0.227185564
Dnajb9	0.242194076	1.230337941	1.179743784
Gm8369	−0.434682295	0.68750399	0.476744935
Ckb	1.683488654	0.985367182	1.041027108
Nr3c1	0.596866537	1.3763776	1.026938489
Sp100	−0.276734925	−0.946107553	−0.567656721
Gabpb1	0.40379582	1.330686374	0.891949362
Uhrf2	0.100713404	1.227704361	0.927995577
Gm8730	−0.398463357	−0.292225535	0.59358649
Dtx1	−0.612484351	−1.44822264	−0.207521149
Areg	0.212427582	1.905811086	1.755119712
Gpr171	1.020738775	1.026142826	0.96946795
Dusp2	1.26074017	−0.285136711	−0.04232493
Cebpb	0.417904147	1.289160943	1.492710901
Snx18	0.253512243	1.181248291	1.402214668
Lpxn	0.960187902	0.964976389	0.97218611
Atf3	0.221926725	1.430600805	0.663376037
Plcxd2	0.80714267	1.178350458	1.765824897
Tspo	−0.459439563	−0.604962665	−0.816095379
Rps19	−0.488789043	−0.220762212	−0.310099291
Ppp1ca	−0.138260669	−0.481445397	−0.664694124
Prkcq	−0.831805974	−1.064405565	−0.910979538
Bcl2l11	0.298668059	1.269735942	1.018797786
Nfkbie	0.320540429	1.253990691	0.778292075
Tnfaip8l2	−0.656745597	−1.002594927	−1.249789844
AB124611	−1.071538249	−1.025761529	−1.069656175
Rsrp1	0.045934577	−0.695910085	−0.308240957
Vim	−0.426911231	−0.60007612	−1.201605759
Zfp36l1	0.409767222	1.004959319	1.615568571
Ninj1	0.456984649	1.330843731	1.146988409
Fut7	−0.902591648	−1.053104849	−0.949863456
Gm26532	0.78795718	1.322682827	1.290107828
Lin54	0.125129429	1.125966706	1.315252047
Tob2	0.373497726	1.295279865	1.335778732
Stx11	0.108734331	1.219878433	0.820456389
Cxcl10	0.238497963	1.594973302	1.451352068
Rpl37	0.116065648	0.27929211	0.479609638
Malat1	0.589352269	0.540521994	0.566513255
Tmsb4x	0.034205633	−0.250963133	−0.32512786
Wdr1	−0.110386912	−0.7976657	0.69312976
Plscr1	0.820629431	1.375621367	0.946173857
Rpl36	0.109936658	0.304016116	0.591038405
Relb	0.452701151	1.315929558	1.088010985
Ehd1	1.350600781	1.355200628	1.225979164
Rps28	−0.052612178	0.164343875	0.733603222
Hsp90ab1	0.183973249	0.770065508	0.382334631
Anxa6	−0.440796803	−0.777608644	−1.033157811
Map3k8	0.786413742	1.533242075	1.57543773
Hist1h1c	1.156393093	1.914039852	1.713398295
Clic1	−0.126278872	−0.577454964	−0.698476892
Ddit4	−0.550655713	−1.322882165	−1.549423159
AW112010	0.530350631	−0.269167964	−0.120512172
Rbm39	0.121133079	0.591211818	0.666508922
Actn2	1.674186971	1.09423599	1.668343285
Sema4a	−1.076586289	−1.381910022	−1.47235225
S1pr4	−1.055213166	−1.004407804	−1.132415542
Tnfrsf1b	0.839325851	1.485819835	1.360630531
Anxa1	−1.511107054	−1.396051355	−2.188471733
Rpl41	0.089207305	0.269891062	0.458372809
Dennd4a	0.40921547	1.450236431	1.196022302
Emb	0.256860695	1.031210454	0.639730557
Sub1	−0.212606624	0.525046364	0.171178095
Arl4c	−0.49415572	−0.985244078	−1.582854063
Smim3	1.157858029	1.41368162	1.507860613
Ifng	2.239791472	1.729179922	1.492569488
Rgcc	0.283384363	1.767101847	0.447220961
Psmb8	−0.110504023	−0.489140738	−0.649175005
Satb1	−0.73170529	0.829100852	0.63424116
mt-Cytb	−0.546265334	−0.42351736	−0.415001765
Dusp10	0.166031321	1.460807234	1.313007697
Osgin1	1.638804775	0.665375907	1.581835883
Vcpkmt	0.485718496	1.353540366	1.181968319
Chd2	0.490638634	1.209409986	1.442340463
Ifi27l2a	−1.447651542	−1.320038979	−1.014727105
Cnbp	0.328954303	0.714682188	0.750969488
Gngt2	1.6715869	1.008170978	1.394249117
Ptpn7	0.034473291	−1.133069364	−0.919157917
Herpud1	0.052692615	1.177557859	1.034451055
Nrp1	−1.191469771	−1.264227267	−1.279785482
Gch1	0.60986345	1.540707807	0.845457397
Birc3	0.178272259	1.269097181	1.31937574
Cfl1	−0.181428647	−0.482315806	−0.478158167
Vgll4	0.553934184	1.336407518	0.803366983
Kcnn4	−0.66182234	−1.259249871	−1.318323926
Kpna1	0.236709891	1.160296596	1.200898507
Nabp1	0.898469347	1.13108023	0.937505709
Hsph1	0.063771251	1.223646137	0.804849095
Il22	0.636407037	1.727603551	3.375767379
Lrrc58	−0.280678767	−0.931657812	0.078861966
Polg2	0.115967235	0.988832852	0.963823755
Lck	−0.046016642	−0.478587291	−0.328836522
Rps27l	−0.422405737	−0.706969497	−1.151277553
4930523C07Rik	−0.049553342	0.77439766	0.458814483
Capg	0.444179609	−0.258086072	−1.063350641
Rbpj	1.221814752	0.931669327	0.810911354
Aldoa	0.602520735	0.466664486	−0.004097069
Rps17	−0.554098377	−0.38055098	−0.294626154
Zc3hav1	−0.118281001	0.800121918	0.686580555
Ddit3	0.633412182	1.056768321	1.505656004
Camk2n1	1.281680699	1.103759494	0.695796302
Il2rg	0.199050169	0.585724189	0.878628642
Traf4	0.387903813	1.143370115	1.166481487
Hnrnpf	−0.289637392	−0.457763526	−0.442403466
Ppp1r16b	0.722505925	1.131785945	1.123510124
Usmg5	0.338211483	0.562446426	0.884243935
Gm9493	−0.373348956	−0.119724093	0.654836138
Gm20186	0.376387595	0.983081489	1.508057083
Cyba	−0.12164775	−0.398081178	−0.628053762
Zeb1	0.268976051	1.117792672	0.955359161
Gm9843	0.050245934	0.036828943	0.933575173
Rpl27	0.112631873	0.224950706	0.508803925
Dusp4	0.153431151	0.94029633	0.821545552
Tnfrsf9	0.954876882	1.509800497	0.514373324
PhIda1	0.741010016	1.447979137	1.083660668
Map3k14	0.236317904	0.977429196	1.3068537
Slamf6	−1.45895434	−0.965084691	−0.811078956
Ctla2a	0.298799669	1.071932508	0.251123192
Hdac1	0.284581969	−0.596423747	−0.759024583
H2-Q4	0.275988306	0.749276391	1.06798585
Fam46a	0.080223304	1.343132414	0.596687066
Fam65b	−1.112352618	−0.915624467	−0.779034525
Mxi1	0.327724833	1.096423847	0.916698704
Ccr5	1.136442096	1.03663238	1.414443159
D8Ertd738e	0.149173189	0.591554745	0.705970327
Gzmb	1.484474865	1.671588876	1.899825501
Sdf4	0.478973842	0.771120166	0.376506356
Stat3	0.590121867	1.132951528	0.779233082
Zyx	−0.565107863	−1.017829067	−1.105422427
Ms4a4c	−1.135742662	−1.080990165	−1.214454415
Hic1	1.490225264	0.64937241	1.158758155
Rpl23a-ps3	−0.108683292	−0.042050175	0.797803645
Hbp1	0.153253653	1.045263235	1.08918818
Ywhaq	−0.50728297	−0.695383339	−0.933175471
Dtx4	0.325907203	0.900111631	1.402409997
Prdx1	−0.441253622	−0.579820321	−0.84275194
Dapk2	1.504802415	0.556414029	1.01750907
Rpl35	−0.198257565	−0.137039195	0.501566337
Tgif2	0.028216662	1.039982456	0.913047919
Aebp2	0.532530932	1.101390751	1.10384383
Spn	−0.442218027	−0.924628279	−0.908993083
Peli1	0.180571514	0.945055781	0.778179164
Rplp0	−0.40462238	−0.178016	−0.146562691
Insig1	0.334913953	1.102843857	1.570247867
Arpc3	0.335449112	0.581367164	0.431387866
Hk2	0.400462873	1.272037672	0.895345873
Arl6ip5	−0.350457803	−0.638658603	−0.860140937
Reep5	−0.543838571	−0.696314196	−0.957208206
Gpx4	0.416949548	0.78623455	0.456449996
Prdx4	−1.087776303	−1.023745704	−1.086234685
mt-Co3	−0.373726515	−0.283800873	−0.245313316
Slc38a2	0.027794305	0.890981228	1.265084578
Fkbp1a	−0.457711587	−0.609776872	−0.807238893
Cdc42se1	−0.509406321	−0.94083351	−0.723317952
Mfsd6	0.322475507	1.177204896	0.993936731
Hbb-bs	−0.951439469	−0.833727323	−0.920809369
Sgk1	−1.401626324	−0.881994243	−1.153947764
Ccr9	0.472499792	0.23501735	2.246312713
Cdc42	−0.194978171	−0.457363489	−0.492606763
Nr4a3	0.37734512	1.000912689	0.932683465
Sash3	0.284465257	−0.904496449	−0.450998844
Flna	−1.021845631	−0.972657753	−0.939784581
Id2	0.546829646	−0.150446648	−0.594648468
Ccl4	3.615166269	0.52950705	1.537818194
Sik1	0.187430647	1.003588487	1.049624518
Ldlrad4	0.983465129	1.170317969	1.242760762
Sh3bgrl3	0.178502582	−0.151124267	−0.520462292
Selk	0.20817301	0.633800345	0.574745819
Txndc5	−0.793923149	−1.079044363	−1.044409331
Lztfl1	0.811919165	1.025717051	1.778608941
Lilrb4a	1.040771731	1.662603733	1.34866513
Plac8	1.367181977	1.647105676	1.336533536
Pfn1	−0.227374524	−0.464331976	−0.494146426
Got1	0.912228134	2.351604957	2.113401784
Lgals1	−0.94241438	−0.994539931	−1.811527329
Coro1a	−0.383867449	−0.878811184	−0.690027583
Neurl3	1.260230617	2.259242074	2.263083272
Bcl2a1d	1.325205435	1.991992964	2.161429488
Fosl2	0.686981772	2.317777656	2.162692641
Ddx5	0.655299575	0.933006654	1.022505971
Mxd1	1.185545347	2.408175848	2.46113118
Prdx6	0.739133202	1.540245599	1.651132315
Btg2	1.340461972	1.610387778	1.855311255
Zc3h12a	0.368012894	2.196963947	1.920529072
Nr4a1	1.42026219	2.585195396	2.900870393
Fth1	0.438172042	0.958382191	0.695953321
Kdm6b	0.591919262	2.601159919	2.643867444
Ms4a6b	−0.855435822	−1.113772966	−1.061157866
Gpr132	0.493626692	1.832550927	1.916165176
Dgat1	1.068086006	2.507427706	2.268265285
P2ry10	0.323139521	1.961409192	2.046154573
Hspa8	0.262418528	0.947116547	0.507076538
Hif1a	0.506541402	1.846412062	1.394299692
Emp3	−0.885092139	−1.135130594	−1.534190065
Cytip	0.137241836	1.150444566	1.050113634
Arhgap31	0.592761886	1.828812646	2.147009927
Cd160	1.958868733	0.090626817	1.530097888
Ubc	0.781082329	1.059189076	1.267041913
Rora	0.393843317	1.626184495	1.580189974
Arf4	0.450172863	1.33901057	1.4270623
Dnajb1	1.088486132	2.625921173	1.768476477
S100a4	−1.381786387	−1.735446939	−2.192760959
Slc3a2	0.924990309	1.747063943	2.041745429
Skil	1.356501548	2.046292284	2.167743506
Tspan32	−1.855941613	−1.830468648	−1.826575438
Gadd45b	1.644895671	2.363959806	2.524371898
Cd69	2.140083096	1.914092308	2.039146629
Lilr4b	0.990097521	2.072444849	1.943112929
Itgb2	−0.437930531	−1.311953723	−1.34504361
Rasgrp2	−1.64073261	−1.468891321	−1.529423898
Hilpda	0.905718851	2.266685919	2.255743112
Klf2	−1.908273266	−1.798692995	−1.640237406
Itgb7	−0.626689284	−1.091031288	−1.049129185
Samsn1	0.78733775	1.881432949	1.370388308
Nfkbiz	0.564142293	2.33024327	2.303550906
Cd48	−0.503647963	−1.580728968	−1.440014098
Crem	1.206942842	3.204559128	2.776895991
Tnfrsf4	0.711364773	2.978807129	2.192236669
Hspa5	0.512591422	1.816140229	1.534632246
Ifngr1	0.1883354	1.834862227	1.306178775
Ms4a4b	−0.69284433	−1.322205103	−1.664468636
Pim1	0.795270671	2.633332305	2.675211977
Pnrc1	0.753615753	2.106610657	2.294488941
Odc1	0.740493817	3.345533836	2.810015439
Jund	1.182643946	2.186035889	1.805102708
Ctla4	1.41332301	3.559115658	3.332369379
Bhlhe40	0.657224846	2.50015099	2.34894059
H3f3b	0.477447103	1.445573521	1.329294416
Junb	2.293137211	2.821816343	3.206316002
Btg1	1.136233966	2.049380574	2.322550341
Tnfaip3	1.367360021	3.427648559	3.788144571
Rgs1	4.407235959	3.620285869	4.048113626
Ubald2	0.135059491	2.902661389	2.820329823
Dusp5	0.88846288	2.589658521	2.324825039
Tgif1	0.340947728	2.662628566	2.532311028
Eif1	0.243600213	0.897018313	0.883631546
Gramd3	−0.887373725	2.001685574	1.518112402
Ramp3	0.522452694	2.929582726	2.693749522
Orai1	0.427837319	2.054256414	1.840750897
Cd52	−0.037974717	−0.76219941	−0.92083237
Srgn	0.650406948	1.163382845	0.975668862
Akap13	0.784905453	1.650364325	1.687843023
Traf1	0.731922421	1.939073251	1.667369064
Dusp1	2.876266732	3.102439229	3.283532744
Nfkbia	0.475871735	2.098426093	1.964656983
Pde4b	0.340023511	2.135521921	2.032281316
Il21r	1.066352442	2.30984097	2.07051372
Bcl2a1b	1.159629853	2.026583358	2.045369986
Rgs2	1.759347044	3.276603612	2.690971945
Itgb1	−2.939748656	−2.801847036	−3.211007959
Icos	0.760296669	2.291146199	2.058091574
Prr7	0.576910072	2.642494452	2.148843937
Gna13	0.539301733	2.190136992	2.212428937
Ubb	0.608762321	1.16229746	0.888058795
Ifrd1	−0.341562044	2.123182298	2.008949468
Furin	2.373523387	3.208611369	3.210149442
Lmna	0.355749856	2.240959029	−0.139418188
Ctsd	−0.140445912	−1.256042585	−1.271899886
Dnaja1	0.065582453	1.228590453	0.7971197
Crip1	−0.848292102	−0.618979571	−1.41225136
Gpr183	−0.01113956	1.374005606	1.168714694
Rrad	0.234847579	1.697004089	1.594487107
Ccnd3	−0.329577306	−1.091466059	−1.193102261
Nmrk1	0.428665057	1.738810544	1.410635343
Rps29	−0.118044035	0.078118241	0.675561481
Itgae	2.118239644	0.501790147	1.613848439
Rps27rt	0.111778933	0.348355098	1.256433873
Dnajb6	0.42215896	1.048311667	0.903790169
Ptprcap	−0.333296008	−0.877052246	−0.657134231
Itm2b	0.681017998	0.052557376	0.053940026
Maff	0.050178399	1.358068789	1.717191704
Coq10b	0.487474641	1.48815124	1.590649725
Nr4a2	1.446906214	2.322415055	2.418160579
Rnf157	0.220493355	1.530141868	1.533565628
Csrnp1	0.705386191	1.723900036	1.723469654
Asb2	2.113128181	1.044679174	1.30745449
Fosb	0.448314652	1.939752943	1.173309182
Per1	0.223435351	1.324161399	1.655894131
Tnfsf8	0.591517515	2.049539473	1.756714493
Jun	2.701679209	1.602621976	2.540136604
Rpl37a	0.189109219	0.337383963	0.57738162
Ppia	−0.260468097	−0.515647244	−0.498914699
Actr3	−0.264798485	−0.678531948	−0.608192443
Ets1	0.308769926	0.854380244	0.897921106
Tbc1d10c	−0.086644317	−1.048383269	−0.603012764
Ctsw	1.133912136	0.290339316	0.428742181
Rac2	−0.090279627	−0.457497646	−0.519640137
Hspe1	0.125328811	1.183289599	0.848573905
Cirbp	0.671161615	1.276126719	1.325610584
Nrip1	0.295798404	1.495372547	1.599803514
Amica1	1.912537743	0.540771353	0.63720074
Tnfsf11	1.000192602	2.011665838	1.063992968
Ifnar1	0.410475913	1.357726581	1.453941357
Cd3g	0.649613891	0.161480653	0.074462457
Kdm2b	0.35110053	1.500408169	1.365103199
Litaf	1.724751835	1.533159899	1.755054093
Nfkb2	0.309083464	1.45267526	1.126281499
Cnn2	−0.125436839	−0.833705916	−0.656443942
Crbn	0.689883175	1.357746765	1.315931184
Hsd11b1	−0.845495767	−1.422255063	−1.515881372
Fasl	1.24195807	1.680829553	1.40489363
Myl6	−0.303122474	−0.557407151	−0.743323701
Tnfrsf18	0.51027686	1.418821878	0.897476585
Sh2d2a	0.683649276	1.523838419	1.534011293
S100a6	−0.701943112	−0.925981609	−1.558846918
Bin2	−0.716008243	−1.168500998	−0.929495808
Arhgdib	−0.47819901	−0.678544906	−0.662983446
Abi3	2.169958211	0.784928318	1.430075624
Ppp1r15a	1.012213891	1.834038062	2.123484272
Serpinb9	−0.332079489	1.762867925	1.404007136
Cdkn1a	0.659293662	2.26693393	1.978030213
Itk	0.717407706	1.534128909	1.605916535
Glipr2	−1.012290006	−1.288705972	−1.608611968
Pglyrp1	−1.560081733	−1.527481278	−1.707966652
Fam110a	0.441701934	1.956309955	1.205559948
S100a10	−0.686684425	−0.755853614	−1.196982129
Ptp4a1	0.423511875	1.501139578	1.631998685
Arid5a	0.615734799	1.671003212	1.588627125
Hsp90aa1	0.265232836	1.516738352	0.86998671
Fos	3.307489836	1.662604426	2.60078825
Il4ra	0.262122295	1.768613781	1.41559797
Gm12840	0.852894278	2.038425581	2.604479224
Lsp1	−0.469255726	−0.871230904	−0.802596375
Rel	0.328871591	1.654583385	1.684956995
Rpl38	0.304384053	0.391714781	0.80557411
Pycard	−0.68605811	−1.204678987	−1.095961376
Cxcr6	1.481967857	0.614235458	0.242141429
Zfp36l2	−0.069112161	1.097355571	1.827830136
Ptpn22	0.637640602	1.105479795	1.407606827
AI467606	−0.359100183	−1.428559988	−1.619259014
Sqstm1	0.312316129	1.45874511	1.187923862
D16Ertd472e	0.528778168	1.560727657	1.355501147
Ly6c2	−2.635976447	−2.243628333	−2.730896442
Hspa1a	3.317587579	4.024832432	3.280867889
Atp1b3	−1.338905265	−1.163595102	−1.260436923
Srsf5	0.318943246	1.058847246	1.077088912
Rps27	0.105449775	0.336978206	0.811170641
Stk17b	0.539893656	1.082520549	1.239142099
Cd28	0.068398706	1.095601812	0.97109367
Rnf125	−0.044505337	1.467264431	1.164227533
Clk1	0.561911434	1.338154822	1.645145128
Klf6	1.842955526	1.439880235	1.966650811
Apobec3	−0.366808091	−0.852090391	−0.527398995
Ndufa4	−0.442428302	−0.680313916	−0.62851769
Apol9b	1.129514917	0.060106654	0.431228775
Tmem123	0.395783307	0.858468607	0.762317881
Pim3	0.156477935	1.049132589	1.270764685
Rpl39	−0.003885791	0.14733345	0.492421372
Adora2a	0.327386179	1.093504821	0.814533896
Id3	−0.983976649	−1.278212723	−1.408714151
Abcb1b	0.084811939	1.03652624	0.878461297
Calm1	−0.195447541	−0.347331831	−0.60335137
Cdc25b	−1.001522994	−0.97877959	−1.052446445
Phf11b	−0.595465154	−0.962170945	−0.832403232
Arpc1b	−0.172988304	−0.41263938	−0.36702828
Btg3	0.40302651	0.954493008	1.329566612
Socs3	0.534617386	1.276515071	1.205826408
Gpr34	1.406180781	0.523866618	0.752660178
Cd7	0.935530259	−0.713133698	0.512262464
Capn2	−0.394029971	−0.888329339	−1.003188684
Pde4d	0.245207794	0.967356097	0.893857778
Nfil3	0.397653866	1.106103131	0.792415119
Gimap6	0.349265811	0.588644836	0.727785154
Ly6g5b	1.33303203	0.485097242	0.157396087
mt-Atp6	−0.360413265	−0.197400255	−0.170326369
Lfng	−0.266671791	−0.820206738	−1.30945717
Avl9	0.413463318	0.992356488	1.138418506
Esyt1	−0.466108154	−0.899494199	−0.850901825
Itpkb	0.167612218	0.953070885	0.909004332
Irf4	0.02354066	0.928322708	0.868943333
Mir142hg	1.033642023	0.963245615	1.048769847
Nkg7	0.53133988	−0.169812636	−0.218528706
Zcchc11	0.416794184	0.991651408	1.111287695
Prkarla	0.498190887	0.547270984	0.36703625
Def6	−0.079903039	−0.845247189	−0.627240921
Slc9a3r1	0.490368769	−0.270993821	−0.330351807
	GeneSymbol	logCPM	LR	PValue	FDR
	Vps37b	10.03454595	30072.7125	0	0
	Rps8	11.62809538	2038.340013	0	0
	Dnajb9	9.316221247	2038.542663	0	0
	Gm8369	9.792018318	2044.58434	0	0
	Ckb	9.342944532	2055.399452	0	0
	Nr3c1	9.352262661	2059.924855	0	0
	Sp100	9.725036992	2060.348785	0	0
	Gabpb1	9.366278776	2073.287426	0	0
	Uhrf2	9.439369633	2077.350399	0	0
	Gm8730	10.38863469	2087.887702	0	0
	Dtx1	9.344984765	2098.163291	0	0
	Areg	9.282241434	2108.862759	0	0
	Gpr171	9.650575449	2109.203412	0	0
	Dusp2	9.611670263	2127.669358	0	0
	Cebpb	9.3841575	2133.511667	0	0
	Snx18	9.268008725	2190.232089	0	0
	Lpxn	9.6426486	2193.717339	0	0
	Atf3	9.235797229	2208.396751	0	0
	Plcxd2	9.299070121	2035.025508	0	0
	Tspo	10.07426107	2023.345914	0	0
	Rps19	12.63595929	2023.3203	0	0
	Ppp1ca	10.49158341	1994.14525	0	0
	Prkcq	9.361161976	1853.113558	0	0
	Bcl2l11	9.267192159	1854.01069	0	0
	Nfkbie	9.322134913	1856.618069	0	0
	Tnfaip8l2	9.437338541	1861.9971	0	0
	AB124611	9.228809043	1871.487619	0	0
	Rsrp1	10.20843239	1878.782142	0	0
	Vim	10.67445805	1885.643262	0	0
	Zfp36l1	9.441704346	1885.761429	0	0
	Ninj1	9.293255705	2231.202495	0	0
	Fut7	9.205232517	1929.797777	0	0
	Gm26532	9.255741547	1938.00365	0	0
	Lin54	9.261013077	1938.45873	0	0
	Tob2	9.34461902	1940.459028	0	0
	Stx11	9.356175668	1942.830244	0	0
	Cxcl10	9.271930887	1943.092733	0	0
	Rpl37	11.92011245	1950.728079	0	0
	Malat1	14.51807182	1976.820212	0	0
	Tmsb4x	14.40631533	1989.761718	0	0
	Wdr1	9.737409412	1932.290417	0	0
	Plscr1	9.425543981	1845.833759	0	0
	Rpl36	11.71243313	2232.517819	0	0
	Relb	9.371248744	2289.99945	0	0
	Ehd1	9.407112899	2500.528557	0	0
	Rps28	11.51231021	2511.446233	0	0
	Hsp90ab1	10.9175943	2531.925683	0	0
	Anxa6	9.925148315	2535.31738	0	0
	Map3k8	9.344670944	2540.995063	0	0
	Hist1h1c	9.414339905	2569.222047	0	0
	Clic1	10.5597468	2577.83152	0	0
	Ddit4	9.550516634	2600.936733	0	0
	AW112010	11.67788795	2611.060111	0	0
	Rbm39	10.50344179	2642.465618	0	0
	Actn2	9.546273651	2644.093081	0	0
	Sema4a	9.283140537	2653.703924	0	0
	S1pr4	9.586568308	2654.674252	0	0
	Tnfrsf1b	9.355129694	2660.647695	0	0
	Anxa1	9.411481213	2691.011076	0	0
	Rpl41	12.6407868	2731.32137	0	0
	Dennd4a	9.274100293	2760.713271	0	0
	Emb	10.0275267	2499.689705	0	0
	Sub1	10.94059551	2495.827025	0	0
	Arl4c	9.658613942	2472.060488	0	0
	Smim3	9.29654546	2450.775194	0	0
	Ifng	9.645960024	2313.756922	0	0
	Rgcc	9.423330348	2323.950455	0	0
	Psmb8	10.64253999	2337.404757	0	0
	Satb1	9.601014895	2341.400318	0	0
	mt-Cytb	11.21803568	2343.700873	0	0
	Dusp10	9.359033873	2356.458156	0	0
	Osgin1	9.252826914	2372.802143	0	0
	Vcpkmt	9.367243143	2393.600427	0	0
	Chd2	9.393875664	2268.146622	0	0
	Ifi27l2a	10.02903758	2393.718927	0	0
	Cnbp	10.09284839	2394.16337	0	0
	Gngt2	9.361328315	2400.498408	0	0
	Ptpn7	9.466595096	2419.001687	0	0
	Herpud1	9.439096692	2425.533038	0	0
	Nrp1	9.223298204	2432.20787	0	0
	Gch1	9.354399974	2433.304066	0	0
	Birc3	9.33752681	2433.841201	0	0
	Cfl1	11.32725331	2444.786376	0	0
	Vgll4	9.587844265	2393.91655	0	0
	Kcnn4	9.466905719	2772.34088	0	0
	Kpna1	9.300137202	1843.522866	0	0
	Nabp1	9.532328268	1838.067205	0	0
	Hsph1	9.370438221	1557.836398	0	0
	Il22	9.338583329	1562.121908	0	0
	Lrrc58	9.493596476	1562.433427	0	0
	Polg2	9.233059976	1579.366602	0	0
	Lck	10.49845031	1579.753574	0	0
	Rps27l	9.674913084	1579.872913	0	0
	4930523C07Rik	9.699182127	1581.475882	0	0
	Capg	9.985868123	1585.265244	0	0
	Rbpj	9.368575331	1587.924302	0	0
	Aldoa	10.22924571	1589.244945	0	0
	Rps17	10.6596725	1592.755036	0	0
	Zc3hav1	9.554454222	1593.51781	0	0
	Ddit3	9.316873219	1601.418493	0	0
	Camk2n1	9.323686292	1602.078899	0	0
	Il2rg	10.00219656	1605.322872	0	0
	Traf4	9.292948329	1608.521941	0	0
	Hnrnpf	10.55525903	1613.128498	0	0
	Ppp1r16b	9.413801897	1557.800865	0	0
	Usmg5	9.936350613	1552.872437	0	0
	Gm9493	10.23217758	1549.335257	0	0
	Gm20186	9.253161772	1546.807571	0	0
	Cyba	10.60431895	1498.529546	0	0
	Zeb1	9.301751944	1502.294376	0	0
	Gm9843	10.33749646	1503.691737	0	0
	Rpl27	11.33055291	1504.195501	0	0
	Dusp4	9.213500374	1507.49956	0	0
	Tnfrsf9	9.321390476	1509.427303	0	0
	PhIda1	9.361394132	1509.496196	0	0
	Map3k14	9.283321913	1519.537609	0	0
	Slamf6	9.377252261	1615.425761	0	0
	Ctla2a	10.09921699	1523.777018	0	0
	Hdac1	9.546612696	1527.943772	0	0
	H2-Q4	9.630172513	1528.27877	0	0
	Fam46a	9.394476103	1532.18059	0	0
	Fam65b	9.310020493	1535.116406	0	0
	Mxi1	9.258459389	1535.331101	0	0
	Ccr5	9.453526865	1545.929884	0	0
	D8Ertd738e	9.906338542	1546.031392	0	0
	Gzmb	10.14452997	1546.525056	0	0
	Sdf4	9.821782432	1526.727595	0	0
	Stat3	9.515695899	1840.239522	0	0
	Zyx	9.42338924	1618.184248	0	0
	Ms4a4c	9.23739877	1629.796583	0	0
	Hic1	9.283045422	1737.143544	0	0
	Rpl23a-ps3	10.57494605	1741.679055	0	0
	Hbp1	9.340839113	1751.790252	0	0
	Ywhaq	9.77397317	1756.913129	0	0
	Dtx4	9.223206978	1775.308624	0	0
	Prdx1	10.11192982	1776.398305	0	0
	Dapk2	9.293084109	1780.844891	0	0
	Rpl35	11.13718458	1785.683581	0	0
	Tgif2	9.23223275	1790.943013	0	0
	Aebp2	9.382936752	1810.668654	0	0
	Spn	9.544899055	1812.185322	0	0
	Peli1	9.632602802	1812.607057	0	0
	Rplp0	12.40493661	1817.429013	0	0
	Insig1	9.305878553	1819.439028	0	0
	Arpc3	10.3928013	1822.685843	0	0
	Hk2	9.240976423	1830.502099	0	0
	Arl6ip5	9.930300727	1836.898892	0	0
	Reep5	9.767497293	1733.322052	0	0
	Gpx4	9.948950125	1731.797924	0	0
	Prdx4	9.235537849	1731.056056	0	0
	mt-Co3	12.20719178	1713.852782	0	0
	Slc38a2	9.380152268	1635.802681	0	0
	Fkbp1a	9.869140443	1647.111254	0	0
	Cdc42se1	9.485319255	1658.571945	0	0
	Mfsd6	9.299958076	1663.612597	0	0
	Hbb-bs	9.200640448	1664.72306	0	0
	Sgk1	9.293049535	1668.770669	0	0
	Ccr9	9.24920942	1669.561887	0	0
	Cdc42	10.55125063	1672.292717	0	0
	Nr4a3	9.219687388	1624.091677	0	0
	Sash3	9.392380929	1680.800024	0	0
	Flna	9.339442013	1690.430613	0	0
	Id2	10.81654571	1695.187398	0	0
	Ccl4	10.14764842	1696.147403	0	0
	Sik1	9.224860652	1703.135534	0	0
	Ldlrad4	9.264750802	1703.376687	0	0
	Sh3bgrl3	11.4029623	1704.291179	0	0
	Selk	9.923482712	1709.896179	0	0
	Txndc5	9.289175725	1710.771391	0	0
	Lztfl1	9.35467745	1684.358705	0	0
	Lilrb4a	9.500994059	2799.837328	0	0
	Plac8	10.29800915	2666.923532	0	0
	Pfn1	12.40959764	2823.18042	0	0
	Got1	9.572501168	6155.123374	0	0
	Lgals1	12.08066005	6170.117639	0	0
	Coro1a	11.10558954	6173.409649	0	0
	Neurl3	9.445974691	6174.776117	0	0
	Bcl2a1d	9.713856957	6253.274041	0	0
	Fosl2	9.360613737	6382.142761	0	0
	Ddx5	10.94756817	6396.297438	0	0
	Mxd1	9.428217948	6638.119592	0	0
	Prdx6	9.932199951	6693.369054	0	0
	Btg2	10.27784938	6722.847197	0	0
	Zc3h12a	9.375963011	6767.694681	0	0
	Nr4a1	9.441853787	6805.260947	0	0
	Fth1	11.28479407	6872.446213	0	0
	Kdm6b	9.499428313	6926.302094	0	0
	Ms4a6b	10.51149168	7027.371621	0	0
	Gpr132	9.625285306	7072.34788	0	0
	Dgat1	9.520162453	7113.950101	0	0
	P2ry10	9.409785965	6070.471392	0	0
	Hspa8	11.98283195	6067.230307	0	0
	Hif1a	9.566468789	5800.541484	0	0
	Emp3	10.15792608	5634.940442	0	0
	Cytip	9.939689328	4728.057313	0	0
	Arhgap31	9.474258321	4796.907361	0	0
	Cd160	9.433702154	2814.080819	0	0
	Ubc	10.79352095	4856.266946	0	0
	Rora	9.735274165	4955.577014	0	0
	Arf4	9.74527555	4956.839167	0	0
	Dnajb1	9.951049781	4962.650222	0	0
	S100a4	10.35643749	5050.816426	0	0
	Slc3a2	9.817091287	7244.608843	0	0
	Skil	9.427601511	5070.343816	0	0
	Tspan32	9.333183118	5088.9466	0	0
	Gadd45b	9.530669537	5134.595901	0	0
	Cd69	9.782614588	5148.722666	0	0
	Lilr4b	9.559633455	5221.957907	0	0
	Itgb2	9.853071355	5228.958886	0	0
	Rasgrp2	9.546231995	5314.353412	0	0
	Hilpda	9.465091188	5456.24451	0	0
	Klf2	10.40246321	5566.904066	0	0
	Itgb7	10.24576431	5083.968747	0	0
	Samsn1	9.573511029	4684.830967	0	0
	Nfkbiz	9.434908969	7264.143413	0	0
	Cd48	10.15245869	7549.34267	0	0
	Crem	9.682165373	11246.04429	0	0
	Tnfrsf4	10.12383994	11439.35552	0	0
	Hspa5	10.52876384	11491.98875	0	0
	Ifngr1	10.6249228	12241.35701	0	0
	Ms4a4b	11.32479865	12696.72714	0	0
	Pim1	10.31487793	14315.81915	0	0
	Pnrc1	10.16392663	14881.26408	0	0
	Odc1	9.952419577	15414.75011	0	0
	Jund	11.36341037	15875.17087	0	0
	Ctla4	9.751318648	16157.30951	0	0
	Bhlhe40	10.24123106	18383.23837	0	0
	H3f3b	11.89130548	18628.63053	0	0
	Junb	11.37526503	19488.80684	0	0
	Btg1	11.71813077	19540.27276	0	0
	Tnfaip3	9.733547635	19674.48034	0	0
	Rgs1	10.88182319	21795.32212	0	0
	Ubald2	10.08974357	22204.07143	0	0
	Dusp5	9.681302178	11216.17781	0	0
	Tgif1	9.475989105	10855.11363	0	0
	Eif1	11.52939519	10657.53	0	0
	Gramd3	9.833476646	10324.26187	0	0
	Ramp3	9.589354936	7595.304751	0	0
	Orai1	9.620559436	7682.097248	0	0
	Cd52	12.265481	7737.734437	0	0
	Srgn	11.04442682	7769.393006	0	0
	Akap13	10.01433481	8164.656794	0	0
	Traf1	9.817235232	8193.623841	0	0
	Dusp1	9.732110949	8513.455523	0	0
	Nfkbia	10.38534176	8552.271703	0	0
	Pde4b	9.456656488	7281.724662	0	0
	Il21r	9.854712698	8723.721998	0	0
	Bcl2a1b	10.05711684	8913.380572	0	0
	Rgs2	9.702426281	8964.070432	0	0
	Itgb1	9.705679139	9226.334266	0	0
	Icos	9.895747212	9291.702058	0	0
	Prr7	9.545379603	9695.382535	0	0
	Gna13	9.680943589	9786.483787	0	0
	Ubb	12.53331081	9989.288582	0	0
	Ifrd1	9.693003713	10167.64578	0	0
	Furin	10.01245811	8904.797941	0	0
	Lmna	9.487124604	4658.20846	0	0
	Ctsd	9.949305296	4845.431139	0	0
	Dnaja1	10.42008114	4631.648037	0	0
	Crip1	11.90464273	3132.064265	0	0
	Gpr183	9.513344586	3141.680794	0	0
	Rrad	9.39537213	3149.5252	0	0
	Ccnd3	9.736841478	3152.424211	0	0
	Nmrk1	9.349533747	3167.947491	0	0
	Rps29	12.07015461	3191.395691	0	0
	Itgae	9.329438603	3234.931065	0	0
	Rps27rt	10.90517839	3265.713412	0	0
	Dnajb6	9.840231332	3283.455427	0	0
	Ptprcap	10.30898425	3310.884109	0	0
	Itm2b	11.11270922	3315.950892	0	0
	Maff	9.240293623	3337.823207	0	0
	Coq10b	9.389551852	3344.97829	0	0
	Nr4a2	9.378053303	4644.481088	0	0
	Rnf157	9.270523021	3363.842169	0	0
	Csrnp1	9.355377363	3381.74524	0	0
	Asb2	9.517846942	3394.318362	0	0
	Fosb	9.303641607	3126.413381	0	0
	Per1	9.256131905	3124.848247	0	0
	Tnfsf8	9.718612422	3082.301398	0	0
	Jun	9.585203942	3082.055112	0	0
	Rpl37a	12.4341219	2829.244733	0	0
	Ppia	11.75036121	2843.993406	0	0
	Actr3	10.45956272	2849.847024	0	0
	Ets1	10.064916	2856.422455	0	0
	Tbc1d10c	9.730725723	2875.702927	0	0
	Ctsw	10.03070607	2876.03227	0	0
	Rac2	11.32889337	2877.122189	0	0
	Hspe1	9.993360632	2881.352973	0	0
	Cirbp	9.674191382	3397.589205	0	0
	Nrip1	9.435157115	2943.750441	0	0
	Amica1	9.41423544	2949.790876	0	0
	Tnfsf11	9.406688169	2954.591251	0	0
	Ifnar1	9.421114289	2964.121212	0	0
	Cd3g	11.2059335	2977.399621	0	0
	Kdm2b	9.339281333	2987.835357	0	0
	Litaf	9.380464881	3000.045609	0	0
	Nfkb2	9.395165675	3024.090259	0	0
	Cnn2	10.16482738	3076.591106	0	0
	Crbn	9.56278392	2946.210161	0	0
	Hsd11b1	9.443353968	3412.966153	0	0
	Fasl	9.476220888	3349.320794	0	0
	Myl6	11.14840445	3511.339172	0	0
	Tnfrsf18	9.841475941	4250.584103	0	0
	Sh2d2a	9.653507549	4255.040768	0	0
	S100a6	11.39787222	3469.674452	0	0
	Bin2	9.826963154	4264.487697	0	0
	Arhgdib	10.97661097	4277.750305	0	0
	Abi3	9.391339833	4283.327994	0	0
	Ppp1r15a	9.451226916	4287.130131	0	0
	Serpinb9	9.595001511	4348.90624	0	0
	Cdkn1a	9.482496831	4408.038615	0	0
	Itk	9.614921991	4410.719519	0	0
	Glipr2	9.696046944	4420.494789	0	0
	Pglyrp1	9.506947739	4470.0937	0	0
	Fam110a	9.361980417	4511.411134	0	0
	S100a10	11.19773491	4516.927676	0	0
	Ptp4a1	9.525742489	4529.394015	0	0
	Arid5a	9.50033819	4544.040212	0	0
	Hsp90aa1	10.36821572	4593.064023	0	0
	Fos	9.552464487	4202.563514	0	0
	Il4ra	9.363165505	4128.939871	0	0
	Gm12840	9.824287347	4262.194424	0	0
	Lsp1	10.59943054	3987.168317	0	0
	Rel	9.330686608	3532.720938	0	0
	Rpl38	11.47201227	3553.915854	0	0
	Pycard	9.8090997	3566.116382	0	0
	Cxcr6	10.49165114	4030.459915	0	0
	Zfp36l2	9.621046058	3625.420712	0	0
	Ptpn22	9.913891288	3635.182121	0	0
	AI467606	9.43007721	3640.142865	0	0
	Sqstm1	9.498888294	3650.157793	0	0
	D16Ertd472e	9.472104236	3737.310203	0	0
	Ly6c2	9.502687689	3618.463071	0	0
	Hspa1a	10.53633121	3787.129231	0	0
	Atp1b3	9.546244885	3800.287392	0	0
	Srsf5	9.897879383	3863.410621	0	0
	Rps27	13.00250321	3869.553469	0	0
	Stk17b	9.912060431	3906.395949	0	0
	Cd28	10.12482917	3764.96956	0	0
	Rnf125	9.417495282	3924.712406	0	0
	Clk1	9.595487126	3970.918448	0	0
	Klf6	9.797177616	3972.157002	0	0
	Apobec3	9.640320763	1495.459668	0	0
	Ndufa4	9.876365917	1492.897357	0	0
	Apol9b	9.199371767	1487.707525	0	0
	Tmem123	9.564567543	1487.503495	0	0
	Pim3	9.272489284	1486.441633	0	0
	Rpl39	11.64815567	1484.740228	0	0
	Adora2a	9.348672319	1483.853226	0	0
	Id3	9.247020127	1483.833186	0	0
	Abcb1b	9.244761887	1482.289748	0	0
	Calm1	10.97692159	1481.737386	0	0
	Cdc25b	9.279842463	1481.142685	0	0
	Phf11b	9.40303954	1474.921118	0	0
	Arpc1b	10.71697209	1472.676489	0	0
	Btg3	9.276956785	1467.968361	0	0
	Socs3	9.39717008	1464.828407	0	0
	Gpr34	9.284399972	1464.226552	0	0
	Cd7	9.668408289	1454.523736	0	0
	Capn2	9.422824606	1450.935801	0	0
	Pde4d	9.22996209	1445.702756	0	0
	Nfil3	9.237942693	1431.837424	0	0
	Gimap6	10.30711133	1428.814757	0	7.8975E−308
	Ly6g5b	9.254627632	1426.806364	0	2.1484E−307
	mt-Atp6	12.54893107	1421.705249	5.7448E−308	2.7405E−306
	Lfng	9.501444391	1418.204835	3.3025E−307	1.5711E−305
	Avl9	9.328579122	1409.911793	2.0816E−305	9.8758E−304
	Esyt1	9.431724645	1407.121941	8.3901E−305	3.9698E−303
	Itpkb	9.419678004	1402.3989	8.8845E−304	4.1923E−302
	Irf4	9.221609323	1396.730424	1.5089E−302	7.1006E−301
	Mir142hg	9.267707121	1391.820647	1.754E−301	8.232E−300
	Nkg7	11.44730108	1387.945816	1.2157E−300	5.6904E−299
	Zcchc11	9.302440385	1383.018269	1.4258E−299	6.6559E−298
	Prkarla	10.04221526	1363.674016	2.2468E−295	1.046E−293
	Def6	9.460419037	1358.115422	3.6117E−294	1.677E−292
	Slc9a3r1	9.774883184	1355.051977	1.6689E−293	7.7286E−292

Table 3A-3Y. Tables related to the 10×, single-cell sequencing on T cells derived from the in-vivo mouse experiments originating from the small intestine or colonic lamina propria. Table 3A-X Contains the results of 1 vs all differential expression tests for each of the 12 clusters defined in the study. Additionally, contains the results of within-cluster, between-genotype differential expression comparisons. Table 3Y—GWAS.

Table Description and Headings:

Table 3B-3X: Each section contains the output from an edgeR likelihood ratio test

LPL-X vs. All: Differential expression between cells of cluster LPL-X and the remaining cells. Positive log FC values are associated with genes with higher expression in LPL-X than in the remaining clusters.

LPL-X Ctrl vs. KG: Differential expression between the Ctrl cells of cluster LPL-X and the KG cells of cluster LPL-X. Positive log FC values are associated with genes with higher expression Ctrl cells.

Table 3Y: LogFC and FDR are from the respective LPL-X Ctrl vs. KG data. GWAS?represents whether or not the gene is associated with an JBD GWAS loci

TABLE 3A
LPL-0 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Kdm6b	2.107587482	9.740581499	2670.288539	0	0
Actb	1.497848932	13.40498915	2396.01558	0	0
Pim1	1.461379632	10.82584099	2720.504688	0	0
Pdcd4	1.219186897	9.736968363	1010.192462	1.0935E−221	4.4192E−218
Ptpn22	0.952379409	10.09353484	1004.31626	2.0705E−220	6.6942E−217
Cdkn1b	1.406854085	9.41746112	924.3880645	4.9003E−203	1.3203E−199
Skil	1.075200413	9.558821973	630.5081997	3.8752E−139	8.9495E−136
Insig1	1.236303319	9.37347705	609.4877932	1.446E−134	2.9219E−131
Cbx3	1.138162421	9.518041852	583.4355315	6.711E−129	1.2054E−125
Ppp1r16b	1.071177085	9.488149826	577.2586691	1.4804E−127	2.3932E−124
Abhd2	1.264504281	9.292308214	557.0948216	3.6024E−123	5.2943E−120
Kmt2d	1.182934835	9.264164205	501.3129014	4.9239E−111	6.6333E−108
Malat1	0.469300018	14.66860135	468.8149754	5.8028E−104	7.216E−101
Notch2	1.144895562	9.219647316	460.7171162	3.3561E−102	3.8753E−99
Srrm2	0.728412434	9.808238582	450.9545447	4.4708E−100	4.81828E−97
Ric1	1.070534111	9.254655607	415.4351764	2.40462E−92	2.42957E−89
B4galt1	0.929978748	9.375488034	378.7315027	2.35036E−84	2.23505E−81
Gm2a	0.806274736	9.581878937	372.8559359	4.47069E−83	4.01518E−80
Gnb1	0.683710369	9.703253309	339.4692154	8.32657E−76	7.0846E−73
Akap13	0.490064243	10.3088199	317.9684284	4.0126E−71	3.24338E−68
Birc6	0.899837946	9.320978822	316.6681692	7.70296E−71	5.92981E−68
Ncoa3	0.950672833	9.252526077	311.806689	8.82375E−70	6.48385E−67
Furin	0.768132247	10.38141056	304.7209557	3.08504E−68	2.16838E−65
Actg1	−0.386910949	12.09926089	303.0075558	7.2868E−68	4.90827E−65
Klf13	0.673649384	9.695536973	286.8107826	2.46304E−64	1.5927E−61
Alkbh5	0.7944529	9.368743909	269.8374031	1.23125E−60	7.65554E−58
Marf1	0.860276436	9.233752654	237.0707291	1.71172E−53	1.02488E−50
Slc39a1	0.870689481	9.215151083	236.7856356	1.97515E−53	1.14037E−50
Acot2	0.85369456	9.215557552	228.5059564	1.26233E−51	7.03684E−49
Rpgrip1	0.891339331	9.229068972	226.3087385	3.80516E−51	2.05047E−48
Lgals1	−0.482229612	11.62762181	224.1163784	1.14428E−50	5.96725E−48
S100a10	−0.401281287	10.93996309	224.0265794	1.19707E−50	6.04744E−48
Arglu1	0.754488666	9.336509872	221.4240554	4.42349E−50	2.16697E−47
Srsf2	0.517320857	9.857790838	219.0310508	1.47143E−49	6.99619E−47
Dpysl2	0.723664118	9.405651172	217.5019153	3.17171E−49	1.46497E−46
S100a4	−0.950902667	9.86649183	208.771962	2.54561E−47	1.14312E−44
Atxn1	0.741510873	9.344913237	202.2253919	6.82676E−46	2.98274E−43
Zc3hav1	0.547715562	9.665242259	200.5016307	1.62318E−45	6.90533E−43
Klf2	−1.069853137	9.96079822	200.3107523	1.78657E−45	7.40554E−43
Supt16	0.80168198	9.269926089	199.557353	2.60872E−45	1.05432E−42
Crip1	−0.533283322	11.66663236	199.1348964	3.22566E−45	1.27185E−42
Btg1	0.311293881	12.25006794	188.8750979	5.59599E−43	2.15392E−40
Myh9	0.651340239	9.438500102	187.5898867	1.06764E−42	4.01382E−40
Emp3	−0.572932793	9.864609149	179.6697432	5.72175E−41	2.10222E−38
Pitpnc1	0.634559946	9.3795869	168.1865931	1.84181E−38	6.6166E−36
S100a6	−0.529021515	10.99619486	159.8843786	1.19925E−36	4.21459E−34
Ppm1h	0.63807851	9.32382984	154.0799487	2.22463E−35	7.65177E−33
Erdr1	0.702265193	9.351150867	153.7127232	2.67615E−35	9.01305E−33
H2afz	−0.426974884	10.7655434	153.4276703	3.08892E−35	1.01909E−32
Cdk6	0.69278665	9.323662785	148.8770447	3.05082E−34	9.86392E−32
Whsc1l1	0.512329382	9.540585951	145.903876	1.36256E−33	4.31904E−31
Jund	0.351175103	11.8341681	144.7390714	2.4491E−33	7.61388E−31
Mbnl1	0.413036368	9.849897993	142.1924147	8.82692E−33	2.69238E−30
Rbm15	0.628984036	9.221090464	133.4475927	7.21627E−31	2.16034E−28
Vim	−0.437802323	10.47337793	131.8303156	1.62971E−30	4.79015E−28
Pan3	0.626656499	9.234208712	129.8623289	4.39208E−30	1.2679E−27
Btg2	0.352738759	10.53793205	129.3740822	5.6169E−30	1.59303E−27
Tmf1	0.627601139	9.275192923	129.1549672	6.27249E−30	1.74829E−27
2810417H13Rik	−1.247677001	9.337299453	126.8996408	1.95409E−29	5.35422E−27
Stmn1	−1.206782014	9.430175049	126.1409638	2.864E−29	7.71656E−27
Yme1l1	0.579622353	9.30034005	126.1065549	2.91409E−29	7.72281E−27
Tacc1	0.604302394	9.2685904	124.1370695	7.86206E−29	2.04997E−26
Rps2	−0.205226981	11.63566325	123.1141609	1.31652E−28	3.37823E−26
Paip1	0.551270107	9.192203166	115.9410137	4.89646E−27	1.23681E−24
Actr2	0.392668307	9.67646915	114.132176	1.21906E−26	3.03189E−24
Picalm	0.555431958	9.321258484	113.9378103	1.3446E−26	3.29346E−24
Sbno1	0.513517128	9.426293354	113.1197864	2.03125E−26	4.90107E−24
Inpp4a	0.587876896	9.237580327	112.0650956	3.45769E−26	8.22015E−24
Ldha	−0.320721971	10.35600944	111.3867557	4.86835E−26	1.12431E−23
Sik1	0.602626506	9.263004564	111.4022104	4.83054E−26	1.12431E−23
Wtap	0.491265482	9.408000204	110.6189664	7.17102E−26	1.63277E−23
Ets1	0.290857133	10.24994698	109.3408892	1.36644E−25	3.06804E−23
Coro1a	−0.280380953	10.77303317	107.8067187	2.9631E−25	6.56185E−23
Junb	0.298950285	11.89123884	106.8133985	4.89122E−25	1.06853E−22
Slc25a36	0.582838679	9.248175989	106.3278949	6.24906E−25	1.34696E−22
Vps54	0.565971111	9.235814078	103.7126119	2.33898E−24	4.97525E−22
Slc24a5	0.553964628	9.200019039	103.63554	2.43176E−24	5.10543E−22
Tra2b	0.370231771	9.814904189	103.315665	2.85785E−24	5.92307E−22
Gm11713	0.572636965	9.228906171	103.2557973	2.94552E−24	6.02751E−22
Ms4a4b	−0.307441662	10.75184171	100.524946	1.16915E−23	2.36256E−21
Ubc	−0.296729819	11.05003167	100.4017801	1.24416E−23	2.4831E−21
Gapdh	−0.27320874	10.56202545	99.15190914	2.33857E−23	4.61041E−21
Atp5b	−0.290696215	10.21322353	98.82442542	2.7591E−23	5.37394E−21
Clk1	0.36378697	9.76646424	96.66015417	8.23092E−23	1.58406E−20
Rbm39	0.215576064	10.68049787	92.55576108	6.54543E−22	1.24486E−19
Tuba1b	−0.552571308	9.729974254	92.05832174	8.41593E−22	1.582E−19
Ass1	−0.523431526	9.534289055	91.07958592	1.38008E−21	2.56441E−19
Gm28875	0.563226861	9.244792702	90.68509289	1.68458E−21	3.09464E−19
Ran	−0.404512958	9.801116978	89.98963	2.39412E−21	4.34868E−19
Mxd1	0.445030151	9.600631761	88.53118238	5.00398E−21	8.98826E−19
Cdc42	−0.241615643	10.40474043	88.09235834	6.24685E−21	1.10974E−18
Dctn4	0.515634719	9.226791755	87.91551187	6.83109E−21	1.20034E−18
Tagln2	−0.315292626	10.29861125	85.67548392	2.12025E−20	3.68559E−18
Pycard	−0.480518193	9.577079204	85.3625029	2.48386E−20	4.27172E−18
Iqgap1	0.367736638	9.634427689	85.30814659	2.55309E−20	4.34456E−18
Ccna2	−0.429260011	9.193741049	85.24349744	2.63795E−20	4.44219E−18
Rps17	−0.238111557	10.6149625	84.2556873	4.34751E−20	7.24555E−18
Tspo	−0.3241737	9.918108481	82.82928905	8.94546E−20	1.47564E−17
Birc5	−0.774306859	9.251476471	82.78125795	9.16549E−20	1.49666E−17
Rps20	−0.199278964	11.06854686	82.45020041	1.08366E−19	1.75185E−17
Lsp1	−0.289441501	10.32146402	82.23662981	1.20732E−19	1.93242E−17
Tmsb4x	−0.124205111	14.24920305	81.97789106	1.37618E−19	2.1811E−17
Anxa2	−0.424357411	9.842409891	81.44249127	1.80436E−19	2.83198E−17
Slc25a5	−0.256183417	10.39387945	80.44715179	2.98585E−19	4.64127E−17
Twistnb	0.466840475	9.374854863	80.3380422	3.15535E−19	4.85804E−17
Vmp1	0.412669378	9.490475476	79.90893633	3.92069E−19	5.97943E−17
Erh	−0.369077248	9.741195422	79.50363006	4.8134E−19	7.27228E−17
Luc7l2	0.340413015	9.66558153	78.75848933	7.01865E−19	1.05059E−16
Hmgb2	−0.305301671	10.71128878	77.75424372	1.16692E−18	1.73069E−16
2310035C23Rik	0.479288441	9.250856289	77.25219276	1.50464E−18	2.21128E−16
D17H6S53E	0.406173804	9.17696648	76.49933424	2.20287E−18	3.20826E−16
Fhl3	0.398167305	9.169266684	76.3836551	2.33577E−18	3.37143E−16
Rpl10a	−0.169361349	11.14217591	73.76932407	8.78005E−18	1.25609E−15
Ube2c	−0.641235053	9.233348605	72.70415792	1.50616E−17	2.13585E−15
Rpl32	−0.117506557	12.44734553	72.55274494	1.62627E−17	2.28611E−15
Rpl7	−0.15134652	11.21186942	71.29300761	3.07925E−17	4.26112E−15
Rpl28	−0.19927858	10.72551078	71.29000083	3.08395E−17	4.26112E−15
4933434E20Rik	0.427011884	9.335042118	71.15520058	3.30201E−17	4.52376E−15
Myef2	0.473342591	9.220160509	70.98360765	3.60205E−17	4.89334E−15
Asf1b	−0.519244424	9.223192204	69.8277614	6.47156E−17	8.71827E−15
Hsf2	0.362266417	9.168337049	69.71039283	6.86833E−17	9.17631E−15
Arhgdib	−0.215029523	10.73176838	69.28228906	8.53324E−17	1.13072E−14
Ube2h	0.460203792	9.263527957	68.76398418	1.10981E−16	1.45863E−14
Gsk3b	0.407848736	9.383828957	68.63067832	1.18742E−16	1.54806E−14
Itgb1	−0.651985291	9.299264118	68.61024305	1.19979E−16	1.55167E−14
Rps27a	−0.126520352	11.80972706	68.55707054	1.23258E−16	1.58142E−14
Brd4	0.414924172	9.358976296	68.13900406	1.52367E−16	1.9395E−14
Pkm	−0.263117525	10.16193974	67.81711708	1.79385E−16	2.26558E−14
Eif4a1	−0.22402961	10.43971408	67.73133076	1.87363E−16	2.34799E−14
Rpl10	−0.154085529	11.48655718	67.63680055	1.96564E−16	2.44435E−14
Cdca3	−0.407079178	9.196715741	67.36575915	2.25532E−16	2.78317E−14
Rps8	−0.141029567	11.59257343	67.11812291	2.55717E−16	3.13176E−14
Cd48	−0.386951826	9.721176096	66.9921926	2.72585E−16	3.31323E−14
Paxbp1	0.466529975	9.251251081	66.57229938	3.37293E−16	4.06916E−14
Rps3	−0.111776312	11.96705488	66.29601134	3.88043E−16	4.64674E−14
Otub1	0.41672661	9.332259923	66.2658541	3.94026E−16	4.68369E−14
Myl6	−0.177794839	10.93119837	65.70031043	5.24976E−16	6.19472E−14
Rnf157	0.433755297	9.351493602	64.59611437	9.19365E−16	1.07699E−13
Rps10	−0.147538768	11.22179603	64.31354938	1.06113E−15	1.23412E−13
Eef1a1	−0.110321731	12.38176503	63.52961517	1.57974E−15	1.82415E−13
Rps12	−0.195856238	10.77060475	63.26015038	1.81132E−15	2.07672E−13
Gnb2l1	−0.190267377	10.54006448	62.23026714	3.05555E−15	3.4786E−13
Nusap1	−0.491535516	9.207147356	61.59057605	4.22838E−15	4.78013E−13
Il18r1	0.368848685	9.526791354	61.355196	4.76532E−15	5.34973E−13
Gzmk	−0.690300473	9.363676844	61.27842647	4.9548E−15	5.52409E−13
Tyms	−0.498994778	9.238838131	61.20745879	5.13666E−15	5.66822E−13
Lrrc8a	0.409765583	9.190599691	61.20074377	5.15421E−15	5.66822E−13
Cdca8	−0.458035324	9.207869503	60.94749215	5.86176E−15	6.40278E−13
Rrm2	−0.611980984	9.247497636	60.56190851	7.13004E−15	7.73586E−13
Ccnb2	−0.485513492	9.212240288	59.84990711	1.02374E−14	1.10332E−12
Rpl31	−0.170290124	10.87151483	59.78576465	1.05766E−14	1.13232E−12
Pnrc1	0.208894663	10.57788165	59.46508287	1.24483E−14	1.32395E−12
Clic1	−0.227413644	10.32554613	59.07912283	1.51458E−14	1.6003E−12
Ccnb1	−0.297805543	9.183009169	58.84515862	1.70581E−14	1.79066E−12
Gnl3l	0.393730748	9.189382723	58.79316531	1.75149E−14	1.82674E−12
Zscan26	0.396044821	9.188162719	58.13789649	2.44373E−14	2.53239E−12
B2m	−0.093766772	12.79982	57.0257555	4.30142E−14	4.42909E−12
Gm26699	0.375519253	9.394464865	56.90560992	4.5724E−14	4.67831E−12
Rplp0	−0.108717289	12.38775842	56.85972585	4.68034E−14	4.75864E−12
Rpsa	−0.129421707	11.60009635	56.83524585	4.73896E−14	4.78813E−12
Plcxd2	0.426020085	9.360396846	56.77268616	4.89214E−14	4.9122E−12
Wnk1	0.324700375	9.627959621	56.58347879	5.38625E−14	5.37494E−12
Foxo3	0.45328937	9.215455773	56.21309552	6.5027E−14	6.44924E−12
Fbxo46	0.342072366	9.178401822	56.16217377	6.67331E−14	6.5781E−12
Abcg1	0.404303623	9.204739969	56.05560672	7.045E−14	6.90239E−12
Cks1b	−0.545261815	9.261603647	55.41157135	9.77593E−14	9.52034E−12
Eomes	−0.641532838	9.215520909	55.26385568	1.05389E−13	1.02019E−11
Ddx3y	0.488648104	9.286792787	55.16274371	1.10952E−13	1.06765E−11
Lbh	0.382006384	9.408476281	54.62758716	1.45676E−13	1.39349E−11
Ppia	−0.134187803	11.56530329	54.30730708	1.71463E−13	1.62098E−11
Cdkn1a	0.406730252	9.693181563	54.31309281	1.70959E−13	1.62098E−11
Rpl7a	−0.167038867	10.71263743	53.61755631	2.43573E−13	2.2893E−11
Gngt2	0.409025485	9.363461133	52.9479409	3.42507E−13	3.20056E−11
Rps7	−0.11087119	11.94311471	52.54889015	4.1967E−13	3.89907E−11
Itgb7	−0.270792151	9.956558259	52.49357441	4.31658E−13	3.98754E−11
Neurl3	0.323822382	9.619672539	52.41712233	4.48794E−13	4.12227E−11
Rplp1	−0.124745324	11.7032513	52.07151016	5.35158E−13	4.88777E−11
Mcmbp	0.413813179	9.263665081	51.20857013	8.30552E−13	7.5431E−11
Itpkb	0.339679714	9.50966549	51.02768436	9.10724E−13	8.22501E−11
Rpl23	−0.117810619	11.70858916	50.8216993	1.01149E−12	9.08433E−11
Glipr2	−0.378200114	9.484106509	50.74315683	1.05279E−12	9.40298E−11
Rplp2	−0.114755509	11.91005984	50.19613435	1.39122E−12	1.23574E−10
Ppib	−0.241497971	9.880914383	49.93316246	1.59073E−12	1.40523E−10
Rbbp7	−0.389687456	9.3983099	49.65461608	1.83338E−12	1.61079E−10
Etv3	0.407752576	9.25329147	49.62740311	1.85899E−12	1.62446E−10
Ptma	−0.16554087	11.28820186	49.53884871	1.94482E−12	1.69032E−10
Hmgb1	−0.226258893	10.2970404	49.01334479	2.54227E−12	2.19777E−10
Arhgap31	0.330556748	9.65435635	48.91411752	2.67419E−12	2.29952E−10
Gigyf1	0.347864515	9.189703078	48.79333282	2.84405E−12	2.41067E−10
Txn1	−0.239849684	10.00206855	48.790484	2.84818E−12	2.41067E−10
Rasgrp2	−0.418570333	9.377071127	48.79152979	2.84667E−12	2.41067E−10
Clasp2	0.332052036	9.17236319	48.4325801	3.41841E−12	2.86332E−10
Rps3a1	−0.108391678	11.67388738	48.43755822	3.40975E−12	2.86332E−10
Hnrnpk	−0.203363418	10.15623829	48.37079186	3.52784E−12	2.93974E−10
Dut	−0.4252743	9.370293948	47.66015211	5.06891E−12	4.20225E−10
1500009L16Rik	−0.436094888	9.246962693	47.54794259	5.36751E−12	4.4271E−10
Rps23	−0.091493016	12.48529685	47.41265727	5.75101E−12	4.71933E−10
Rpl5	−0.166750551	10.56753913	47.10915065	6.71415E−12	5.48187E−10
Cdc45	−0.176040165	9.168332637	46.94437406	7.30303E−12	5.9327E−10
Psma4	−0.320075079	9.543453421	46.8948269	7.49002E−12	6.05418E−10
Dusp5	0.244343465	9.994465583	46.81799425	7.78949E−12	6.26492E−10
Tgif1	0.288197973	9.720285893	46.55851466	8.8923E−12	7.11648E−10
Iqsec1	0.306868317	9.175097412	46.31161233	1.00864E−11	8.03238E−10
Arhgap26	0.362226979	9.20131511	46.26928545	1.03067E−11	8.16756E−10
Smc2	−0.457838158	9.240576863	46.18600984	1.07542E−11	8.48062E−10
Aurkb	−0.227897739	9.176287527	46.17329213	1.08243E−11	8.49441E−10
Themis	0.338780405	9.406121809	46.15809092	1.09086E−11	8.51922E−10
Rad51ap1	−0.168933582	9.168873929	45.83353646	1.28741E−11	1.00059E−09
Ddit4	−0.457302383	9.366175801	45.70124776	1.37735E−11	1.06285E−09
Set	0.268072579	9.77371175	45.6965463	1.38066E−11	1.06285E−09
Bcl2l1	0.374282608	9.376443509	45.58015518	1.46519E−11	1.12257E−09
Tpx2	−0.255816003	9.180936262	45.48370732	1.53914E−11	1.17367E−09
Uvssa	0.357771198	9.191219939	45.45775589	1.55967E−11	1.18374E−09
Uhrf2	0.345073862	9.554452999	45.43283888	1.57964E−11	1.19329E−09
Rbm3	−0.174412186	10.73098646	45.27873534	1.70895E−11	1.28497E−09
Rap2b	0.386872593	9.217861261	45.25646564	1.72849E−11	1.29365E−09
Ahnak	0.279946145	9.648666059	45.20386587	1.77554E−11	1.32274E−09
Anp32a	−0.238121521	9.878253526	44.91218759	2.06071E−11	1.52814E−09
Anxa6	−0.266357286	9.747058157	44.88962553	2.08459E−11	1.53879E−09
Hspa5	−0.188078636	10.97852379	44.34155639	2.75799E−11	2.02662E−09
Calr	−0.237935659	10.02077588	44.24976673	2.89039E−11	2.1143E−09
Tk1	−0.276494249	9.186384692	44.05815286	3.18763E−11	2.32123E−09
Ezr	−0.28511791	9.722755344	43.93118787	3.40126E−11	2.46568E−09
Peli1	0.262373761	9.756230653	43.77706211	3.67993E−11	2.65579E−09
Hmmr	−0.151166002	9.167541924	43.57211811	4.0862E−11	2.93589E−09
Dbi	−0.354303671	9.462114256	43.44556351	4.35919E−11	3.11817E−09
Hint1	−0.205762868	10.08266688	43.31598681	4.65763E−11	3.31697E−09
Snrpe	−0.239207361	9.827296541	43.27064695	4.76681E−11	3.37984E−09
Tppp3	−0.326363173	9.18599552	43.02109733	5.41527E−11	3.82285E−09
Cct8	−0.301160499	9.521391609	42.40689585	7.41282E−11	5.21025E−09
Hmgcr	0.36841636	9.25124838	42.32625686	7.72485E−11	5.40606E−09
Ly6c2	−0.697969266	9.265996044	42.30561042	7.80683E−11	5.43988E−09
Tnfaip3	0.227027416	10.12507605	42.22671488	8.12821E−11	5.61541E−09
Mki67	−0.3515189	9.202982177	42.22810773	8.12242E−11	5.61541E−09
Rrm1	−0.384070718	9.219634699	41.86633532	9.77309E−11	6.72305E−09
Hist1h2ap	−0.286036608	9.18659925	41.65572091	1.08846E−10	7.45598E−09
Stim2	0.362672122	9.238378298	41.47872855	1.1916E−10	8.12805E−09
Fn3krp	0.184846223	9.161101118	41.29537404	1.30878E−10	8.88982E−09
Bmp2k	0.358909864	9.218888635	41.24306732	1.34428E−10	9.05483E−09
Rps24	−0.101666272	12.00584544	41.25017653	1.3394E−10	9.05483E−09
Spc24	−0.346692321	9.204100128	40.95893737	1.55461E−10	1.04282E−08
Hnrnpa2b1	−0.196534148	10.12046099	40.88778863	1.61225E−10	1.07274E−08
S1pr1	−0.422059619	9.290338593	40.88748874	1.6125E−10	1.07274E−08
mt-Atp6	0.102698372	12.47134724	40.86302484	1.63281E−10	1.08181E−08
Prdx1	−0.232856001	9.945082204	40.62557883	1.84377E−10	1.21659E−08
Xist	−0.490990751	9.888398691	40.56781288	1.89909E−10	1.248E−08
Smap2	0.28963393	9.515102178	40.50424865	1.96189E−10	1.28404E−08
Rpl26	−0.103119108	11.57423238	40.39614168	2.0735E−10	1.35162E−08
Btf3	−0.134387238	10.715474	40.35161787	2.1213E−10	1.37722E−08
Rps4x	−0.09543889	11.84794084	40.24202475	2.24369E−10	1.45086E−08
Naca	−0.135088853	10.80132827	40.22731503	2.26065E−10	1.456E−08
Zbtb21	0.346325707	9.20850205	40.1126819	2.39728E−10	1.53787E−08
Ppp1ca	−0.180999333	10.29795938	40.09980116	2.41314E−10	1.54193E−08
Anp32e	−0.31717177	9.516881137	39.89016764	2.68652E−10	1.70985E−08
Cct4	−0.269302589	9.5936703	39.78464151	2.83566E−10	1.7977E−08
Yes1	0.387710552	9.221085842	39.58488074	3.14106E−10	1.98353E−08
Reep5	−0.27118009	9.637135956	39.51909329	3.24867E−10	2.04351E−08
Sept2	0.342873186	9.274290012	39.48946663	3.29834E−10	2.0667E−08
Rpl35a	−0.09831683	11.7234212	39.28221717	3.66766E−10	2.28925E−08
Cotl1	−0.182341504	10.46112717	39.11250618	4.00073E−10	2.48753E−08
Il7r	0.272892916	9.753485896	38.72699605	4.87421E−10	3.01902E−08
Psmb7	−0.295620167	9.46523868	38.2618874	6.18591E−10	3.81685E−08
Atf7ip	0.365085149	9.253987334	37.9190664	7.3741E−10	4.53269E−08
Hnrnpul1	0.306269675	9.37910581	37.75916648	8.00397E−10	4.90122E−08
Cdkn3	−0.220464584	9.177347936	37.69331595	8.27877E−10	5.05037E−08
Dnajb1	0.393957367	10.31781379	37.62379926	8.57913E−10	5.21392E−08
Cd2	−0.195141092	10.31973533	37.56156193	8.85728E−10	5.3628E−08
Klhl9	0.321655077	9.198908172	37.50704817	9.10833E−10	5.49422E−08
Cenpm	−0.21208704	9.175769069	37.44666956	9.3947E−10	5.6459E−08
Mcm2	−0.372335465	9.227695356	37.4049719	9.59771E−10	5.74654E−08

TABLE 3B
LPL-1 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Actb	−1.788578756	13.40456535	1969.985989	0	0
Vps37b	0.895007394	10.60462528	1103.972392	4.5239E−242	3.6566E−238
S100a4	−2.066980708	9.866840932	990.3446629	2.2542E−217	1.2147E−213
S100a6	−1.154115196	10.99649875	760.3528646	2.2508E−167	9.0966E−164
Crem	1.135777664	10.06722635	752.2332434	1.3116E−165	4.2408E−162
Ifngr1	0.612024932	11.11302914	721.8445664	5.3157E−159	1.4322E−155
Pfn1	−0.538711172	12.14558847	686.3702201	2.7519E−151	6.3553E−148
Plac8	1.128214216	10.5691871	665.727518	8.4869E−147	1.715E−143
Klf2	−1.940850631	9.960578273	662.9676093	3.3803E−146	6.0718E−143
Rgs2	1.097780206	10.06000559	658.8370261	2.6746E−145	4.3237E−142
Got1	1.084074843	9.855972072	655.3423412	1.5391E−144	2.2619E−141
Il21r	0.809669496	10.19619539	636.1687863	2.276E−140	3.0662E−137
Coro1a	−0.610607496	10.77323885	589.3688971	3.437E−130	4.2741E−127
Serpinb9	1.081184718	9.858313142	578.5602139	7.7137E−128	8.9071E−125
Eif1	0.337833647	11.85889679	560.5165898	6.49E−124	6.9945E−121
Lgals1	−0.72773285	11.62802019	535.1379291	2.1536E−118	2.176E−115
Lsp1	−0.654984065	10.32147718	488.4511929	3.0961E−108	2.9442E−105
Ptprcap	−0.783000793	10.0401488	488.2382418	3.4447E−108	3.0937E−105
Pycard	−1.085203588	9.577184042	487.7836331	4.3258E−108	3.6806E−105
Dgat1	0.89679146	9.778871165	483.8844962	3.0514E−107	2.4664E−104
Fosl2	0.952434136	9.53162468	477.9445926	5.9841E−106	4.6066E−103
Rps27rt	0.520913608	11.16205822	470.2190332	2.8715E−104	2.11E−101
Neurl3	0.799145197	9.619598144	457.07289	2.0839E−101	1.46474E−98
Rps27	0.285776264	13.23482323	418.9475401	4.13549E−93	2.7856E−90
Fth1	0.376259293	11.58476825	415.2458293	2.644E−92	1.64396E−89
Tmsb4x	−0.273689693	14.24925717	415.3072706	2.56382E−92	1.64396E−89
H2-K1	0.343352537	11.6100296	411.2718478	1.93767E−91	1.16016E−88
KIrc1	1.023930603	9.658425729	411.0322548	2.1849E−91	1.26147E−88
Ubald2	0.549709616	10.62002464	403.3569592	1.0237E−89	5.70662E−87
Cd52	−0.444841022	11.79358725	396.9799802	2.50243E−88	1.34847E−85
Cfl1	−0.392116577	11.11291947	384.8948211	1.06979E−85	5.57879E−83
Il4ra	0.774913613	9.499541933	367.1576528	7.78158E−82	3.93116E−79
Dusp5	0.581228407	9.994361734	364.1948693	3.43699E−81	1.68371E−78
Samsn1	0.721144616	9.795511159	359.8134916	3.09169E−80	1.47001E−77
Fgl2	0.863824189	9.496139473	356.3691619	1.7386E−79	8.03034E−77
Rps21	0.368294596	10.92388869	355.6060267	2.54903E−79	1.14466E−76
Arhgdib	−0.446836849	10.7318272	353.5929365	6.9942E−79	3.0559E−76
H2-D1	0.251752892	12.28194438	353.1089558	8.91515E−79	3.79269E−76
Gna13	0.565688846	9.98513228	340.9752456	3.91273E−76	1.62188E−73
Ddx5	0.344568543	11.1991571	340.3406904	5.37866E−76	2.17379E−73
Cnn2	−0.654811498	9.902885218	336.4034115	3.87396E−75	1.52748E−72
Emp3	−0.70120027	9.864713566	333.8561537	1.38972E−74	5.34909E−72
Cd48	−0.798426594	9.72124298	328.3159143	2.23659E−73	8.40854E−71
Pik3r1	0.73885528	9.484799174	319.99719	1.45049E−71	5.32921E−69
Lilrb4a	0.738717163	9.646925283	318.7921692	2.65457E−71	9.5364E−69
Ndufa4	−0.679488465	9.73553315	315.5972178	1.31808E−70	4.6322E−68
mt-Co3	−0.28661259	12.09929008	308.8719528	3.8456E−69	1.32272E−66
Prr7	0.638751806	9.824437298	306.931633	1.01779E−68	3.42783E−66
Fasl	0.69087468	9.594176945	306.2337496	1.44442E−68	4.7654E−66
Slc25a5	−0.452500278	10.39410252	304.0526899	4.31366E−68	1.39469E−65
Rac2	−0.337772566	11.09602488	296.8583091	1.59313E−66	5.04992E−64
Dnaja1	0.566084182	10.76357045	294.7162074	4.66622E−66	1.45066E−63
Nrip1	0.732165744	9.582519625	288.2422587	1.20104E−64	3.59555E−62
Arpc3	0.372459303	10.54021408	288.2457578	1.19893E−64	3.59555E−62
Litaf	0.809822856	9.445009121	284.4411901	8.08743E−64	2.37712E−61
Arpc1b	−0.375752302	10.55364549	281.7754455	3.08106E−63	8.89436E−61
Tubb5	−0.772688378	10.00334547	281.1572307	4.20163E−63	1.19164E−60
Ctla2a	0.700790544	10.33575323	279.3695207	1.03036E−62	2.87186E−60
Rpl37a	0.210248664	12.61564007	277.6971692	2.38468E−62	6.53402E−60
Bin2	−0.728028996	9.612828291	277.1285376	3.17211E−62	8.54673E−60
Wdr89	0.513393949	10.42643281	274.3649881	1.26942E−61	3.36418E−59
Eif5	0.511485385	9.823441033	269.7699212	1.27366E−60	3.32097E−58
Nabp1	0.636082496	9.632410631	268.2210034	2.77101E−60	7.11051E−58
Klrk1	0.934839579	9.564414696	268.1106967	2.92873E−60	7.3978E−58
Rplp0	−0.218100349	12.38791042	267.9073344	3.24342E−60	8.06663E−58
Rcbtb2	0.809053481	9.39894406	265.5508845	1.05829E−59	2.59216E−57
Rpl38	0.237996532	11.67460313	258.5201237	3.60659E−58	8.70212E−56
Tmem176a	−1.165497721	9.404480668	252.8672547	6.15696E−57	1.46373E−54
mt-Atp6	−0.243334052	12.4711756	248.1279894	6.64601E−56	1.55709E−53
Capzb	−0.431404911	10.15899075	247.9573988	7.24023E−56	1.67208E−53
Clic1	−0.422522733	10.32564272	246.7932166	1.29887E−55	2.95739E−53
Ifrd1	0.521730657	10.02583298	238.8278921	7.08402E−54	1.59056E−51
Nfkbia	−0.581770075	10.83335684	237.7851151	1.1958E−53	2.64812E−51
Usmg5	0.41505392	10.06859317	237.6977148	1.24944E−53	2.72953E−51
Nr3c1	0.688319036	9.448726347	237.0161873	1.75925E−53	3.792E−51
Actr3	−0.415162569	10.23427966	234.8065523	5.33531E−53	1.13488E−50
Ppp1ca	−0.397132915	10.29810957	233.8723064	8.52878E−53	1.7906E−50
Cnbp	0.356953072	10.25780671	233.8107991	8.7963E−53	1.82309E−50
Gimap6	0.391836768	10.4658122	231.7934375	2.42231E−52	4.95685E−50
Gnai2	−0.456079708	10.17424924	231.4370798	2.89697E−52	5.85405E−50
Pglyrp1	−0.932489522	9.331204668	231.4010017	2.94993E−52	5.88747E−50
Rplp2	0.21411519	11.91020827	230.6878952	4.22012E−52	8.31982E−50
Lilr4b	0.578605702	9.77812791	228.9456823	1.01222E−51	1.97151E−49
Irak2	0.726366279	9.278620156	226.4881484	3.47731E−51	6.69217E−49
Rpl35	−0.293445674	11.18862876	225.0845461	7.03672E−51	1.3383E−48
Lmna	0.838878501	9.713616963	223.8901563	1.28196E−50	2.40979E−48
Cbx3	−0.793973529	9.51797351	221.1859312	4.98546E−50	9.26378E−48
Itk	0.497130976	9.814380172	220.0345571	8.88885E−50	1.63292E−47
Jun	−1.278105538	9.603448288	218.9495885	1.53288E−49	2.78433E−47
Ifitm2	0.728838581	10.68450898	218.2894633	2.13551E−49	3.83585E−47
Nr4a2	0.715704419	9.52121308	217.1365889	3.81052E−49	6.76933E−47
P2ry10	0.557735676	9.588148915	216.0497309	6.57768E−49	1.15581E−46
Dennd4a	0.661822792	9.353169932	215.1945639	1.0107E−48	1.75688E−46
Dnajb6	0.402259307	10.0235756	214.4131266	1.49656E−48	2.57376E−46
Rps24	0.201933056	12.00595021	212.9332807	3.14722E−48	5.35558E−46
Il12rb2	0.713180429	9.345960823	210.587897	1.02236E−47	1.72161E−45
Fus	0.415736893	9.89924265	209.6682075	1.62276E−47	2.70449E−45
Actg1	−0.305072557	12.09966478	209.2739452	1.97821E−47	3.26323E−45
Cotl1	−0.387624119	10.46139499	208.5595047	2.83234E−47	4.62502E−45
Hilpda	0.643315922	9.667586402	207.5609804	4.67741E−47	7.5615E−45
Abracl	−0.459491705	9.935333895	204.9361765	1.74868E−46	2.79893E−44
Stmn1	−1.408402171	9.430733602	204.5829412	2.08827E−46	3.3097E−44
S100a13	−0.460207609	9.897903663	200.3466085	1.75467E−45	2.75397E−43
Zyx	−0.78157278	9.311171714	198.7702945	3.87423E−45	6.02219E−43
mt-Co1	−0.219039635	12.21547146	198.0155703	5.66095E−45	8.71571E−43
Tnfrsf1b	0.594415005	9.452768175	197.5495441	7.15471E−45	1.09116E−42
Cks1b	−0.902420001	9.26180276	197.452059	7.51393E−45	1.13524E−42
Cdkn1a	0.684828228	9.693082603	197.3870862	7.7633E−45	1.16205E−42
Rpl36	0.191378672	11.87412411	196.3232522	1.325E−44	1.96514E−42
Prdx6	0.387419462	10.19719876	195.9655521	1.58592E−44	2.33073E−42
2810417H13Rik	−1.348762706	9.337778098	195.5943825	1.91112E−44	2.78335E−42
Pkp3	−0.590268938	9.709686255	194.7192546	2.96677E−44	4.28222E−42
H2-Q7	0.318794872	10.6210556	194.3215104	3.6232E−44	5.18343E−42
Rps28	0.239174935	11.70755238	194.1805529	3.88917E−44	5.51512E−42
Myl6	−0.272160511	10.93133884	189.5951424	3.89676E−43	5.47782E−41
Itgb7	−0.467285899	9.956624675	189.2773925	4.57154E−43	6.37099E−41
1700097N02Rik	−0.721214639	9.227389704	187.3734805	1.19032E−42	1.64468E−40
Prkca	0.631509347	9.472730429	185.026078	3.87351E−42	5.30671E−40
Abcb1b	0.705256247	9.297095082	184.288226	5.61288E−42	7.62503E−40
Bcl2l11	0.679389484	9.333331974	183.929455	6.72219E−42	9.05591E−40
Slc3a2	0.401407628	10.08963433	183.7616752	7.31374E−42	9.7714E−40
Osbpl9	0.664999167	9.306537304	183.4761973	8.44237E−42	1.10959E−39
Lcp1	−0.387042933	10.2911179	183.490149	8.38337E−42	1.10959E−39
S1pr1	−0.798212974	9.290347096	183.128455	1.0055E−41	1.31088E−39
Sh2d1a	−0.668941826	9.507382786	182.7651867	1.20696E−41	1.56094E−39
Rabac1	0.420182689	9.787494723	182.5076575	1.37378E−41	1.76258E−39
Sec61b	−0.425196971	9.885092925	181.610947	2.15622E−41	2.74469E−39
Riok1	0.638753261	9.379978763	181.4859042	2.29612E−41	2.89993E−39
Gpr132	0.416559375	9.8660454	180.8336852	3.1871E−41	3.994E−39
Crip1	−0.493199874	11.66680468	180.0759095	4.66494E−41	5.80103E−39
Rps16	0.16161083	12.35143085	179.5347494	6.12356E−41	7.55676E−39
Abcb1a	0.648799063	9.300398573	178.4612223	1.05052E−40	1.28657E−38
BC021614	−0.744896507	9.270925728	178.3219969	1.12669E−40	1.36948E−38
Orai1	0.43534957	9.884592153	176.58257	2.70161E−40	3.25927E−38
Gabpb1	0.596714389	9.478113973	175.9501956	3.71289E−40	4.44611E−38
Rexo2	−0.610677527	9.465244675	175.0647112	5.79529E−40	6.88873E−38
Hspa8	0.298364729	12.33067999	171.6427177	3.23885E−39	3.82184E−37
Tbc1d10c	−0.609447245	9.522567817	171.179049	4.08936E−39	4.79048E−37
Ap2s1	−0.560849494	9.498112489	171.1596432	4.12946E−39	4.80266E−37
Atp5c1	−0.393590419	9.901816954	170.3699703	6.14273E−39	7.0931E−37
Chchd2	0.281156025	10.44216726	169.2568613	1.07517E−38	1.23271E−36
Glipr2	−0.62575301	9.484139571	169.1833807	1.11565E−38	1.27011E−36
Ltb	−0.525135472	10.15487923	169.094768	1.16649E−38	1.31871E−36
Apobec3	−0.614418213	9.503277979	168.9346551	1.26431E−38	1.41936E−36
Hsp90ab1	0.358235846	11.19703839	168.5749929	1.51499E−38	1.68906E−36
Traf4	0.618977528	9.359798595	168.1736074	1.85388E−38	2.05273E−36
Gch1	0.58977029	9.459478409	167.9384628	2.08662E−38	2.29471E−36
Rps15a	0.15887194	12.4038352	167.7357859	2.31053E−38	2.52379E−36
Pim1	−0.449599367	10.82518403	166.6702327	3.94877E−38	4.28429E−36
AW112010	−0.356352013	11.38310706	166.0238903	5.46572E−38	5.89059E−36
Arpc5	−0.374716295	10.09994182	165.8699709	5.90568E−38	6.32259E−36
Tmem176b	−0.88387982	9.4480561	164.2381697	1.34194E−37	1.42722E−35
Pde4b	0.463371289	9.65862148	164.1390035	1.41057E−37	1.49041E−35
Cdc42	−0.290733616	10.40483847	164.0282804	1.49136E−37	1.56554E−35
Rbm3	−0.303875972	10.73119655	163.8078342	1.66626E−37	1.73785E−35
Stat4	0.509660197	9.50654617	161.4842906	5.36238E−37	5.55694E−35
Pomp	−0.461350255	9.70146416	160.7695414	7.68272E−37	7.91076E−35
Isg15	0.724401352	9.495169432	160.4188089	9.16525E−37	9.37756E−35
Tspo	−0.399054221	9.918101434	160.304487	9.70783E−37	9.87023E−35
Arf4	0.373788321	9.974865872	159.6926899	1.32066E−36	1.33437E−34
Gm11808	0.354253549	10.17414183	159.250362	1.64982E−36	1.65659E−34
Flna	−0.685998565	9.27108819	159.1706353	1.71734E−36	1.71374E−34
Uba52	0.326559163	10.2399743	158.987408	1.88318E−36	1.8677E−34
Hsp90aa1	0.484135824	10.76861348	157.8713379	3.30183E−36	3.25472E−34
Adora2a	0.552025884	9.426699157	157.5091965	3.96173E−36	3.88153E−34
Gm9843	0.337819429	10.49171063	156.9213278	5.32526E−36	5.18603E−34
Vim	−0.444021646	10.47382906	156.4739419	6.66963E−36	6.45636E−34
Hspe1	0.476979188	10.27539148	156.3922483	6.9495E−36	6.68724E−34
Pkm	−0.357373771	10.1621659	155.5786776	1.04649E−35	1.00104E−33
Ccnd2	0.45234154	9.824519901	155.4920344	1.09313E−35	1.0395E−33
Kpna1	0.56949201	9.374027049	155.1833538	1.27681E−35	1.20707E−33
D16Ertd472e	0.457345281	9.624068057	154.0966474	2.20601E−35	2.07339E−33
S100a10	−0.30141114	10.94016781	154.0320192	2.27893E−35	2.12955E−33
Ccnb2	−0.632375053	9.212365668	153.0418621	3.7508E−35	3.4848E−33
Arf5	−0.352340754	9.981775241	152.9596822	3.90917E−35	3.61118E−33
Wdr1	−0.508723478	9.566638472	150.3847378	1.42845E−34	1.31207E−32
Slamf6	−0.73893756	9.319065378	149.892996	1.82957E−34	1.671E−32
Nfkb2	0.481830243	9.521885906	149.3244526	2.43568E−34	2.21209E−32
Ctla4	0.427747962	10.1530728	149.2551209	2.52217E−34	2.27785E−32
Gm26740	0.475205161	9.65890753	147.7317529	5.42961E−34	4.8764E−32
Ube2c	−0.767726489	9.233532012	147.2871077	6.79154E−34	6.06586E−32
Ago2	0.552705416	9.333716732	147.1394927	7.31539E−34	6.49784E−32
Birc5	−0.876229377	9.251711307	146.9093125	8.21402E−34	7.25617E−32
Gapdh	−0.299112432	10.56241857	146.8533552	8.44868E−34	7.4229E−32
Tagln2	−0.374638047	10.29890981	145.9056211	1.36136E−33	1.18961E−31
H2-Q6	0.403745938	9.740233488	145.8383905	1.40822E−33	1.22394E−31
Slc25a4	−0.505941443	9.597149244	145.6070287	1.58216E−33	1.36777E−31
Limd2	−0.388646178	10.08900365	145.4829362	1.68415E−33	1.44819E−31
Eif3h	−0.278504501	10.29703998	144.4345701	2.85483E−33	2.44186E−31
Acadl	0.535803555	9.426500038	143.2243213	5.2503E−33	4.46718E−31
Set	−0.454430557	9.773657326	143.1546396	5.43776E−33	4.60245E−31
Ifi27l2a	−0.716236939	9.817229705	143.0476155	5.73879E−33	4.83194E−31
Naca	−0.227053893	10.80149233	142.6503305	7.00947E−33	5.87125E−31
Ccr2	0.502477166	9.897669405	142.4515995	7.74707E−33	6.45563E−31
Cox5b	−0.342361485	10.0435119	142.0600531	9.43518E−33	7.82201E−31
Atp5l	−0.258434484	10.47768281	141.8235363	1.06284E−32	8.76623E−31
Crot	0.556863942	9.397231084	141.2860124	1.39316E−32	1.14324E−30
Batf	−0.546937194	9.653590189	140.6727645	1.89713E−32	1.54894E−30
Prelid1	−0.441857874	9.693857441	140.6149759	1.95315E−32	1.58053E−30
Tmem243	0.522419335	9.382999777	140.6127047	1.95538E−32	1.58053E−30
Tnfsf8	−0.746667051	10.01800671	139.9167141	2.77604E−32	2.23271E−30
Hnrnpa3	−0.33187099	10.15611501	139.2100176	3.96249E−32	3.17117E−30
Cd7	−0.955133649	9.49407751	138.7709549	4.94294E−32	3.93634E−30
Dtx4	0.588912666	9.260819691	138.0520211	7.09925E−32	5.62581E−30
H2-Q4	0.389274444	9.753654107	136.5636584	1.5022E−31	1.18461E−29
Cd53	0.267838459	10.54705558	136.2510731	1.75831E−31	1.37984E−29
Cirbp	0.372879235	9.821591303	136.0340404	1.96139E−31	1.53178E−29
Vcpkmt	0.490218515	9.468573275	135.7031786	2.31703E−31	1.80082E−29
Ms4a6b	−0.363533853	10.19483269	135.0862488	3.16134E−31	2.44527E−29
Rps23	0.136676892	12.485355	134.6595977	3.91917E−31	3.01701E−29
Tnfrsf18	0.363350646	10.06784669	134.0909261	5.21897E−31	3.99858E−29
Erh	−0.424916553	9.741395893	134.0299115	5.38185E−31	4.10392E−29
Ran	−0.43677254	9.801466447	132.078733	1.43801E−30	1.09141E−28
Pnrc1	0.279551131	10.57763129	131.7585909	1.68966E−30	1.27641E−28
Tox2	−0.494429465	9.191330625	130.5732514	3.06992E−30	2.30829E−28
Rpl23a-ps3	0.275124423	10.72027491	130.4319429	3.29643E−30	2.46713E−28
Cytip	0.305917579	10.18851993	130.0553827	3.98502E−30	2.96875E−28
Eomes	−0.808402797	9.215475259	129.9784094	4.14259E−30	3.07198E−28
Gnb1	−0.441806484	9.703176458	129.6601205	4.86309E−30	3.5898E−28
Calm2	0.281457442	10.41344741	129.5654599	5.10063E−30	3.74803E−28
Cdk6	−0.652717771	9.323625219	128.9918874	6.80961E−30	4.98119E−28
Plscr1	0.538048062	9.521580156	128.9205551	7.05879E−30	5.1402E−28
Ldha	−0.30771685	10.3562952	128.8545946	7.29731E−30	5.29006E−28
Btg2	0.325367246	10.53756271	128.1980853	1.01582E−29	7.3311E−28
Lmnb1	0.417613687	9.781595274	127.9843878	1.13129E−29	8.12822E−28
Rgcc	0.688439061	9.563499202	127.9722539	1.13823E−29	8.14188E−28
mt-Co2	−0.195884131	11.38674194	127.8524506	1.20905E−29	8.61038E−28
Rpl37	0.14371841	12.07306348	127.7719313	1.25911E−29	8.92756E−28
Tpt1	0.157950068	11.78349556	127.3775638	1.5359E−29	1.08425E−27
Gramd3	0.412706804	10.20636682	127.0334653	1.82667E−29	1.28391E−27
Gpx4	0.323281731	10.07618977	126.6694303	2.19444E−29	1.53573E−27
Cdca3	−0.472652508	9.196810536	126.3015826	2.64133E−29	1.84051E−27
Ccr5	0.540398603	9.51436215	125.9629608	3.13276E−29	2.17357E−27
Xist	0.750105813	9.888938449	125.3127903	4.34727E−29	3.00333E−27
Amz2	0.525949285	9.343188021	125.1580219	4.6999E−29	3.23313E−27
St8sia4	0.546224409	9.30811702	125.1322589	4.76131E−29	3.2615E−27
Zfp36	−0.811141834	9.294562058	124.0351838	8.2763E−29	5.64534E−27
Gltp	−0.507531701	9.448093847	122.3124798	1.972E−28	1.33947E−26
Rps29	0.16387477	12.24471453	121.9208529	2.40233E−28	1.61844E−26
mt-Cytb	−0.234943587	11.07879665	121.9205166	2.40274E−28	1.61844E−26
Igtp	0.504055964	9.509084729	121.2284811	3.40562E−28	2.28445E−26
Tbx21	0.557575631	9.277655891	120.9884633	3.84361E−28	2.56759E−26
Capn2	−0.559140819	9.322209356	120.5648275	4.75861E−28	3.16575E−26
Tnfaip8	0.423063549	9.630282095	120.3926675	5.19002E−28	3.4386E−26
Cox6b1	−0.278552491	10.15777506	118.9346766	1.08236E−27	7.1418E−26
Arpc4	−0.35503697	9.810411465	118.1622595	1.59769E−27	1.04993E−25
Ncl	0.289826807	10.07288426	116.7834774	3.20182E−27	2.09557E−25
Anp32b	−0.444708978	9.652821361	116.7595092	3.24075E−27	2.1125E−25
2700094K13Rik	−0.564948118	9.385390715	116.5920387	3.52629E−27	2.2894E−25
Mfsd6	0.50695786	9.369441943	116.3646697	3.95464E−27	2.55723E−25
Tuba4a	0.505604749	9.389389134	116.122805	4.46758E−27	2.8774E−25
Psmb3	−0.320343547	9.906091127	116.0098837	4.72934E−27	3.03391E−25
Gcnt2	0.569564724	9.21801522	115.8092096	5.23294E−27	3.3437E−25
Bcl2l1	0.52714474	9.376464751	115.7519424	5.38625E−27	3.42812E−25
Rpl23a	0.13563776	12.17564937	115.2767761	6.84457E−27	4.33919E−25
Rilpl2	−0.546494215	9.398901147	115.0842673	7.54234E−27	4.74599E−25
Hcst	0.252834434	10.61089101	115.0835741	7.54497E−27	4.74599E−25
Ass1	−0.51973323	9.534398406	114.7355685	8.99234E−27	5.6345E−25
Ubb	0.210452543	12.90465659	114.6470029	9.40307E−27	5.86911E−25
Rpl12	0.207576935	10.99249069	113.9508319	1.3358E−26	8.30559E−25
Ywhah	−0.3943071	9.722022338	113.8003544	1.44112E−26	8.92609E−25
Emp1	0.514205699	9.358540577	113.4343025	1.7333E−26	1.06949E−24
Hint1	−0.296617099	10.08286375	113.2323232	1.91917E−26	1.17967E−24
Dkkl1	0.504724291	9.308686473	113.1616116	1.98885E−26	1.21787E−24
Tcp11l2	0.490513451	9.433883691	112.7141682	2.49235E−26	1.52043E−24
Xcl1	1.194998958	9.40506854	112.2843688	3.09567E−26	1.88137E−24
Rpl24	−0.148371665	11.77231549	111.9741934	3.61992E−26	2.19174E−24
Antxr2	0.524111919	9.257858404	111.8224562	3.90784E−26	2.35725E−24
Tnfrsf25	−0.601839819	9.258889969	111.8014874	3.94939E−26	2.37345E−24
Timp2	−0.576983903	9.295775851	110.8832755	6.27592E−26	3.75765E−24
Amd1	0.506986556	9.33704939	110.5121875	7.56787E−26	4.51447E−24
Hsd11b1	−0.573712404	9.289649192	109.2285995	1.44609E−25	8.59464E−24
Cyba	−0.255410775	10.4309546	108.8830417	1.7215E−25	1.01941E−23
Twf2	−0.506092699	9.389135379	108.4415119	2.15105E−25	1.26912E−23
Cldnd1	0.437135874	9.795121381	108.1944154	2.43665E−25	1.4324E−23
H3f3b	0.176835587	12.3442743	107.9279532	2.78728E−25	1.63258E−23
Sub1	0.223420381	11.1488509	107.9028414	2.82282E−25	1.63562E−23
Nme1	−0.410983186	9.653644082	107.9169334	2.80282E−25	1.63562E−23
Dbi	−0.503923317	9.46225676	107.9081308	2.8153E−25	1.63562E−23
Mat2a	0.442640021	9.501583097	107.6673044	3.17904E−25	1.82891E−23
Emb	0.3409222	10.25108753	107.6709239	3.17324E−25	1.82891E−23
Itga4	−0.538393532	9.394382328	107.19807	4.02829E−25	2.30927E−23
Tpgs1	−0.547232328	9.260754207	106.3574922	6.15642E−25	3.51678E−23
Eno1	−0.340480149	9.942475304	106.210237	6.63132E−25	3.77472E−23
Sash3	−0.558983887	9.280791065	105.5651388	9.18291E−25	5.2088E−23
Rpl21	0.141624442	11.76877751	105.5424416	9.2887E−25	5.25039E−23
Rpl18a	0.115781407	12.84271355	105.3725254	1.01203E−24	5.70054E−23
Bak1	−0.530049389	9.291925002	104.9557381	1.24895E−24	7.01059E−23
Tmpo	−0.551234966	9.399332732	104.4649178	1.60001E−24	8.95012E−23
Fkbp1a	−0.359503623	9.733415831	104.2324114	1.79923E−24	1.00298E−22
Ndfip1	0.349750518	9.658014518	103.9167295	2.11E−24	1.17218E−22
Rgs1	0.371335135	11.08975907	103.6582181	2.40408E−24	1.33097E−22
Ech1	−0.423155488	9.539595739	103.6369821	2.42999E−24	1.34072E−22
Nop56	0.424122186	9.44999363	103.4998715	2.60411E−24	1.43191E−22
Il22	−1.546604232	9.482887499	103.4238643	2.70596E−24	1.48286E−22
Gnb2	−0.326724769	9.816182555	102.9851985	3.37662E−24	1.84413E−22
Psma4	−0.420490298	9.543577958	102.9024256	3.52068E−24	1.91634E−22
Coq10b	0.407565103	9.509829344	102.7580597	3.78682E−24	2.05429E−22
Kdm6b	−0.564998666	9.740092853	102.2484393	4.89775E−24	2.64806E−22
Def6	−0.512941554	9.346043162	100.9911559	9.23951E−24	4.97886E−22
Rpl9-ps6	0.349639434	9.841114929	100.3147377	1.30006E−23	6.95919E−22
Gpr171	0.366635846	9.722718651	100.3157828	1.29937E−23	6.95919E−22
Rpl9	0.128286541	11.84230049	100.2331707	1.35472E−23	7.22783E−22
Rpl27-ps3	0.364109983	9.836595897	100.0840856	1.46062E−23	7.76726E−22
Srsf5	0.266057713	10.09087953	99.90009247	1.60282E−23	8.49546E−22
Mki67	−0.465243552	9.203073676	99.69938332	1.77376E−23	9.37081E−22
Cisd3	−0.525536963	9.289876433	99.52839188	1.93371E−23	1.01825E−21
Arid5a	0.364870228	9.656742664	99.48865318	1.9729E−23	1.03552E−21
Fau	0.117665937	12.30167106	99.0301156	2.48691E−23	1.30108E−21
Nr4a3	0.496623394	9.253599057	98.98547036	2.54361E−23	1.32645E−21
Klf6	−0.463656693	9.896878744	98.88672106	2.67366E−23	1.38979E−21
Rpl23	0.143460142	11.70879327	98.81011908	2.77911E−23	1.43997E−21
Cdkn3	−0.295491219	9.177389757	98.76406715	2.84449E−23	1.46914E−21
Taf10	−0.439262723	9.515336126	98.5028028	3.24565E−23	1.67099E−21
Acp5	−0.483724271	9.39691276	98.31170727	3.57446E−23	1.83444E−21
Alyref	−0.512386856	9.471617456	98.26781953	3.65457E−23	1.86961E−21
Mtch1	−0.522764482	9.286913269	97.80966112	4.60595E−23	2.34889E−21
Malat1	0.220170852	14.6684552	97.38689353	5.70222E−23	2.89881E−21
Rps14	0.110659316	12.65498594	97.1959583	6.27947E−23	3.18225E−21
Tk1	−0.352993071	9.186456549	97.00099196	6.92926E−23	3.50058E−21
Rpl36a	0.183239744	11.04535005	96.7894076	7.71075E−23	3.88324E−21
Icos	0.315321976	10.25650888	96.68836511	8.11447E−23	4.07387E−21
Serf2	−0.187728813	10.7068503	96.04038582	1.12564E−22	5.63376E−21
Tnfsf11	0.557938441	9.547078237	95.67026522	1.35703E−22	6.77093E−21
Aprt	−0.395206011	9.637373978	95.66236935	1.36246E−22	6.77707E−21
Lamtor5	−0.44478946	9.410023241	95.65457018	1.36784E−22	6.78295E−21
Sec62	0.310396292	9.756891332	95.09887676	1.81109E−22	8.95356E−21
Glul	0.464844545	9.375643512	94.1625981	2.90641E−22	1.43247E−20
Hmgn2	−0.576602296	9.445404975	94.09059207	3.01408E−22	1.48102E−20
Grap2	0.454216031	9.308784996	94.05858529	3.06322E−22	1.50061E−20
Hspa5	0.244336232	10.97867799	94.03946443	3.09295E−22	1.51059E−20
Gm2a	−0.430040205	9.581841921	93.88699024	3.34063E−22	1.62664E−20
Izumo1r	−0.608712826	9.250980816	93.71023726	3.65267E−22	1.77324E−20
Adrb2	0.535741715	9.281420121	93.6761559	3.71611E−22	1.79864E−20
Traf1	0.282213829	10.10515014	92.36351394	7.21318E−22	3.48084E−20
Ptpn7	−0.519506241	9.307713029	92.22828093	7.72331E−22	3.71593E−20
Crbn	0.358418487	9.708112889	92.04198204	8.48571E−22	4.07062E−20
Calm3	−0.363800232	9.648589796	92.00946041	8.62631E−22	4.12583E−20
Snrpe	−0.308597904	9.827468486	91.71067545	1.00322E−21	4.7841E−20
Peli1	0.331773787	9.75612779	91.23737361	1.27431E−21	6.05895E−20
Cdkn2d	−0.507234255	9.369237934	91.08746139	1.3746E−21	6.51665E−20
1500009L16Rik	−0.548390626	9.247085147	91.06913756	1.38739E−21	6.55805E−20
Saraf	0.265182173	10.21648935	91.0409854	1.40727E−21	6.63262E−20
Me2	0.460112182	9.315619916	90.96509981	1.46229E−21	6.8719E−20
Tnfrsf9	0.580005635	9.402134791	90.77972333	1.60591E−21	7.52495E−20
Ccna2	−0.400426756	9.19384283	90.75730099	1.62421E−21	7.58871E−20
Mrpl42	−0.491601474	9.309100457	90.67135954	1.69631E−21	7.90275E−20
Socs1	0.473388021	9.398189402	89.78506933	2.6549E−21	1.23331E−19
Nusap1	−0.513197969	9.207259227	89.5987643	2.91706E−21	1.35121E−19
Atp5f1	−0.299068276	9.82227645	89.58192797	2.94199E−21	1.35886E−19
Dut	−0.525005434	9.370492812	89.35609919	3.29774E−21	1.51884E−19
Rpl22l1	−0.210893716	10.87576972	89.25595861	3.46896E−21	1.59316E−19
Oat	0.438985505	9.329297018	89.15554471	3.64959E−21	1.67137E−19
Wtap	−0.440428643	9.407943162	89.1100865	3.73442E−21	1.70539E−19
Arpc5l	−0.465637304	9.354510705	88.86346776	4.23024E−21	1.92637E−19
Reep5	−0.359793383	9.637232149	88.39947996	5.34849E−21	2.42875E−19
Rps18-ps3	0.402507463	9.485009861	88.29003132	5.65276E−21	2.55973E−19
Eif3f	−0.187506949	10.66456064	88.11582239	6.17319E−21	2.78759E−19
Anxa6	−0.329415877	9.7471733	87.93028771	6.78025E−21	3.05319E−19
Rpl36-ps3	0.382762365	9.494055337	87.66475526	7.75439E−21	3.48215E−19
Tob1	0.4322116	9.42000657	87.56689353	8.14771E−21	3.64864E−19
Eif1ax	−0.447944725	9.373714585	87.11118469	1.02589E−20	4.58135E−19
Itpkb	0.388213113	9.50956752	86.97951369	1.09651E−20	4.88325E−19
Rps11	−0.120222506	12.26312327	86.95742035	1.10883E−20	4.92454E−19
Ccr7	−0.827352902	9.273177568	86.88147711	1.15223E−20	5.1033E−19
Rps13	0.118476361	11.9252863	86.86801277	1.16011E−20	5.12412E−19
Sytl3	0.385802963	9.504493169	85.81774359	1.97308E−20	8.69122E−19
Hnrnpf	−0.218975824	10.40312097	85.6906052	2.1041E−20	9.24318E−19
Relb	0.381710195	9.473542129	85.55433278	2.25422E−20	9.8758E−19
Prdx1	−0.30210979	9.945243865	85.47656524	2.34464E−20	1.02442E−18
Hif1a	0.31517707	9.774227368	85.08751446	2.85447E−20	1.24381E−18
Cox5a	−0.258557899	10.08167074	84.9467374	3.06512E−20	1.33201E−18
Rasgrp2	−0.489347096	9.377108103	84.74049136	3.40211E−20	1.47449E−18
Tob2	0.453132367	9.437008471	84.68313645	3.50225E−20	1.51383E−18
Asf1b	−0.504596732	9.223323692	84.66123288	3.54126E−20	1.52661E−18
Id2	0.312337499	10.64556525	84.33429136	4.17805E−20	1.79634E−18

TABLE 3C
LPL-2 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Lgals1	1.107635326	11.62794788	1745.765645	0	0
Crip1	1.160964893	11.66677342	1329.701702	3.969E−291	3.2081E−287
S100a6	1.198020946	10.99644365	1210.536111	3.1298E−265	1.6865E−261
S100a10	0.711665053	10.94013071	1098.436026	7.2245E−241	2.9198E−237
Lgals3	1.396672722	10.20022841	1079.543841	9.2247E−237	2.9825E−233
S100a4	1.527217655	9.866777731	973.9490277	8.2582E−214	2.225E−210
Itgb1	1.751523134	9.299279016	928.1234969	7.5546E−204	1.7447E−200
Emp3	0.930153302	9.864694656	866.1214647	2.2739E−190	4.5949E−187
Actg1	0.557655647	12.09959146	800.9549005	3.3454E−176	6.0091E−173
Vim	0.882078214	10.4737473	792.3381022	2.4998E−174	4.0412E−171
Ifitm1	3.164079151	9.599747165	776.5403323	6.8031E−171	9.9982E−168
Rps27	−0.387759423	13.23483519	632.9819097	1.1228E−139	1.5125E−136
Rps29	−0.402671414	12.24470733	625.94336	3.8116E−138	4.7399E−135
Itgb7	0.728056874	9.956612648	623.3865772	1.3715E−137	1.5837E−134
Ms4a4b	0.643490527	10.75178795	622.8012833	1.8386E−137	1.9815E−134
Junb	−0.777993669	11.89087159	602.8382153	4.0408E−133	4.0827E−130
Pglyrp1	1.2119906	9.331208685	570.368253	4.6689E−126	4.4398E−123
Lsp1	0.607948171	10.3214748	559.4531755	1.1055E−123	9.9289E−121
Cd52	0.479542234	11.79358704	526.2289603	1.8679E−116	1.5893E−113
Klrd1	1.281868785	9.372635779	515.4102303	4.2181E−114	3.4095E−111
Got1	−1.246704373	9.855927617	502.3476321	2.9321E−111	2.2571E−108
Odc1	−0.999359158	10.45374948	480.1976985	1.9352E−106	1.422E−103
Nkg7	0.635156724	11.21006764	466.4812842	1.8684E−103	1.3133E−100
Cd48	0.801758485	9.721230863	465.5348676	3.0021E−103	2.0222E−100
Glipr2	0.840279767	9.484133594	428.4566632	3.52206E−95	2.2775E−92
Anxa1	1.198698478	9.278573422	424.2938572	2.83693E−94	1.76392E−91
Klf2	1.251446468	9.96061809	422.5102224	6.93538E−94	4.1525E−91
Pycard	0.821577501	9.577165063	416.4397023	1.45343E−92	8.3915E−90
Rps28	−0.384870366	11.70752993	413.5454065	6.19998E−92	3.45617E−89
AA467197	0.966906994	9.471388865	399.1453036	8.45263E−89	4.55484E−86
Ramp3	−1.423901616	9.937109715	376.5001514	7.19354E−84	3.75131E−81
Rps27rt	−0.541894598	11.16203814	374.50616	1.9547E−83	9.87488E−81
Fxyd5	0.374291229	10.88895574	373.588429	3.09665E−83	1.51698E−80
S1pr4	0.789331367	9.466032912	359.098318	4.4251E−80	2.10401E−77
Rgs1	−0.786014575	11.08978155	352.5170907	1.19954E−78	5.54048E−76
Bin2	0.674444277	9.612834003	332.5449837	2.68221E−74	1.20446E−71
Zyx	0.871870874	9.311172942	332.0349778	3.46394E−74	1.51346E−71
Anxa2	0.694314803	9.842643949	325.6200897	8.64484E−73	3.67769E−70
Tnfrsf4	−0.770960782	10.62243251	323.315614	2.746E−72	1.13825E−69
Ifitm2	0.899150526	10.68445772	319.4990272	1.86219E−71	7.52605E−69
Ctla4	−0.717492	10.15306486	313.1390335	4.52291E−70	1.78335E−67
Malat1	−0.429232236	14.66848179	310.0933732	2.08393E−69	8.02116E−67
Crem	−0.936462251	10.06717199	309.4765776	2.83955E−69	1.06754E−66
Ifitm3	1.07385109	9.717589617	305.0557418	2.60811E−68	9.58243E−66
Myl6	0.319639864	10.93131338	295.8728592	2.6119E−66	9.38311E−64
Gna15	0.723530518	9.413846926	293.4396749	8.85314E−66	3.1113E−63
Reep5	0.576970257	9.637214739	287.0003799	2.23954E−64	7.70305E−62
Rpl12	−0.361118726	10.9924655	286.9340944	2.31527E−64	7.79763E−62
S1pr1	0.88219731	9.290345556	285.4522276	4.86969E−64	1.6066E−61
Arhgdib	0.369730687	10.73181656	282.2713569	2.40234E−63	7.76726E−61
Rpl37a	−0.230463204	12.61563546	281.1880744	4.1371E−63	1.31138E−60
S100a13	0.477912226	9.89789302	277.2675542	2.95838E−62	9.19714E−60
Sh3bgrl3	0.316794291	11.24486223	275.9719088	5.66773E−62	1.72877E−59
Rpl36a	−0.336268091	11.04533644	275.3234377	7.84748E−62	2.3493E−59
Hspe1	−0.734968089	10.27537472	273.5809707	1.88136E−61	5.52982E−59
Cd47	0.409603749	10.23585118	273.0362546	2.47277E−61	7.13837E−59
Ly6c2	1.596385353	9.266014145	270.6111246	8.3506E−61	2.36835E−58
Rac2	0.302952162	11.09602966	268.3984579	2.53491E−60	7.0654E−58
Rps16	−0.212403538	12.35142328	267.4464731	4.08742E−60	1.11995E−57
Klrc1	0.869453849	9.658428758	264.6488216	1.66425E−59	4.48404E−57
Tspo	0.452765846	9.918102726	261.1004221	9.87762E−59	2.61773E−56
Ptma	−0.368146026	11.28837461	260.25122	1.51271E−58	3.94427E−56
Klrk1	0.967738565	9.564428224	260.2132923	1.54178E−58	3.95627E−56
Ubb	−0.340558743	12.90467053	253.8842203	3.69547E−57	9.33454E−55
Rps15a	−0.209512678	12.40382894	252.2257436	8.49603E−57	2.11303E−54
Selplg	0.412758765	10.21362445	248.0654969	6.85781E−56	1.67975E−53
Coro1a	0.365510663	10.77320156	247.1536687	1.08388E−55	2.61521E−53
Rasgrp2	0.746165592	9.377101403	245.1227903	3.00439E−55	7.1425E−53
Rplp2	−0.239346191	11.91018134	243.9392817	5.44245E−55	1.27511E−52
Ggt1	0.845090141	9.203353657	240.5208096	3.02793E−54	6.9928E−52
Ctsd	0.558572919	9.641720936	239.4727209	5.12479E−54	1.16687E−51
Hsp90ab1	−0.478995578	11.19701824	238.7640474	7.31478E−54	1.64237E−51
Prr13	0.385685076	10.23778924	236.1715783	2.68844E−53	5.9536E−51
Klhl6	0.724094678	9.316899465	233.3735902	1.09557E−52	2.39338E−50
Rps20	−0.30849135	11.06878098	226.7801872	3.00297E−51	6.4728E−49
Anxa6	0.477668152	9.747152467	226.6718002	3.17095E−51	6.74495E−49
Ms4a6b	0.431526867	10.19485172	224.1053813	1.15062E−50	2.4157E−48
Epsti1	0.481889636	9.946002487	222.8372549	2.17532E−50	4.50849E−48
Tnfsf11	−0.995325248	9.547066191	222.1985428	2.99803E−50	6.13496E−48
Ccl5	0.805026235	13.31088043	221.9811923	3.34383E−50	6.75704E−48
Vps37b	−0.498283973	10.60463013	221.6741013	3.90145E−50	7.78651E−48
Arl6ip5	0.446676163	9.776818831	218.2461026	2.18253E−49	4.30278E−47
Asb2	−0.823122831	9.480734994	211.5725771	6.23419E−48	1.21424E−45
Tagln2	0.425196214	10.29885571	211.0250542	8.20787E−48	1.57962E−45
Fth1	−0.300407416	11.58475892	209.3862439	1.8697E−47	3.55594E−45
Rplp1	−0.235120996	11.70338212	208.9022913	2.38428E−47	4.4819E−45
Prkca	−0.804901317	9.47273378	207.833874	4.07816E−47	7.57788E−45
Gadd45b	−0.794871222	9.727248868	207.396577	5.08014E−47	9.33244E−45
Dusp1	−0.761030155	9.939132795	205.1520683	1.56893E−46	2.84982E−44
Rps24	−0.211580124	12.0059312	198.8559219	3.71107E−45	6.6659E−43
Rpl29	0.231642848	11.21438856	194.4462645	3.40302E−44	6.04542E−42
Hsp90aa1	−0.610066784	10.76858556	190.5798156	2.37559E−43	4.17432E−41
Gzma	1.156987494	10.72602929	190.2449752	2.81098E−43	4.88628E−41
Socs3	−0.775105706	9.492203988	183.9508242	6.65037E−42	1.14372E−39
Gngt2	−0.76920447	9.363427733	183.8492044	6.99892E−42	1.19099E−39
Ahnak	0.497917205	9.6486335	183.5158121	8.27591E−42	1.39363E−39
Isg15	−0.919606683	9.495169961	182.7671755	1.20575E−41	2.00951E−39
Eif1	−0.215075871	11.85890479	181.8854963	1.87824E−41	3.09833E−39
Arpc1b	0.279591712	10.55364386	181.858684	1.90373E−41	3.10866E−39
Usmg5	−0.411662014	10.06859105	179.6012963	5.92208E−41	9.57363E−39
Arpc5	0.357914994	10.09992322	178.1056272	1.25618E−40	2.01063E−38
Pfn1	0.266033705	12.14558689	176.9357799	2.26201E−40	3.58507E−38
Rps27a	−0.185752928	11.80983865	173.8717911	1.0558E−39	1.6571E−37
Ncf4	0.616931601	9.322576992	173.4282403	1.31961E−39	2.05124E−37
Izumo1r	−0.833944275	9.250979762	173.23288	1.45583E−39	2.24143E−37
Ddx5	−0.273154117	11.19917209	171.9221905	2.8142E−39	4.29191E−37
Tob2	−0.749576508	9.437017288	170.2866433	6.40562E−39	9.67787E−37
Nrp1	0.475718816	9.166737051	169.9443495	7.60889E−39	1.13894E−36
Il21r	−0.505264995	10.19620078	168.9413091	1.26008E−38	1.86885E−36
Fosl2	−0.703183417	9.531613662	167.1288651	3.13532E−38	4.60778E−36
Cnbp	−0.336972315	10.25780833	165.3131087	7.8147E−38	1.13813E−35
Slc25a5	0.31094711	10.3940621	164.7439998	1.04048E−37	1.50182E−35
Cyba	0.29682531	10.43094576	164.7129212	1.05687E−37	1.51198E−35
Rgs2	−0.683188002	10.05998032	161.9432033	4.25694E−37	6.03664E−35
Abracl	0.369184781	9.935327557	160.800472	7.5641E−37	1.06332E−34
Fus	−0.414749315	9.899258939	159.1748408	1.71371E−36	2.38827E−34
Rps21	−0.275761051	10.92385795	157.8355226	3.36186E−36	4.64512E−34
Cnn2	0.399519194	9.90288659	157.5798679	3.82334E−36	5.23797E−34
Dgat1	−0.627039178	9.778835893	157.0134201	5.08414E−36	6.90674E−34
AB124611	0.538688322	9.180449702	156.1726476	7.7614E−36	1.04559E−33
Ctsw	0.407627769	9.94349627	154.5480574	1.75775E−35	2.34842E−33
Rom1	0.565412526	9.185573671	153.2571454	3.36569E−35	4.45982E−33
Wdr89	−0.438648459	10.42635108	151.6029863	7.73744E−35	1.01694E−32
Fos	−1.040226793	9.517179661	151.265106	9.1716E−35	1.19571E−32
1500009L16Rik	0.743494969	9.247062972	151.0129633	1.04125E−34	1.34663E−32
Rasa3	0.62108061	9.237628541	150.0581948	1.6836E−34	2.16009E−32
Serpinb6b	0.578341369	9.622263112	148.5069318	3.67553E−34	4.65689E−32
S100a11	0.301724985	10.60261496	148.500602	3.68725E−34	4.65689E−32
Dusp10	−0.723669213	9.475537805	148.3230479	4.03195E−34	5.05275E−32
Furin	−0.608670033	10.38118207	147.4418599	6.2826E−34	7.81265E−32
Rpl38	−0.196298052	11.67459296	147.2648676	6.868E−34	8.47542E−32
Lfng	0.600318631	9.38679975	146.3855751	1.06918E−33	1.30942E−31
Cdkn1a	−0.694573024	9.693100492	143.1294135	5.50726E−33	6.69401E−31
Flna	0.610624204	9.27107707	141.7573801	1.09883E−32	1.32565E−30
Ube2s	−0.407475264	10.00303894	140.9661991	1.63657E−32	1.95976E−30
Msn	0.333987136	9.894256294	140.9427275	1.65602E−32	1.96847E−30
Rps9	−0.160448533	11.99541117	140.6491255	1.91985E−32	2.26542E−30
Rps8	−0.188998621	11.59272654	140.2001816	2.40679E−32	2.81944E−30
Tuba1b	−0.648609572	9.730329249	139.675338	3.1348E−32	3.64584E−30
Hspa8	−0.295280678	12.33066824	139.3532611	3.68674E−32	4.25713E−30
Slc25a4	0.446208668	9.597123846	136.8862867	1.27692E−31	1.45371E−29
mt-Co1	0.180371584	12.21548846	136.8986462	1.269E−31	1.45371E−29
BC021614	0.604666583	9.270921447	135.1654782	3.03767E−31	3.43406E−29
Trib2	−0.68443991	9.363798856	134.4595166	4.3347E−31	4.86631E−29
Sdf4	−0.390564968	9.917420235	133.745527	6.21069E−31	6.92427E−29
Adgre5	0.508601548	9.38877853	132.9968145	9.0557E−31	1.0027E−28
Rpl23a	−0.155302608	12.17563324	132.7561574	1.02227E−30	1.11663E−28
Hsph1	−0.728156382	9.472375617	132.7619407	1.0193E−30	1.11663E−28
Saraf	−0.355176401	10.21648742	131.5242654	1.90136E−30	2.06291E−28
Arhgap31	−0.552171788	9.654221563	131.071069	2.38898E−30	2.57469E−28
Hspd1	−0.558182167	9.781137532	130.015877	4.06513E−30	4.35211E−28
Hmha1	0.381765719	9.750126154	129.5912318	5.03483E−30	5.35481E−28
Atp1b3	0.486515092	9.413034296	129.2689007	5.92258E−30	6.25781E−28
Cd27	−0.803947605	9.342803037	126.3516604	2.57551E−29	2.70362E−27
Tnfsf8	−0.737355758	10.01797843	126.0626608	2.97926E−29	3.10727E−27
Il22	−1.756753656	9.482889609	126.0406633	3.01247E−29	3.12177E−27
Ubald2	−0.351497132	10.62004401	124.5294437	6.45147E−29	6.64296E−27
Rpl36	−0.164380166	11.87412221	124.1971999	7.62739E−29	7.80407E−27
Ifi27l2a	−0.68890883	9.81720141	123.5990198	1.0311E−28	1.04835E−26
Rpl23a-ps3	−0.295698901	10.72022914	123.4369527	1.11886E−28	1.13046E−26
Gas7	0.571971199	9.194248976	121.9870221	2.32353E−28	2.33305E−26
Nccrp1	0.393930301	9.164828209	121.8725845	2.46149E−28	2.45633E−26
Gpx4	−0.351438364	10.07617554	121.6178872	2.79867E−28	2.77567E−26
Rps23	−0.138447821	12.48534445	121.4722896	3.01179E−28	2.96882E−26
Gramd3	0.418596938	10.20637838	121.4465525	3.05111E−28	2.98935E−26
Rps15	−0.172864084	11.49080729	120.486991	4.94903E−28	4.81964E−26
Gzmm	0.434802686	9.16991855	118.6914094	1.22358E−27	1.18446E−25
Icos	−0.390581255	10.25649242	118.6538485	1.24697E−27	1.19992E−25
Dnaja1	−0.411629472	10.76360037	118.4506794	1.38147E−27	1.32147E−25
Plp2	0.532759958	9.268337634	117.7246556	1.99209E−27	1.89436E−25
Cdc42	0.23089803	10.40482074	117.6820088	2.03538E−27	1.92421E−25
Tppp3	0.695346253	9.186033366	117.5848399	2.13758E−27	2.00908E−25
Tnfrsf1b	−0.53842263	9.452770816	117.4706506	2.26426E−27	2.11584E−25
Capn2	0.485018692	9.322203269	114.5742255	9.75458E−27	9.06279E−25
Eif3f	0.203096883	10.66455686	114.1050524	1.23585E−26	1.14164E−24
Lcp1	0.287302962	10.29112703	113.717244	1.5028E−26	1.38036E−24
Stat1	−0.513852248	9.580220981	113.5655779	1.62226E−26	1.48167E−24
Jun	−0.94325618	9.603506659	113.0395558	2.11513E−26	1.92096E−24
Tmsb4x	0.144182849	14.24924733	112.5416481	2.71893E−26	2.45554E−24
Clic1	0.268803753	10.32562522	112.5094932	2.76339E−26	2.48183E−24
Vasp	0.287636612	10.04115431	112.1944017	3.23938E−26	2.89325E−24
Sema4a	0.512251592	9.198626437	112.0481305	3.4874E−26	3.09766E−24
Btf3	0.187828928	10.71559571	111.2147299	5.30965E−26	4.69048E−24
Esyt1	0.475445557	9.338053167	110.1227206	9.21083E−26	8.09251E−24
Arpc3	−0.254844539	10.54018788	108.5503449	2.03612E−25	1.77924E−23
Hsd11b1	0.527808948	9.289647124	107.9739699	2.72331E−25	2.36694E−23
Rps25	−0.179054311	11.11875547	107.5235213	3.41824E−25	2.95505E−23
Areg	−1.179794443	9.38613304	107.4853962	3.48464E−25	2.99642E−23
Rap1b	0.265092354	10.1124176	107.3677512	3.69775E−25	3.16285E−23
Tpt1	−0.15517681	11.7834661	107.2473914	3.92927E−25	3.34319E−23
Actr3	0.261765133	10.23426606	107.0671408	4.3034E−25	3.64235E−23
Tox	−0.523743046	9.202083903	104.462925	1.60162E−24	1.34853E−22
Cd7	0.758734546	9.494093275	104.186839	1.84109E−24	1.54213E−22
Rpl23	−0.156527601	11.70875625	103.6246787	2.44512E−24	2.03752E−22
Supt4a	0.284417019	9.962767148	103.560841	2.52519E−24	2.09345E−22
Gm11808	−0.317351685	10.17411983	101.4055452	7.49537E−24	6.18215E−22
Rpl39	−0.154446809	11.7773745	101.3066649	7.87902E−24	6.4656E−22
Gna13	−0.357361906	9.985128145	100.8831794	9.75716E−24	7.96638E−22
Phf11b	0.486488786	9.311766492	100.510537	1.17769E−23	9.56709E−22
Eef1a1	−0.130787248	12.38191171	99.99485692	1.52793E−23	1.23503E−21
Hspa1a	−1.119432968	11.00098792	99.97583829	1.54268E−23	1.24074E−21
Ccnd3	0.409152136	9.527402171	99.62411953	1.84247E−23	1.47452E−21
Adam8	0.511454079	9.247167125	99.41606727	2.04655E−23	1.62978E−21
Fosb	−0.690931948	9.410758224	99.12867187	2.36618E−23	1.87508E−21
Prss16	0.453141756	9.187154617	99.03879299	2.47604E−23	1.95257E−21
Fut7	0.243038107	9.160603564	98.82820564	2.75384E−23	2.1611E−21
Capzb	0.252231093	10.1589729	98.61753077	3.06296E−23	2.39207E−21
2810001G20Rik	0.514611056	9.235596474	98.50063828	3.2492E−23	2.52532E−21
Tra2b	−0.360766994	9.814709276	98.41122462	3.39927E−23	2.62931E−21
Maf	−0.499169931	9.56864775	98.38318927	3.44774E−23	2.6541E−21
Dnajc15	0.302461752	9.893147259	98.27310767	3.64482E−23	2.79252E−21
Rpl9	−0.13362575	11.84228944	96.87312552	7.39152E−23	5.63638E−21
Dnajb1	−0.701565277	10.3172835	96.68446985	8.13045E−23	6.17074E−21
Sla	−0.448798408	9.546198944	96.60348318	8.46991E−23	6.39835E−21
Ptprcap	0.315090568	10.04014467	96.37240421	9.51847E−23	7.157E−21
Nr4a2	−0.567778459	9.521228879	96.12073243	1.08087E−22	8.08951E−21
Gm9843	−0.294369077	10.49166455	95.54204333	1.44784E−22	1.0786E−20
Laptm5	0.208711783	10.49799071	94.88345685	2.0193E−22	1.49743E−20
Snrpg	−0.264157695	10.10181353	94.14112586	2.93811E−22	2.16883E−20
Ass1	0.437532946	9.53437863	92.9075629	5.47947E−22	4.02642E−20
ler5l	−0.591031741	9.223274756	92.85145529	5.63704E−22	4.12345E−20
Birc5	−0.774093032	9.251668784	92.70648319	6.06546E−22	4.41685E−20
Rpl21	−0.141074021	11.76876712	92.34010486	7.29901E−22	5.29129E−20
Lmnb1	−0.395473345	9.781576618	92.00566036	8.64289E−22	6.23754E−20
Qrfp	0.327357379	9.165807799	91.69725749	1.01005E−21	7.25708E−20
Eno1	0.29946273	9.942452612	91.61301618	1.05397E−21	7.53918E−20
Ppp1ca	0.233359723	10.29808235	91.22780891	1.28048E−21	9.11905E−20
Gm10073	−0.394855462	9.699374848	90.63658937	1.72638E−21	1.22407E−19
Itpkb	−0.452002805	9.509585234	90.53161196	1.82045E−21	1.28513E−19
Tmem176a	−0.709693164	9.404482276	90.2402785	2.10924E−21	1.48252E−19
Mpnd	0.436149431	9.307880167	90.19537586	2.15766E−21	1.50999E−19
Rab8a	0.368294453	9.516531936	89.88306722	2.5266E−21	1.76056E−19
Mt1	0.685595236	9.253327294	89.15305586	3.65418E−21	2.53534E−19
Capg	0.383533992	9.809408711	88.6700908	4.66465E−21	3.2226E−19
Ikzf2	−0.697619136	9.29885187	88.40616184	5.33045E−21	3.6669E−19
Hrh4	0.220443917	9.160771464	88.04349384	6.40309E−21	4.38612E−19
Eif5	−0.335801311	9.823445443	87.78758948	7.28748E−21	4.97086E−19
Rpl41	−0.105943424	12.79526034	87.62321264	7.91898E−21	5.37892E−19
Degs1	0.387396398	9.418897111	87.48336602	8.49916E−21	5.74884E−19
Ccna2	−0.40044653	9.193824398	87.40535243	8.84109E−21	5.95521E−19
Il4ra	−0.451028003	9.499550436	86.23410607	1.59847E−20	1.07223E−18
Kcnab2	0.447184668	9.290281332	85.60058808	2.2021E−20	1.47104E−18
Cdkn2d	0.465467752	9.369239164	85.53454873	2.27688E−20	1.51474E−18
Rps12-ps3	−0.339355757	9.91463743	85.02653826	2.94387E−20	1.95044E−18
Dok2	0.39150937	9.437395362	84.64612001	3.56843E−20	2.35458E−18
Ecm1	−0.527046667	9.213869135	84.63123432	3.5954E−20	2.36273E−18
Srsf7	−0.369743626	9.589293129	84.41319337	4.0146E−20	2.62753E−18
Gnai2	0.258354443	10.17425826	84.02128898	4.89475E−20	3.19067E−18
Atp5l	0.187626855	10.47767657	82.95184884	8.40767E−20	5.45857E−18
2810474O19Rik	0.414915888	9.518034833	82.51633462	1.048E−19	6.77682E−18
Tmem176b	−0.636118826	9.448063427	82.22323647	1.21552E−19	7.82875E−18
Cenpa	−0.530464482	9.394708498	80.8065773	2.48928E−19	1.59689E−17
Rpl6l	−0.255942445	10.20631876	80.66181687	2.67848E−19	1.70474E−17
Rplp0	0.119720189	12.38788281	80.66592463	2.67292E−19	1.70474E−17
Srsf2	−0.318215702	9.857765406	80.54991993	2.83453E−19	1.79698E−17
Il1r2	−0.709588642	9.25672179	80.41166541	3.03995E−19	1.91968E−17
Cox4i1	0.165502192	10.68635697	79.34468754	5.21663E−19	3.2814E−17
Sp100	0.35419291	9.553598448	79.04472727	6.07196E−19	3.80462E−17
Coq10b	−0.402784111	9.509847044	78.97265199	6.29757E−19	3.93075E−17
Lcn4	0.452058809	9.193732712	78.58412421	7.6663E−19	4.76667E−17
Penk	−0.97476906	9.250330203	78.56769485	7.73033E−19	4.78807E−17
Rps17	−0.207724729	10.61521551	77.30519082	1.46481E−18	9.03819E−17
Npc2	0.258897774	9.848502166	77.27191156	1.4897E−18	9.15682E−17
Kpna1	−0.465763262	9.374034121	77.23584317	1.51715E−18	9.29025E−17
Klrc2	0.494282599	9.283377565	77.02917358	1.68451E−18	1.02762E−16
1810058124Rik	0.350718585	9.463204041	76.79034685	1.90105E−18	1.15535E−16
Tubb5	−0.402918211	10.00329454	76.77948586	1.91153E−18	1.15737E−16
Runx2	0.418744898	9.311867377	76.7116709	1.97831E−18	1.19333E−16
Hspa1b	−0.811543031	9.330502334	76.31282443	2.42106E−18	1.45498E−16
Pld3	0.396449863	9.363194614	76.05243089	2.76232E−18	1.65391E−16
2810417H13Rik	−1.011187289	9.337691412	75.408969	3.82648E−18	2.28261E−16
Hist1h1c	0.520548203	9.543347573	75.2055756	4.24168E−18	2.52099E−16
Abi3	−0.513763069	9.334628841	74.69953195	5.48091E−18	3.24558E−16
Maff	−0.542704954	9.305194699	74.66275934	5.58396E−18	3.29453E−16
Eprs	−0.467694903	9.384361092	74.62296026	5.69767E−18	3.3494E−16
Plec	0.418445279	9.207830137	74.5132662	6.02322E−18	3.52795E−16
Ctsa	0.36742707	9.447076929	74.12724047	7.32407E−18	4.2744E−16
Uba52	−0.247091632	10.23997211	73.81613397	8.57429E−18	4.98604E−16
Xist	−0.668090773	9.888840859	73.76865447	8.78303E−18	5.08912E−16
Stmn1	−0.902189526	9.430632462	73.4820959	1.01553E−17	5.86324E−16
Tmsb10	0.127806456	12.94248487	73.30106466	1.11308E−17	6.40357E−16
Rps13	−0.114822052	11.92527065	72.93365805	1.34082E−17	7.68641E−16
Hmgn1	−0.472844497	9.24964203	72.65748184	1.54221E−17	8.80968E−16
Top2a	−0.571920918	9.285394761	72.45227309	1.71121E−17	9.74063E−16
Spc24	−0.4090324	9.204180171	72.24512376	1.9006E−17	1.07807E−15
Ppp1r15a	−0.411070109	9.595245048	72.1100221	2.03527E−17	1.15043E−15
Eomes	−0.680093092	9.215483506	71.67702638	2.53467E−17	1.42771E−15
Swap70	0.410801492	9.194641096	71.595587	2.64147E−17	1.48271E−15
Itga4	0.403875994	9.394391702	71.57584864	2.66802E−17	1.49243E−15
Anp32e	−0.379405088	9.516990745	70.78954069	3.97439E−17	2.21551E−15
Arl2bp	0.321268348	9.473272776	70.77467715	4.00444E−17	2.2246E−15
Sike1	0.404053142	9.285336783	70.63030965	4.30847E−17	2.3853E−15
Myo1f	0.413029505	9.304626444	70.51398558	4.57015E−17	2.52154E−15
Fxyd4	0.216164291	9.161845803	70.34300404	4.98393E−17	2.74048E−15
Insig1	−0.468471973	9.373382406	70.3189397	5.0451E−17	2.76471E−15
Anxa5	0.335340423	9.456501432	70.29264776	5.11279E−17	2.79234E−15
Rps12	−0.189372327	10.77087646	69.76259892	6.68892E−17	3.64085E−15
Arpc2	0.155543095	10.79500611	69.53607194	7.50297E−17	4.07024E−15
Pnrc1	−0.22302859	10.57767668	69.46707965	7.77006E−17	4.20103E−15
Ppib	0.233842294	9.881020252	69.34980439	8.24608E−17	4.44354E−15
Gm9493	−0.228613016	10.33361801	69.2113078	8.84594E−17	4.75095E−15
Dpcd	0.422954441	9.248387156	69.18710349	8.95517E−17	4.79369E−15
Rpl24	0.115597877	11.77230384	69.10660292	9.32825E−17	4.97692E−15
Pkp3	0.322991067	9.70969078	69.06988323	9.50356E−17	5.05377E−15
Crip2	0.493033563	9.219720142	68.71993548	1.13488E−16	6.01523E−15
Rps6	−0.104903549	12.20844385	68.69896404	1.14701E−16	6.05967E−15
Cox5a	0.222688552	10.08163797	68.41076629	1.32751E−16	6.99039E−15
Kdm6b	−0.473433547	9.740181133	68.2056575	1.47303E−16	7.73147E−15
Rbm3	0.190550874	10.73115847	67.86636293	1.74961E−16	9.15344E−15
Rpl6	−0.112569061	11.76088309	67.73571974	1.86946E−16	9.74893E−15
Arpc4	0.248366607	9.810389381	67.10469229	2.57465E−16	1.33832E−14
Rpl13	−0.102585652	12.63773605	66.84961241	2.9303E−16	1.51346E−14
D8Ertd738e	−0.24018408	10.02747279	66.85109585	2.92809E−16	1.51346E−14
Hmgn2	−0.499593273	9.445371749	66.69834967	3.164E−16	1.62896E−14
Atox1	0.27625198	9.640004593	66.58567045	3.35013E−16	1.71931E−14
Eef2	0.127179582	11.29644286	66.52871607	3.44833E−16	1.76411E−14
Nr4a3	−0.449594613	9.253600396	66.40569813	3.6704E−16	1.87179E−14
H2afx	−0.484140494	9.351631242	66.38946902	3.70074E−16	1.88133E−14
Rcbtb2	−0.478710507	9.398952659	66.37266476	3.73242E−16	1.89149E−14
Il17a	−0.932121997	9.237217593	66.09431516	4.29854E−16	2.17157E−14
Tuba4a	−0.427821736	9.389392328	66.08179574	4.32593E−16	2.1786E−14
Fau	−0.101663836	12.30166869	65.56169951	5.63228E−16	2.82768E−14
Paxbp1	−0.443740412	9.251233688	65.53032342	5.72266E−16	2.85533E−14
Rpl5	−0.176646222	10.56771244	65.53343568	5.71363E−16	2.85533E−14
Rrm2	−0.60210116	9.247674435	65.35593265	6.25214E−16	3.10991E−14
Abcb1a	−0.448389508	9.300396921	65.34292109	6.29356E−16	3.12091E−14
Pim3	−0.482845753	9.328422325	65.07244979	7.21944E−16	3.5691E−14
Spef2	0.337654887	9.175320605	65.03415325	7.36111E−16	3.62804E−14
Car5b	0.345768026	9.17782806	64.90035524	7.87829E−16	3.87114E−14
Xrn2	0.37261421	9.343045417	64.8757557	7.97726E−16	3.90789E−14
Ech1	0.305307325	9.539590664	64.52484105	9.5323E−16	4.65556E−14
Rap1gap2	0.247182525	9.165395658	64.43601206	9.97188E−16	4.85558E−14
Tox2	−0.366384133	9.191330824	64.11910587	1.1712E−15	5.68578E−14
Tnfaip8l2	0.393193127	9.325796745	63.9932113	1.24849E−15	6.04283E−14
Nt5c	0.321207331	9.46177492	63.91994481	1.29579E−15	6.25306E−14
Rasgrp1	−0.390344872	9.487650699	63.86570537	1.33196E−15	6.40848E−14
Prelid1	0.277620155	9.693827343	63.70800001	1.44297E−15	6.92199E−14
Rpl13a	0.093506977	13.1315227	63.41756016	1.67221E−15	7.9979E−14
Cks1b	−0.54776796	9.261766706	63.35897481	1.72269E−15	8.21503E−14
Mmd	−0.493783446	9.302850291	63.28725567	1.78656E−15	8.49459E−14
Serpini1	0.297936677	9.172144254	63.1533642	1.91223E−15	9.06541E−14
Rps18-ps3	−0.383942395	9.484983983	63.13228605	1.9328E−15	9.13615E−14
Atp8b4	0.282378055	9.170105411	62.70317375	2.40328E−15	1.13269E−13
Chchd2	−0.185649555	10.44214805	62.67240577	2.44112E−15	1.14718E−13
Rpl22	−0.161149578	10.60718396	62.52082164	2.63643E−15	1.23538E−13
Madd	0.355724386	9.387289733	62.16934741	3.15155E−15	1.47249E−13
Spc25	−0.265138721	9.180366242	62.11597042	3.23815E−15	1.50858E−13
Apobec3	0.340744453	9.503283445	61.75805314	3.8836E−15	1.80409E−13
Nmrk1	−0.43682095	9.470654245	61.62438468	4.15639E−15	1.92528E−13
Ltb	0.299299727	10.15492701	61.50031252	4.42673E−15	2.04464E−13
Itgb2	0.302934438	9.575070658	61.4814308	4.46938E−15	2.05846E−13
Rgs19	0.371295223	9.28716881	61.40647112	4.64282E−15	2.13227E−13
Chchd10	−0.473427777	9.239735277	61.29318067	4.91781E−15	2.25216E−13
Arhgap15	0.327112956	9.436551627	60.90418079	5.99215E−15	2.73641E−13
5430427O19Rik	0.372356642	9.195518327	60.83083196	6.21962E−15	2.83229E−13
1110008F13Rik	0.315751896	9.430011424	60.72906256	6.5496E−15	2.97418E−13
Adora2a	−0.392567249	9.426697678	60.21879694	8.48778E−15	3.84351E−13
Cbx3	−0.405488348	9.517985802	60.17684028	8.67064E−15	3.91535E−13
Snx10	0.373362566	9.204288337	60.06212372	9.19101E−15	4.13877E−13
Ccr4	−0.421655714	9.227421818	59.72211968	1.09242E−14	4.90556E−13
Cxcl10	−0.664443182	9.358371286	59.64847266	1.13407E−14	5.07851E−13
Cfl1	0.149724783	11.11290366	59.32651689	1.33565E−14	5.96252E−13
Fam65b	0.396364559	9.256723776	59.32179213	1.33886E−14	5.96252E−13
Kxd1	0.3361848	9.397333347	59.2482617	1.38983E−14	6.17253E−13
Nusap1	−0.426549788	9.207238975	59.13228173	1.47421E−14	6.52933E−13
P2ry14	0.347177821	9.17900749	59.03492232	1.54898E−14	6.84177E−13
Oat	−0.395947403	9.329291217	58.93175541	1.63236E−14	7.19041E−13
Flt3l	0.35959273	9.333363234	58.9039048	1.65563E−14	7.27309E−13
Fmnl1	0.350065739	9.349669898	58.68899791	1.84671E−14	8.0905E−13
Morf412	−0.364938214	9.397534901	58.42868198	2.10795E−14	9.21005E−13
Slc25a24	0.377308788	9.218974536	58.36398837	2.17842E−14	9.49228E−13
Rpl14	−0.107475124	11.87708218	58.29747299	2.25333E−14	9.79231E−13
Faah	0.370597532	9.275976683	58.27112054	2.28372E−14	9.89775E−13
Cotl1	0.197250984	10.46134647	58.24188048	2.31792E−14	9.99238E−13
Tmem71	0.38204988	9.273813725	58.24380723	2.31565E−14	9.99238E−13
Plek	0.43842105	9.215818477	57.95124621	2.68695E−14	1.15525E−12
Fam110a	−0.37843848	9.494240477	57.91214141	2.7409E−14	1.17532E−12
Calm2	−0.204357886	10.41345274	57.66217283	3.11231E−14	1.33105E−12
Cdc20	−0.352635513	9.190015265	57.57131431	3.25945E−14	1.3903E−12
Rilpl2	0.353546322	9.398891472	57.47613338	3.42105E−14	1.45539E−12
Nucks1	−0.385021534	9.378610594	57.24063171	3.85622E−14	1.63621E−12
Traf4	−0.412707476	9.35979853	57.1752643	3.98654E−14	1.68708E−12
Myo1g	0.326411976	9.439455324	56.91402368	4.55288E−14	1.92172E−12
PISD	−0.424075103	9.326147814	56.80816092	4.80468E−14	2.02272E−12
Bbc3	0.390523027	9.210384865	56.78266578	4.86738E−14	2.04379E−12
Mki67	−0.367343453	9.203057109	56.75183508	4.94429E−14	2.07071E−12
1700025G04Rik	0.355444841	9.18123029	56.74235589	4.96818E−14	2.07534E−12
Phlda1	−0.491778784	9.440764624	56.55498898	5.46486E−14	2.27693E−12
Tmem160	0.265315817	9.59150512	56.52865987	5.53852E−14	2.30169E−12
Arf5	0.198635135	9.981768048	56.30803437	6.19617E−14	2.56839E−12
Trpv2	0.372377047	9.250925444	56.10050974	6.88593E−14	2.847E−12
Usp3	0.355354175	9.292631844	56.06888598	6.99758E−14	2.88579E−12
Pqlc3	0.362365955	9.234748342	56.01745486	7.18305E−14	2.95474E−12
Rpl9-ps6	−0.290907311	9.841070067	55.92224168	7.53948E−14	3.09348E−12
Gabpb1	−0.386813549	9.478096364	55.7462451	8.24556E−14	3.37463E−12
Rpl37	−0.100831831	12.07305382	55.51209471	9.28858E−14	3.7919E−12
Ptprc	0.203113685	10.11524395	55.28566724	1.04226E−13	4.24412E−12
Tmem234	0.252630089	9.671898221	55.08446668	1.1546E−13	4.68976E−12
Tesc	−0.34262081	9.483468613	55.07619352	1.15947E−13	4.69773E−12
Xcl1	−0.961147086	9.405065931	55.04662835	1.17704E−13	4.75701E−12
Lag3	−0.642931722	9.272156156	55.01140439	1.19832E−13	4.83095E−12
Uqcrfs1	0.229745717	9.714864078	54.99578919	1.20788E−13	4.85737E−12
Tktl1	0.186029244	9.161740461	54.91081279	1.26125E−13	5.0594E−12
Edf1	0.203844061	9.905022216	54.87068451	1.28727E−13	5.15099E−12
Cirbp	−0.263662128	9.821626437	54.83975146	1.30769E−13	5.21978E−12
Ska1	−0.153998658	9.167697937	54.81765797	1.32247E−13	5.26578E−12
Cdc42se1	0.329661747	9.377124053	54.67523687	1.42187E−13	5.64764E−12
Asf1b	−0.438345195	9.223299882	54.65077324	1.43968E−13	5.70437E−12
Hmgb1	−0.219889837	10.29714889	54.58969676	1.48512E−13	5.87005E−12
Hic1	−0.432264919	9.270363669	54.4810714	1.56952E−13	6.18852E−12
Sept11	0.356045397	9.343747121	54.27766493	1.74069E−13	6.84672E−12
Tprgl	0.251967719	9.655126678	54.16606559	1.84241E−13	7.22924E−12
Nfatc2	−0.402648226	9.26546375	54.15455217	1.85324E−13	7.25411E−12
Gyg	0.370089737	9.256694676	54.09174115	1.91344E−13	7.47165E−12
H2-K1	−0.13757215	11.61002041	53.98001915	2.02539E−13	7.88974E−12
Isy1	−0.370234123	9.388840432	53.94586091	2.06091E−13	8.0088E−12
Cenpe	−0.220150784	9.175332099	53.84735181	2.16687E−13	8.38029E−12
Fryl	−0.393078983	9.288378553	53.84761229	2.16658E−13	8.38029E−12
Tacc3	−0.302069013	9.190084756	53.74794908	2.27932E−13	8.79415E−12
Dusp4	−0.416920504	9.244696816	53.55668266	2.51238E−13	9.67028E−12
Tpm4	0.30198206	9.580032755	53.4530001	2.64854E−13	1.01701E−11
Ccdc12	0.24770037	9.642269047	53.43241053	2.67645E−13	1.02529E−11
Stk11	−0.342997764	9.400849509	53.3637069	2.77171E−13	1.05928E−11
Acp5	0.327797466	9.39691335	53.27003737	2.90707E−13	1.10839E−11
Serf2	0.134205382	10.706856	53.12999948	3.12188E−13	1.18749E−11
Nr3c1	−0.376848168	9.448729303	52.68065901	3.92437E−13	1.48923E−11
Cdca8	−0.387769623	9.207959893	52.53102797	4.23504E−13	1.60337E−11
Srrm2	−0.257041817	9.807993986	52.48496978	4.33554E−13	1.63758E−11
Prkcq	0.358224651	9.276198391	52.33872288	4.67073E−13	1.76007E−11
Ccl4	−1.176767063	9.567226392	52.26773318	4.84267E−13	1.82062E−11
Smc2	−0.437413231	9.240676881	52.25511877	4.87387E−13	1.8281E−11
Kcnn4	0.360084555	9.328517363	52.18835536	5.04243E−13	1.88694E−11
Icam1	0.396186315	9.404345015	51.59667848	6.81568E−13	2.54463E−11
Tpgs1	0.358707501	9.260754154	51.49756628	7.16859E−13	2.67022E−11
Lck	0.169753726	10.31649673	51.26743412	8.06017E−13	2.99542E−11
Riok1	−0.390179495	9.379968099	51.08907685	8.82681E−13	3.25786E−11
Mapkapk3	0.323418904	9.378101749	51.09610669	8.79526E−13	3.25786E−11
Dnajb2	−0.356805427	9.204584167	51.09030293	8.8213E−13	3.25786E−11
Rrm1	−0.36213335	9.219702428	51.03600203	9.06873E−13	3.33952E−11
Ckb	−0.422149772	9.335719986	50.72744307	1.06125E−12	3.89914E−11
Rpl13-ps3	−0.279124517	9.66187407	50.69891137	1.07679E−12	3.94726E−11
Lin54	−0.392624993	9.319364611	50.60318457	1.13061E−12	4.13518E−11
Aurkb	−0.208001106	9.176325027	50.50706228	1.18737E−12	4.33295E−11
Fam71b	0.31531926	9.185043177	50.47467455	1.20713E−12	4.39513E−11
Fam188a	0.352368275	9.234514724	50.44674626	1.22443E−12	4.44811E−11
Cyb5r4	0.316676256	9.336417497	50.28053448	1.33265E−12	4.8304E−11
Rnf138	0.269807224	9.608877256	50.16919159	1.41045E−12	5.10097E−11
H2-Q4	−0.265803125	9.753674988	50.11945341	1.44666E−12	5.22024E−11
Gpr171	0.266612793	9.722723261	50.08308592	1.47372E−12	5.30604E−11
mt-Nd1	−0.157466526	11.14928249	49.66729327	1.82157E−12	6.5439E−11
Arhgap30	0.318944329	9.36964608	49.49433071	1.98946E−12	7.13117E−11
Ranbp1	−0.295883166	9.626989183	49.47831386	2.00577E−12	7.17194E−11
Ube2d3	0.142474457	10.46165668	49.47446563	2.00971E−12	7.17194E−11
Gng2	0.272653394	9.504051907	49.4405448	2.04476E−12	7.28096E−11
Gm7676	0.177214754	9.1626667	49.12506242	2.40152E−12	8.53253E−11
Rps18	−0.093749751	12.47336152	49.06724846	2.47336E−12	8.76848E−11
Atp5c1	0.195509129	9.901795293	48.70713718	2.97183E−12	1.05126E−10
Rpl31	−0.139099182	10.87169602	48.69410038	2.99165E−12	1.05596E−10
Tnfaip3	−0.241621431	10.12478557	48.62414786	3.10028E−12	1.09192E−10
Mrpl52	−0.256915947	9.675785023	48.59779994	3.14222E−12	1.10428E−10
Csrnp1	−0.361872414	9.467384752	48.40889259	3.45996E−12	1.21331E−10
Nudc	−0.299772679	9.486198177	48.36831434	3.5323E−12	1.236E−10
Gdi2	−0.219013875	9.887687816	48.28408552	3.68733E−12	1.28468E−10
Hnrnpab	−0.306971441	9.483082447	48.28732967	3.68123E−12	1.28468E−10
H2afz	−0.227597078	10.76601923	48.17724714	3.8938E−12	1.3537E−10
Lef1	0.357453344	9.289398985	48.07662452	4.09884E−12	1.42193E−10
Sgip1	−0.382056564	9.193478703	47.83666323	4.63248E−12	1.60361E−10
Wnk1	−0.291417518	9.627909802	47.80634854	4.70466E−12	1.62512E−10
Aldoa	0.180711042	10.23632336	47.80033381	4.71912E−12	1.62664E−10
Dusp 14	−0.452661472	9.24162358	47.66873348	5.04677E−12	1.73587E−10
Rpl27-ps3	−0.279625551	9.836541137	47.62586986	5.15833E−12	1.77048E−10
Sema4d	0.313025469	9.35787998	47.5753698	5.29293E−12	1.81283E−10
Nfkbid	−0.465977677	9.347258824	47.55442849	5.34978E−12	1.82842E−10
Ccr7	−0.653811338	9.273164068	47.46702965	5.59369E−12	1.90775E−10
Napsa	0.299633138	9.173963637	47.45450146	5.62955E−12	1.91594E−10
Mt2	0.405205255	9.179003522	47.44257025	5.66392E−12	1.92359E−10
Impdh2	−0.328858199	9.377823225	47.41545958	5.7428E−12	1.94629E−10
Tpx2	−0.235310258	9.180975529	47.31848587	6.03405E−12	2.04072E−10
D930028M14Rik	0.221228249	9.165073917	47.30826359	6.0656E−12	2.04711E−10
Shcbp1	−0.186670641	9.173032321	47.12435823	6.66226E−12	2.24379E−10
Snx5	0.285118196	9.443629607	46.87702366	7.55837E−12	2.5403E−10
Rnf13	0.334006595	9.270089812	46.83603919	7.7181E−12	2.5886E−10
Zfp36l1	−0.354382619	9.536461336	46.67959216	8.3595E−12	2.79792E−10
Mad2l1	−0.336041583	9.208096533	46.66245921	8.43291E−12	2.81666E−10
Gm8369	0.245202324	9.924470839	46.62050658	8.61539E−12	2.87168E−10
Itgb1bp1	0.312257232	9.308749164	46.50417327	9.14235E−12	3.04106E−10
Npm3	0.254196025	9.590225344	46.44713082	9.41241E−12	3.11805E−10
Slamf7	0.355858539	9.281091881	46.4475631	9.41033E−12	3.11805E−10
Nop10	−0.247091186	9.680893727	46.36563341	9.81215E−12	3.24383E−10
IlZrb	0.250143282	9.646387369	46.35369914	9.8721E−12	3.25699E−10
St13	−0.295016503	9.483628577	46.29117192	1.01922E−11	3.35575E−10
Lamb3	0.352261752	9.282524225	46.10335197	1.12176E−11	3.68586E−10
4930503L19Rik	−0.366113571	9.217222488	46.0856953	1.13192E−11	3.71168E−10
Psmb3	0.188881553	9.906083726	46.05925169	1.1473E−11	3.75451E−10
Itm2c	−0.297908775	9.518082662	45.91218367	1.23674E−11	4.03903E−10
Dynll2	−0.337577901	9.353846602	45.64014248	1.42099E−11	4.63141E−10
Ppp3ca	0.310612578	9.326663671	45.56895099	1.47359E−11	4.79317E−10
Pdcd10	0.238398558	9.559474431	45.50441543	1.52295E−11	4.94378E−10
Hnrnpa1	−0.26197532	9.626210649	45.43016426	1.58179E−11	5.12451E−10
Cxcr6	0.246872073	10.38993842	45.24422742	1.73932E−11	5.62358E−10
Ckap2l	−0.110672662	9.164094745	45.23933167	1.74368E−11	5.62641E−10
Ndufa5	−0.282769786	9.479890673	44.84834027	2.12901E−11	6.8561E−10
Pbk	−0.121046883	9.166098176	44.70325909	2.29275E−11	7.36872E−10
Slc3a2	−0.220945351	10.08964541	44.59582917	2.42207E−11	7.76889E−10
Rbms1	0.285512041	9.408009945	44.5829661	2.43804E−11	7.80461E−10
Tbc1d10c	0.280613085	9.522585953	44.55291444	2.47575E−11	7.90967E−10
Tiparp	−0.383475799	9.253515787	44.52403539	2.51254E−11	8.01137E−10
Ablim1	0.286261251	9.407304211	44.49848449	2.54554E−11	8.10064E−10
Ccnb1	−0.246088895	9.183063921	44.26867125	2.86261E−11	9.09174E−10
Fyb	−0.19056904	10.08185682	44.23904901	2.90626E−11	9.21226E−10
Smco4	−0.348268101	9.324729592	44.19116783	2.97822E−11	9.4219E−10
Nhp2l1	−0.22781492	9.714965176	43.83830396	3.56656E−11	1.12611E−09
Ncl	−0.191524875	10.07286917	43.70541544	3.81714E−11	1.20288E−09
Cldnd1	−0.308788378	9.795081241	43.55524172	4.12159E−11	1.2963E−09
Marcksl1	−0.412529974	9.352502046	43.54726008	4.13843E−11	1.29907E−09
Hist1h2ap	−0.268260711	9.186664241	43.4233744	4.4089E−11	1.38128E−09
Avl9	−0.326052978	9.389562788	43.36184802	4.54973E−11	1.42265E−09
Itgav	−0.360644343	9.245488736	43.33825691	4.60492E−11	1.43712E−09
Hk2	−0.407653809	9.291524998	43.16055459	5.04271E−11	1.57072E−09
AW011738	−0.339602901	9.202092298	43.07369562	5.27163E−11	1.63887E−09
Ppp1cc	−0.199608403	10.14033253	42.81442413	6.01867E−11	1.86752E−09
Bpnt1	−0.336240301	9.20504925	42.69801734	6.3877E−11	1.97823E−09
Mvb12a	0.294858646	9.323824234	42.65192056	6.54002E−11	2.02153E−09
Eif3h	0.142723574	10.29701565	42.48500485	7.12262E−11	2.19741E−09
Psmb1	0.150510975	10.1666932	42.38821715	7.48396E−11	2.30449E−09
Acot7	0.241728025	9.577204572	42.3784288	7.5215E−11	2.31165E−09
Bak1	0.314497757	9.291916907	42.22934344	8.11729E−11	2.49002E−09
Grap	0.253931168	9.547624225	42.1727058	8.35581E−11	2.55833E−09
Tpst2	0.257626354	9.502673289	42.15008125	8.45304E−11	2.58321E−09
Nuf2	−0.124493218	9.166373674	42.01178275	9.07251E−11	2.76729E−09
Card19	0.31293595	9.298133437	42.00070748	9.12404E−11	2.77776E−09
Nop56	−0.297251616	9.449988788	41.996255	9.14484E−11	2.77886E−09
Pdlim1	0.34171296	9.286551213	41.96937305	9.27143E−11	2.81204E−09
St3gal4	0.317411314	9.222969771	41.85826443	9.81351E−11	2.97088E−09
Fcgrt	0.184065277	9.164513649	41.8039417	1.009E−10	3.04887E−09
Msrb1	0.314774706	9.280628983	41.77610517	1.02347E−10	3.08682E−09
Rasgrp4	−0.295228004	9.196046455	41.7685978	1.0274E−10	3.09292E−09
AI467606	0.324438402	9.267747664	41.73680495	1.04425E−10	3.13779E−09
Cdc37	0.203897376	9.718870186	41.71248815	1.05731E−10	3.17116E−09
Casc5	−0.148113275	9.168214058	41.66042957	1.08585E−10	3.2507E−09
Plk1	−0.149116992	9.169178309	41.61760036	1.1099E−10	3.31656E−09
Tspan13	−0.27748507	9.546665786	41.59956108	1.12018E−10	3.34112E−09
Lrrfip1	0.242872199	9.612103437	41.52173694	1.16568E−10	3.47041E−09
Phpt1	−0.340431832	9.254999299	41.51672903	1.16867E−10	3.47291E−09
Neurl3	−0.286535533	9.619611619	41.47993197	1.19087E−10	3.53241E−09
Samsn1	−0.284615787	9.795489494	41.41464949	1.23131E−10	3.64568E−09
Zfand2b	0.305793679	9.278292325	41.37076738	1.25927E−10	3.72162E−09
Myl12a	0.136720366	10.6785009	41.28722683	1.31425E−10	3.87703E−09
Abhd17c	−0.333647132	9.339492108	41.13540964	1.4204E−10	4.18254E−09
H1f0	0.390304588	9.42979381	41.10570101	1.44215E−10	4.23887E−09
Eif4e3	0.324534257	9.248327932	41.0449197	1.4877E−10	4.36474E−09
Glmp	0.274250566	9.373701727	41.04141669	1.49037E−10	4.36474E−09
Rps3a1	−0.090667436	11.67400244	40.92375183	1.58286E−10	4.62721E−09
Gm15518	0.228681393	9.168202192	40.85271619	1.64145E−10	4.78983E−09
Rpl15	−0.128287104	10.73595635	40.74537027	1.73414E−10	5.05118E−09
AI662270	0.246465493	9.519765054	40.71742886	1.75911E−10	5.11471E−09
Mettl23	0.24517514	9.492427646	40.62567419	1.84368E−10	5.35098E−09
Klhdc2	0.319366014	9.222186834	40.59634857	1.87156E−10	5.42216E−09
Mina	0.323015776	9.23713881	40.58692412	1.88061E−10	5.43863E−09
Tspan17	0.219617857	9.166558893	40.57116773	1.89584E−10	5.47287E−09
Mast4	−0.268505285	9.181693356	40.49239029	1.97383E−10	5.68788E−09
Nrros	0.326643367	9.212274046	40.45712311	2.00978E−10	5.78117E−09
Rpl35a	−0.091306405	11.72350894	40.31639133	2.15989E−10	6.16905E−09
Tecpr1	0.291847632	9.413080476	40.31802823	2.15808E−10	6.16905E−09
Tnfaip8	−0.272987616	9.630271166	40.31930658	2.15667E−10	6.16905E−09
Iqgap2	0.31845389	9.250835755	40.32196987	2.15373E−10	6.16905E−09
Nacc2	0.113924114	9.158821816	40.16272262	2.33665E−10	6.66212E−09
Sdc4	−0.319690858	9.184319545	40.14933305	2.35272E−10	6.69613E−09
Cox5b	0.173428491	10.04348938	40.0573221	2.46619E−10	7.00674E−09
Clec12a	0.347851947	9.187024502	39.98950738	2.55331E−10	7.24154E−09
Gadd45a	−0.316811725	9.199789132	39.9749406	2.57242E−10	7.28297E−09
Osbpl9	−0.347920433	9.306529663	39.95290108	2.60161E−10	7.35273E−09
Fabp5	−0.345368512	9.261083113	39.92194667	2.64317E−10	7.45714E−09
Skil	−0.300077713	9.558668519	39.91051627	2.65868E−10	7.48784E−09
Wdr95	0.256187953	9.168701519	39.61982647	3.08535E−10	8.6744E−09
Plac8	0.315422604	10.56912296	39.54916829	3.19903E−10	8.97838E−09
Gzmb	0.462504549	10.35039813	39.53373005	3.22442E−10	9.03395E−09
Uqcrh	0.128854127	10.54582243	39.49939278	3.28161E−10	9.1783E−09
Uqcrc2	0.243771762	9.469343526	39.41541302	3.42582E−10	9.56508E−09
Cdk1	−0.282404204	9.197337951	39.40808657	3.4387E−10	9.58449E−09
Gm10263	−0.356543926	9.257269073	39.30048844	3.6335E−10	1.011E−08
Jak2	−0.339854318	9.275558522	39.22581003	3.77517E−10	1.04861E−08
Tff1	−0.343877655	9.186730263	39.16799524	3.88863E−10	1.07828E−08
Lypla1	0.281543012	9.34948844	39.03404604	4.16479E−10	1.15288E−08
H2afv	−0.270944916	9.565009799	38.95620237	4.33421E−10	1.19772E−08
Cmtm7	0.271258758	9.51328408	38.81166005	4.66732E−10	1.28757E−08
Zdhhc20	0.287294355	9.3491135	38.69079567	4.96545E−10	1.36293E−08
Sla2	0.304926143	9.310517201	38.69603223	4.95215E−10	1.36293E−08
Kif4	−0.083959125	9.162292079	38.69067267	4.96576E−10	1.36293E−08
Ythdc1	−0.304345812	9.376355755	38.65093522	5.0679E−10	1.3886E−08
Nek2	−0.092225985	9.163012699	38.61679108	5.15733E−10	1.41072E−08
Rad51	−0.174396222	9.174504007	38.53074142	5.3898E−10	1.47182E−08
Serp2	0.23272394	9.169810674	38.36728567	5.86067E−10	1.5977E−08
Dstn	0.315401763	9.262001726	38.26911479	6.16304E−10	1.6773E−08
Stk17b	0.177968741	10.0837855	38.26279885	6.18302E−10	1.67991E−08
Rps7	−0.087706789	11.94320961	38.23534949	6.27061E−10	1.70085E−08
Rad51ap1	−0.140603093	9.168896905	38.1844517	6.43632E−10	1.74287E−08
1700097N02Rik	0.369642879	9.22738468	38.17693316	6.46117E−10	1.74668E−08
Gbp9	−0.314504429	9.2142636	38.1724911	6.4759E−10	1.74774E−08
Ppdpf	0.258511912	9.446285275	38.05634714	6.87308E−10	1.85184E−08
Klra3	0.226113548	9.163693648	38.03066405	6.96415E−10	1.87325E−08
Ipmk	−0.359137989	9.271383503	38.01288193	7.02791E−10	1.88726E−08
Ebi3	−0.24348842	9.178706953	37.89078919	7.48176E−10	2.00581E−08
Lig1	−0.326558724	9.221381095	37.80398986	7.82216E−10	2.09359E−08
Ndc80	−0.199325077	9.175316165	37.55760968	8.87525E−10	2.36761E−08
Cphx3	0.057112739	9.157760229	37.56039337	8.86259E−10	2.36761E−08
Fam64a	−0.106025888	9.164136557	37.51593717	9.06691E−10	2.41476E−08
Bcl2l1	−0.336680952	9.376460922	37.44850717	9.38585E−10	2.49149E−08
Stat4	−0.279257694	9.506546424	37.45009794	9.3782E−10	2.49149E−08

TABLE 3D
LPL−3 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Ccl5	−3.484093569	13.31083469	2049.126973	0	0
Nkg7	−2.068053995	11.21003636	2880.823851	0	0
Plac8	−2.112200427	10.56917796	1107.936846	6.221E−243	3.3523E−239
Tmem176a	1.889821585	9.404480898	1048.337873	5.5924E−230	2.2602E−226
Ifitm2	−2.051929407	10.68450167	928.579589	6.0127E−204	1.944E−200
Tmem176b	1.68947291	9.448057145	897.7209976	3.0708E−197	8.2737E−194
Gzmb	−2.848731127	10.35041419	861.179545	2.6985E−189	6.2321E−186
Gzma	−3.564634629	10.72609336	855.0832065	5.7078E−188	1.1534E−184
Lgals3	−1.660989425	10.20024122	735.8113412	4.8816E−162	8.7685E−159
Ctsw	−1.058583981	9.943492884	639.5495471	4.187E−141	6.7688E−138
Trib2	1.252838144	9.363791422	630.2041805	4.5125E−139	6.6317E−136
Fgl2	−1.622816533	9.496139008	629.1073924	7.8155E−139	1.0529E−135
Ccr5	−1.619827421	9.514363816	614.231888	1.3437E−135	1.671E−132
mt-Co3	0.389203125	12.09929332	564.6764741	8.0786E−125	9.3285E−122
Rgs1	−1.059866606	11.08976227	547.5976498	4.1937E−121	4.5197E−118
Rpl24	0.322646952	11.77231383	525.051429	3.3694E−116	3.4043E−113
Ifitm3	−1.878179626	9.717619666	520.6260984	3.0926E−115	2.9409E−112
Rps27a	0.315480197	11.80985986	518.9505848	7.1591E−115	6.4296E−112
Rpl35	0.438027821	11.18862718	511.4426173	3.0785E−113	2.6193E−110
mt-Atp6	0.346407175	12.47118005	484.3733011	2.3885E−107	1.9307E−104
Il17re	1.006347022	9.176312021	478.786329	3.925E−106	3.0215E−103
Emb	0.723801071	10.25108396	461.5739746	2.1846E−102	1.6053E−99
Rps3a1	0.298969367	11.67402431	449.1348284	1.1128E−99	7.82125E−97
AW112010	−0.654555404	11.38311024	444.3256362	1.23889E−98	8.34493E−96
mt-Co1	0.333063388	12.21547389	441.1231167	6.16614E−98	3.98727E−95
Rps7	0.296343917	11.94322764	440.2941583	9.3417E−98	5.80838E−95
Tcf7	0.970709967	9.419632902	430.9726984	9.98116E−96	5.97613E−93
Serpinb1a	1.594483756	9.512634337	428.3674149	3.68317E−95	2.1265E−92
Rplp0	0.280821674	12.38790648	420.5795835	1.82513E−93	1.01741E−90
Rps19	0.311069961	12.57927057	409.2190817	5.42142E−91	2.92142E−88
Rpl31	0.392600539	10.8717304	403.7205395	8.53158E−90	4.44908E−87
Fasl	−1.073589983	9.594179124	401.7278324	2.31638E−89	1.1702E−86
Ifng	−1.773900792	9.68657816	393.9867729	1.12192E−87	5.49606E−85
mt-Nd1	0.433097056	11.1492421	392.3866971	2.50204E−87	1.18965E−84
Tnfrsf25	1.035091499	9.258890182	381.807873	5.02761E−85	2.32218E−82
Rps29	0.309768839	12.24471351	380.2129007	1.11843E−84	5.02238E−82
Satb1	0.803900794	9.757124872	378.0954162	3.23312E−84	1.41261E−81
Slamf6	1.078369968	9.319064798	371.7261222	7.8771E−83	3.35108E−80
Rpl4	0.268392668	11.68907178	368.4591631	4.05214E−82	1.67966E−79
1110034G24Rik	1.031636667	9.229074688	368.1006541	4.85002E−82	1.96014E−79
Rpl10	0.330381836	11.48679578	365.7282838	1.59329E−81	6.28221E−79
Klrk1	−1.466071219	9.564416625	363.1277724	5.86852E−81	2.25882E−78
Rps8	0.298612024	11.59275565	354.4180219	4.62455E−79	1.73862E−76
Rps18	0.253195601	12.47336872	353.1207929	8.8624E−79	3.25613E−76
Rpl11	0.254557202	11.70912388	351.9326937	1.60795E−78	5.77646E−76
Ramp3	1.163483877	9.937171094	350.6122351	3.11758E−78	1.09562E−75
Litaf	−1.200479411	9.445010559	345.721109	3.62197E−77	1.2458E−74
Rpl6	0.253049825	11.76090091	341.3669788	3.21491E−76	1.08275E−73
Rpl32	0.241752504	12.44743739	338.9149259	1.09947E−75	3.56635E−73
Hspa8	−0.492721587	12.33067832	338.9084539	1.10304E−75	3.56635E−73
Rpl18	0.257294066	11.80695531	335.2274387	6.98668E−75	2.21464E−72
Rpl17	0.235452932	12.29667899	334.8509986	8.43833E−75	2.62335E−72
Rps11	0.243194098	12.26312142	333.0602877	2.07139E−74	6.31813E−72
Ccl4	−2.829589103	9.567161703	332.3003568	3.0323E−74	9.0778E−72
Dnajb1	−1.447456963	10.31718294	330.6483343	6.94352E−74	2.04089E−71
Nebl	0.947797864	9.313896931	326.9696736	4.39345E−73	1.26829E−70
mt-Co2	0.314373224	11.38674425	320.6458124	1.04768E−71	2.97138E−69
Gzmk	−1.551161338	9.363616364	319.3540035	2.00269E−71	5.58198E−69
Ctla2a	−0.96000106	10.33574783	318.1231264	3.71303E−71	1.01737E−68
mt-Nd4	0.424844629	10.50325528	313.2764014	4.22177E−70	1.13749E−67
AA467197	−1.116233892	9.471396917	303.1631618	6.73964E−68	1.78612E−65
Ccr6	0.698205543	9.169603333	297.721111	1.03341E−66	2.69452E−64
mt-Cytb	0.368527173	11.07880159	295.4669217	3.20185E−66	8.21605E−64
Tox2	0.915454575	9.191330653	295.0827827	3.88237E−66	9.80661E−64
Sh3bgrl3	−0.377804436	11.24487265	294.6544492	4.81306E−66	1.19705E−63
Rpl13a	0.205282595	13.13152313	285.2357853	5.42831E−64	1.32961E−61
Klrd1	−1.254419995	9.372630202	281.7142906	3.17707E−63	7.66574E−61
Naca	0.316236433	10.80148809	280.0481025	7.33017E−63	1.74264E−60
Rps14	0.200329253	12.65498588	275.9777944	5.65102E−62	1.32398E−59
Cdkn1a	−1.052199877	9.693085153	274.133611	1.42571E−61	3.29258E−59
Rpl13	0.20968469	12.63773823	272.0638942	4.02809E−61	9.17155E−59
Rpl21	0.243080459	11.76877603	271.3049896	5.89515E−61	1.32363E−58
Epsti1	−0.650432645	9.945996659	268.5614751	2.33578E−60	5.17264E−58
Rpl8	0.242856061	11.65231323	268.265358	2.71001E−60	5.92028E−58
Rps9	0.221652232	11.99541867	264.7442415	1.58643E−59	3.41949E−57
Nav2	0.696878506	9.1720222	262.7499097	4.31632E−59	9.18126E−57
Rpl26	0.240002472	11.57434921	260.0823989	1.64648E−58	3.45674E−56
Ms4a4b	−0.505784178	10.7517777	255.3500466	1.77064E−57	3.66976E−55
Rpl35a	0.231823918	11.72352561	254.4117161	2.83582E−57	5.80302E−55
KIf2	1.050914377	9.96058395	253.5496162	4.37132E−57	8.83335E−55
Dnaja1	−0.649029266	10.76357472	252.0606719	9.23E−57	1.84213E−54
Dapk2	−0.98929305	9.267215042	251.000474	1.57155E−56	3.09826E−54
Rps6	0.203360892	12.20845582	250.6981996	1.82905E−56	3.56247E−54
Ccnd2	−0.72559072	9.824522402	248.9497462	4.39953E−56	8.467E−54
Rpl15	0.315788404	10.73598071	247.5305633	8.97036E−56	1.70606E−53
Rps28	0.291807857	11.70754918	244.5326764	4.04034E−55	7.59489E−53
Ccr2	−0.829690745	9.897671261	243.2619236	7.64681E−55	1.4209E−52
Il12rb2	−0.988980941	9.345961023	240.1135399	3.71491E−54	6.82447E−52
Tnfsf8	0.919482593	10.01800267	236.6741879	2.08882E−53	3.79415E−51
1700003C15Rik	0.760033251	9.171905958	236.1461485	2.72298E−53	4.89108E−51
Rpl34	0.203480775	11.98010645	235.5343091	3.70223E−53	6.57694E−51
Il1r1	0.593316052	9.16767934	234.6804095	5.68417E−53	9.98807E−51
Zfp3611	0.736388217	9.5364341	234.5048916	6.20785E−53	1.0791E−50
Amica1	−1.075213054	9.335190274	234.4351252	6.42917E−53	1.10568E−50
Id2	−0.621714646	10.64556657	232.0313476	2.14955E−52	3.65786E−50
Serpina3g	−0.944522464	9.674077113	230.2129487	5.35676E−52	9.02056E−50
Pim1	−0.589343531	10.82520099	229.9043517	6.25463E−52	1.0424E−49
Rps4x	0.212878973	11.84808117	229.3253412	8.36518E−52	1.37991E−49
Rpl10a	0.271453577	11.14239123	227.5823075	2.0073E−51	3.27778E−49
Rplp1	0.244800173	11.70340699	226.3395342	3.74676E−51	6.05702E−49
Rps25	0.258258722	11.11877073	223.8649551	1.29829E−50	2.07803E−48
Rps20	0.300464014	11.06882543	221.3182323	4.66495E−50	7.39349E−48
H2-D1	−0.231313769	12.28194321	220.6330101	6.58126E−50	1.03294E−47
Sgip1	0.972538832	9.193478982	220.2322415	8.0487E−50	1.25111E−47
Bhlhe40	−0.446071264	10.72333649	218.3308818	2.09154E−49	3.22018E−47
Hspa1a	−1.839599971	11.00088949	218.2514974	2.17662E−49	3.31956E−47
Lysmd2	0.793775935	9.24333495	213.2812689	2.64248E−48	3.99237E−46
Rpl18a	0.178127329	12.84271416	213.0268771	3.00268E−48	4.49457E−46
1700012B07Rik	0.635632788	9.170176807	211.5320497	6.36241E−48	9.43621E−46
Znrf1	0.677706008	9.400584211	210.8496366	8.96398E−48	1.31738E−45
Rps5	0.196579458	12.08892933	208.586472	2.79423E−47	4.06951E−45
Rpl14	0.206279565	11.87709072	208.0441994	3.66923E−47	5.29615E−45
Rps23	0.183689361	12.48535349	207.3464825	5.20961E−47	7.45297E−45
Serpinb9	−0.869185379	9.8583095	205.8671083	1.09544E−46	1.55341E−44
Rps27	0.222000489	13.23482494	204.3505846	2.34686E−46	3.29907E−44
Cmtm7	−0.738958546	9.513298908	203.6105545	3.40379E−46	4.74359E−44
Pde5a	0.594157393	9.168289214	203.3978824	3.78764E−46	5.23341E−44
Ubb	−0.320988013	12.90465858	202.2363742	6.78919E−46	9.3012E−44
Smco4	0.707891435	9.324733933	202.1246558	7.18119E−46	9.75556E−44
Hilpda	−0.79271988	9.667584429	195.5064907	1.99743E−44	2.69087E−42
Gadd45b	−0.824371717	9.727231622	195.3857517	2.12237E−44	2.83556E−42
Rcbtb2	−0.897551208	9.398945286	194.1830275	3.88434E−44	5.14707E−42
Slamf7	−0.863101363	9.281089293	193.3260324	5.97533E−44	7.85344E−42
Anxa2	−0.662567838	9.842688336	192.9337152	7.27762E−44	9.48791E−42
Rpl19	0.175722974	12.1175247	192.3267078	9.87363E−44	1.27694E−41
Rpl22l1	0.315937439	10.87576896	192.041405	1.13959E−43	1.46211E−41
Tuba1b	−0.817728304	9.730396626	189.0237562	5.1931E−43	6.61037E−41
Ifitm1	−2.386356518	9.599763038	188.2845877	7.52969E−43	9.50977E−41
Icos	0.472569335	10.25650654	188.1996714	7.85803E−43	9.84751E−41
Rora	0.507992709	9.982330628	187.9097328	9.09084E−43	1.13048E−40
Rps24	0.205699287	12.0059475	184.8181341	4.30032E−42	5.30679E−40
Smim3	−0.828729834	9.350028927	184.7835494	4.37574E−42	5.35895E−40
Klrc1	−0.911521288	9.658426162	183.5897616	7.97391E−42	9.6922E−40
Il1r2	1.118729196	9.256730933	183.3064645	9.19434E−42	1.10922E−39
Xcl1	−1.732920533	9.405068169	182.9886277	1.07872E−41	1.29175E−39
Il22	1.870572455	9.482887799	182.8520365	1.1554E−41	1.37339E−39
Plek	−0.751460525	9.215817596	182.2332023	1.57702E−41	1.86089E−39
Rps2	0.235163135	11.63594659	180.5370278	3.6997E−41	4.33401E−39
Fosb	−1.0044227	9.410738732	179.1890367	7.28599E−41	8.47377E−39
Lilr4b	−0.647414806	9.778128629	177.1360399	2.04534E−40	2.36179E−38
Rpl12	0.278475812	10.9924871	176.0772239	3.48315E−40	3.99352E−38
Rassf3	0.683581715	9.199068087	176.0013684	3.61857E−40	4.11956E−38
Rps16	0.174627684	12.35142977	175.5750544	4.48364E−40	5.06871E−38
Cldnd1	−0.684362495	9.795115659	175.4406393	4.79715E−40	5.38546E−38
Ctsd	−0.594814309	9.64172066	172.9552202	1.67397E−39	1.86631E−37
Rpl23	0.203421469	11.70878799	170.7965908	4.95662E−39	5.48827E−37
Rgs10	0.539364334	9.631678923	169.9400775	7.62525E−39	8.3857E−37
S1pr1	0.756906257	9.290346876	168.9861794	1.23197E−38	1.34567E−36
Dusp5	−0.50010877	9.994364417	168.5445148	1.53839E−38	1.6691E−36
Sptssa	0.530775409	9.597728351	168.3290064	1.7145E−38	1.84778E−36
Lsp1	0.371113465	10.32147684	167.8015721	2.23534E−38	2.39314E−36
Tmsb4x	−0.190326855	14.24925577	166.3632964	4.60795E−38	4.9008E−36
Icam1	−0.836752343	9.404341293	166.161961	5.09903E−38	5.38764E−36
Rps26	0.255375413	10.99418168	166.0950448	5.27357E−38	5.53588E−36
Socs2	−0.893608998	9.351698274	165.9933737	5.55026E−38	5.78874E−36
Rpa2	−0.768064662	9.392655105	164.4327646	1.21681E−37	1.26096E−35
Rps3	0.163431739	11.96715944	163.6126366	1.83816E−37	1.89272E−35
Rpl41	0.148484636	12.79527095	163.2689082	2.18512E−37	2.23574E−35
Tspan13	0.526355965	9.546671007	162.7547983	2.83002E−37	2.87736E−35
Cd69	−0.700203337	9.886218478	161.6594313	4.91014E−37	4.96108E−35
Odc1	0.530928101	10.453789	160.6935792	7.982E−37	8.01472E−35
Bcl2l1	−0.778019491	9.376464206	159.4570551	1.48688E−36	1.48376E−34
Mrps5	0.67574663	9.263071627	158.1039542	2.93715E−36	2.91301E−34
Hey1	0.339150364	9.161115987	157.942378	3.1859E−36	3.14044E−34
Glrx	−0.646284655	9.565877632	157.1553176	4.73381E−36	4.63799E−34
Abi3	−0.803877473	9.334617896	156.9668392	5.2047E−36	5.06863E−34
H2afy	−0.435862619	9.9300789	156.0855564	8.10908E−36	7.84978E−34
Samsn1	−0.607961392	9.795508071	156.0048309	8.44524E−36	8.12653E−34
Rps15	0.19771985	11.49082426	154.2349025	2.05775E−35	1.96838E−33
Rpl29	0.219501544	11.21441306	152.8746442	4.08009E−35	3.87992E−33
Gmfg	0.332354389	10.21757862	152.1259771	5.94693E−35	5.62211E−33
Limd2	0.389855996	10.089006	150.8366734	1.13785E−34	1.06945E−32
Rpl23a	0.168220353	12.17564707	150.4212869	1.40242E−34	1.31049E−32
Rpl28	0.263182468	10.72582102	149.6866768	2.02976E−34	1.88581E−32
Lilrb4a	−0.653757891	9.646924972	148.6586133	3.40536E−34	3.14578E−32
Ftl1	0.286104977	10.82038569	148.5083679	3.67287E−34	3.37361E−32
Cd3g	−0.263497128	11.10927275	148.2266944	4.23231E−34	3.86551E−32
Arhgap31	0.539802079	9.654196025	146.6272891	9.46691E−34	8.59787E−32
Serpinb6b	−0.694956176	9.622268614	145.5103981	1.66103E−33	1.50012E−31
Tbx21	−0.741006971	9.277656746	144.9687718	2.18167E−33	1.95938E−31
Tmem64	0.7402499	9.248102293	143.79394	3.94133E−33	3.5202E−31
Gnb2l1	0.257536167	10.54032337	143.4136363	4.77301E−33	4.23959E−31
Tm6sf1	−0.614151136	9.205991409	141.0728903	1.55097E−32	1.37011E−30
Gpr171	−0.527919467	9.722719309	140.898755	1.69309E−32	1.48753E−30
Ass1	0.557775131	9.534395587	140.432394	2.14121E−32	1.87107E−30
Hsp90aa1	−0.551436005	10.7686095	140.4135022	2.16168E−32	1.8788E−30
Nsg2	0.457632765	9.167222657	139.9230257	2.76724E−32	2.39225E−30
Rpl22	0.24172144	10.60720364	139.3472402	3.69794E−32	3.17983E−30
Krtcap2	−0.356333163	10.06414216	139.1868613	4.00896E−32	3.42904E−30
Stk24	0.468770685	9.608428218	138.9674266	4.47733E−32	3.79489E−30
Rgcc	−0.900503044	9.563503156	138.9646335	4.48364E−32	3.79489E−30
Gpr34	−0.757646242	9.25651743	138.0295522	7.18003E−32	6.04544E−30
St6galnac1	0.564245409	9.173614926	137.6712982	8.59957E−32	7.20314E−30
Pkp4	0.568152144	9.180314385	136.6038442	1.4721E−31	1.2267E−29
Slpi	0.486549059	9.166637373	135.5644851	2.48466E−31	2.05985E−29
Cxcr3	0.531979192	9.551340066	134.7179405	3.80568E−31	3.13891E−29
Lmna	−0.825151176	9.713615726	133.8629815	5.85392E−31	4.80378E−29
Rpl7	0.189257523	11.21210542	133.217726	8.10208E−31	6.61506E−29
2810417H13Rik	−1.285204722	9.337765738	132.6784218	1.0631E−30	8.63619E−29
S100a4	0.670964086	9.866831921	132.345813	1.257E−30	1.01603E−28
Ifi27l2a	0.667189776	9.81722567	132.2788965	1.30009E−30	1.04564E−28
Tubb5	−0.571247104	10.00333821	131.589452	1.83994E−30	1.4725E−28
Birc5	−0.886968249	9.251705243	131.3715948	2.05336E−30	1.6352E−28
Txn1	−0.38477823	10.00228125	130.9094939	2.59157E−30	2.04367E−28
Dtx1	0.710488782	9.250196625	130.9121903	2.58805E−30	2.04367E−28
Mast4	0.551969332	9.181692037	129.6748765	4.82707E−30	3.78808E−28
Cd38	−0.722178037	9.272404605	129.2849214	5.87497E−30	4.58815E−28
Iltifb	0.466521316	9.164994613	128.6602113	8.04814E−30	6.25511E−28
Plcb4	0.396482666	9.163609867	128.5931213	8.32484E−30	6.4392E−28
Eef1a1	0.151323644	12.38193961	127.3339193	1.57005E−29	1.20864E−27
Gbp2	−0.762105085	9.365780295	126.7822278	2.07319E−29	1.5884E−27
Rpl3	0.150394133	12.09257424	126.6318569	2.23638E−29	1.70535E−27
Ccr7	1.097629633	9.273175644	125.9374899	3.17323E−29	2.40838E−27
Nr4a2	−0.69869436	9.521215332	125.4110146	4.13733E−29	3.12542E−27
Rplp2	0.17351654	11.91020443	124.8852816	5.39237E−29	4.05456E−27
Rps10	0.188460525	11.22201226	123.7513581	9.549E−29	7.14672E−27
Eif3f	0.224777999	10.6645601	123.6885264	9.85622E−29	7.34265E−27
Klrg1	−0.619319207	9.202815326	123.5187912	1.07365E−28	7.96173E−27
Ppia	−0.201559198	11.56548656	122.9632193	1.42058E−28	1.04863E−26
mt-Nd2	0.348333644	9.930964526	122.1357147	2.15576E−28	1.58409E−26
Cxcr6	−0.460498452	10.38993977	122.1090465	2.18493E−28	1.59826E−26
Stmn1	−1.215251954	9.430719181	120.6930632	4.46074E−28	3.2483E−26
Hspa1b	−1.061056122	9.330476915	120.3110025	5.40813E−28	3.92053E−26
Plscr1	−0.642118473	9.521580006	119.2788005	9.09973E−28	6.56724E−26
Ccnd3	−0.536704025	9.527398394	118.8178614	1.14801E−27	8.24835E−26
Izumo1r	0.73550348	9.250980666	118.2124259	1.55778E−27	1.1143E−25
Cdk5r1	0.576455527	9.178698472	117.6513688	2.06707E−27	1.47208E−25
Eef1b2	0.295763405	10.0755718	117.2418803	2.54109E−27	1.80172E−25
Camk2n1	−0.685364499	9.340459445	117.1854268	2.61445E−27	1.84564E−25
Nfkbia	−0.443575026	10.83336515	117.0602753	2.78475E−27	1.95731E−25
2010111l01Rik	−0.58976034	9.402743483	116.5749773	3.55676E−27	2.48911E−25
Rps17	0.255513344	10.61526354	115.2722497	6.86021E−27	4.77841E−25
Mxd1	−0.561117916	9.600457879	115.2644894	6.88711E−27	4.77841E−25
Gngt2	−0.645521342	9.363421412	114.291152	1.12514E−26	7.73998E−25
Eif3e	0.276298263	10.13949795	114.293671	1.12371E−26	7.73998E−25
Rpl9	0.148253371	11.84229891	113.9941505	1.30693E−26	8.9525E−25
Ccr4	0.593390397	9.227425335	113.5628703	1.62448E−26	1.10807E−24
Txk	0.567145719	9.335340173	113.2795033	1.87405E−26	1.27293E−24
Aqp3	0.501331766	9.177291322	112.4084827	2.90782E−26	1.96685E−24
S100a11	−0.300484266	10.60261953	112.3500062	2.99486E−26	2.01729E−24
Pecam1	0.57408471	9.257221083	111.8795665	3.79688E−26	2.5469E−24
Avpi1	0.587850586	9.200072787	111.4995665	4.59906E−26	3.07225E−24
Ly6c2	−1.077631275	9.266017563	111.3836024	4.8761E−26	3.24391E−24
Rpl36a	0.210891627	11.04534811	109.1644599	1.49364E−25	9.896E−24
Tnfrsf26	0.569766024	9.206961652	107.6619109	3.1877E−25	2.10336E−23
Rbpj	−0.56851782	9.385158504	107.1608345	4.10469E−25	2.69741E−23
Smpdl3a	0.418240822	9.556683298	106.5726921	5.5229E−25	3.61471E−23
Fau	0.133036285	12.30167072	106.2430132	6.52254E−25	4.25175E−23
Slbp	0.483341551	9.609796597	106.0970615	7.02107E−25	4.55834E−23
Efhd2	−0.507188907	9.465456867	105.6326427	8.87536E−25	5.73916E−23
Actn1	0.575522456	9.187194301	105.6017048	9.01501E−25	5.80624E−23
Itga1	−0.481159298	9.197482484	104.95344	1.2504E−24	8.0214E−23
Junb	−0.334624697	11.89080177	104.8572636	1.31259E−24	8.38706E−23
Tspo	0.314378756	9.918101619	104.6270095	1.47433E−24	9.38349E−23
Dusp10	0.58029624	9.475539651	104.0297313	1.99303E−24	1.2635E−22
Rpl30	0.19389992	10.96422059	103.0676934	3.2389E−24	2.04531E−22
Lztfl1	−0.623767739	9.420902283	102.5746732	4.1541E−24	2.61304E−22
Dennd4a	−0.578405941	9.353169382	102.5290984	4.25078E−24	2.66349E−22
5430421N21Rik	0.646852187	9.214329084	102.1476476	5.1534E−24	3.2166E−22
Ldha	0.277341313	10.35628782	101.9060758	5.82177E−24	3.6198E−22
Eomes	−0.779813416	9.215476434	101.3944563	7.53744E−24	4.66859E−22
Ppp1cc	0.303541918	10.14034874	99.89229099	1.60914E−23	9.92879E−22
Malat1	−0.254811632	14.66845899	99.87543084	1.6229E−23	9.97559E−22
Gpr18	−0.656361909	9.406528173	99.35693704	2.10858E−23	1.29119E−21
H2-K1	0.198523334	11.61002829	98.90320569	2.6515E−23	1.61751E−21
Runx3	−0.471586573	9.557610794	97.59444435	5.13478E−23	3.12063E−21
Tmsb10	0.154827346	12.94248991	97.16784513	6.36926E−23	3.85639E−21
Lag3	−0.863184819	9.272147436	97.12994873	6.49234E−23	3.91624E−21
Cpm	0.566098049	9.24931383	97.09275961	6.61544E−23	3.97566E−21
Ms4a6b	−0.333588841	10.1948354	96.00750204	1.14449E−22	6.85253E−21
H2-Q7	−0.264138572	10.62105384	95.84377435	1.24316E−22	7.41586E−21
Rpl27a	0.13805365	11.7398871	94.43658567	2.53071E−22	1.5041E−20
Gas7	−0.461230762	9.194247453	94.25268389	2.7771E−22	1.64449E−20
Tecpr1	0.465177325	9.413068687	93.95828779	3.22244E−22	1.90124E−20
Tsc22d1	0.514971286	9.170828337	93.63509947	3.794E−22	2.23032E−20
Rorc	0.340741054	9.165458039	92.99485602	5.24304E−22	3.07098E−20
Ptrh1	0.416669722	9.177194315	92.97032326	5.30844E−22	3.09806E−20
Dhrs3	0.469692706	9.174233573	92.76398048	5.89178E−22	3.42613E−20
Nfkbiz	−0.472625752	9.633382235	92.64171855	6.26723E−22	3.6314E−20
Gnas	−0.249759348	10.37740546	92.59947857	6.40243E−22	3.69649E−20
Il2ra	−0.594584914	9.266141063	91.94031851	8.93303E−22	5.1392E−20
Slc9a3r1	−0.397597403	9.651360086	91.91314639	9.05654E−22	5.19177E−20
Smoc2	0.217368642	9.159952973	91.81873843	9.49907E−22	5.42622E−20
Asb2	−0.566764352	9.480727364	91.47295697	1.13128E−21	6.43952E−20
Ccnb2	−0.574479423	9.212362432	91.21075062	1.29157E−21	7.32613E−20
Chst12	−0.591913388	9.307931014	91.00443213	1.43351E−21	8.10282E−20
Dusp2	−0.651560783	9.446121177	90.7507899	1.62956E−21	9.17892E−20
Rexo2	0.41801584	9.465243005	89.60388759	2.90952E−21	1.63317E−19
Hsph1	−0.62803205	9.472358293	88.22977687	5.8276E−21	3.25983E−19
Arf6	−0.341525694	9.853237401	87.74031434	7.46375E−21	4.16066E−19
Cd84	0.465838199	9.34855222	87.58985183	8.05368E−21	4.47408E−19
Gbp3	−0.575087315	9.305894756	86.67276617	1.28048E−20	7.08912E−19
Cyb5a	0.418826942	9.520944338	86.4705939	1.41831E−20	7.82537E−19
Traf4	−0.547865622	9.359798586	85.45465565	2.37076E−20	1.3036E−18
Prkcb	0.470193718	9.208819069	84.45661779	3.92738E−20	2.15221E−18
Lrrc25	0.258088384	9.161329097	84.44163993	3.95725E−20	2.16125E−18
Sh2d2a	−0.380576774	9.846351053	84.3959534	4.04976E−20	2.20432E−18
Hmgn2	−0.601700458	9.445400237	83.92876523	5.12928E−20	2.78255E−18
Rhoc	−0.562347362	9.244274494	83.85510055	5.32401E−20	2.87852E−18
Acsbg1	0.47503696	9.314382446	83.81601429	5.43031E−20	2.92622E−18
Dkkl1	−0.529480805	9.308686946	83.51509157	6.32314E−20	3.39601E−18
Hcst	−0.252513111	10.61089653	83.25678198	7.20579E−20	3.85724E−18
Acad	−0.497894127	9.426499963	83.21766254	7.34981E−20	3.92135E−18
Asap1	0.515125763	9.22985191	82.67182493	9.68723E−20	5.15144E−18
Cox7a21	0.245914858	10.13150038	82.17709101	1.24424E−19	6.59486E−18
Ap3s1	0.392394745	9.478733316	82.12212471	1.27932E−19	6.75868E−18
Shisa5	0.193645712	11.05064206	82.01459451	1.35085E−19	7.11333E−18
Ltb	0.362820009	10.15488605	81.87811624	1.44743E−19	7.59713E−18
Ccna2	−0.403785662	9.193840202	81.36484801	1.87666E−19	9.81817E−18
Mns1	−0.536056376	9.250789284	81.30652077	1.93288E−19	1.00796E−17
Csf1	−0.510822609	9.192100854	81.19288199	2.04728E−19	1.06419E−17
Ramp1	0.361595708	9.166176693	80.89429173	2.38121E−19	1.2338E−17
Cyba	−0.238796652	10.43095334	80.73209482	2.5849E−19	1.33506E−17
Ptms	−0.527438745	9.287856152	80.5814284	2.78969E−19	1.43625E−17
Ccl3	−0.910093878	9.220257049	80.47423238	2.94521E−19	1.5115E−17
Ppm1j	−0.509834666	9.231926591	80.0920149	3.57374E−19	1.82826E−17
Asf1b	−0.539633023	9.223320297	80.00113282	3.74195E−19	1.90828E−17
Rpl39	0.140509529	11.77739482	79.99106699	3.76106E−19	1.91199E−17
Eif3h	0.207162722	10.29703651	79.51031985	4.79713E−19	2.43105E−17
Itm2b	−0.202508228	10.97659374	79.05171761	6.05051E−19	3.05664E−17
Rpl5	0.195642628	10.56774531	78.40370728	8.39944E−19	4.23007E−17
Mt1	−0.681149163	9.25333207	78.01199452	1.02417E−18	5.14183E−17
Slc2a3	−0.535215118	9.267489223	77.88899828	1.08997E−18	5.45524E−17
Jund	−0.291126203	11.83355423	77.37694158	1.41255E−18	7.04791E−17
Vcam1	0.41406013	9.169856475	77.29191905	1.47468E−18	7.33529E−17
Cxcl3	0.555799907	9.168367119	77.24424832	1.51071E−18	7.49144E−17
Ralgps2	0.447656391	9.202191153	77.21516413	1.53312E−18	7.57933E−17
Atf3	−0.680296415	9.293174358	76.62548982	2.06655E−18	1.01853E−16
Osgin1	−0.593267168	9.241885952	76.07875288	2.72574E−18	1.33934E−16
Ctla2b	−0.522490544	9.270070138	76.04275853	2.77588E−18	1.35985E−16
Faah	0.44588788	9.275977389	75.14662319	4.37024E−18	2.13442E−16
Prr7	−0.393644523	9.824437204	75.07309927	4.53605E−18	2.20873E−16
Tnfrsf18	−0.323439954	10.06784361	74.91937037	4.90336E−18	2.38041E−16
Fam101b	0.44395883	9.174664735	74.87849381	5.00593E−18	2.42293E−16
Sla	0.378547652	9.546204364	74.52405875	5.99038E−18	2.89076E−16
Cdca3	−0.416722054	9.196808089	73.81078112	8.59757E−18	4.13656E−16
Lgals1	−0.288816159	11.62800987	73.67765585	9.19741E−18	4.41203E−16
Stk32c	−0.48699157	9.236288863	73.53762236	9.87362E−18	4.72239E−16
Gm9493	0.236255264	10.33364392	73.33101042	1.09632E−17	5.22805E−16
Rrm2	−0.656260613	9.247707962	73.06368613	1.25533E−17	5.96873E−16
Gm8730	0.223093492	10.44488374	72.87273433	1.38285E−17	6.55579E−16
Serpina3f	−0.661617841	9.259699948	72.26884197	1.87789E−17	8.8766E−16
Il14ra	−0.441442073	9.499543146	71.80778832	2.37214E−17	1.11802E−15
Ckb	0.483538637	9.335721648	71.61412486	2.61677E−17	1.22973E−15
Acp5	0.397423986	9.396912844	71.56913307	2.67712E−17	1.25185E−15
Rcn1	−0.444001155	9.211899643	71.5675056	2.67933E−17	1.25185E−15
Spc24	−0.443249395	9.204195345	70.62308424	4.32427E−17	2.01459E−15
Rps12	0.192586529	10.77092803	70.24630421	5.23433E−17	2.43155E−15
Clta	−0.284608639	9.8733927	70.18241162	5.40664E−17	2.5044E−15
Skil	−0.428945944	9.558639486	69.82061796	6.49504E−17	2.99997E−15
Cdkn2c	−0.492927169	9.239141777	69.80701627	6.53998E−17	3.01212E−15
2310001H17Rik	0.45313487	9.290442993	69.72339182	6.82321E−17	3.13364E−15
Egln3	0.460826066	9.20786883	69.16184134	9.07061E−17	4.15398E−15
Ncor1	0.309981143	9.664996809	69.00893228	9.80185E−17	4.47618E−15
Tnfrsf9	−0.607969904	9.402131727	68.99666734	9.863E−17	4.49141E−15
Prelid2	0.424695126	9.192055381	68.68295117	1.15636E−16	5.25106E−15
Padi2	−0.447711328	9.215639868	67.88323124	1.7347E−16	7.85524E−15
Ndufa4	0.305255781	9.735529358	67.70371654	1.90005E−16	8.57995E−15
Gbp7	−0.476561834	9.290910914	67.67068329	1.93215E−16	8.7006E−15
Ube2c	−0.631545281	9.233527278	67.5201665	2.08543E−16	9.36474E−15
Ifrd1	−0.336527284	10.02583543	67.17457762	2.48498E−16	1.1128E−14
Cdk1	−0.39769185	9.19735213	67.15632591	2.50809E−16	1.12005E−14
Tuba4a	−0.464387774	9.389389589	67.02800208	2.67678E−16	1.19209E−14
Neurl3	−0.393731218	9.619600065	66.75753682	3.07041E−16	1.36363E−14
Cnn3	0.198623534	9.160462978	66.70096425	3.1598E−16	1.39949E−14
Cd47	−0.236561159	10.2358714	66.62087045	3.29083E−16	1.45354E−14
Pelo	−0.459502434	9.234978423	66.57690441	3.36506E−16	1.48228E−14
Ubc	−0.246876595	11.04983306	66.51122535	3.47907E−16	1.52833E−14
Ptma	−0.194475287	11.28840747	66.30598276	3.86085E−16	1.69145E−14
Itgb1	−0.6429514	9.29928184	66.26452004	3.94292E−16	1.72274E−14
Rpl37a	0.114612104	12.61563941	66.16203022	4.15337E−16	1.80979E−14
Ptger4	−0.503230593	9.34461786	66.11246381	4.25914E−16	1.85089E−14
Rps15a	0.109891473	12.40383431	66.08931246	4.30946E−16	1.86774E−14
Ccl1	−1.01837332	9.258139682	65.45285896	5.95208E−16	2.57276E−14
Tcp11l2	0.407869719	9.433884628	65.28344021	6.48641E−16	2.79625E−14
Eif3k	0.209698805	10.09230815	65.11697117	7.05816E−16	3.03463E−14

TABLE 3E
LPL−4 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Jun	2.590143686	9.603439503	1533.659276	0	0
Klf6	1.545036169	9.89686973	1361.417237	5.089E−298	4.1134E−294
Dusp1	1.611063957	9.939042764	1258.200347	1.3708E−275	7.387E−272
Fos	2.334554203	9.517129944	1248.343188	1.9017E−273	7.6858E−270
Ubb	0.716874178	12.90465449	1126.424498	5.9667E−247	1.9291E−243
Rgs1	1.270826473	11.08975568	1112.879546	5.2433E−244	1.4127E−240
Hspa1a	2.826179586	11.00085583	1078.202577	1.805E−236	4.1685E−233
Ubc	0.914435003	11.0498222	1066.356992	6.778E−234	1.3697E−230
Dnajb1	1.892963828	10.31714857	948.4998693	2.8108E−208	5.0489E−205
Cd69	1.363050626	9.886202315	884.9866185	1.8013E−194	2.9119E−191
Zfp36	1.848813098	9.294559476	835.0942821	1.2651E−183	1.8593E−180
Hspa1b	2.15174286	9.330468231	793.0459723	1.7539E−174	2.3628E−171
Hspa8	0.696470563	12.33068176	751.3892978	2.0013E−165	2.4887E−162
Nfkbia	0.985907956	10.83334808	699.2477201	4.3581E−154	5.0323E−151
Gadd45b	1.286294082	9.727225725	674.2268837	1.2033E−148	1.2969E−145
H2afz	−1.07018428	10.76614048	664.4674558	1.5951E−146	1.6116E−143
Junb	0.793003216	11.89077788	658.8329868	2.68E−145	2.5485E−142
Ppp1r15a	1.114516956	9.595202536	607.3150774	4.2927E−134	3.8553E−131
Ifngr1	−0.797175635	11.1130316	606.1095339	7.8512E−134	6.6802E−131
Tnfaip3	0.803794065	10.12471168	549.5002817	1.617E−121	1.307E−118
Tagap	1.261551553	9.424665079	531.4945681	1.336E−117	1.0284E−114
Phlda1	1.400498169	9.440744496	524.7965068	3.8283E−116	2.8131E−113
Gramd3	1.16036844	10.20636507	497.1879766	3.8888E−110	2.7333E−107
Hsp90aa1	0.935956122	10.76861769	471.3892672	1.5976E−104	1.0761E−101
Fosb	1.329877314	9.41073207	435.298814	1.14187E−96	7.38381E−94
ler5	0.885845247	9.710298508	407.4325977	1.32736E−90	8.25311E−88
Tsc22d3	0.984645148	9.704342129	404.9225279	4.67066E−90	2.79652E−87
Hsp90ab1	0.633814222	11.19704142	400.9346148	3.44732E−89	1.99033E−86
Emb	−0.904301807	10.2510913	391.702411	3.52584E−87	1.96547E−84
Serpinb9	−1.366273321	9.858316986	378.3861841	2.79458E−84	1.50591E−81
Asb2	1.034237011	9.480724756	375.4102947	1.2423E−83	6.47842E−81
Ramp3	−1.695838734	9.93719207	371.2181081	1.01619E−82	5.13367E−80
Bag3	1.280714683	9.20292133	370.6579391	1.34568E−82	6.59218E−80
Ostf1	−0.757739549	10.18398253	354.6784426	4.05846E−79	1.92968E−76
Ifng	1.390059422	9.686573599	352.8816351	9.99148E−79	4.61492E−76
Hsph1	1.120114423	9.472352373	351.0872604	2.45683E−78	1.10325E−75
Csrnp1	0.935572167	9.467362177	341.0348346	3.79755E−76	1.65922E−73
Ppp1cc	−0.712400694	10.14035428	333.4083474	1.73963E−74	7.40074E−72
Satb1	−1.050886834	9.757129414	330.9907931	5.8478E−74	2.42399E−71
Sub1	−0.498310969	11.14885309	313.5062323	3.76209E−70	1.52045E−67
Atf3	1.255366092	9.293173328	311.0704066	1.27657E−69	5.03343E−67
Tnfrsf4	−0.886369845	10.622478	308.5109707	4.60895E−69	1.77401E−66
Dgat1	−1.090343512	9.778876472	305.9824441	1.63848E−68	6.15991E−66
Odc1	−0.912868376	10.45380252	294.6839137	4.74244E−66	1.74241E−63
Dnaja1	0.660328779	10.76356594	292.0198727	1.80488E−65	6.48395E−63
Hmgb2	−0.68462046	10.71173142	285.2036862	5.51645E−64	1.93867E−61
Tnfrsf9	−1.386299016	9.402138025	270.8266947	7.49438E−61	2.57775E−58
Abi3	0.939528469	9.334614155	254.4801334	2.74009E−57	9.22838E−55
Icos	−0.694823726	10.25651136	252.956149	5.88827E−57	1.94265E−54
Lmnb1	−0.796445565	9.781598082	235.4925917	3.78059E−53	1.22234E−50
Tpm4	−0.870737305	9.58004696	232.0124485	2.17005E−52	6.87863E−50
Gabpb1	−1.01277835	9.478116622	231.3253372	3.06417E−52	9.52602E−50
Il21r	−0.709656805	10.19619458	230.7497394	4.09108E−52	1.24786E−49
Actg1	−0.385352565	12.09967582	227.9718392	1.65067E−51	4.9416E−49
Nfkb2	−0.872840303	9.521887809	227.4662535	2.12776E−51	6.25408E−49
Tra2b	0.566603683	9.814659783	225.7459621	5.04794E−51	1.45723E−48
Nr4a1	0.760017624	9.629880779	225.0326612	7.22249E−51	2.0484E−48
Actb	−0.686498084	13.40455375	224.189125	1.10323E−50	3.07497E−48
Malat1	0.384658746	14.66845119	222.1869687	3.01551E−50	8.26249E−48
Crem	−0.929344412	10.06723454	221.6786464	3.89255E−50	1.04878E−47
Irf1	0.800988362	9.430944526	220.5435406	6.88374E−50	1.8243E−47
S100a4	−1.124176336	9.866850446	220.2298465	8.05839E−50	2.10116E−47
Dnajb4	0.898452918	9.252159229	218.0567114	2.40034E−49	6.15935E−47
Eif4a2	0.587188346	9.723691704	215.5267639	8.55372E−49	2.16062E−46
Lgals1	−0.544772962	11.62803108	210.6664274	9.82814E−48	2.44433E−45
Vps37b	−0.567998001	10.60462455	208.2553343	3.29997E−47	8.08292E−45
Arpc2	−0.339096705	10.79502771	198.9781559	3.48999E−45	8.42077E−43
Ldha	−0.477227524	10.356303	198.1191431	5.37386E−45	1.27756E−42
Slc38a2	0.6945798	9.471310328	196.4081687	1.26965E−44	2.97467E−42
Rhoh	0.680272061	9.50146616	195.902854	1.63669E−44	3.77982E−42
Kcnk5	0.865065562	9.212048811	195.5640523	1.94048E−44	4.41827E−42
Cd47	−0.469147919	10.23587831	193.5887493	5.23627E−44	1.17569E−41
Cd28	0.462328972	10.37935338	193.379503	5.8169E−44	1.28817E−41
Hspe1	0.62125485	10.275394	192.4921794	9.08574E−44	1.98487E−41
Tnfrsf18	−0.597638271	10.06784994	192.2396956	1.0315E−43	2.22336E−41
Gadd45g	1.091498475	9.253008237	191.6702361	1.37329E−43	2.92114E−41
Sh2d2a	−0.665095634	9.846350864	191.0225578	1.90166E−43	3.99249E−41
Cd2	−0.492480832	10.31976175	186.0579796	2.30587E−42	4.77907E−40
Ccdc117	0.815294707	9.229125118	181.8435023	1.91832E−41	3.9255E−39
mt-Nd1	−0.358612694	11.14922829	179.4352069	6.43782E−41	1.30092E−38
Prelid1	−0.628281747	9.693861972	176.724491	2.51555E−40	5.02053E−38
Ptp4a2	−0.517215133	9.957507214	175.4580103	4.75543E−40	9.37515E−38
Btg2	0.440636277	10.53755263	170.6805646	5.25444E−39	1.02341E−36
Rplp0	−0.21033764	12.38791457	169.8702747	7.89769E−39	1.51993E−36
Rora	−0.613089505	9.982326095	165.5083791	7.08364E−38	1.34723E−35
Cytip	−0.464571312	10.18852324	164.5920026	1.12315E−37	2.11126E−35
Ywhae	−0.599038836	9.677391704	163.9902312	1.52018E−37	2.82474E−35
Dusp2	0.836057215	9.446119208	163.7671751	1.70068E−37	3.12424E−35
Gm8797	0.673519794	9.41752959	163.683435	1.77385E−37	3.22203E−35
Txnip	0.67807196	9.461611552	163.1794609	2.28568E−37	4.06048E−35
Crip1	−0.565568902	11.66680939	163.1805573	2.28442E−37	4.06048E−35
Zeb1	−0.876726155	9.368997506	162.7540564	2.83107E−37	4.97469E−35
Xbp1	−0.711218017	9.544485173	161.4373091	5.49063E−37	9.54425E−35
Orai1	−0.579250032	9.884591795	160.2159281	1.01501E−36	1.7456E−34
Kdm6b	−0.863501587	9.740079571	155.8597275	9.0849E−36	1.54596E−33
Serpinb6b	−0.806046844	9.622270494	153.802115	2.55844E−35	4.3083E−33
Rps27l	−0.691596722	9.542736211	153.7031579	2.68906E−35	4.48159E−33
S100a6	−0.604109019	10.99650705	153.6377922	2.77898E−35	4.58419E−33
Rbm3	−0.359226464	10.73120229	152.3012466	5.44486E−35	8.89107E−33
Pnrc1	0.353791235	10.57762445	151.8347313	6.88568E−35	1.11314E−32
Osgin1	0.824202552	9.241883295	149.9615518	1.76752E−34	2.82908E−32
Ppp1r16b	−0.763243765	9.488059972	148.3650029	3.9477E−34	6.25671E−32
Jund	0.404038488	11.83352068	147.7973495	5.25327E−34	8.24508E−32
Dnajb6	−0.461679658	10.02357702	146.7975356	8.68943E−34	1.3507E−31
Mns1	0.755135013	9.25079002	146.6385192	9.41355E−34	1.44933E−31
Rhob	0.74975205	9.186759187	145.176197	1.96535E−33	2.99735E−31
Rps26	−0.284540248	10.99419139	142.8574902	6.31524E−33	9.54133E−31
Amica1	0.785928661	9.335185757	138.7221207	5.066E−32	7.58305E−30
Cd3g	0.261967409	11.10926437	138.1653066	6.70559E−32	9.94519E−30
Maff	0.743744556	9.305178125	136.9026641	1.26643E−31	1.8612E−29
Bcl2a1d	−0.556400874	9.947971478	135.9736136	2.022E−31	2.92191E−29
Cxcl10	1.022791565	9.358380139	135.9713164	2.02434E−31	2.92191E−29
mt-Co2	−0.245307237	11.3867395	134.1830298	4.9824E−31	7.12791E−29
Ndufa4	−0.533333906	9.735537154	132.5007031	1.16265E−30	1.64873E−28
Got1	−0.718746583	9.85597876	130.9493044	2.54011E−30	3.57073E−28
mt-Co1	−0.214636506	12.2154689	130.618136	3.00128E−30	4.18265E−28
Gch1	−0.741103157	9.459479195	128.8681559	7.24762E−30	9.96255E−28
Stmn1	−1.367904009	9.430748828	128.8615105	7.27193E−30	9.96255E−28
Serpinb1a	−1.211789733	9.512634009	128.4498585	8.94794E−30	1.21557E−27
Zfp3612	0.548721708	9.813907288	127.2191653	1.6635E−29	2.24102E−27
Samsn1	−0.60534197	9.795514419	124.3876645	6.9293E−29	9.25777E−27
Cacybp	0.534106834	9.501045641	123.654719	1.00256E−28	1.32847E−26
Bcl11b	0.557187574	9.518363932	123.2267919	1.24387E−28	1.63483E−26
Nab1	−0.638659495	9.481607755	122.2066184	2.08007E−28	2.71181E−26
Eif4a1	−0.326967555	10.43982044	119.198664	9.47487E−28	1.22537E−25
Ctsw	0.420268747	9.943491723	118.6678023	1.23823E−27	1.58867E−25
Manf	−0.503781652	9.719597578	116.9764749	2.90493E−27	3.69772E−25
Sit1	0.594504365	9.400129387	116.683346	3.36762E−27	4.2532E−25
Ahr	0.665620939	9.32837131	116.5385822	3.62263E−27	4.5398E−25
Dnaja4	0.702154245	9.306294868	116.2943522	4.09737E−27	5.09524E−25
Rasgrp1	0.54719873	9.4876411	115.5982599	5.82026E−27	7.18247E−25
Rpl28	−0.277273945	10.72583795	114.4206894	1.05399E−26	1.29081E−24
Tnf	0.657378601	9.19510683	113.7154721	1.50415E−26	1.82828E−24
Map2k3	−0.639195811	9.403893144	112.180806	3.26167E−26	3.93493E−24
Bcl2a1b	−0.401042562	10.39223313	111.0495442	5.77103E−26	6.9107E−24
mt-Co3	−0.206451547	12.09928666	110.9099873	6.19193E−26	7.3602E−24
Ddit3	0.600713605	9.375996145	110.3339779	8.27972E−26	9.77007E−24
Arpc5	−0.375095913	10.09994462	110.1520132	9.07572E−26	1.06317E−23
Anxa2	−0.551214664	9.842703511	109.8227857	1.07155E−25	1.24623E−23
Tbx21	0.633815107	9.277654988	107.7502756	3.0487E−25	3.52038E−23
Hspa5	−0.331253095	10.97868219	106.0074139	7.34599E−25	8.42235E−23
Gm26740	−0.5631075	9.658905522	105.6525046	8.78684E−25	1.00034E−22
Hspd1	0.522874198	9.781160578	105.5573721	9.21897E−25	1.0422E−22
Egr1	0.693243113	9.204622648	105.294982	1.05242E−24	1.18149E−22
Arpc3	−0.300445815	10.54021802	104.3124691	1.72798E−24	1.92652E−22
Slc25a5	−0.317657126	10.39410861	102.9141475	3.49991E−24	3.87531E−22
Slc25a19	−0.671198564	9.304164557	102.4999831	4.31371E−24	4.74391E−22
Arf5	−0.355950623	9.981776324	102.4262272	4.47735E−24	4.89059E−22
P2ry10	−0.542627996	9.588148813	100.0926173	1.45435E−23	1.57792E−21
Tiparp	0.622859048	9.253508946	99.43211855	2.03003E−23	2.18784E−21
Dapk2	0.629735843	9.267212724	99.37047465	2.09422E−23	2.24206E−21
Srgn	−0.248081982	11.37107818	98.58322616	3.11648E−23	3.31454E−21
S1pr4	−0.599660571	9.466039302	98.42214907	3.38057E−23	3.57191E−21
Prdx1	−0.402768256	9.945248275	98.10603607	3.96568E−23	4.16294E−21
Mif4gd	−0.554622287	9.488410444	97.43644609	5.56129E−23	5.80025E−21
Pyhin1	0.625926041	9.241802634	97.31544236	5.91175E−23	6.12624E−21
Atp2b1	−0.577740061	9.529038489	96.38102805	9.4771E−23	9.75839E−21
Klf4	0.785414982	9.240042515	95.6473965	1.3728E−22	1.4046E−20
Kdm2b	−0.590418174	9.446725658	95.06884645	1.83878E−22	1.86954E−20
Gpr34	0.643868069	9.256515481	94.58899127	2.34318E−22	2.36749E−20
Ddx5	0.222201788	11.19915484	94.33581499	2.66288E−22	2.6738E−20
Dedd2	0.548833108	9.289954935	93.22117023	4.67652E−22	4.66671E−20
Gngt2	0.563130652	9.363419251	92.71645706	6.03496E−22	5.98535E−20
Ptger4	0.593740113	9.344615159	92.63473731	6.28938E−22	6.19964E−20
Rap1b	−0.323870206	10.11242022	92.0761552	8.34043E−22	8.1716E−20
Ndfip1	−0.453916191	9.658016099	91.91248652	9.05956E−22	8.8227E−20
Pmaip1	0.569597424	9.419279032	91.40457314	1.17106E−21	1.13361E−19
Ass1	−0.570778569	9.534401383	91.02169791	1.42105E−21	1.36742E−19
mt-Nd4	−0.283267739	10.50324563	89.83638465	2.58693E−21	2.47457E−19
Stat4	−0.539139242	9.506546131	89.82057516	2.60768E−21	2.47975E−19
Zfand2a	0.571863902	9.203483651	89.75384762	2.69713E−21	2.54982E−19
Peak1	0.543559655	9.307893678	89.44490698	3.15298E−21	2.96343E−19
Ube2c	−0.73303176	9.233537011	89.11225779	3.73032E−21	3.4858E−19
Klc1	−0.689120968	9.658425271	89.02069137	3.90705E−21	3.62996E−19
Ccnb2	−0.590326734	9.212369085	88.83145927	4.29924E−21	3.97152E−19
Kras	−0.549993886	9.430506668	88.81040425	4.34525E−21	3.99121E−19
Atf4	0.472417228	9.430489091	88.68127167	4.63836E−21	4.23637E−19
Tbc1d10c	0.461521425	9.522565087	88.25782723	5.74554E−21	5.21812E−19
S1pr1	−0.676389037	9.290347327	87.8844838	6.93909E−21	6.26689E−19
Oaz1	−0.179343623	11.23129158	87.66043355	7.77135E−21	6.97954E−19
Mkrn1	−0.435496851	9.625707011	86.99298233	1.08907E−20	9.72701E−19
Mpc1	−0.482130101	9.498929683	86.81722357	1.19028E−20	1.05726E−18
Cwc15	−0.440746307	9.591066965	86.59722366	1.33034E−20	1.1752E−18
Yeats4	−0.576896023	9.335828716	86.0310623	1.77131E−20	1.55625E−18
Zc3hav1	−0.453828247	9.665187247	85.82752191	1.96335E−20	1.71565E−18
Mxi1	−0.615229665	9.308272849	85.48875372	2.33023E−20	2.0253E−18
Gna13	−0.394257142	9.985132901	85.39771314	2.44003E−20	2.10938E−18
Eno1	−0.376092563	9.94247872	85.37363547	2.46992E−20	2.12387E−18
Metap2	−0.532246668	9.437215686	84.64093112	3.57781E−20	3.06026E−18
Cd53	−0.276565437	10.54705579	84.11975064	4.65695E−20	3.96233E−18
H3f3a	−0.262916696	10.34162816	84.03680502	4.85649E−20	4.11047E−18
Chmp4b	−0.386119126	9.755857713	83.79332771	5.49299E−20	4.62498E−18
Rgcc	0.655205768	9.563495027	82.72779326	9.41678E−20	7.88765E−18
Fam189b	0.494624586	9.381139083	82.68518295	9.62198E−20	8.01799E−18
Srp9	−0.371205013	9.749456535	82.04588879	1.32963E−19	1.1023E−17
Myl12a	−0.241036233	10.67854662	81.89353345	1.43618E−19	1.18456E−17
Ube2d2a	−0.380758113	9.705617285	81.87867272	1.44702E−19	1.18744E−17
Rcbtb2	0.554113844	9.398942766	81.83643178	1.47828E−19	1.20697E−17
C1d	−0.55506624	9.33962429	81.52340884	1.73198E−19	1.40699E−17
Cenpa	−0.644600095	9.394732697	81.06499933	2.18414E−19	1.76544E−17
Rps2	−0.182975709	11.63596206	80.5615055	2.81796E−19	2.26642E−17
Rab2a	−0.405486929	9.638428497	80.08770238	3.58155E−19	2.8663E−17
Rps17	−0.253525207	10.61527996	79.99091046	3.76136E−19	2.99538E−17
Crbn	−0.45331621	9.708110897	79.55964126	4.67886E−19	3.70777E−17
Evl	0.449484781	9.48202136	79.48943941	4.8481E−19	3.82314E−17
Atp1b3	−0.525675487	9.413041736	79.31700201	5.29025E−19	4.15156E−17
Birc5	−0.803153176	9.251717708	78.81955099	6.80503E−19	5.3145E−17
Pelo	0.534389282	9.234977676	78.7693748	6.98008E−19	5.425E−17
Ube2b	−0.340873439	9.912296976	78.67640507	7.31642E−19	5.6592E−17
Slc25a3	−0.335596538	9.94973675	78.52605368	7.89501E−19	6.07765E−17
Gimap9	0.414105757	9.580964503	77.89866942	1.08464E−18	8.31012E−17
Gbp8	0.519003936	9.225073835	77.70588153	1.19585E−18	9.1189E−17
Sash3	0.526717574	9.280790532	76.92431049	1.77637E−18	1.34821E−16
Nfkb1	−0.482750495	9.537095283	76.9019338	1.79661E−18	1.3572E−16
Tgfb1	−0.436908782	9.751104871	76.52399621	2.17553E−18	1.6358E−16
Gm19585	−0.589333363	9.333697403	76.49300801	2.20994E−18	1.65398E−16
2810417H13Rik	−1.137160497	9.337791148	76.28397891	2.45669E−18	1.83018E−16
Erh	−0.391194693	9.741401362	75.75485582	3.2116E−18	2.3816E−16
Nabp1	−0.474933711	9.632410427	75.07324761	4.53571E−18	3.34814E−16
H3f3b	−0.183055632	12.3442719	75.06348853	4.55818E−18	3.34944E−16
Tra2a	0.437013456	9.420550179	74.87618174	5.0118E−18	3.6661E−16
Rpl4	−0.145002236	11.68907687	74.81745426	5.16312E−18	3.75978E−16
Reep5	−0.410263139	9.63723477	74.70029247	5.4788E−18	3.97176E−16
ler2	0.372614919	9.828501111	74.64201981	5.64293E−18	4.07248E−16
Abcb1b	−0.617002181	9.297095714	74.45737621	6.19617E−18	4.45188E−16
Atp5a1	−0.343731345	9.817876037	74.34844531	6.54768E−18	4.68362E−16
Pfn1	−0.208967825	12.14558871	74.16052907	7.20159E−18	5.12868E−16
Madd	−0.529984212	9.387287048	74.00633058	7.78669E−18	5.52104E−16
Tomm20	−0.285577806	10.023749	73.94492556	8.03272E−18	5.67061E−16
Cmas	−0.523719597	9.365634653	73.92293145	8.12272E−18	5.70921E−16
Cdca3	−0.440059827	9.19681312	73.80929833	8.60403E−18	6.02133E−16
Cd226	0.541531319	9.268561012	73.70228655	9.08336E−18	6.32938E−16
Stk4	−0.531488797	9.393563986	73.65355009	9.31042E−18	6.45976E−16
Cript	−0.418219478	9.556480747	73.60266337	9.55357E−18	6.60013E−16
Lztfl1	0.516188841	9.420902233	73.17831763	1.1845E−17	8.14834E−16
Cox5b	−0.29984058	10.04351529	72.98093175	1.30909E−17	8.96723E−16
Snrpe	−0.339808137	9.827473175	72.71911464	1.49479E−17	1.01961E−15
Rps3a1	−0.144846919	11.67403179	72.62804541	1.56539E−17	1.06328E−15
Gpx4	−0.322618499	10.07619191	71.72461952	2.47426E−17	1.67359E−15
Lcp1	0.267873223	10.29111652	70.77546944	4.00283E−17	2.69624E−15
Gramd1a	0.428949158	9.45882935	70.50743203	4.58536E−17	3.0758E−15
Rpl22l1	−0.227855341	10.87577052	70.42828761	4.77306E−17	3.18848E−15
Carnmt1	−0.533340181	9.382599136	70.14896737	5.49908E−17	3.65836E−15
Fam78a	0.483182295	9.208922936	69.96525619	6.03583E−17	3.99898E−15
Itk	−0.384569882	9.814381707	69.34499645	8.26621E−17	5.45435E−15
Sirt7	0.451348242	9.346429512	69.25139271	8.66797E−17	5.6962E−15
Lpar6	0.50184775	9.25603568	69.13687452	9.18617E−17	6.01229E−15
Podnl1	0.465684375	9.399826176	69.07032239	9.50144E−17	6.19356E−15
Cd27	−0.693527396	9.342790688	69.00506198	9.8211E−17	6.37622E−15
Il1r2	−0.769598989	9.256734057	68.4351569	1.31119E−16	8.47868E−15
Rpl31	−0.198288808	10.87174216	68.22727856	1.45696E−16	9.38377E−15
Ube2a	−0.430232394	9.476224302	68.15744891	1.50948E−16	9.68345E−15
Il2rg	0.284318296	10.13321138	68.10803166	1.54779E−16	9.88995E−15
Btf3	−0.188936964	10.71562669	67.84995712	1.76422E−16	1.12285E−14
Flna	−0.543132079	9.271089863	67.71229144	1.89181E−16	1.19933E−14
Ostc	−0.417712022	9.507638046	67.39567345	2.22136E−16	1.40275E−14
Nap1l1	−0.446817289	9.497843766	67.25802126	2.382E−16	1.49834E−14
Gm26532	0.539119111	9.298825204	67.17554702	2.48376E−16	1.5563E−14
Rassf5	0.40289647	9.456960458	67.14089843	2.5278E−16	1.57598E−14
Psmd6	−0.511849794	9.309065396	67.13554255	2.53467E−16	1.57598E−14
Slc39a1	−0.517971835	9.215123658	66.93618839	2.80439E−16	1.737E−14
Sipa1	0.445171877	9.377580607	66.78277931	3.03135E−16	1.87041E−14
Rpl24	−0.138569497	11.77231724	66.27823268	3.91559E−16	2.40682E−14
Plk3	0.492663873	9.37620264	66.21240355	4.04857E−16	2.47913E−14
1500009L16Rik	−0.568387028	9.247088485	65.79956575	4.99192E−16	3.04526E−14
Arf4	−0.322744466	9.97486799	65.76286864	5.08574E−16	3.09083E−14
Ccr7	−0.852512495	9.2731796	65.71215821	5.2183E−16	3.15507E−14
Hmgb1	−0.289258843	10.29717658	65.70756036	5.23048E−16	3.15507E−14
Psmb5	−0.408420536	9.522708713	65.65722349	5.36579E−16	3.22466E−14
Zfp3611	0.437347092	9.536424792	65.53388802	5.71232E−16	3.4202E−14
Rsrp1	0.294708181	10.00255998	65.36956236	6.20905E−16	3.70389E−14
Ccnd3	0.392403552	9.527397103	64.82584356	8.1819E−16	4.86282E−14
Etf1	−0.44463723	9.430618507	64.09079524	1.18815E−15	7.03578E−14
Rpl37a	0.122987072	12.61564076	63.93640264	1.28501E−15	7.58157E−14
Gapdh	−0.237914704	10.5624293	63.49863181	1.60478E−15	9.43379E−14
St3gal6	0.467788849	9.290007328	63.39446236	1.69193E−15	9.91005E−14
Stat3	−0.427360634	9.627931004	63.34309522	1.73663E−15	1.01352E−13
Capza2	−0.336100212	9.686699536	63.08839131	1.97635E−15	1.14927E−13
Aim1	−0.518130757	9.317849014	62.96031012	2.10914E−15	1.22209E−13
4930503L19Rik	0.477664395	9.217221064	62.90849567	2.16536E−15	1.25019E−13
Ptpn22	−0.320448302	10.0931864	62.87594088	2.20145E−15	1.2665E−13
Isy1	−0.489261775	9.388853979	62.86177423	2.21734E−15	1.27112E−13
Dcun1d5	−0.394885964	9.525965055	62.63746655	2.48481E−15	1.41942E−13
Sys1	−0.391713519	9.549646283	62.46696151	2.70952E−15	1.54233E−13
Cox6a1	−0.247773288	10.15026993	62.43173845	2.75842E−15	1.56465E−13
Hif1a	−0.36303621	9.774226901	62.23603398	3.04662E−15	1.72209E−13
Dennd4a	−0.506038575	9.353170513	61.80891426	3.78457E−15	2.13176E−13
Ermn	−0.670779521	9.304666665	61.78992983	3.82124E−15	2.14493E−13
Pglyrp1	−0.581505876	9.331204063	61.76551296	3.86891E−15	2.16418E−13
Smad7	0.432811456	9.374760348	61.6967973	4.00631E−15	2.23331E−13
Emp3	−0.353830378	9.864716413	61.4528883	4.53465E−15	2.51914E−13
Mif	−0.336814609	9.843573442	61.40913837	4.63654E−15	2.56693E−13
Ncl	−0.277240909	10.07288653	61.28557928	4.93683E−15	2.72385E−13
Tax1bp1	−0.346224474	9.700820891	61.18575971	5.19358E−15	2.85576E−13
Gm11808	0.267683291	10.17414513	61.10326802	5.41582E−15	2.96787E−13
Tnip1	−0.466236205	9.396423421	61.03989719	5.59298E−15	3.0546E−13
Il2rb	−0.377545771	9.646395321	60.97710191	5.77425E−15	3.14298E−13
Selk	−0.25836491	10.04778191	60.88064076	6.06423E−15	3.28974E−13
mt-Atp6	−0.143668358	12.47117091	60.56120241	7.1326E−15	3.85638E−13
Rpl32	−0.118637876	12.44744241	60.38463939	7.80194E−15	4.20421E−13
Uap1	−0.479451457	9.373416437	60.17826839	8.66436E−15	4.65342E−13
B2m	0.104190832	12.79985088	60.16460126	8.72473E−15	4.67033E−13
Ubl3	−0.402699619	9.565973366	59.28291636	1.36557E−14	7.28574E−13
Cd160	0.664206821	9.334737973	59.26672523	1.37685E−14	7.32177E−13
Nfkbid	0.548241659	9.347248926	59.24549012	1.39179E−14	7.37694E−13
Sdhb	−0.373471788	9.57477766	59.140164	1.46831E−14	7.75712E−13
Cd40lg	0.434709702	9.469009802	59.079041	1.51464E−14	7.97579E−13
Ccl4	1.216184948	9.567139597	59.07002117	1.5216E−14	7.98642E−13
Ifi203	0.397729022	9.466695884	59.02071419	1.56021E−14	8.16257E−13
Hsp90b1	−0.360458376	9.704110499	58.95054865	1.61685E−14	8.4316E−13
Atp5f1	−0.298472638	9.82228089	58.8189421	1.72869E−14	8.98585E−13
Ms4a6b	0.26638962	10.19482982	58.69772529	1.83854E−14	9.52623E−13
Ell2	−0.499117657	9.233861253	58.59765846	1.93447E−14	9.99124E−13
Rps27	0.130528567	13.23482143	58.50543285	2.0273E−14	1.04374E−12
Pin1	−0.459464991	9.345121381	58.32632468	2.22053E−14	1.13959E−12
Nmrk1	−0.50895163	9.47064308	58.21551447	2.34919E−14	1.2018E−12
Ccna2	−0.39001523	9.193845605	58.12778027	2.45633E−14	1.25265E−12
Ube2j2	−0.376431055	9.513342518	58.03685007	2.57253E−14	1.30779E−12
Rpl38	0.138662549	11.67460466	58.0220768	2.59193E−14	1.31351E−12
Uqcrfs1	−0.314965169	9.7148766	57.9988405	2.62272E−14	1.32497E−12
Rasgrp4	0.436494297	9.196048428	57.85877003	2.81629E−14	1.41832E−12
Gm4955	0.499775199	9.225196819	57.61657645	3.1853E−14	1.59918E−12
Pik3r1	−0.45075266	9.484798888	57.58402923	3.23844E−14	1.62083E−12
Tuba4a	0.431200046	9.389388654	56.87585494	4.64211E−14	2.31618E−12
Smarce1	−0.408252588	9.44121571	56.75737258	4.93039E−14	2.45245E−12
Rac1	−0.27734301	9.864108042	56.73130979	4.99617E−14	2.47755E−12
Nfkbiz	0.364141505	9.633378704	56.64467691	5.2212E−14	2.58122E−12
Rpl7	−0.145513172	11.2121183	56.47267357	5.69848E−14	2.80859E−12
Tm2d2	−0.487628577	9.29650158	56.43314473	5.8142E−14	2.84825E−12
Prkar1a	−0.244526548	10.1098473	56.43460194	5.80989E−14	2.84825E−12
Hn1	−0.290730748	9.912834007	56.21069494	6.51064E−14	3.17979E−12
Vimp	−0.385693308	9.528415566	56.17137881	6.64214E−14	3.23424E−12
Il12rb1	0.457617355	9.249603528	56.07279355	6.98368E−14	3.39034E−12
Sar1a	−0.38919719	9.487454256	55.83677354	7.87447E−14	3.81134E−12
Rgs3	0.445767105	9.212312097	55.42399885	9.71432E−14	4.68781E−12
H2afx	−0.53405617	9.351667018	55.39133439	9.87709E−14	4.75217E−12
Fam46a	−0.593104785	9.504386119	54.85249022	1.29924E−13	6.2325E−12
Unc50	−0.463482394	9.291047169	54.8152367	1.3241E−13	6.33297E−12
Psmb6	−0.315898886	9.664543895	54.5840988	1.48936E−13	7.10235E−12
Relb	−0.416261884	9.473543412	54.39215697	1.64217E−13	7.80803E−12
Areg	−0.981677364	9.386135347	54.37400443	1.65741E−13	7.85739E−12
Nusap1	−0.478892551	9.207262276	54.2609206	1.75559E−13	8.29849E−12
Dnajb11	−0.399861357	9.443671568	54.13350774	1.8732E−13	8.82859E−12
Rpl8	−0.128862907	11.65232029	54.1236023	1.88266E−13	8.84742E−12
Psmb4	−0.368425685	9.512666637	54.07411222	1.93068E−13	9.04679E−12
Pfdn5	0.183243053	10.55366333	53.80238941	2.21703E−13	1.03585E−11
Pdia6	−0.405605687	9.493421923	53.74006008	2.28849E−13	1.06616E−11
Tdg	−0.465092218	9.267189123	53.56871386	2.49704E−13	1.15998E−11
Rasgrp2	−0.474109476	9.377109112	53.28818106	2.88034E−13	1.3342E−11
Chordc1	0.43790998	9.243519132	53.22033495	2.98156E−13	1.37714E−11
Eomes	−0.676427393	9.215474018	52.88113851	3.54356E−13	1.63206E−11
Riok1	−0.482947013	9.379980367	52.86480692	3.57315E−13	1.64101E−11
Mrpl43	−0.430748788	9.347336785	52.85289924	3.59488E−13	1.64631E−11
B930036N10Rik	0.476518913	9.189748854	52.78752614	3.71654E−13	1.69722E−11
Snrpd1	−0.387511242	9.480040942	52.74552695	3.79687E−13	1.72902E−11
Rps27rt	0.21726945	11.16206124	52.6596686	3.96653E−13	1.80121E−11
Tnfrsf25	−0.507674416	9.258889745	52.54427375	4.20657E−13	1.90486E−11
Capzb	−0.237573376	10.15899344	52.46292909	4.38447E−13	1.97987E−11
Cks1b	−0.578941254	9.261808188	52.11841755	5.22525E−13	2.34643E−11
Eif1	−0.13433723	11.85889558	52.12359736	5.21149E−13	2.34643E−11
Psmb2	−0.31086955	9.69395085	52.03727219	5.44571E−13	2.43865E−11
Fnta	−0.448658046	9.225372599	51.97384086	5.6245E−13	2.51176E−11
Cisd2	−0.391653223	9.458300452	51.95684696	5.67339E−13	2.52661E−11
Cirbp	−0.312038116	9.821586015	51.83115822	6.04843E−13	2.68623E−11
Cdc25b	−0.45061542	9.220519401	51.78564824	6.19026E−13	2.74169E−11
Ndufb9	−0.334018339	9.600272915	51.60840143	6.7751E−13	2.99252E−11
Rps8	−0.135138035	11.5927656	51.58476284	6.85717E−13	3.02052E−11
Tmem165	−0.454708653	9.262410636	51.47792094	7.24068E−13	3.18079E−11
Acot9	−0.455587461	9.289681303	51.33930244	7.77043E−13	3.40425E−11
Gna15	−0.42915867	9.413846476	51.31381614	7.87197E−13	3.43941E−11
Batf	−0.397304061	9.653588452	51.22533009	8.23491E−13	3.58829E−11
Marcksl1	−0.536219973	9.352514486	51.11147635	8.72666E−13	3.79234E−11
Cd4	0.302355981	9.643165705	51.0304068	9.09462E−13	3.94165E−11
Fosl2	−0.454425467	9.531626337	50.9750422	9.35479E−13	4.04357E−11
Bcl211	−0.502971673	9.333332611	50.85441484	9.94773E−13	4.2884E−11
mt-Cytb	−0.182059117	11.07879142	50.36934489	1.27368E−12	5.47616E−11

TABLE 3F
LPL−5 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Tnfrsf4	1.093522489	10.62226106	635.4400281	3.2785E−140	5.3E−136
Tgfb1	0.975322652	9.751061303	520.2631269	3.7093E−115	2.9982E−111
Bcl2a1b	0.780135087	10.39216426	514.3928564	7.022E−114	3.7839E−110
Bcl2a1d	0.89577233	9.947939732	466.5419171	1.8125E−103	7.3252E−100
Rpl13a	−0.326086663	13.13152047	458.393353	1.0753E−101	3.47664E−98
Furin	1.083121158	10.3814011	438.3306291	2.49901E−97	6.73315E−94
Fam110a	1.071979962	9.494271745	431.7915513	6.62154E−96	1.38439E−92
Srgn	0.499629456	11.37085449	431.7236111	6.85087E−96	1.38439E−92
Re	1.088827341	9.441983899	426.4493209	9.63164E−95	1.73006E−91
Ctla4	0.839377678	10.15303035	392.4986426	2.36551E−87	3.82408E−84
Id2	0.802587697	10.64561455	386.6248147	4.49435E−86	6.60507E−83
Mmd	1.251992193	9.302839885	381.7863212	5.08222E−85	6.8466E−82
Cxcr6	0.819984404	10.3899312	377.6613434	4.01909E−84	4.99789E−81
Tnfrsf9	1.354848987	9.402019905	371.2362656	1.00698E−82	1.16278E−79
Rplp0	−0.336949142	12.38776356	370.2741409	1.63119E−82	1.75799E−79
Areg	2.120364333	9.386124375	352.1899639	1.41334E−78	1.42801E−75
Rps18	−0.319352603	12.47332519	347.6549277	1.37346E−77	1.30608E−74
Lag3	1.647526397	9.272200366	346.4561421	2.50539E−77	2.25012E−74
Sdf4	0.666738475	9.917375756	342.4166661	1.89919E−76	1.61591E−73
Hspa5	0.561489025	10.97852902	331.228038	5.19183E−74	4.19656E−71
Rpl32	−0.302417146	12.44734872	330.2768468	8.36546E−74	6.43981E−71
Ehd1	0.91198395	9.471470346	322.9608951	3.28068E−72	2.4107E−69
Bhlhe40	0.560219792	10.72354665	318.8827651	2.53665E−71	1.78293E−68
Penk	2.37977032	9.250280046	318.735219	2.73149E−71	1.83989E−68
Gadd 45b	1.002640146	9.727336037	316.7675708	7.32834E−71	4.73879E−68
Il21r	0.742031608	10.19622389	314.7885445	1.97741E−70	1.2295E−67
Stat3	0.825967681	9.627915766	310.4807593	1.71591E−69	1.02739E−66
Dusp14	1.311493662	9.241607784	302.6348425	8.78489E−68	5.07202E−65
Actb	−0.868840136	13.40497483	291.6698206	2.1514E−65	1.19929E−62
Nmrk1	0.997099834	9.470696344	289.2668478	7.18297E−65	3.87066E−62
Plscr1	0.963349071	9.521574474	285.8877732	3.91377E−64	2.04097E−61
Rps19	−0.329912744	12.57926811	282.5048755	2.13673E−63	1.07945E−60
Rora	0.701354189	9.982410898	271.7577505	4.69699E−61	2.30096E−58
Klf2	−1.613268488	9.960790759	267.4297392	4.12189E−60	1.95984E−57
Capg	0.78217281	9.809382216	267.1893548	4.65038E−60	2.14795E−57
Rpl29	−0.371532652	11.21426477	265.936218	8.72202E−60	3.91667E−57
Junb	0.563013782	11.89122367	260.4847643	1.34539E−58	5.87828E−56
Odc1	0.760576176	10.45354943	252.8701509	6.14801E−57	2.61549E−54
Tnfrsf18	0.61336575	10.06773107	249.7951843	2.878E−56	1.19297E−53
Rps5	−0.27022034	12.08886363	247.3691807	9.72734E−56	3.9313E−53
Stx11	0.844497	9.44438744	243.9575398	5.3928E−55	2.12634E−52
H2-D1	0.267762308	12.28190082	240.4816947	3.08798E−54	1.18858E−51
Ostf1	0.551472516	10.1838504	238.6389317	7.78902E−54	2.92831E−51
Ermn	1.23629042	9.304608573	238.0447323	1.04966E−53	3.85654E−51
Rpl18	−0.274617166	11.80689186	230.9705444	3.66172E−52	1.31545E−49
Rpl18a	−0.230919204	12.8427361	230.9237523	3.74877E−52	1.31745E−49
Ece1	0.949006386	9.199067932	228.403278	1.32913E−51	4.57163E−49
Gem	1.164414567	9.368386927	225.2504315	6.47426E−51	2.18048E−48
Rpl13	−0.237763931	12.637725	222.4024543	2.7062E−50	8.92825E−48
Fam46a	1.075761036	9.504325402	218.6210206	1.80792E−49	5.84536E−47
Rps11	−0.249263758	12.26305424	217.0901119	3.90053E−49	1.23639E−46
Cd82	0.515694291	10.12752586	216.2520302	5.94214E−49	1.84732E−46
Ccl20	1.571767244	9.175986718	215.708926	7.8058E−49	2.38092E−46
Rps6	−0.236751525	12.20838346	214.0506452	1.79543E−48	5.37499E−46
Tnfsf11	1.000729109	9.5470138	208.7598636	2.56113E−47	7.52787E−45
Rpl10a	−0.334028709	11.1421834	206.6183549	7.51057E−47	2.16814E−44
Rps4x	−0.25351799	11.84794571	203.2452547	4.08952E−46	1.15985E−43
H2-K1	0.310569301	11.6099805	199.5324875	2.64152E−45	7.36256E−43
Gramd3	−0.754266192	10.20642813	194.9036165	2.70425E−44	7.40965E−42
Vgll4	0.685758581	9.732056241	192.3735559	9.64387E−44	2.59838E−41
Rps10	−0.298690801	11.22180355	192.3216417	9.8988E−44	2.62334E−41
Zeb2	1.004261208	9.266619145	189.0385742	5.15457E−43	1.34401E−40
Rps7	−0.249396851	11.94311863	188.1593636	8.01885E−43	2.05766E−40
Rpl14	−0.247313373	11.87703907	187.7451879	9.87468E−43	2.49428E−40
Rps16	−0.223372261	12.35139052	184.4010715	5.30335E−42	1.31898E−39
B2m	0.192848994	12.79982102	184.2318403	5.77425E−42	1.41434E−39
Rps3	−0.216536407	11.96705851	183.2730085	9.35028E−42	2.25607E−39
Rpl8	−0.253480179	11.65218841	179.8911834	5.11893E−41	1.21695E−38
Foxp3	0.625482423	9.163304427	179.8254281	5.29099E−41	1.23962E−38
H3f3b	0.284663226	12.34435911	173.7735014	1.1093E−39	2.56184E−37
Timp2	0.802832395	9.295781647	172.1120915	2.55788E−39	5.82405E−37
Ikzf2	1.073873069	9.298841109	170.9085501	4.68525E−39	1.05197E−36
Ddx5	0.316171351	11.19923668	169.5222404	9.40838E−39	2.0835E−36
Ly6e	0.358526245	10.76648585	169.4937633	9.54409E−39	2.085E−36
Cdkn1a	0.806219522	9.693178201	169.0570774	1.18881E−38	2.56245E−36
Trps1	0.845530208	9.247854818	163.5175317	1.92824E−37	4.10156E−35
Orai1	0.526678565	9.884604613	162.1675472	3.80264E−37	7.98356E−35
Tmsb10	−0.244760928	12.94245948	160.4130676	9.19176E−37	1.90505E−34
Rpsa	−0.258005375	11.60010538	160.3539494	9.46924E−37	1.93772E−34
Zfp36l2	−0.788376864	9.814128538	159.4437221	1.49689E−36	3.02484E−34
Klf3	−0.990105413	9.422133449	159.1328844	1.75027E−36	3.4932E−34
Itm2b	0.315828579	10.97659894	158.3293848	2.62222E−36	5.16961E−34
Marcksl1	0.883574181	9.352455125	155.3767044	1.15844E−35	2.2563E−33
Ndfip1	0.526351822	9.657958285	154.7210113	1.61125E−35	3.10088E−33
Rps28	−0.295632581	11.7074328	154.5592024	1.74792E−35	3.32434E−33
Tnfsf8	0.870087777	10.01785574	153.9305856	2.39827E−35	4.5082E−33
Rpl35	−0.315995326	11.18856979	153.1436099	3.56359E−35	6.62172E−33
Nfkb1	0.606837763	9.537083442	152.6546593	4.55771E−35	8.37273E−33
Rbpj	0.680460617	9.38517504	152.5848125	4.72076E−35	8.57482E−33
Tubb5	−0.744906297	10.00307441	152.0091079	6.30718E−35	1.13291E−32
S1pr1	−0.952521601	9.290338881	150.4433721	1.38692E−34	2.46383E−32
Il2rb	0.537577161	9.646357284	148.867921	3.06486E−34	5.3855E−32
Litaf	0.754556108	9.445062895	147.9067642	4.97178E−34	8.64235E−32
Cd3g	0.286935653	11.10942082	145.2921461	1.85392E−33	3.18835E−31
Rplp1	−0.248269602	11.7032567	144.8967265	2.26224E−33	3.84962E−31
Slc15a3	0.801237735	9.227334772	144.1671838	3.26617E−33	5.50009E−31
Stk24	0.558224742	9.608522084	144.136344	3.31727E−33	5.52856E−31
Il1r2	1.188001348	9.256675468	142.1821627	8.87259E−33	1.46362E−30
Ccr1	0.904615136	9.184947429	142.1482447	9.02541E−33	1.47379E−30
Jund	0.428678506	11.83414679	141.6222609	1.17619E−32	1.90143E−30
Traf1	0.437567505	10.10521315	141.2746865	1.40113E−32	2.24264E−30
Lilrb4a	0.639236426	9.646913438	141.0375314	1.57883E−32	2.50229E−30
Rpl41	−0.169568893	12.79520696	140.2066552	2.39896E−32	3.7652E−30
Rpl19	−0.186575538	12.11746352	138.3592406	6.08169E−32	9.45352E−30
Uhrf2	0.663533091	9.554448493	137.618841	8.82976E−32	1.35945E−29
Nfkbiz	0.589490901	9.633444859	137.3518839	1.01003E−31	1.54039E−29
Gm8730	−0.391879071	10.44464909	137.2040135	1.08811E−31	1.64397E−29
Eif1	0.221160233	11.85893927	136.6927236	1.40766E−31	2.10706E−29
Sdc4	0.864197912	9.184332418	136.104023	1.89346E−31	2.80823E−29
Nrgn	0.79593449	9.169490694	134.3836196	4.50361E−31	6.61867E−29
Ikzf3	0.758912682	9.310513762	134.3025958	4.6912E−31	6.83225E−29
Gpr65	0.721922552	9.365534671	133.4092603	7.35695E−31	1.0619E−28
ler5l	0.917735422	9.22331753	132.9741944	9.15947E−31	1.31037E−28
Sla	0.573929064	9.546171489	132.091611	1.42872E−30	2.02602E−28
Ptms	0.706758953	9.287837433	131.8631613	1.60296E−30	2.25335E−28
Epsti1	−0.531779216	9.946031824	129.0243258	6.69923E−30	9.33618E−28
Samsn1	0.565617595	9.795395326	127.6319862	1.3511E−29	1.86683E−27
Btg1	0.316118724	12.25005454	126.0369939	3.01804E−29	4.13472E−27
Rpl4	−0.200905454	11.68898179	125.9194397	3.20222E−29	4.35018E−27
Rpl22l1	−0.325682762	10.87574132	122.9210326	1.45111E−28	1.95489E−26
Rps24	−0.209984223	12.00584899	122.8780161	1.48291E−28	1.98122E−26
Il2ra	0.732900379	9.266099444	122.2199043	2.06619E−28	2.73787E−26
Cd74	1.042070273	9.434236978	120.8762601	4.06726E−28	5.34563E−26
Rabgap1l	0.625903862	9.328937377	120.4547377	5.03015E−28	6.55785E−26
Bcl211	0.671196005	9.376444233	119.2060708	9.43956E−28	1.21377E−25
Rps27	−0.20992776	13.23488676	119.2017178	9.4603E−28	1.21377E−25
Fas	0.720279276	9.354790431	119.0791946	1.00631E−27	1.28094E−25
Rps23	−0.172279837	12.48529882	117.8778644	1.844E−27	2.32892E−25
Rpl17	−0.175623878	12.29663229	116.7248327	3.29791E−27	4.13287E−25
Rab11fip1	0.683102221	9.24534037	116.0444077	4.64772E−27	5.77962E−25
Ctsb	0.491115464	9.553686158	115.6909048	5.55461E−27	6.85464E−25
Csf1	0.893917069	9.192117276	114.1779361	1.19125E−26	1.45892E−24
Batf	0.556500291	9.653651878	113.1282182	2.02263E−26	2.45848E−24
Camk2n1	0.677140769	9.340531404	112.320738	3.0394E−26	3.66679E−24
Lmnb1	0.496811846	9.781495667	112.1642896	3.28895E−26	3.93846E−24
Prr7	0.506933212	9.824433563	112.1237154	3.35695E−26	3.99033E−24
Wisp1	0.57314674	9.168186557	110.4669626	7.74251E−26	9.13616E−24
Rps29	−0.210381637	12.2446762	109.1261756	1.52277E−25	1.78385E−23
Rps3a1	−0.189505791	11.67389213	109.0426157	1.58834E−25	1.84727E−23
Rpl12	−0.280198685	10.99235633	108.860878	1.74086E−25	2.01019E−23
Plk2	0.750446155	9.17838771	108.6038869	1.98186E−25	2.27225E−23
Kdm2b	0.56499929	9.446703124	108.5076284	2.08048E−25	2.36852E−23
Wnk1	0.492798635	9.627957555	108.2227911	2.40202E−25	2.71545E−23
Cd83	0.807532146	9.178407827	106.7863598	4.95842E−25	5.56651E−23
Ifng	0.886646176	9.686658841	106.6990667	5.18171E−25	5.77707E−23
Rps27a	−0.184418544	11.80973167	106.5796788	5.50347E−25	6.09377E−23
Cytip	0.350491758	10.18840246	106.0027935	7.36313E−25	8.09744E−23
Lilr4b	0.511360258	9.778154625	105.7520711	8.35625E−25	9.12751E−23
Nfkbib	0.504241566	9.487223272	105.680851	8.66204E−25	9.39802E−23
Scn1b	0.509524106	9.169087199	105.5628385	9.19358E−25	9.90822E−23
Rps15	−0.203059364	11.4907216	102.7590505	3.78493E−24	4.05213E−22
Il17a	1.935391149	9.237168765	102.4199032	4.49166E−24	4.77712E−22
Ucp2	0.363772503	10.01286384	101.8832566	5.88922E−24	6.22256E−22
St6galnac3	0.675416095	9.261096607	101.3057309	7.88274E−24	8.27483E−22
Rpl37a	−0.172845664	12.61561552	100.6238399	1.11221E−23	1.16E−21
Cd6	0.418108973	9.931698154	100.1180091	1.43582E−23	1.48104E−21
Rpl36	−0.186839018	11.87411391	100.1145234	1.43835E−23	1.48104E−21
Rpl9	−0.172551122	11.84224161	99.8545999	1.64006E−23	1.67805E−21
Rps13	−0.169190789	11.9252029	97.97494346	4.2371E−23	4.30799E−21
Ctla2a	−0.609825116	10.33555104	96.53343799	8.77493E−23	8.86597E−21
Stat4	0.501673088	9.506547453	95.6224894	1.39018E−22	1.39588E−20
Nr4a1	0.550612812	9.629989419	95.20303248	1.71827E−22	1.71466E−20
Il7r	−0.558749116	9.75347996	95.17603619	1.74186E−22	1.72754E−20
Rpl26	−0.184107869	11.57423644	94.93673751	1.96568E−22	1.93763E−20
Rps14	−0.146333995	12.65498378	94.80316287	2.10289E−22	2.06033E−20
Rasgrp2	−0.687938938	9.37707238	94.64490756	2.27792E−22	2.21836E−20
Dnajc15	−0.415379881	9.893121495	94.12385202	2.96386E−22	2.86909E−20
Gzmk	−1.043301711	9.363674736	94.00786796	3.14272E−22	3.02412E−20
Rpl35a	−0.177783341	11.72342483	93.76286064	3.55684E−22	3.40236E−20
Rpl37	−0.16620817	12.07301201	93.58838916	3.8846E−22	3.69402E−20
Emb	0.407065297	10.25095358	93.57139524	3.91809E−22	3.70409E−20
Gch1	0.570152772	9.459450391	93.03068278	5.14899E−22	4.83945E−20
D16Ertd472e	0.453585869	9.624017665	92.73130439	5.98986E−22	5.59723E−20
Dgat1	0.530352135	9.77868262	92.53634073	6.60998E−22	6.1412E−20
Nfkbia	0.423596882	10.83366717	92.43061048	6.97272E−22	6.4412E−20
Ly6c2	−1.111488738	9.265996796	91.81855201	9.49997E−22	8.72593E−20
Rpl3	−0.158339089	12.09253162	91.51920698	1.10514E−21	1.00936E−19
Zc3h12a	0.484764166	9.536813666	90.15458744	2.2026E−21	2.00041E−19
Rps9	−0.162455931	11.99537323	90.08851031	2.2774E−21	2.05679E−19
Tnfrsf1b	0.516562473	9.452782192	89.6453515	2.84917E−21	2.55888E−19
Rpl27a	−0.166874022	11.73983306	89.41629258	3.19891E−21	2.85711E−19
Pdcd1	0.790619463	9.244434269	89.09231595	3.76812E−21	3.347E−19
Myl12a	0.247801136	10.67832871	89.02278242	3.90292E−21	3.44779E−19
Pim3	0.642188756	9.328476745	88.91325482	4.1251E−21	3.62426E−19
Rpl23	−0.182988453	11.70859607	88.24623254	5.77932E−21	5.05019E−19
Il22	1.587785436	9.48289887	88.01465782	6.49712E−21	5.64691E−19
S100a11	0.291981912	10.60259181	87.37637479	8.97158E−21	7.75586E−19
Tgif1	0.448665946	9.72028063	87.1158878	1.02345E−20	8.80059E−19
Rpl39	−0.181027763	11.77727203	86.79123751	1.20603E−20	1.03157E−18
Sytl3	0.484538559	9.50441997	86.48786684	1.40597E−20	1.19626E−18
Mir155hg	0.675607589	9.203846162	86.09119012	1.71827E−20	1.45432E−18
Hif1a	0.401934609	9.774243864	86.00779175	1.79228E−20	1.50906E−18
Itgb1	−0.867290308	9.299264735	85.97505545	1.8222E−20	1.5263E−18
Smim3	0.576452859	9.350052324	85.96468815	1.83178E−20	1.52642E−18
Rpl6	−0.160525203	11.76079317	84.93181841	3.08833E−20	2.56031E−18
Rps20	−0.237673584	11.06855654	84.75338603	3.38E−20	2.78781E−18
Bcl2a1a	0.64471644	9.252650209	84.52563174	3.79266E−20	3.11229E−18
Ccl1	1.624101666	9.258098088	83.86340919	5.30168E−20	4.30688E−18
Tmem176b	0.721063124	9.448095178	83.87163544	5.27966E−20	4.30688E−18
Cox17	0.352580634	9.818116404	83.64777925	5.91266E−20	4.77921E−18
Rpl21	−0.169864625	11.76872215	83.24580779	7.2459E−20	5.82772E−18
Hmgb2	−0.387568788	10.71130337	82.84554995	8.87218E−20	7.10038E−18
Commd8	−0.54296912	9.438213878	82.57656026	1.01655E−19	8.09538E−18
Uap1	0.520815246	9.373356657	82.55889475	1.02568E−19	8.12801E−18
Eef2	−0.185290498	11.29631996	80.9150407	2.35633E−19	1.85817E−17
Mmp9	0.58263451	9.175261184	80.89442021	2.38105E−19	1.86855E−17
Emp3	−0.437281554	9.864612689	80.86112424	2.42151E−19	1.89112E−17
Crem	0.520771771	10.06693577	80.83319269	2.45598E−19	1.90881E−17
Tmem176a	0.756251292	9.404489195	80.19433366	3.39339E−19	2.62476E−17
Itm2c	0.438982008	9.518096519	79.53250521	4.74357E−19	3.65164E−17
Itk	0.389293322	9.814325519	79.31793277	5.28776E−19	4.05127E−17
Crlf2	0.486705303	9.388760459	79.07850293	5.96903E−19	4.55167E−17
Ms4a6b	−0.359447432	10.19493409	78.10427151	9.77424E−19	7.41832E−17
Arf6	0.343694888	9.853374067	78.01575022	1.02222E−18	7.72208E−17
Eea1	0.570647144	9.220110798	77.7632572	1.16161E−18	8.73423E−17
Tmem158	0.422938332	9.165141433	77.63465939	1.23975E−18	9.27864E−17
Fth1	0.215979972	11.58471842	77.57335302	1.27884E−18	9.52705E−17
Prkar1a	0.274347844	10.10979937	76.99987246	1.70969E−18	1.26784E−16
Rpl11	−0.151171628	11.70903164	76.76522996	1.92538E−18	1.42126E−16
Stat5a	0.552298427	9.260743354	76.06349512	2.74689E−18	2.01846E−16
Rpl23a	−0.147657414	12.17556349	75.49517478	3.66301E−18	2.67947E−16
Cd28	−0.347012261	10.37952986	75.2579058	4.13073E−18	3.00799E−16
Rps2	−0.18944846	11.63567309	74.93771616	4.858E−18	3.52173E−16
Havcr2	0.539582937	9.180313486	73.34910354	1.08631E−17	7.83989E−16
Nfkbid	0.644113236	9.347296213	72.72063103	1.49364E−17	1.07317E−15
Cbx3	−0.581747509	9.518039516	72.62422047	1.56842E−17	1.12191E−15
Rpl24	−0.15447822	11.77225336	72.39600541	1.7607E−17	1.2539E−15
Sh2d2a	0.376644419	9.846354303	71.99999673	2.15198E−17	1.52583E−15
Lef1	−0.609615782	9.289425739	71.88108079	2.28565E−17	1.61353E−15
Gm27166	0.407317455	9.163327075	71.56233274	2.68636E−17	1.88816E−15
AW112010	0.282452628	11.38322545	71.2150772	3.20331E−17	2.24176E−15
Serpina3g	0.534098778	9.674243135	70.42584586	4.77897E−17	3.33003E−15
Ifitm1	−1.804896002	9.599666975	69.60975443	7.22786E−17	5.01483E−15
Cish	0.464190484	9.408302432	69.50815718	7.60991E−17	5.25734E−15
Myl12b	0.261240272	10.14192399	69.43717684	7.88876E−17	5.4268E−15
Hccs	0.494564115	9.354685384	69.31445298	8.39521E−17	5.75072E−15
Ubald2	0.304205172	10.62012763	69.07611792	9.47356E−17	6.46201E−15
Ppp1r14c	0.355051825	9.162055719	68.72964003	1.12931E−16	7.67075E−15
Ubl3	0.399042618	9.565981005	67.66623714	1.93651E−16	1.30986E−14
Rplp2	−0.157925517	11.91006486	67.41326155	2.20163E−16	1.48298E−14
Rpl30	−0.196263195	10.96407438	66.75449795	3.07515E−16	2.06277E−14
Rpl36a	−0.20636157	11.04527747	65.99089756	4.5301E−16	3.02618E−14
Ifitm3	−0.741460054	9.717437467	65.84393111	4.88081E−16	3.24704E−14
Pycard	−0.484732372	9.57708276	65.33967505	6.30393E−16	4.17661E−14
Ptp4a2	0.290548225	9.957583537	65.07030211	7.22731E−16	4.76884E−14
Ccl5	−0.614177482	13.31111049	65.02719932	7.38714E−16	4.85449E−14
H2-Q7	0.238928118	10.62098954	64.16806184	1.14246E−15	7.47732E−14
Nfil3	0.543821195	9.279162762	64.01922369	1.23211E−15	8.03157E−14
Gnb2l1	−0.219333271	10.54007349	63.52463448	1.58374E−15	1.02822E−13
Tmsb4x	0.134395465	14.24920488	63.32329405	1.75418E−15	1.13432E−13
Srxn1	0.443413556	9.179960772	62.81840721	2.2667E−15	1.4599E−13
Dusp4	0.542015029	9.244687523	62.16159044	3.16399E−15	2.02973E−13
Ifi27	0.364029871	9.579454659	61.73449754	3.93034E−15	2.51138E−13
Dennd5a	0.486880142	9.227017994	61.55510006	4.30525E−15	2.74011E−13
Ube2l6	0.494919463	9.197355951	61.47362964	4.48713E−15	2.84466E−13
Nrip1	0.453730601	9.582617594	61.30329582	4.89261E−15	3.0896E−13
Rnf19b	0.466509748	9.379266424	60.94088293	5.88147E−15	3.6996E−13
Dad1	0.255140794	10.03535203	60.85328081	6.14909E−15	3.85296E−13
Cd81	0.489308098	9.170580291	60.72356256	6.56793E−15	4.0995E−13
Adora2a	0.449099604	9.426691213	60.60452645	6.97734E−15	4.33829E−13
Glipr2	−0.475835778	9.484107632	60.27095878	8.2658E−15	5.11973E−13
2810417H13Rik	−1.104938967	9.337315681	60.12562098	8.89924E−15	5.49103E−13
Rpl28	−0.211074368	10.72552157	59.95350725	9.71248E−15	5.97003E−13
Cxcr3	−0.481054249	9.551371405	59.90276731	9.96612E−15	6.10274E−13
Hk2	0.558083103	9.291512241	59.86859259	1.01407E−14	6.1862E−13
Ckb	0.537418423	9.335711504	59.82713032	1.03566E−14	6.29415E−13
Pqlc1	0.536550639	9.21423837	59.77158922	1.0653E−14	6.45006E−13
Ubl5	0.227393519	10.27393085	59.43006853	1.26718E−14	7.64375E−13
Hlf	0.469359308	9.183131189	59.07360438	1.51883E−14	9.12766E−13
Ggt1	−0.482757461	9.203324774	58.96486419	1.60513E−14	9.61055E−13
Eef1g	−0.232791111	10.38514948	58.86655143	1.68736E−14	1.00657E−12
Tff1	0.800550053	9.186702666	58.58119672	1.95072E−14	1.15939E−12
Asb2	0.474910444	9.480773625	58.26906703	2.28611E−14	1.35374E−12
Rpl15	−0.196567365	10.73583328	58.16857192	2.40592E−14	1.41949E−12
Pdcd4	−0.433321184	9.736958579	57.54915517	3.29637E−14	1.93779E−12
Gm26740	0.385787547	9.658978649	57.29699619	3.74727E−14	2.19487E−12
Arf4	0.289627395	9.97479051	56.75239941	4.94287E−14	2.88471E−12
Kit	0.361389295	9.167862474	56.47666634	5.68692E−14	3.30701E−12
Stmn1	−0.996361487	9.43019399	56.43186032	5.818E−14	3.3711E−12
Btg2	0.279901817	10.53791954	56.13951487	6.75066E−14	3.89754E−12
Esm1	−0.770430889	9.307911702	56.02164157	7.16777E−14	4.12363E−12
Jun	−0.827066689	9.603760111	55.34047173	1.0136E−13	5.81059E−12
Rps8	−0.149468965	11.59257976	55.20418787	1.08637E−13	6.20575E−12
Rps27rt	−0.255171721	11.16195099	55.0140882	1.19669E−13	6.81186E−12
Cd44	0.362141582	9.560095995	54.61856376	1.46347E−13	8.30119E−12
Myo1g	0.396341726	9.439415321	54.50805268	1.54812E−13	8.75068E−12
Calr	0.281098495	10.02078334	54.09506061	1.91021E−13	1.07597E−11
Crbn	0.353059697	9.708183401	53.96723433	2.03861E−13	1.14431E−11
Cd3e	0.233574904	10.3749064	53.67655956	2.36367E−13	1.32218E−11
Nr3c1	0.435805045	9.448742099	53.64404633	2.40311E−13	1.33961E−11
Sp100	−0.41585345	9.553686189	53.59274678	2.46668E−13	1.36563E−11
Klhl6	−0.508204735	9.316905875	53.59681118	2.46159E−13	1.36563E−11
Rps12	−0.210582225	10.77061599	53.54559432	2.5266E−13	1.39403E−11
S1pr4	−0.454655152	9.466008758	52.71694568	3.85253E−13	2.11837E−11
Aplp1	0.432674667	9.212555161	52.59179415	4.10601E−13	2.25009E−11
Gimap4	−0.240367235	10.52502448	52.52162603	4.25537E−13	2.32406E−11
Plk3	0.478782538	9.376309307	52.27013392	4.83675E−13	2.63269E−11
Nfkb2	0.369018011	9.521818169	52.2111144	4.98432E−13	2.70391E−11
Herpud1	0.372438068	9.555345247	52.01800557	5.4994E−13	2.97336E−11
Cotl1	−0.247357975	10.46113625	51.80498811	6.12959E−13	3.30303E−11
Rpl27	−0.143507587	11.47263607	51.4272134	7.43014E−13	3.99055E−11
Cdkn1b	−0.502025248	9.417453754	51.41112286	7.49129E−13	4.01007E−11
Slc25a3	0.260721523	9.949542602	51.20807313	8.30763E−13	4.43238E−11
1500009L16Rik	−0.542177966	9.246966845	51.17448647	8.45099E−13	4.49404E−11
Tbc1d10c	−0.420702224	9.522664674	51.06091305	8.95437E−13	4.74611E−11
Zap70	0.337335162	9.555404972	50.97047958	9.37656E−13	4.94794E−11
Csf2	0.79245829	9.183961698	50.96633727	9.39637E−13	4.94794E−11
Nabp1	0.36892163	9.632417698	50.79434236	1.02569E−12	5.38354E−11
Serpinb1a	0.721125754	9.512639892	50.70625213	1.07277E−12	5.61244E−11
Rpl34	−0.118076419	11.98010888	50.63819169	1.11063E−12	5.79174E−11
Rpl7a	−0.185997252	10.71264639	50.5255593	1.17623E−12	6.11412E−11
Atp1b3	−0.43409369	9.41300625	50.42513044	1.23799E−12	6.41452E−11
Ramp3	0.557408857	9.936798851	50.34255136	1.29119E−12	6.66882E−11
Tmbim6	0.218312849	10.08427218	49.92911906	1.59401E−12	8.20663E−11
Csnk1a1	0.284142186	9.708202059	49.80980859	1.69395E−12	8.69346E−11
Rpl38	−0.14321935	11.67454895	49.67673704	1.81283E−12	9.2741E−11
Ubb	0.178674236	12.9047306	49.33933111	2.15302E−12	1.09797E−10
Itgav	0.460676285	9.245494327	49.23555497	2.26999E−12	1.15398E−10
Dnajb1	−0.621384827	10.31779183	49.17154489	2.34528E−12	1.18852E−10
Slamf6	−0.548414682	9.319043642	49.08519847	2.45083E−12	1.23813E−10
Tmem123	0.308551986	9.654226375	48.55589077	3.21009E−12	1.61664E−10
Cxcr4	0.458227755	9.20350922	47.73294408	4.88415E−12	2.45209E−10
Vamp8	0.288954516	9.668612941	47.46653284	5.59511E−12	2.79168E−10
Psme2	0.231125589	10.07701741	47.47010135	5.58493E−12	2.79168E−10
Dusp5	0.282745296	9.994462064	47.30156077	6.08637E−12	3.02746E−10
Tubb6	0.311404816	9.16596651	47.00909462	7.06581E−12	3.50386E−10
Xbp1	0.346296453	9.544395327	46.81439795	7.8038E−12	3.84513E−10
Gabpb1	0.407342294	9.478019755	46.80899053	7.82536E−12	3.84513E−10
Gimap6	−0.250117271	10.46581517	46.81130486	7.81612E−12	3.84513E−10
Tcf7	−0.458371226	9.419705743	46.79725798	7.87235E−12	3.8565E−10
Il21	0.334899575	9.167189925	46.65641679	8.45895E−12	4.13134E−10
Ppp1r11	0.315315515	9.56745842	46.63219242	8.56417E−12	4.17013E−10
Serpina3f	0.611380344	9.259717975	46.43170786	9.48679E−12	4.60551E−10
C2cd4b	0.305709635	9.163047524	45.77620863	1.32564E−11	6.41625E−10
Ccnd2	0.321927763	9.824613466	45.72543169	1.36045E−11	6.56508E−10
Pdlim1	−0.473620534	9.286476238	45.16874379	1.80767E−11	8.69727E−10
Ttc39c	0.403933345	9.318650364	44.88156534	2.09319E−11	1.00411E−09
Ciapin1	0.392937977	9.338637993	44.67693901	2.32378E−11	1.11143E−09
Smox	0.466037737	9.201962775	44.63380471	2.37554E−11	1.13283E−09
Itpr1	0.395519874	9.29809745	44.54267134	2.48873E−11	1.18332E−09
Csrnp1	0.398371772	9.467469906	44.4996176	2.54407E−11	1.20608E−09
Eef1b2	−0.234877371	10.07539868	44.48805958	2.55913E−11	1.20968E−09
Coro1a	−0.210386427	10.77304014	44.28150328	2.84391E−11	1.34037E−09
Ly6g5b	0.453449596	9.223291205	44.27562159	2.85246E−11	1.34049E−09
Hmgn2	−0.516427634	9.445227782	44.18024862	2.99488E−11	1.40334E−09
Arpc3	0.193568182	10.54007412	44.16091507	3.02461E−11	1.41317E−09
Itgb8	0.150825817	9.157971212	44.02687611	3.23898E−11	1.50897E−09
Rasa3	−0.456532606	9.237633903	43.88549931	3.48159E−11	1.61734E−09
4833407H14Rik	0.432971571	9.210586484	43.61892105	3.98963E−11	1.84803E−09
Srsf5	0.224610507	10.09105297	42.90253888	5.75359E−11	2.64993E−09
Tnfrsf26	−0.421012345	9.206974678	42.90779839	5.73815E−11	2.64993E−09
Uba52	−0.238263321	10.23996246	42.68346594	6.43539E−11	2.95553E−09
Tg	0.21283359	9.163083285	42.49207931	7.0969E−11	3.2501E−09
Eef1a1	−0.107002554	12.38177109	42.46218858	7.20619E−11	3.29083E−09
2700094K13Rik	−0.438643961	9.385257191	42.44288494	7.27767E−11	3.31411E−09
Cdca3	−0.392634098	9.196718956	42.4258423	7.34136E−11	3.33372E−09
Ptpn 18	−0.226744978	10.2346755	42.2886025	7.87502E−11	3.56604E−09
Il10	0.594261639	9.174516082	42.24369134	8.05795E−11	3.63868E−09
Rheb	0.295652408	9.556041475	42.10431461	8.65321E−11	3.89659E−09
Ebi3	0.367076397	9.178699077	41.85523589	9.82872E−11	4.41364E−09
Birc5	−0.679292998	9.251484435	41.7880138	1.01725E−10	4.55537E−09
Traf4	0.397393716	9.359798204	41.65359192	1.08965E−10	4.85815E−09
Naca	−0.15683386	10.80133383	41.65139444	1.09088E−10	4.85815E−09
Xcl1	0.951964559	9.405054453	41.31879274	1.2932E−10	5.74335E−09
Pdia6	0.340678053	9.493316871	41.26199076	1.33133E−10	5.8965E−09
Mki67	−0.402680653	9.20298528	41.2101277	1.36712E−10	6.0385E−09
Cks1b	−0.56316805	9.261610399	41.09631286	1.44909E−10	6.38312E−09
Klrb1b	0.402897716	9.168673107	41.05896621	1.47705E−10	6.48858E−09
Cd4	0.28495697	9.643227058	40.87227781	1.6251E−10	7.11962E−09
Maf	0.361126024	9.568694911	40.76659514	1.7154E−10	7.49493E−09
Ube2c	−0.603273399	9.233354826	40.64117095	1.82912E−10	7.97022E−09
Ifrd1	0.287187244	10.02592468	40.57737019	1.88983E−10	8.21262E−09
Rpl31	−0.16139966	10.87152232	40.55059192	1.9159E−10	8.30362E−09
Dusp10	−0.470357283	9.475528346	40.43935976	2.02814E−10	8.74317E−09
Rbm3	−0.193760967	10.73099358	40.43969521	2.02779E−10	8.74317E−09
Tacc3	−0.331766486	9.190029393	40.29368335	2.18514E−10	9.39495E−09

TABLE 3G
LPL-6 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Ccl5	−2.119299251	13.31114939	553.6615868	2.0112E−122	3.2513E−118
Actb	−1.037279996	13.40503113	371.7898077	7.62957E−83	6.16698E−79
Malat1	−0.585159603	14.66861581	331.2421667	5.15517E−74	2.77795E−70
Tmsb4x	0.298469035	14.2491977	309.5886424	2.68433E−69	1.08487E−65
Jund	−0.708702846	11.83423061	291.9011257	1.91568E−65	6.19377E−62
Kdm6b	−1.224505023	9.740630281	265.2542981	1.22814E−59	3.30902E−56
Pim1	−0.747674341	10.82590639	254.0062819	3.47585E−57	8.02723E−54
Klf6	−0.974714591	9.897242743	244.207249	4.7574E−55	9.61352E−52
Icos	0.600295791	10.25640856	233.1244444	1.24157E−52	2.23014E−49
Dnajb1	−1.387544483	10.31787822	204.9269834	1.75678E−46	2.84001E−43
Tnfrsf4	0.656744874	10.62223191	193.5807006	5.25749E−44	7.7266E−41
Jun	−1.611103318	9.603803257	192.9520131	7.211E−44	9.71443E−41
Klf2	−1.352858036	9.960820117	190.3008952	2.73308E−43	3.39869E−40
Junb	−0.53873041	11.89128335	178.4624427	1.04988E−40	1.21231E−37
Klrk1	−1.134540447	9.564496772	163.4242247	2.0209E−37	2.17799E−34
Klrc1	−1.002669535	9.658443855	158.9563459	1.91284E−36	1.93269E−33
Rps11	0.194712205	12.26304473	156.1743432	7.75479E−36	7.37435E−33
Fos	−1.298192946	9.517399295	144.8988051	2.25988E−33	2.02962E−30
Actg1	0.308629396	12.09922083	140.7810921	1.79643E−32	1.52848E−29
Psme2	0.36279445	10.07701332	140.1516077	2.46638E−32	1.99358E−29
Cd52	0.319567834	11.79358582	139.3304579	3.72932E−32	2.87087E−29
Ifi27l2a	0.787112867	9.817057964	136.8601041	1.29387E−31	9.50759E−29
Cbx3	−0.769736489	9.518048716	136.1258701	1.87275E−31	1.3163E−28
Satb1	0.570904875	9.757032638	135.046907	3.2246E−31	2.17204E−28
Nr4a1	−0.731187746	9.630004042	133.3325151	7.64691E−31	4.9448E−28
Nkg7	−0.477227983	11.21025218	127.7495144	1.27342E−29	7.73982E−27
Arpc2	0.244788106	10.79491082	127.7197104	1.29268E−29	7.73982E−27
Tmsb10	0.208835701	12.94245518	126.3656535	2.55741E−29	1.47654E−26
Rac2	0.253915556	11.09605368	126.0748863	2.96096E−29	1.65058E−26
Dusp1	−0.734404833	9.939529983	121.3508566	3.20189E−28	1.72539E−25
Sh3bgrl3	0.259050953	11.24480074	121.1440221	3.55374E−28	1.85322E−25
Pdcd4	−0.608087104	9.736997086	120.6294586	4.60607E−28	2.32693E−25
Ccl4	−2.269830956	9.567609898	120.086778	6.0553E−28	2.96636E−25
Tra2b	−0.476194641	9.814927917	118.9336673	1.08291E−27	5.14892E−25
Fosb	−0.934865905	9.410873748	117.0575887	2.78852E−27	1.28798E−24
Tubb5	−0.629055114	10.0030371	114.7348946	8.9954E−27	4.03943E−24
Eef2	0.193903782	11.29629909	111.5670215	4.44521E−26	1.9422E−23
Rpl29	0.210961309	11.21424374	111.1928464	5.36859E−26	2.28391E−23
Coro1a	0.300729816	10.77301274	109.4044536	1.32332E−25	5.48533E−23
Zfp36	−0.929098819	9.294666471	107.2992323	3.82783E−25	1.54702E−22
Cotl1	0.313916071	10.46110054	105.4791704	9.59007E−25	3.7813E−22
Btg1	−0.31432151	12.25010724	103.5727856	2.51001E−24	9.66116E−22
Rplp0	0.166102954	12.38774335	103.4192727	2.71223E−24	1.01967E−21
Crip1	−0.502107257	11.66661525	103.2854441	2.90177E−24	1.06614E−21
Cox4i1	0.21654735	10.68632092	101.9225287	5.77362E−24	2.07414E−21
Ptpn22	−0.418069094	10.09356864	101.6750761	6.54183E−24	2.29903E−21
Myl6	0.224771123	10.93118441	98.12750402	3.92292E−23	1.34932E−20
Tuba1b	−0.669934532	9.729931155	95.76193385	1.29563E−22	4.36358E−20
Rgcc	−0.874994054	9.563667858	94.81868148	2.08647E−22	6.88366E−20
Cdkn1b	−0.635174622	9.417482747	93.7734478	3.53786E−22	1.14386E−19
Neat1	−0.596555269	9.477111072	92.32207019	7.36583E−22	2.33482E−19
Csrnp1	−0.610932033	9.467484395	91.63024448	1.04484E−21	3.24824E−19
Naca	0.203875855	10.80131195	90.9215054	1.49486E−21	4.55961E−19
Gem	−0.865598263	9.368397194	89.87230954	2.54038E−21	7.46686E−19
Abhd2	−0.664957436	9.292318122	89.87963305	2.53099E−21	7.46686E−19
Rpl41	0.127967691	12.79519793	89.67974193	2.80008E−21	8.08322E−19
Pfn1	0.239223472	12.14557892	89.50160675	3.0639E−21	8.68964E−19
Btf3	0.194596928	10.71545921	88.29955513	5.62561E−21	1.56799E−18
Ier2	−0.464679761	9.828717858	88.24976501	5.76901E−21	1.58071E−18
Rpgrip1	−0.620409035	9.229072115	87.48124452	8.50828E−21	2.29241E−18
Hspa1a	−1.404194987	11.00156878	87.25336404	9.54728E−21	2.53018E−18
Rpl32	0.144936887	12.44733618	86.78944154	1.20712E−20	3.14747E−18
Epsti1	0.367584515	9.946036789	86.67117338	1.28151E−20	3.2884E−18
Rpl7a	0.213884318	10.71261113	86.19936713	1.6268E−20	4.10919E−18
Atp5e	0.230435333	10.27341219	86.16667568	1.65391E−20	4.11341E−18
Clta	0.31374906	9.873288523	85.62610594	2.17386E−20	5.32465E−18
Klrd1	−0.780902756	9.372668746	85.1636242	2.74669E−20	6.6273E−18
Ppp1ca	0.265838001	10.29794445	85.06970008	2.88031E−20	6.84751E−18
Rps27	−0.178481761	13.23489548	83.42957086	6.60269E−20	1.54694E−17
Eomes	−0.782994701	9.215525466	83.32009501	6.97866E−20	1.61167E−17
Btg2	−0.361177255	10.53796877	82.29599985	1.17159E−19	2.66759E−17
Arhgdib	0.246995265	10.73176252	81.72143316	1.56685E−19	3.51801E−17
Srsf2	−0.38575707	9.857793962	81.57579594	1.68667E−19	3.73517E−17
Ifng	−0.925453687	9.686670275	81.19858443	2.04138E−19	4.45959E−17
Rpl18	0.147120477	11.80688286	80.88213076	2.3959E−19	5.16429E−17
B2m	0.127460393	12.79981702	80.45008985	2.98141E−19	6.34177E−17
Rps6	0.132843484	12.20837322	79.63837783	4.49607E−19	9.43941E−17
Gzmk	−0.915585703	9.363683032	78.08817128	9.85423E−19	2.04235E−16
Tsc22d3	−0.554100907	9.704520503	77.67486703	1.21477E−18	2.48582E−16
Atp5l	0.208815411	10.47764488	76.5962148	2.09741E−18	4.23835E−16
Klrc2	−0.638997942	9.283451384	75.72542726	3.25983E−18	6.42663E−16
Atp5h	0.204975402	10.35716243	75.73020212	3.25195E−18	6.42663E−16
Myl12a	0.216154026	10.67829946	74.71071179	5.44996E−18	1.06149E−15
Cldnd1	0.455613978	9.794877348	74.25249729	6.87378E−18	1.32288E−15
Rpl24	0.143523244	11.77224479	74.13572633	7.29265E−18	1.38698E−15
Tnfaip3	−0.365730976	10.12511135	73.48927117	1.01185E−17	1.90204E−15
Igtp	0.489020478	9.509011969	72.98604439	1.3057E−17	2.4262E−15
Zeb2	−0.683047486	9.266621361	72.37282587	1.7815E−17	3.2727E−15
Hspa1b	−0.982648588	9.33065317	71.96673669	2.18856E−17	3.9753E−15
Gbp2	0.578294327	9.365760865	71.84703864	2.32542E−17	4.17698E−15
Limd2	0.306608864	10.08910343	70.73863745	4.07827E−17	7.24497E−15
Nr4a2	−0.594424353	9.521309096	70.3636035	4.93216E−17	8.66666E−15
Podnl1	0.474592382	9.399899052	69.83512388	6.44745E−17	1.12075E−14
Ubb	−0.227426973	12.90474075	69.5319117	7.51881E−17	1.29308E−14
Ctla4	0.371383943	10.15302447	68.7764088	1.10284E−16	1.87669E−14
Ier5	−0.446282214	9.710419	67.34884443	2.27475E−16	3.83059E−14
Cyba	0.228161069	10.43090095	67.27316027	2.36378E−16	3.93946E−14
Ly6a	0.344276567	10.37489399	66.83157909	2.95723E−16	4.87822E−14
Rpsa	0.151295131	11.60006986	65.95050999	4.62389E−16	7.55048E−14
Izumo1r	0.61967677	9.250974438	65.90232049	4.73833E−16	7.65999E−14
Ptpn18	0.246625147	10.23468686	65.53911194	5.6972E−16	9.11891E−14
Eef1a1	0.126330716	12.38174726	65.51205207	5.77597E−16	9.15434E−14
Cd47	0.243733981	10.23573149	65.08241585	7.18302E−16	1.12739E−13
Tnfrsf18	0.317256822	10.06771506	64.95225433	7.6735E−16	1.19279E−13
Rpl28	0.196367442	10.72547914	64.85165546	8.07542E−16	1.24331E−13
Dnaja1	−0.382910023	10.76375183	64.28950963	1.07416E−15	1.6382E−13
Cdkn1a	−0.572722919	9.693191434	64.04001936	1.21917E−15	1.84198E−13
Pmaip1	−0.551162792	9.419398949	63.93022725	1.28905E−15	1.92951E−13
Psmb10	0.346016435	9.566302759	63.15714108	1.90856E−15	2.83063E−13
Camk2n1	−0.548998521	9.340541632	62.825393	2.25868E−15	3.31944E−13
Rpa2	−0.513404915	9.392689651	62.62460404	2.50109E−15	3.64258E−13
Rbm39	−0.201350849	10.68052293	62.46412644	2.71342E−15	3.91654E−13
Rgs16	−0.549477284	9.19690865	62.21207359	3.08391E−15	4.41191E−13
Rpl7	0.144293297	11.21184535	62.08606475	3.2877E−15	4.66219E−13
Srgn	0.197435701	11.37082448	61.91810443	3.58043E−15	5.03314E−13
Gapdh	0.22553958	10.56198637	61.58565581	4.23896E−15	5.9075E−13
Rps2	0.160373372	11.63563438	61.3663959	4.73829E−15	6.54694E−13
Rgs2	−0.521144086	10.0598516	60.74892465	6.48385E−15	8.88288E−13
Atp5c1	0.250321016	9.90168537	60.61894058	6.92643E−15	9.40947E−13
Gm26532	−0.572078015	9.298938254	60.31224518	8.09423E−15	1.09043E−12
Ctss	0.407612199	9.35788439	59.39882781	1.28746E−14	1.72009E−12
Rpl36al	0.178394642	10.49579188	59.19840331	1.42549E−14	1.8889E−12
Psma5	0.353113416	9.439553675	58.52395081	2.00831E−14	2.63954E−12
Rpl3	0.117312584	12.09252558	58.41988325	2.1174E−14	2.75249E−12
Gimap4	0.227922697	10.52504419	58.40977973	2.1283E−14	2.75249E−12
Ppp1r16b	−0.456851556	9.488158562	58.18107506	2.39068E−14	3.06728E−12
Gbp3	0.466119067	9.305848055	57.61787477	3.1832E−14	4.05193E−12
Kmt2d	−0.509132586	9.2641734	57.50848455	3.36524E−14	4.21725E−12
Srrm2	−0.320172857	9.808268375	57.51207828	3.3591E−14	4.21725E−12
Rora	−0.362384089	9.982422283	57.46868504	3.43403E−14	4.27035E−12
Plek	−0.517944688	9.215823682	57.14493073	4.0485E−14	4.96758E−12
Nfkbia	−0.369646528	10.83370997	57.14120793	4.05617E−14	4.96758E−12
Myeov2	0.282121028	9.682137922	57.06950421	4.20679E−14	5.1133E−12
Litaf	−0.519571904	9.445070319	56.35236309	6.05804E−14	7.30853E−12
Cfl1	0.175243041	11.11282374	56.04269339	7.09143E−14	8.49185E−12
Lmna	−0.624473963	9.713563886	55.98834182	7.2902E−14	8.66569E−12
Rpl31	0.170535302	10.87149283	55.72060327	8.35382E−14	9.8575E−12
Eif4a2	−0.342532769	9.723875751	55.39883565	9.83947E−14	1.15264E−11
Klf4	−0.641217216	9.240094172	54.83835195	1.30862E−13	1.52195E−11
Il22	−1.523067898	9.482900463	54.56924671	1.50066E−13	1.73283E−11
H3f3b	−0.169982377	12.34437077	54.47679797	1.57294E−13	1.80342E−11
Psma2	0.235537521	9.873200775	54.25508068	1.76081E−13	2.0046E−11
Ubl5	0.20032877	10.27392635	53.90086965	2.10864E−13	2.3838E−11
Riok1	0.43384703	9.379913783	53.22660276	2.97206E−13	3.33656E−11
Odc1	0.372271092	10.4535154	53.12397078	3.13148E−13	3.49127E−11
Asb2	0.435113714	9.4807802	52.57892819	4.133E−13	4.54517E−11
Tomm20	0.208801999	10.02363568	52.582178	4.12617E−13	4.54517E−11
Sdf4	0.266427534	9.917368178	52.46598598	4.37765E−13	4.7817E−11
Glrx	0.371027895	9.565807787	52.40309399	4.52011E−13	4.87233E−11
Ptma	−0.20232451	11.28818093	52.40274773	4.52091E−13	4.87233E−11
Rps3	0.104436824	11.96704423	51.85522186	5.97476E−13	6.39655E−11
Pkp3	0.335067835	9.709713743	51.70638646	6.44528E−13	6.85489E−11
Ssr4	0.28033814	9.653692829	51.63120088	6.69688E−13	7.07593E−11
Rps10	0.137124331	11.22177397	51.58076967	6.87113E−13	7.2129E−11
Pomp	0.278699623	9.701368752	51.44364086	7.36823E−13	7.68482E−11
Ifitm2	0.480316373	10.68419752	51.28794721	7.97639E−13	8.25903E−11
Rgs10	0.343212205	9.631731346	51.27700924	8.02095E−13	8.25903E−11
Il2rg	−0.273364109	10.13353391	51.09215035	8.813E−13	9.01715E−11
Tbx21	−0.476153418	9.277692364	50.63469984	1.1126E−12	1.13122E−10
Gcnt2	−0.470647546	9.218058561	50.41597291	1.24378E−12	1.25668E−10
Tesc	0.35234916	9.483450902	49.94337593	1.58247E−12	1.58896E−10
Slc39a1	−0.433417379	9.215153753	49.92774503	1.59513E−12	1.59178E−10
Tnfsf8	0.525733735	10.01783487	49.6323025	1.85435E−12	1.83911E−10
Rpl11	0.110213367	11.70901858	49.60546792	1.87989E−12	1.85307E−10
Tbca	0.241332603	9.75478561	49.50794918	1.9757E−12	1.9357E−10
Stk24	−0.345711816	9.60853542	49.47575144	2.00839E−12	1.95588E−10
Gngt2	0.417816178	9.363465198	49.3565518	2.1342E−12	2.06596E−10
Ric1	−0.453997651	9.254662379	49.34080833	2.1514E−12	2.07021E−10
Commd8	0.336386603	9.438214185	48.22616976	3.79786E−12	3.63291E−10
Eif3h	0.175401684	10.29689224	48.11637516	4.01658E−12	3.81953E−10
Sesn3	0.345251994	9.451624571	48.0760595	4.10002E−12	3.87608E−10
Tacc3	−0.330180442	9.190019982	47.8217631	4.66782E−12	4.3872E−10
Lsm3	−0.397355218	9.359397052	47.76572348	4.80317E−12	4.48832E−10
Acot7	0.29321749	9.577129276	47.63640279	5.13069E−12	4.76682E−10
Ccna2	−0.368001411	9.19373092	47.55051727	5.36046E−12	4.95184E−10
Tuba1c	−0.469993277	9.281183564	46.81782197	7.79017E−12	7.15545E−10
Prelid1	0.27790907	9.693674656	46.79339374	7.88789E−12	7.20427E−10
Gdi2	0.236813278	9.887621903	46.18643907	1.07519E−11	9.76486E−10
Ldha	0.212909741	10.35598102	46.03661224	1.16064E−11	1.0482E−09
Cd74	−0.739270074	9.434236295	46.00417217	1.18001E−11	1.05978E−09
Supt16	−0.441561553	9.269927603	45.92148251	1.23089E−11	1.09937E−09
Got1	0.405705948	9.855701415	45.77574039	1.32596E−11	1.17777E−09
Fxyd5	0.163739145	10.88897458	45.59890503	1.45123E−11	1.282E−09
Sh2d2a	0.289479061	9.84635475	45.32644577	1.66782E−11	1.46532E−09
Zfp36l1	−0.418870473	9.536622714	45.19149366	1.78679E−11	1.56137E−09
Phlda1	−0.539847883	9.44085361	45.17023117	1.8063E−11	1.56993E−09
Notch2	−0.425992475	9.219652512	45.03790208	1.93257E−11	1.6707E−09
Gpi1	0.23829591	9.778165149	44.92930737	2.04278E−11	1.74728E−09
Pdcd1	−0.568864329	9.244437101	44.93462396	2.03724E−11	1.74728E−09
Pnrc1	−0.217943097	10.57790653	44.82469758	2.15487E−11	1.83346E−09
Rpl10a	0.138336371	11.14215396	44.52377247	2.51287E−11	2.12686E−09
AW112010	0.227357928	11.38324175	44.21979772	2.93498E−11	2.47119E−09
Plekhf1	−0.295061063	9.179229479	44.15833723	3.02859E−11	2.5368E−09
Gstm5	−0.448209177	9.202000005	44.13230489	3.06914E−11	2.55751E−09
Tuba4a	−0.412258234	9.389408567	43.88249634	3.48693E−11	2.89076E−09
Ube2s	−0.268614956	10.0029558	43.69026594	3.8468E−11	3.15672E−09
Tagap	−0.466944977	9.424808628	43.69120062	3.84497E−11	3.15672E−09
Nt5e	0.416621625	9.297374279	43.63415359	3.9587E−11	3.23214E−09
Cd27	−0.572422105	9.34285757	43.59576726	4.03711E−11	3.2796E−09
Hjurp	−0.393196909	9.227444004	43.52899827	4.17723E−11	3.37646E−09
Cdkn2d	−0.415706203	9.369245485	43.44303379	4.36483E−11	3.51054E−09
Itgb1	−0.592025611	9.299262307	43.33380996	4.61539E−11	3.69369E−09
Cd160	−0.650849788	9.334772106	43.31831197	4.65209E−11	3.70472E−09
Prdx2	0.285220158	9.529013404	43.19820628	4.9466E−11	3.91399E−09
Dnajc15	0.238508998	9.893117104	43.19161067	4.9633E−11	3.91399E−09
Cd69	−0.413066046	9.886545576	43.00176598	5.46905E−11	4.29187E−09
Gnb2l1	0.158004594	10.54003804	42.81387557	6.02036E−11	4.67909E−09
Slamf6	0.449149176	9.319040639	42.81726381	6.00994E−11	4.67909E−09
Smc4	−0.429041212	9.387774585	42.7743266	6.14331E−11	4.75181E−09
Insig1	−0.434558342	9.37348859	42.70816037	6.35466E−11	4.89188E−09
Lag3	−0.697350346	9.272207901	42.56198867	6.84773E−11	5.24646E−09
Ms4a4b	0.223679571	10.7518482	42.36461224	7.57483E−11	5.77616E−09
Pttg1	−0.391336105	9.448089255	42.14887763	8.45825E−11	6.41953E−09
Stat1	0.341265519	9.58026255	42.13598362	8.5142E−11	6.4318E−09
Hsph1	−0.497945951	9.472478285	42.07543816	8.78193E−11	6.6032E−09
Nrip1	−0.403101209	9.582631136	41.82131157	1.00007E−10	7.48481E−09
Atp5j	0.205249314	9.978678584	41.68575303	1.07187E−10	7.9852E−09
Nucks1	−0.385882183	9.378591222	41.51091348	1.17215E−10	8.69217E−09
Rps20	0.152105258	11.06851844	41.49249368	1.18324E−10	8.69469E−09
Luc7l2	−0.277739676	9.665593924	41.49974923	1.17886E−10	8.69469E−09
Arpc1b	0.161633259	10.55363559	41.32194002	1.29112E−10	9.44442E−09
Ddx5	−0.162093211	11.1992476	41.19466182	1.37798E−10	1.00345E−08
Nusap1	−0.445345836	9.207136218	41.16536981	1.39879E−10	1.01403E−08
Slfn1	0.377286016	9.289471571	40.95793788	1.55541E−10	1.12253E−08
Cytip	0.210964863	10.1883862	40.8692185	1.62765E−10	1.16945E−08
Atf3	−0.562020803	9.29319516	40.67024137	1.80211E−10	1.28907E−08
Ndufa13	0.175764796	10.09895175	40.4790137	1.98739E−10	1.41534E−08
Slfn2	0.241009028	10.08513049	40.44035	2.02711E−10	1.43729E−08
Amica1	−0.49791256	9.335281825	40.34320419	2.13045E−10	1.50397E−08
Rsrp1	−0.252392032	10.00279565	40.30324944	2.17447E−10	1.52837E−08
Eif3m	0.213365247	9.796143519	40.14217018	2.36136E−10	1.65254E−08
Inpp4a	−0.39180413	9.237585118	40.03084006	2.49985E−10	1.74192E−08
Bcl11b	−0.360053334	9.518587772	39.49937961	3.28164E−10	2.27686E−08
Id2	−0.297282362	10.6456213	39.45801276	3.3519E−10	2.31567E−08
Rras2	0.375221763	9.260363101	39.37014601	3.50617E−10	2.41194E−08
Vmp1	−0.333230189	9.490487697	39.25674927	3.71582E−10	2.54533E−08
Plac8	0.394314739	10.56879742	39.04923729	4.13251E−10	2.81882E−08
Iqgap1	−0.285882286	9.634436107	38.96640363	4.31162E−10	2.90879E−08
Klf13	−0.313082682	9.695558545	38.96654438	4.31131E−10	2.90879E−08
Cd226	−0.412885191	9.268596107	38.96334564	4.31838E−10	2.90879E−08
Smdt1	0.229451251	9.710629839	38.94863378	4.35105E−10	2.91736E−08
Birc5	−0.64959892	9.251453099	38.94139823	4.3672E−10	2.91736E−08
Ap2s1	0.279837623	9.49800778	38.89100224	4.48141E−10	2.98134E−08
Cenpe	−0.2171381	9.175299278	38.84242197	4.59434E−10	3.04394E−08
Cd7	−0.654275535	9.494173391	38.78759993	4.7252E−10	3.11786E−08
Smc2	−0.461435056	9.240564708	38.73553039	4.85294E−10	3.18913E−08
Psma6	0.26537951	9.550367808	38.67878428	4.9961E−10	3.26992E−08
Ly6c2	−0.81589776	9.265993835	38.62656686	5.13157E−10	3.34504E−08
Erdr1	−0.417244234	9.351156146	38.61788986	5.15443E−10	3.34645E−08
Rpl37	0.099363637	12.07300492	38.38701049	5.80173E−10	3.75163E−08
Ubl3	0.283805464	9.565982019	38.27260434	6.15203E−10	3.9623E−08
Psmb1	0.163974308	10.16664399	38.2135354	6.3411E−10	4.06787E−08
H2-DMa	0.355376414	9.273410275	37.58887051	8.73414E−10	5.58087E−08
Stmn1	−0.820204514	9.430119458	37.47441949	9.26198E−10	5.89485E−08

TABLE 3H
LPL-7 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Eomes	3.2798103	9.215511584	3251.147989	0	0
Gzmk	3.190153811	9.363664177	2419.333478	0	0
Cd27	2.373366823	9.342839542	1206.34871	2.5442E−264	1.371E−260
Furin	−3.348783874	10.38135368	1145.327777	4.6487E−251	1.8788E−247
Ifitm2	−3.790176258	10.6842835	1115.433989	1.4602E−244	4.7212E−241
Cxcr6	−2.192953647	10.38993282	898.5245923	2.0538E−197	5.5336E−194
Ccl5	1.940472599	13.31106087	868.7682803	6.0444E−191	1.3959E−187
Plac8	−2.710532413	10.56890498	770.0228847	1.7774E−169	3.5916E−166
Esm1	2.269358847	9.307909321	724.0160454	1.7922E−159	3.2192E−156
Gm43291	1.497725884	9.168153577	705.4050464	1.9969E−155	3.2281E−152
Sh3bgrl3	−0.862038487	11.24482102	648.2472167	5.3741E−143	7.898E−140
Tnfsf8	−3.028860279	10.01788231	633.226239	9.9345E−140	1.3383E−136
Sh2d1a	1.383466761	9.507414541	592.0909227	8.7924E−131	1.0934E−127
Bend4	1.324976481	9.167728233	556.482621	4.8952E−123	5.6526E−120
Rgs16	1.955281568	9.196903871	517.915318	1.2025E−114	1.296E−111
Tmsb4x	−0.452472001	14.24921403	481.1750869	1.1859E−106	1.1982E−103
Ly6e	−0.861719259	10.76647189	465.704428	2.7576E−103	2.6223E−100
Tmsb10	−0.499708274	12.94246496	462.9150501	1.1157E−102	1.002E−99
Rpa2	1.383564395	9.392679857	455.3472281	4.948E−101	4.20993E−98
Ifitm3	−2.675579011	9.717470428	450.7042073	5.0683E−100	4.09669E−97
Nkg7	0.867977864	11.21019133	448.0411278	1.925E−99	1.48185E−96
Tox	1.504061266	9.202103104	416.0140164	1.79909E−92	1.322E−89
Cd52	−0.719754738	11.79358625	408.008358	9.94623E−91	6.9909E−88
Emb	−1.227465129	10.25097718	388.8176348	1.4972E−86	1.00849E−83
Chchd10	1.514895153	9.239742304	388.0906979	2.15545E−86	1.3938E−83
Pim1	−1.140164893	10.82570706	385.4996796	7.89981E−86	4.91186E−83
Lgals1	−0.966904165	11.62770282	377.1045116	5.31326E−84	3.18126E−81
Vim	−1.164303346	10.47346981	371.6841636	8.04455E−83	4.64458E−80
Cldnd1	−1.594626701	9.794944744	356.8336127	1.37741E−79	7.67836E−77
Rgs10	−1.522269541	9.631716545	350.6347051	3.08265E−78	1.66114E−75
Actn2	−1.902931209	9.563357125	347.3787198	1.57749E−77	8.22635E−75
Cxcr5	1.132676561	9.169334986	340.3476	5.36006E−76	2.70784E−73
Lgals3	−1.631074577	10.20017765	340.2629549	5.59247E−76	2.73963E−73
Capg	−1.43890794	9.809387956	337.9741008	1.7623E−75	8.37921E−73
Rpl41	−0.313152443	12.79521848	320.3014113	1.24522E−71	5.75151E−69
AA467197	−1.792859182	9.471356876	313.3817233	4.00453E−70	1.79826E−67
Tapbpl	1.233104394	9.305800519	312.4747442	6.31139E−70	2.75757E−67
Ly6a	−1.060460377	10.374912	311.9103347	8.37674E−70	3.56364E−67
Il18r1	−1.528906795	9.526772285	307.7518085	6.74503E−69	2.7959E−66
Saraf	0.698107441	10.21648074	302.7946342	8.10819E−68	3.27693E−65
Asb2	−1.706305638	9.480765257	301.6467395	1.44213E−67	5.68623E−65
Itgb7	−1.03195597	9.956571795	298.2957969	7.74575E−67	2.98137E−64
Rasgef1a	0.954832896	9.166122273	293.4389939	8.85616E−66	3.32951E−63
Klrg1	1.479355795	9.202811068	292.035209	1.79105E−65	6.58048E−63
Tmem176b	−1.947455291	9.448088308	283.3636793	1.3887E−63	4.98882E−61
Tnfsf11	−1.871570551	9.547025163	282.4665441	2.17822E−63	7.65502E−61
Dcp1b	1.217734056	9.182915755	273.4090354	2.05089E−61	7.05418E−59
Rps27	0.343182787	13.23487563	268.9950753	1.87901E−60	6.32836E−58
Fxyd5	−0.561431404	10.88896842	265.4526332	1.11178E−59	3.66797E−57
H2afy	−0.896629741	9.930098566	254.1059628	3.30622E−57	1.06897E−54
Txk	1.1165592	9.335401088	250.682348	1.84367E−56	5.84406E−54
Gm2a	−1.254112994	9.58187137	244.1366839	4.92896E−55	1.53234E−52
Cd2	0.602040611	10.31974063	234.8069914	5.33413E−53	1.62701E−50
Irf7	1.233359958	9.309194937	227.5376027	2.05288E−51	6.1457E−49
Lag3	1.648447237	9.27219078	227.0251467	2.65538E−51	7.80488E−49
Rpl29	−0.426163608	11.21429155	226.6636948	3.18389E−51	9.1912E−49
S100a6	−0.954302844	10.99625671	219.2973162	1.28724E−49	3.65078E−47
Ret	0.739017916	9.163901909	214.7890991	1.23901E−48	3.45342E−46
Tmem176a	−1.728150993	9.404487704	212.7090541	3.52245E−48	9.65151E−46
Ccr5	1.01474002	9.514413429	212.4623074	3.98726E−48	1.0743E−45
Klrk1	−1.632071328	9.564474145	206.9732412	6.28407E−47	1.66538E−44
Wdr95	0.858966671	9.168703843	206.6330617	7.45528E−47	1.9439E−44
Pde4b	−1.037180552	9.658605719	206.3101232	8.76851E−47	2.25003E−44
Neurl3	−1.11843401	9.61965738	204.6604978	2.00846E−46	5.07325E−44
Cd40lg	−1.325579191	9.46906787	203.2747273	4.02941E−46	1.00214E−43
H2-Q7	0.485660268	10.62100119	202.3256105	6.49151E−46	1.59003E−43
Dnajc15	−0.810147548	9.893127081	201.7430432	8.69899E−46	2.09892E−43
Gzma	−2.279019802	10.72577583	199.2659566	3.02008E−45	7.17979E−43
Sub1	0.447317923	11.14878706	198.1250066	5.35805E−45	1.25534E−42
Tnfrsf4	−0.896219752	10.62229818	189.4901987	4.10781E−43	9.4867E−41
Ramp3	−1.526846449	9.936866207	184.7197481	4.51835E−42	1.02878E−39
Il10ra	0.940599026	9.177837324	184.0570113	6.30468E−42	1.41558E−39
Il12rb2	−1.311113717	9.345966917	182.373313	1.46977E−41	3.25483E−39
Rpl3	−0.276118955	12.09253931	182.2652047	1.55185E−41	3.39017E−39
Cd47	−0.591482576	10.23577103	171.4400476	3.58636E−39	7.73027E−37
Nr4a2	0.94692531	9.521282587	169.5951037	9.06986E−39	1.92925E−36
Amica1	−1.349724672	9.33525593	169.0337835	1.20282E−38	2.5253E−36
Sema4a	0.976179233	9.198632285	167.4717442	2.63868E−38	5.46883E−36
Il7r	−0.953618116	9.753450222	166.8045235	3.69087E−38	7.55273E−36
Ctsw	−0.77682414	9.943509554	166.4720465	4.36268E−38	8.81588E−36
Icos	−0.730239997	10.25643633	164.2679456	1.32199E−37	2.63843E−35
Actb	−0.746061335	13.40490306	163.2109404	2.24977E−37	4.43534E−35
Satb1	−0.948024097	9.757058763	160.1639583	1.0419E−36	2.02932E−34
Tagln2	−0.639877159	10.29867207	157.3789496	4.23005E−36	8.14082E−34
Rplp0	−0.262641417	12.38778931	157.2206301	4.58078E−36	8.71211E−34
Gtf2i	0.882631296	9.381266311	156.9371115	5.28314E−36	9.93107E−34
Gpr18	0.970290866	9.406589754	155.8660296	9.05614E−36	1.68278E−33
Klrc1	−1.245205556	9.658438919	154.722076	1.61038E−35	2.95835E−33
Sdcbp2	0.909955184	9.294064909	149.7774031	1.93916E−34	3.5223E−32
Socs2	−1.266440957	9.351659082	148.7076923	3.32227E−34	5.96754E−32
mt-Co1	−0.296844605	12.21554609	147.9872407	4.77442E−34	8.48167E−32
Ahr	−1.187489037	9.328418697	147.556191	5.93126E−34	1.04222E−31
Rora	−0.769975041	9.982396399	147.3734285	6.50277E−34	1.13036E−31
Ctla4	−0.752514198	10.15303783	143.5610512	4.43161E−33	7.62142E−31
Gimap6	0.469906688	10.46581469	143.4578381	4.66797E−33	7.94341E−31
Srgn	−0.392519863	11.37089272	143.1641996	5.41165E−33	9.11299E−31
Ltb4r1	−1.111665991	9.272000172	142.6946671	6.85474E−33	1.14241E−30
Fam46a	−1.314561947	9.504335784	141.6679882	1.14942E−32	1.89607E−30
Samd3	0.636378603	9.164604728	140.6602121	1.90916E−32	3.11753E−30
Hk2	−1.16240928	9.291515007	139.523414	3.38402E−32	5.47061E−30
Itgae	−1.184859251	9.27549806	135.9237287	2.07344E−31	3.31873E−29
Fasl	0.707483582	9.594244101	135.8923984	2.10642E−31	3.33846E−29
Rbm47	0.718009897	9.170928286	135.5181016	2.54338E−31	3.99188E−29
Gpr34	−1.061027039	9.256545758	134.3366515	4.61142E−31	7.1681E−29
Eif1	0.260507074	11.85893183	134.2575124	4.79894E−31	7.38855E−29
Gnas	0.39392693	10.37735049	133.5033298	7.01649E−31	1.07008E−28
Sp100	0.675383289	9.55366719	132.5975297	1.10731E−30	1.67297E−28
Tbxa2r	0.585759135	9.164267126	132.1983671	1.35391E−30	2.02661E−28
Nt5e	−1.088041733	9.297376625	132.0590116	1.45237E−30	2.15404E−28
Gxylt1	0.864574803	9.199924509	131.8738591	1.59435E−30	2.34311E−28
Asap1	0.888126055	9.229868598	130.5342162	3.13089E−30	4.55981E−28
Il2ra	−1.040299441	9.266106978	129.9752671	4.14915E−30	5.98886E−28
Rpl10	−0.310792871	11.48660702	129.9264066	4.25256E−30	6.08379E−28
Fam110a	−0.964708157	9.494264974	129.6194418	4.96378E−30	7.03899E−28
Cbx4	0.781047544	9.354636358	128.9857168	6.83082E−30	9.60235E−28
Slc3a2	0.511278475	10.08968291	128.1171727	1.05808E−29	1.47457E−27
Itgad	0.535714085	9.161955942	126.8819115	1.97163E−29	2.72422E−27
Tnfaip8	−0.821651414	9.630233952	126.0811572	2.95162E−29	4.04372E−27
Nebl	−1.069381966	9.313919832	124.5341642	6.43614E−29	8.74342E−27
Rpsa	−0.277280078	11.60015063	123.8483581	9.09342E−29	1.22503E−26
Epsti1	−0.651296117	9.946025493	123.5305898	1.06728E−28	1.42592E−26
Cst7	0.771669339	9.361569648	123.2695875	1.21733E−28	1.61306E−26
H2-T22	0.511037144	9.836593368	122.1981069	2.08902E−28	2.74561E−26
Klf3	0.838002162	9.422127484	120.9469914	3.9248E−28	5.1168E−26
Cd96	−0.884171126	9.446982611	120.5563123	4.77908E−28	6.18068E−26
Ifitm1	−2.559027388	9.599684322	118.0524471	1.68863E−27	2.16654E−25
Cxcr4	0.877743485	9.203511935	117.4615351	2.27469E−27	2.89548E−25
Dnase1l3	0.522754123	9.161900584	117.0414103	2.81136E−27	3.55066E−25
Ddit3	0.779019377	9.376075281	116.2467391	4.19693E−27	5.25951E−25
Plscr1	−0.95795568	9.521575487	115.5912639	5.84083E−27	7.26329E−25
Tspan3	0.784843484	9.325091853	114.3100538	1.11446E−26	1.3753E−24
Klrd1	−1.164056439	9.372657862	113.7518146	1.47683E−26	1.80867E−24
Rps19	−0.246604045	12.57926856	113.2192993	1.93182E−26	2.34811E−24
Btg2	−0.527557012	10.53785684	112.9321685	2.23284E−26	2.69374E−24
Sat1	0.656951889	9.537032997	111.897264	3.76314E−26	4.50629E−24
Ngfrap1	0.646356558	9.495133067	111.7125177	4.13066E−26	4.91002E−24
S100a4	−1.018352282	9.866562997	111.1597843	5.45887E−26	6.44147E−24
Nfkbia	−0.597111959	10.83361265	105.0791749	1.17352E−24	1.37472E−22
Aprt	−0.701406151	9.637312921	104.6412923	1.46374E−24	1.70237E−22
Susd3	−0.901261435	9.36994386	104.5375265	1.54244E−24	1.78108E−22
H1f0	−1.071867051	9.429812238	104.4247351	1.63279E−24	1.87204E−22
Pfn1	−0.317456871	12.14558154	102.6778946	3.9432E−24	4.48914E−22
H3f3b	0.257055136	12.34434425	102.3962134	4.5457E−24	5.13886E−22
A930011G23Rik	0.339865641	9.15868181	102.3174094	4.73017E−24	5.31027E−22
Gm8369	0.521666409	9.924627075	101.6077892	6.76786E−24	7.54547E−22
Dkkl1	−0.896564378	9.308701044	100.1636514	1.40311E−23	1.55361E−21
Tm6sf1	0.797062802	9.205998818	99.8736915	1.62433E−23	1.78632E−21
Bhlhe40	−0.43201621	10.72350871	99.34549809	2.12079E−23	2.31654E−21
Irf2bpl	0.749110924	9.293163503	98.99862068	2.52678E−23	2.74147E−21
Ccr2	0.622882557	9.897726382	98.98187498	2.54823E−23	2.74632E−21
Irf2	0.698581849	9.326143404	98.03421665	4.11215E−23	4.40245E−21
Atp5l	−0.352277104	10.47765534	97.58180026	5.16767E−23	5.49609E−21
2010111I01Rik	0.659221506	9.402781177	96.19904171	1.03895E−22	1.09776E−20
St8sia1	−0.835504537	9.247015066	95.74994331	1.3035E−22	1.36834E−20
Pdcd1	0.966655751	9.244430667	95.28801588	1.64607E−22	1.71679E−20
Rps27rt	0.36584719	11.16196987	95.19935627	1.72146E−22	1.78392E−20
Krtcap2	−0.449237684	10.06413459	95.17864624	1.73957E−22	1.7912E−20
H2-Q10	0.746706806	9.219532223	94.78298372	2.12444E−22	2.17365E−20
Smco4	−0.864745743	9.324712373	94.70819526	2.20624E−22	2.24315E−20
Itm2b	−0.325043857	10.97659803	94.43754827	2.52948E−22	2.55573E−20
Trps1	0.807993435	9.24785037	94.38115316	2.60258E−22	2.61325E−20
Ehd1	−0.785381669	9.471478828	94.29520457	2.71808E−22	2.71238E−20
Lcp1	−0.445197114	10.29115797	93.45936544	4.14626E−22	4.11218E−20
Ccl4	1.798057092	9.567483078	93.36095469	4.35763E−22	4.29545E−20
Itgb2	0.557196956	9.575080932	93.16885995	4.80177E−22	4.70457E−20
Pttg1	0.665331536	9.448095727	93.09752183	4.978E−22	4.81883E−20
Fubp3	0.676573702	9.185256957	93.09812625	4.97648E−22	4.81883E−20
Ly6g5b	−0.772528223	9.223289292	92.75608537	5.91533E−22	5.69209E−20
Wipf3	0.26176696	9.158140644	92.24996768	7.63914E−22	7.30736E−20
AB124611	0.682659164	9.180450532	92.21780357	7.76431E−22	7.3834E−20
Asap2	0.462878352	9.163205905	92.17975453	7.91504E−22	7.48272E−20
Wbp5	0.710373707	9.336227139	92.08583153	8.29975E−22	7.8008E−20
Lax1	0.750516768	9.205901785	91.84961807	9.35199E−22	8.73898E−20
mt-Co3	−0.242677521	12.09938987	91.67605628	1.02093E−21	9.48524E−20
Gm12840	−0.842973953	10.16274436	91.32502726	1.21909E−21	1.12616E−19
Ostf1	−0.48303019	10.18387303	91.04103711	1.40723E−21	1.29257E−19
Acot7	−0.644244133	9.577154168	90.9245269	1.49258E−21	1.36322E−19
Timp2	−0.865419253	9.295780623	90.80210372	1.58784E−21	1.44208E−19
Rexo2	−0.732259687	9.465193175	90.57002666	1.78545E−21	1.61249E−19
Abhd17c	−0.839404611	9.339494063	89.96047193	2.42966E−21	2.18211E−19
Ubc	0.3685984	11.04999023	89.59143681	2.92789E−21	2.61504E−19
Hspe1	0.538143649	10.27531776	89.36763916	3.27856E−21	2.91215E−19
Ms4a6b	0.412280945	10.19491628	89.30355751	3.3865E−21	2.99159E−19
Klk8	−0.677530964	9.559198221	88.48589784	5.11986E−21	4.49824E−19
Prkch	0.58070113	9.449515994	86.82690444	1.18447E−20	1.03504E−18
Syf2	0.443448656	9.733081568	86.7777254	1.21429E−20	1.05539E−18
Prdx6	−0.457748392	10.19721197	86.54540808	1.36565E−20	1.1806E−18
Adam8	−0.807293103	9.247155567	85.89615093	1.89638E−20	1.63068E−18
Ldlrad4	−0.879974484	9.298455799	84.9562291	3.05044E−20	2.60917E−18
Rcbtb2	−0.877505664	9.39898186	84.63477143	3.58898E−20	3.05365E−18
Gramd1a	−0.736031909	9.45889775	84.52414815	3.79551E−20	3.21247E−18
Socs3	0.669638314	9.492279241	84.41671087	4.00746E−20	3.3742E−18
Kremen2	0.614419032	9.177276538	83.90371615	5.19468E−20	4.35115E−18
Ftl1	0.30419987	10.82047194	83.72493817	5.68634E−20	4.73741E−18
Fyn	0.561444187	9.486733177	83.7151954	5.71443E−20	4.73741E−18
Npc2	0.410579927	9.848489901	83.70139601	5.75446E−20	4.74625E−18
Gcnt2	−0.743016267	9.218046584	83.23349557	7.29117E−20	5.9832E−18
Rpl13	−0.173445727	12.63772739	83.18432332	7.47482E−20	6.10292E−18
Cxcr3	0.586788812	9.551365757	83.01615013	8.13857E−20	6.61147E−18
Perp	0.636271306	9.176884673	81.52799393	1.72797E−19	1.39671E−17
Rps18	−0.182969674	12.47333304	81.01252335	2.24292E−19	1.80393E−17
H3f3a	−0.343723722	10.34149301	80.77491166	2.52949E−19	2.02434E−17
Prr5	−0.668175925	9.209950504	79.99053942	3.76207E−19	2.99594E−17
Maf	0.600777868	9.568684693	79.76182883	4.22374E−19	3.34711E−17
1700001O22Rik	0.372137118	9.160348241	79.58478248	4.6197E−19	3.64303E−17
Slco3a1	−0.761871352	9.251168617	79.16254048	5.72045E−19	4.48916E−17
Rbm3	−0.335572075	10.73102924	78.7953872	6.88877E−19	5.3799E−17
Cyb5a	−0.677604285	9.520917476	78.29568723	8.87153E−19	6.89506E−17
Anxa1	−0.915818021	9.278561592	77.85704634	1.10774E−18	8.56831E−17
Gramd3	0.483169371	10.20641741	77.84616622	1.11386E−18	8.57461E−17
Cd44	−0.628062155	9.560090954	77.66490234	1.22092E−18	9.35419E−17
Cd160	−1.060008934	9.334762898	77.45982745	1.3545E−18	1.03287E−16
Gata3	−0.861175492	9.445565238	77.30607749	1.46415E−18	1.11124E−16
Podnl1	−0.768407408	9.399879407	76.93648778	1.76545E−18	1.33366E−16
Gpr55	−0.713985194	9.217387159	76.83201579	1.86136E−18	1.39957E−16
Cd247	0.514152093	9.534122941	76.54776484	2.14951E−18	1.60875E−16
Rps2	−0.231179288	11.63572242	75.92273731	2.94984E−18	2.19756E−16
Dapk2	−0.812348541	9.267248742	75.61455589	3.4481E−18	2.55697E−16
Bcl2a1d	−0.536568274	9.947945196	74.71398893	5.44092E−18	4.01634E−16
Rpl35	−0.266038037	11.18858014	74.15706214	7.21425E−18	5.30116E−16
Ormdl3	0.662349433	9.242329201	73.61447025	9.49659E−18	6.94669E−16
Rpl24	−0.190402777	11.77226429	73.2218925	1.15863E−17	8.43716E−16
Tesc	−0.660354554	9.483456771	73.0535519	1.26179E−17	9.14715E−16
Cks2	−0.777355745	9.525757792	72.98672918	1.30525E−17	9.41991E−16
Gm12216	0.680896072	9.227687607	72.7754164	1.45275E−17	1.04379E−15
Plek	0.751449862	9.215821963	72.38413926	1.77132E−17	1.26704E−15
Sh3glb1	0.450965438	9.599133015	72.35881311	1.7942E−17	1.27775E−15
Malat1	0.278672905	14.6685717	72.26960928	1.87716E−17	1.33097E−15
Rbpj	−0.711555719	9.385172047	71.94087461	2.21743E−17	1.56537E−15
Ppib	−0.424361083	9.880940736	71.9313067	2.22821E−17	1.56614E−15
mt-Atp6	−0.201773503	12.47131233	71.76755318	2.42101E−17	1.69429E−15
Sh2d2a	0.447240574	9.846353728	71.46835454	2.81741E−17	1.9632E−15
Cish	−0.69379779	9.408299131	71.04548685	3.49083E−17	2.42201E−15
Hint1	−0.384281305	10.08270698	70.72226399	4.11225E−17	2.84097E−15
Cd74	−1.106243236	9.434237857	70.69797546	4.16319E−17	2.86392E−15
Lbh	0.579804787	9.408456529	70.37740415	4.89777E−17	3.35497E−15
Lpin1	0.632547096	9.197406237	69.60019426	7.26297E−17	4.95415E−15
Hsp90ab1	0.345884126	11.19694983	69.53672628	7.50048E−17	5.09466E−15
Ubb	0.242830128	12.90471764	69.26272166	8.61832E−17	5.82945E−15
Tm2d3	0.65663079	9.233563913	69.12669132	9.23372E−17	6.21968E−15
Clic1	−0.354187575	10.3255658	68.54893155	1.23768E−16	8.30222E−15
Mxi1	0.61312214	9.308254267	68.4810021	1.28106E−16	8.55768E−15
Kcnip3	0.214050413	9.158157362	68.20905605	1.47049E−16	9.78268E−15
Rgs2	−0.664820587	10.05989421	68.2006855	1.47674E−16	9.78403E−15
Cd69	−0.645530905	9.886453138	68.1516296	1.51394E−16	9.98955E−15
Irf1	0.591854113	9.431031538	67.47468468	2.1341E−16	1.40243E−14
Gcg	0.648871754	9.162673096	67.15821837	2.50569E−16	1.63996E−14
Arpc3	−0.314794705	10.54009876	67.07583725	2.61261E−16	1.70304E−14
Clint1	−0.604253767	9.518647713	66.99244015	2.7255E−16	1.7695E−14
Myl6	−0.256992464	10.93122698	66.77019019	3.05077E−16	1.97275E−14
Nfkbiz	−0.598905696	9.633433533	66.72696278	3.1184E−16	2.00845E−14
Reep5	−0.520338628	9.637155571	66.49848676	3.50162E−16	2.24632E−14
Nme1	−0.531092689	9.653532734	66.23423055	4.00398E−16	2.55843E−14
Nck1	0.612718075	9.252796487	66.02666346	4.44864E−16	2.83137E−14
Bcl2a1b	−0.398493382	10.39217608	65.1482998	6.94684E−16	4.40402E−14
Gng5	0.34112214	9.899707496	64.67244017	8.84433E−16	5.58506E−14
Cox5a	−0.369902109	10.08152668	64.56707148	9.33016E−16	5.86893E−14
D1Ertd622e	0.615527633	9.208393557	64.30341259	1.06661E−15	6.68325E−14
Ube2b	0.353641396	9.912283123	63.83320012	1.35412E−15	8.45202E−14
Pnrc1	0.298835463	10.57783069	63.57012017	1.54759E−15	9.62243E−14
Ier3	0.686673886	9.17570835	63.29753534	1.77727E−15	1.10082E−13
Cyb5r3	0.589129593	9.274984141	62.76482846	2.32921E−15	1.43718E−13
Sec62	0.390672881	9.756942892	62.73250459	2.36776E−15	1.4554E−13
P2rx7	−0.686106279	9.260764108	62.71139686	2.39327E−15	1.46551E−13
Cd226	−0.718795459	9.268586644	62.40322215	2.79865E−15	1.70728E−13
Maff	−0.785642781	9.305243703	62.11356649	3.2421E−15	1.97037E−13
Cir1	0.540883115	9.390079546	61.8636656	3.68079E−15	2.2286E−13
Mier1	−0.56737739	9.536740084	61.39838388	4.66193E−15	2.81212E−13
Hvcn1	−0.697052978	9.29925934	61.38224575	4.7003E−15	2.82472E−13
Leprotl1	0.387799851	9.724295192	61.16177005	5.25725E−15	3.14773E−13
Akap13	−0.346613669	10.30878346	61.06204963	5.5304E−15	3.29906E−13
Cables1	0.58247393	9.182534864	60.94449572	5.87068E−15	3.48917E−13
Ubald2	0.334201988	10.62010958	60.89344557	6.02491E−15	3.56772E−13
Ass1	−0.613406117	9.534311369	60.42124224	7.65821E−15	4.51834E−13
Fam104a	0.504996169	9.38496573	60.18580376	8.63125E−15	5.05913E−13
Atp5h	−0.278014591	10.35719028	60.18440409	8.63739E−15	5.05913E−13
Dusp10	−0.717056732	9.475530411	60.11639783	8.94103E−15	5.21808E−13
6330403K07Rik	0.600891856	9.187821133	59.89795809	9.9905E−15	5.80959E−13
mt-Cytb	−0.259020182	11.07894922	59.78485862	1.05814E−14	6.13116E−13
Sepp1	−0.723631668	9.293155529	59.50165472	1.22191E−14	7.0548E−13
Il1r2	−0.903532683	9.256685507	59.46822742	1.24285E−14	7.15012E−13
Orai1	0.392968699	9.884602454	59.42944137	1.26758E−14	7.26658E−13
Crtam	0.457167582	9.163663097	59.2478005	1.39016E−14	7.94108E−13
Eif5	0.382500506	9.823460355	59.19925072	1.42488E−14	8.11078E−13
Actg1	−0.24698467	12.09934301	59.02051658	1.56037E−14	8.85083E−13
Vmp1	0.480500703	9.490450465	58.65631384	1.87765E−14	1.06133E−12
Cd3g	−0.238281838	11.10939413	58.41952928	2.11778E−14	1.19289E−12
Lysmd2	−0.676383806	9.243342087	58.30789378	2.24143E−14	1.25816E−12
Ccdc50	−0.636888834	9.24053109	58.24392228	2.31551E−14	1.29524E−12
Coro1a	−0.294730343	10.77307504	58.19082122	2.37886E−14	1.32609E−12
Ctsd	0.432871133	9.641722001	58.04221936	2.56552E−14	1.42523E−12
Adam19	0.588396014	9.250767663	57.92386217	2.72462E−14	1.50843E−12
Gm9844	−0.531404913	9.544148899	57.76929535	2.94735E−14	1.62064E−12
H2-Q6	0.39965633	9.740245985	57.7724562	2.94261E−14	1.62064E−12
Rnf149	−0.678390076	9.332967884	57.76244641	2.95763E−14	1.62078E−12
Faim	0.553709883	9.309636125	57.6673891	3.10407E−14	1.69528E−12
Gstm5	−0.595633706	9.20199523	57.63484148	3.15586E−14	1.71776E−12
Ssr4	−0.462687492	9.653712425	57.61772544	3.18344E−14	1.72696E−12
Ppp1ca	−0.313444097	10.29798996	57.51174091	3.35968E−14	1.81647E−12
Man1a	0.591903753	9.262299772	57.36248846	3.62455E−14	1.94666E−12
Ak2	−0.559791812	9.46480863	57.36453397	3.62078E−14	1.94666E−12
Hilpda	−0.610088711	9.667525426	57.29728897	3.74671E−14	2.00561E−12
Hspd1	0.490465034	9.781069436	57.21625898	3.9043E−14	2.08307E−12
Ifrd1	−0.452953447	10.02590859	57.12858627	4.08229E−14	2.17086E−12
Sptssa	−0.528455842	9.597747238	57.11895346	4.10233E−14	2.17437E−12
Ero1l	−0.653981362	9.301167052	56.87647737	4.64064E−14	2.4453E−12
Znrf1	−0.625877517	9.40064809	56.87516065	4.64374E−14	2.4453E−12
Slc15a3	−0.645993624	9.22733484	56.72999974	4.9995E−14	2.62409E−12
Snrpd3	−0.513107614	9.547220839	56.57419645	5.41174E−14	2.83127E−12
Nab1	0.476701688	9.481616428	56.13698376	6.75936E−14	3.5249E−12
Tmbim4	−0.620175868	9.33363574	55.75215867	8.2208E−14	4.27323E−12
Ptpn6	−0.655690323	9.338656784	55.65343816	8.64416E−14	4.47889E−12
Thap3	0.571712939	9.265378945	55.63069262	8.74476E−14	4.51654E−12
Son	0.380723151	9.69657111	55.47166754	9.48158E−14	4.8815E−12
Erp44	0.484253067	9.382705163	55.39965547	9.83537E−14	5.04757E−12
H2-Q4	0.389723252	9.753745914	55.06953171	1.1634E−13	5.95177E−12
Lmo1	0.219255613	9.158225061	55.00767127	1.2006E−13	6.1227E−12
Prf1	0.305417186	9.16134179	54.73770604	1.37738E−13	7.00212E−12
Sp110	0.488354994	9.437502438	54.636272	1.45034E−13	7.3499E−12
Eif3h	−0.277769071	10.296933	54.59602322	1.48035E−13	7.47854E−12
Itga1	−0.499265851	9.19749427	54.25356867	1.76217E−13	8.87452E−12
Pde4d	0.552817694	9.266026673	54.1068785	1.89875E−13	9.53269E−12
Atf3	−0.817587319	9.293189291	54.0557667	1.94879E−13	9.75362E−12
Ets1	0.28518737	10.24991887	53.90587312	2.10328E−13	1.04943E−11
Ubash3b	0.502003409	9.181348024	53.89976936	2.10982E−13	1.04946E−11
Clec12a	−0.430462755	9.187014324	53.88824045	2.12224E−13	1.0524E−11
Dgat1	−0.55834131	9.778715844	53.80814124	2.21055E−13	1.09284E−11
Cdc42ep3	0.575632949	9.28694131	53.17349427	3.05351E−13	1.50497E−11
Hsp90aa1	0.420791665	10.76849068	53.14096424	3.1045E−13	1.52545E−11
Kdm6b	−0.638583048	9.740481683	53.04665018	3.2572E−13	1.59563E−11
Spcs2	−0.360764471	9.914030831	52.97319432	3.38132E−13	1.65143E−11
H2afz	−0.360541992	10.76566171	52.78471826	3.72186E−13	1.81228E−11
Gm13546	−0.513269881	9.199885349	52.69946318	3.88697E−13	1.88699E−11
Rhoh	0.473436285	9.501551957	52.55043386	4.1934E−13	2.02966E−11
Gm14718	−0.588453419	9.20570763	52.38609479	4.55941E−13	2.19367E−11
Cd48	−0.494282495	9.721189722	52.38800866	4.55497E−13	2.19367E−11
Traf1	−0.367189394	10.10520209	52.10848359	5.25175E−13	2.51183E−11
Cd9	0.629962799	9.231253154	52.1093635	5.2494E−13	2.51183E−11
Armc7	0.550696024	9.197060421	52.04413059	5.42672E−13	2.58786E−11
Eef2	−0.182985174	11.29634654	52.01630705	5.50416E−13	2.61707E−11
Hnrnpdl	0.406565088	9.556908077	51.93389098	5.74011E−13	2.72125E−11
Cox6b1	−0.298181628	10.15773008	51.53029184	7.05009E−13	3.33251E−11
Anp32a	−0.368441055	9.87826882	51.36308833	7.67685E−13	3.61819E−11
Il10	0.872476336	9.17451578	51.1391009	8.60471E−13	4.04371E−11
Ndufs5	−0.512031204	9.463767548	51.08750093	8.8339E−13	4.13939E−11
Fam3c	−0.605630051	9.322868853	51.02033744	9.14139E−13	4.27109E−11
Gna13	−0.397146052	9.985113984	50.90425396	9.69832E−13	4.51185E−11
Cpd	−0.473218402	9.194132269	50.90138385	9.71251E−13	4.51185E−11
Gpr174	0.55340071	9.263821812	50.88606644	9.7886E−13	4.53417E−11
Osr2	0.528324536	9.161148525	50.41408333	1.24498E−12	5.75037E−11
Plxnc1	0.364392898	9.165511777	50.1943726	1.39247E−12	6.41328E−11
Gnai2	−0.334762855	10.17428897	50.13923682	1.43215E−12	6.57729E−11
Cox4i1	−0.221749475	10.68633283	50.06740638	1.48554E−12	6.80319E−11
H2-K1	0.188614934	11.60998915	50.02198623	1.52033E−12	6.94284E−11
Cytip	−0.328069424	10.18842314	50.00987741	1.52974E−12	6.94657E−11
Nrn1	0.483613566	9.165074057	50.01143543	1.52853E−12	6.94657E−11
Rab14	0.426761389	9.461449449	49.89200515	1.62445E−12	7.35599E−11
Gimap7	0.313625671	10.07498565	49.73569548	1.75916E−12	7.94374E−11
Yes1	−0.604422292	9.221082612	49.55380987	1.93005E−12	8.69112E−11
Cxcl10	−0.914697883	9.358345131	49.37721533	2.11184E−12	9.48335E−11
Gimap4	0.259745694	10.52499935	49.36824352	2.12152E−12	9.50043E−11
Rps26	−0.21575601	10.99404089	49.26863753	2.23203E−12	9.96766E−11
Gabarapl2	−0.350190949	9.899410329	48.56016717	3.20309E−12	1.42648E−10
Aldoa	−0.304682663	10.23625965	48.51986093	3.26961E−12	1.4521E−10
Mef2d	0.532711694	9.220655304	48.44143467	3.40301E−12	1.50721E−10
Tmbim6	0.267484208	10.08427654	48.41247816	3.45364E−12	1.52129E−10
Rnf145	0.529781681	9.217590475	48.41300404	3.45271E−12	1.52129E−10
Klk1b27	0.380972786	9.165727377	48.39798189	3.47926E−12	1.52689E−10
Ckb	−0.660760349	9.33571335	48.39461397	3.48524E−12	1.52689E−10
Rnf19b	−0.589896188	9.379257024	48.23892168	3.77324E−12	1.6486E−10
Pld3	0.485699376	9.363216876	48.13576818	3.97705E−12	1.73297E−10
Dennd5a	−0.564488698	9.227020583	47.77273449	4.78602E−12	2.07986E−10
Cd68	0.374640404	9.164093483	47.73200657	4.88649E−12	2.11783E−10
Ifng	−0.824643513	9.686644277	47.71134049	4.93827E−12	2.13455E−10
Nod1	0.399719281	9.170204215	47.68415533	5.00722E−12	2.15858E−10
Ndufa3	−0.350060637	9.879747436	47.57998143	5.2805E−12	2.27033E−10
Pdlim1	−0.602115592	9.286492478	47.41649323	5.73977E−12	2.46125E−10
Dnaja1	0.34905358	10.76370187	47.35226766	5.93095E−12	2.5365E−10
Pnrc2	0.469933719	9.363165739	47.30698162	6.06956E−12	2.58893E−10
Trpc1	0.383243845	9.166364579	47.20240867	6.40217E−12	2.72362E−10
Cd84	0.499531179	9.348586397	47.08726344	6.78955E−12	2.88083E−10
S100a13	−0.354122862	9.897856812	46.79593256	7.87767E−12	3.33378E−10
Hsph1	0.561731891	9.47244434	46.69789632	8.28179E−12	3.49565E−10
Ccnd3	−0.500150776	9.527417169	46.67505351	8.37889E−12	3.52742E−10
Slc25a51	−0.575066526	9.32805566	46.52560617	9.0429E−12	3.79708E−10
Serpinb1a	−0.924931877	9.512638923	46.22319099	1.05521E−11	4.41929E−10
Fdx1	−0.61661336	9.293651654	46.1565072	1.09174E−11	4.56047E−10
Fgl2	−0.588978631	9.496125029	46.11929581	1.11267E−11	4.63594E−10
Calm2	0.260443806	10.41347078	45.85998996	1.27014E−11	5.27842E−10
Nrarp	0.497355543	9.184041384	45.77903133	1.32373E−11	5.48703E−10
Cfl1	−0.209942284	11.11285008	45.74902911	1.34416E−11	5.55746E−10
Gm8730	−0.272607384	10.44469147	45.58287839	1.46315E−11	6.034E−10
Rps9	−0.140221794	11.99538144	45.57537937	1.46876E−11	6.04173E−10
Dctpp1	−0.584823203	9.308258583	45.45062678	1.56535E−11	6.42272E−10
Myeov2	−0.391999007	9.682148255	45.31640752	1.67639E−11	6.86088E−10
Lsp1	−0.305708206	10.32146671	45.30229843	1.68851E−11	6.89304E−10
Ccl1	−1.071553426	9.258105615	45.24994825	1.73425E−11	7.06194E−10
Ccna2	−0.408457876	9.193761792	45.04913135	1.92152E−11	7.80487E−10
Klrc2	−0.651905895	9.283426969	45.01296321	1.95734E−11	7.93043E−10
Zfp36l2	0.427884779	9.814090687	44.98399358	1.98652E−11	8.0285E−10
2310031A07Rik	0.362915586	9.165479785	44.90459464	2.06872E−11	8.33988E−10
Lamb3	0.532127003	9.282561154	44.76329977	2.22351E−11	8.94163E−10
Rpl10a	−0.187109705	11.1422209	44.63983869	2.36823E−11	9.49997E−10
Tmem33	0.477950768	9.3077973	44.5371315	2.49579E−11	9.98685E−10
Larp7	0.487803635	9.322608334	44.48668833	2.56093E−11	1.02222E−09
Laptm5	0.221475236	10.49800706	44.38990272	2.69071E−11	1.07138E−09
2810417H13Rik	−1.100112922	9.337396993	44.380798	2.70326E−11	1.07373E−09
Tnfaip8l2	−0.584535976	9.325792226	44.31580305	2.79451E−11	1.10726E−09
Plekha2	0.500523877	9.289919496	44.30617094	2.8083E−11	1.11E−09
Ptma	−0.225883777	11.28824476	44.22970703	2.92016E−11	1.1514E−09
E130308A19Rik	0.31445378	9.162753622	44.16856614	3.01281E−11	1.18504E−09
Nsmaf	0.506430735	9.239663944	44.08781407	3.13969E−11	1.23195E−09
Eif4a2	0.360471487	9.72382619	43.94614377	3.37537E−11	1.32122E−09
Susd1	0.169765045	9.158248282	43.86105877	3.52534E−11	1.37658E−09
Il4ra	−0.514186967	9.499579295	43.78225573	3.67018E−11	1.42969E−09
Gas7	0.534018731	9.194255021	43.70792329	3.81225E−11	1.48146E−09
Ncl	0.278368496	10.07281784	43.57228777	4.08584E−11	1.58397E−09
H2-DMa	−0.576877869	9.273413107	43.48277925	4.27707E−11	1.65414E−09
Nfkb1	−0.476422063	9.537085465	43.45398589	4.34047E−11	1.67167E−09
Klhl6	−0.579490641	9.316904493	43.45280579	4.34308E−11	1.67167E−09
Rsu1	−0.553456622	9.325990907	43.2691892	4.77036E−11	1.83177E−09
Zfp36l1	−0.538126975	9.536569365	43.14567424	5.08121E−11	1.94651E−09
Myo1g	−0.502350092	9.439423987	42.90718154	5.73996E−11	2.19367E−09
Bcl11b	0.437395638	9.518527425	42.87577242	5.83286E−11	2.22391E−09
Camk2n1	0.51765763	9.340518386	42.78669427	6.1046E−11	2.32205E−09
Cox6c	−0.25524067	10.25790139	42.70764093	6.35635E−11	2.41213E−09
Xcl1	−1.217474518	9.40505696	42.44448966	7.2717E−11	2.75303E−09
Ddx5	0.192028691	11.19922275	42.13065591	8.53743E−11	3.22467E−09
Hic1	−0.58737025	9.270379257	42.04651106	8.91281E−11	3.35861E−09
Hspa8	0.2217404	12.33062837	41.87878413	9.71106E−11	3.65091E−09
Tmem64	−0.615622886	9.248115386	41.48317304	1.1889E−10	4.45934E−09
Chpt1	0.429457135	9.179331566	41.39841629	1.24158E−10	4.64615E−09
Ube2c	−0.66752016	9.233385993	41.22575977	1.35623E−10	5.06348E−09
BC094916	0.462966748	9.179306194	41.13909389	1.41772E−10	5.28085E−09
Kmt2e	0.392340073	9.498176274	40.93206348	1.57614E−10	5.85744E−09
Rps13	0.126889713	11.92521755	40.88192763	1.6171E−10	5.99587E−09
Arhgdib	−0.23489064	10.73178038	40.82445287	1.66536E−10	6.16069E−09
Rps11	−0.128635338	12.26306636	40.75299459	1.72739E−10	6.37555E−09
Nrip1	−0.511508437	9.582600354	40.74521701	1.73427E−10	6.3864E−09
Map1lc3b	0.268218052	9.979640755	40.65040396	1.8205E−10	6.68867E−09
Spcs3	−0.531192179	9.347697431	40.61133177	1.85726E−10	6.80829E−09
Cnbp	0.239051499	10.25781376	40.46190118	2.00488E−10	7.33276E−09
Gimap9	0.386062289	9.581018999	40.26864864	2.21332E−10	8.07689E−09
Siah2	0.494945204	9.298903622	40.20996507	2.28082E−10	8.30444E−09
Il22	−1.480069678	9.482896849	40.13656655	2.36814E−10	8.60301E−09
Ermn	−0.714912853	9.304618523	39.83166035	2.76821E−10	1.00338E−08
Lrrk1	0.468677107	9.191477397	39.74374104	2.89567E−10	1.04724E−08
Gnb1	−0.391064061	9.703237593	39.63283371	3.06487E−10	1.10595E−08
Gimap5	0.370228394	9.666351398	39.62670839	3.0745E−10	1.10696E−08
Phlda1	−0.636144657	9.440824176	39.56734338	3.16939E−10	1.13859E−08
Mns1	−0.550791808	9.250778634	39.43515476	3.39136E−10	1.21294E−08
Ugcg	0.492972956	9.205476436	39.43590289	3.39006E−10	1.21294E−08
Gngt2	−0.558255736	9.363452811	39.36832194	3.50944E−10	1.2524E−08
Rpl28	−0.209984435	10.72557562	39.30306294	3.62872E−10	1.29211E−08
Rasd2	0.252071753	9.160323378	39.25591272	3.71741E−10	1.32078E−08
Cdca3	−0.432676987	9.196735064	38.86561366	4.54008E−10	1.60954E−08
Pyhin1	0.507982275	9.241830884	38.84662598	4.58446E−10	1.62171E−08
Gpr155	0.391019223	9.171320995	38.72724925	4.87358E−10	1.71855E−08
Fdps	−0.577186785	9.325334883	38.7248911	4.87947E−10	1.71855E−08
Pafah1b1	0.325223913	9.629847563	38.45459246	5.60425E−10	1.96953E−08
Ahcyl2	0.477977983	9.277929397	38.43033025	5.67436E−10	1.98984E−08
Tbca	−0.330314256	9.754797449	38.36938604	5.85436E−10	2.04852E−08
Sec61g	−0.241152419	10.28521272	38.33449562	5.95997E−10	2.08097E−08
Ggt1	−0.481485267	9.203331028	38.18802532	6.42455E−10	2.23835E−08
Stmn1	−0.969653028	9.430288892	38.12215366	6.64513E−10	2.31022E−08
Ms4a4b	0.250633898	10.75182838	38.11258677	6.6778E−10	2.31659E−08
Setbp1	0.254687577	9.158648722	38.06296275	6.84981E−10	2.37118E−08
Emp1	−0.541943392	9.358546116	37.96775029	7.19237E−10	2.48444E−08
Itpk1	0.476912809	9.247476152	37.77295203	7.94761E−10	2.73423E−08
Smim3	−0.541785751	9.350048092	37.77252938	7.94933E−10	2.73423E−08
Tap1	0.398451698	9.443533326	37.73515593	8.1031E−10	2.7812E−08
2010107E04Rik	−0.300004943	9.866343542	37.56919881	8.82267E−10	3.02177E−08
Gimap3	0.303898627	9.896326654	37.49661931	9.15716E−10	3.1297E−08

TABLE 3I
LPL-8 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
2810417H13Rik	4.421635993	9.33967971	7636.915091	0	0
Hist1h2ap	2.09574419	9.186994176	1698.909855	0	0
Ccnb1	2.047353729	9.183341398	1613.079657	0	0
Hmgb2	2.042066843	10.71344588	4244.556365	0	0
Dut	2.014738394	9.371284608	1684.500852	0	0
Tk1	1.960291577	9.18674202	1653.526255	0	0
Tmpo	1.849269119	9.399807016	1521.174414	0	0
Malat1	−1.842629645	14.66785796	1809.716204	0	0
Alyref	1.825896572	9.471862774	1532.732128	0	0
Tacc3	2.134080213	9.190377363	1956.52509	0	0
2700094K13Rik	1.744910584	9.385940771	1515.690781	0	0
Btg1	−1.646278161	12.24806463	1559.814146	0	0
H2afz	1.610007538	10.76844958	1970.85919	0	0
Hmgb1	1.500577692	10.29770776	3186.436388	0	0
Anp32b	1.470164134	9.653444707	1632.790581	0	0
Rps27	−1.218652996	13.23455517	2460.77123	0	0
Ptma	1.34946352	11.28926493	3489.188041	0	0
Ube2s	1.317791113	10.00342164	1614.321852	0	0
Erh	1.270303306	9.742194835	1517.556473	0	0
Ran	1.738531804	9.802858584	3198.770133	0	0
H2afx	2.183010877	9.352344222	1727.503557	0	0
Stmn1	4.321604337	9.432950351	6902.354621	0	0
Cdk1	2.239500798	9.197717135	1974.285437	0	0
Birc5	3.697269867	9.252643265	5794.46549	0	0
Ube2c	3.240090144	9.234259206	2977.10756	0	0
Rrm2	3.204542691	9.248571475	3515.307592	0	0
Cks1b	3.075180267	9.262592977	4175.962604	0	0
Nusap1	2.820830963	9.207702494	2838.147599	0	0
Ccnb2	2.788955405	9.212862629	2442.72995	0	0
Cdc20	2.234954113	9.190262317	1579.632094	0	0
Tuba1b	2.745376143	9.732138323	4450.514283	0	0
Asf1b	2.67891665	9.2238456	2993.556039	0	0
Ccna2	2.623409165	9.194246974	3128.32616	0	0
Cdca8	2.623040933	9.208417544	2645.789881	0	0
Top2a	2.621298744	9.286093445	2205.726859	0	0
Smc2	2.577662882	9.241183844	2533.553825	0	0
Hmgn2	2.509685643	9.446134814	2642.35048	0	0
Ppia	0.798577016	11.56625059	1783.957265	0	0
Spc24	2.479141858	9.204585668	2657.29096	0	0
Tyms	2.261136472	9.239440332	1821.034615	0	0
Mki67	2.362693927	9.203436617	2323.523705	0	0
Tubb5	2.46042399	10.00447555	3985.581762	0	0
Cdca3	2.476526339	9.197186463	2533.838424	0	0
Gmnn	1.936716643	9.252450911	1428.654999	0	0
Spc25	1.802840265	9.180565556	1423.731434	0	0
Aurkb	1.728322959	9.176515087	1422.512724	0	0
Rbm3	0.993484866	10.73203615	1418.078619	0	8.5198E−308
Tpx2	1.875133132	9.181174219	1402.012636	7.675E−307	2.5849E−304
Fbxo5	1.86163473	9.18189049	1400.863621	1.3638E−306	4.4995E−304
Rrm1	1.877528798	9.220046023	1360.531885	7.9254E−298	2.5624E−295
Rpl37a	−0.759463956	12.61574203	1355.666009	9.045E−297	2.8671E−294
H2afv	1.493806059	9.565358508	1347.992844	4.2058E−295	1.3075E−292
Ranbp1	1.404278127	9.627530072	1294.507322	1.7655E−283	5.385E−281
Fau	−0.627429509	12.30172216	1267.495359	1.3092E−277	3.9193E−275
Cdkn3	1.737691789	9.177555326	1258.830289	1.0002E−275	2.9399E−273
Rps14	−0.606632061	12.65499309	1255.627678	4.9668E−275	1.4338E−272
Tipin	1.929151372	9.251510347	1251.62808	3.6751E−274	1.0423E−271
Anp32e	1.418380455	9.517546841	1249.901683	8.7187E−274	2.4301E−271
Rad51	1.568013575	9.174694718	1222.970551	6.2115E−268	1.702E−265
Ybx1	0.833180643	10.43974649	1218.225603	6.6741E−267	1.7982E−264
Mcm3	1.966718862	9.247410025	1217.41851	9.9952E−267	2.6489E−264
Rpl13a	−0.62938187	13.13153314	1206.09606	2.8871E−264	7.5278E−262
Cenpe	1.653275333	9.175480245	1197.730234	1.8993E−262	4.8735E−260
Racgap1	1.862785236	9.232911791	1182.243973	4.4076E−259	1.1133E−256
Kif22	1.608511734	9.177558442	1165.313674	2.1072E−255	5.2407E−253
Lig1	1.894174794	9.221722332	1152.147372	1.5317E−252	3.7519E−250
Mcm5	1.93647149	9.223522441	1145.109135	5.1862E−251	1.2513E−248
Dek	1.330339959	9.608297419	1108.987405	3.6773E−243	8.7423E−241
Lsm5	1.16498093	9.641405273	1067.935311	3.0765E−234	7.2079E−232
Rps27rt	−1.505651269	11.16249609	1067.058312	4.7717E−234	1.102E−231
Pmf1	1.64552413	9.215533941	1064.284361	1.9125E−233	4.3545E−231
Shcbp1	1.506527243	9.17318021	1057.136768	6.8412E−232	1.536E−229
Mcm7	1.747507535	9.230448074	1054.889735	2.1063E−231	4.6646E−229
Cenpf	1.666917175	9.175513788	1052.18582	8.1514E−231	1.7808E−228
Rpl34	−0.574832472	11.98009302	1041.129553	2.0623E−228	4.4453E−226
Ska1	1.293432357	9.167812846	1022.411565	2.4146E−224	5.1362E−222
Hcst	−1.243433262	10.61003451	1008.706121	2.3008E−221	4.8305E−219
Rpl18a	−0.561627543	12.84261735	1008.01621	3.2497E−221	6.7351E−219
Gapdh	0.881759066	10.56398779	1002.98404	4.0331E−220	8.2531E−218
Esco2	1.327312143	9.168283663	1000.336843	1.5172E−219	3.0659E−217
Mad2l1	1.648573874	9.208311898	997.1899147	7.3296E−219	1.4628E−216
Ezh2	1.668172168	9.233421923	993.4658486	4.7267E−218	9.3185E−216
Smc4	1.616908446	9.388203106	991.8276439	1.0731E−217	2.0901E−215
Hint1	0.850720336	10.08364789	978.6553338	7.8321E−215	1.5073E−212
Hmmr	1.307226984	9.167659346	947.1292515	5.5818E−208	1.0616E−205
Cenpa	1.819799027	9.395189412	944.3750433	2.2155E−207	4.1646E−205
Anapc5	1.398347276	9.36340878	942.2143264	6.5338E−207	1.2141E−204
Rad51ap1	1.283404233	9.169013279	921.3676391	2.2224E−202	4.0826E−200
Snrpe	0.905699046	9.828152436	913.3257782	1.2445E−200	2.2604E−198
Plk1	1.326982021	9.169293368	908.8251646	1.184E−199	2.1267E−197
Uhrf1	1.454022969	9.180325757	906.7397897	3.3626E−199	5.9736E−197
Nuf2	1.191073084	9.166477547	896.459242	5.7748E−197	1.0147E−194
Pcna	1.440069441	9.444285329	882.2308741	7.1558E−194	1.2439E−191
Rpl36	−0.620306689	11.87416485	879.5581675	2.727E−193	4.6899E−191
Pfdn5	−0.85624987	10.55314292	864.7146686	4.5983E−190	7.8249E−188
Dbi	1.368833292	9.462823711	858.1134292	1.2523E−188	2.1088E−186
Nap1l1	1.185055027	9.498411667	850.4819	5.7122E−187	9.5199E−185
Dnajc9	1.378564642	9.367319875	848.3018439	1.7012E−186	2.8062E−184
Lgals1	1.19567371	11.62962461	845.9087386	5.6366E−186	9.2042E−184
Pfn1	0.80604367	12.14562436	840.3634126	9.0489E−185	1.4628E−182
Knstrn	1.473768485	9.18618408	839.6230027	1.3109E−184	2.0982E−182
Cenpm	1.329309763	9.175946219	827.6359859	5.2921E−182	8.3874E−180
Lsm2	1.380526709	9.294336576	823.0375001	5.2891E−181	8.3013E−179
Cenpw	1.490656497	9.256061112	817.7818314	7.3455E−180	1.1418E−177
Clspn	1.292669733	9.172837657	812.9828057	8.117E−179	1.2497E−176
Pbk	1.157650531	9.166198533	812.7880338	8.9483E−179	1.3647E−176
Hnrnpa3	0.835034638	10.15657482	797.3158283	2.0685E−175	3.1251E−173
Rps15a	−0.540860736	12.40397278	794.0829964	1.0436E−174	1.5621E−172
Ywhah	1.011739916	9.722350699	785.426649	7.9544E−173	1.1797E−170
Prc1	1.603165548	9.193597027	784.9083275	1.0311E−172	1.5153E−170
Kif11	1.323931035	9.173024115	770.7097078	1.2602E−169	1.8354E−167
Prdx1	0.952910094	9.945888311	770.5570053	1.3603E−169	1.9635E−167
Kif20a	1.187224656	9.167869132	764.7075308	2.5439E−168	3.6393E−166
Clic1	0.808262932	10.32602803	762.7488106	6.7824E−168	9.6179E−166
Hmgb3	1.455055923	9.208966791	761.6651289	1.1668E−167	1.6403E−165
Mcm6	1.533695009	9.312060518	761.2803647	1.4147E−167	1.9716E−165
H2-K1	−0.78477459	11.61022938	757.7886343	8.1261E−167	1.1228E−164
Cfl1	0.657597691	11.11327051	745.6811454	3.4872E−164	4.7775E−162
Casc5	1.197590409	9.16829785	740.8335564	3.9494E−163	5.3652E−161
Ccdc34	1.447741361	9.198023808	739.5048275	7.6816E−163	1.0348E−160
Rfc4	1.371829427	9.206979896	738.7492504	1.1214E−162	1.4982E−160
Ncapg	1.232809113	9.171161894	738.4232469	1.3202E−162	1.7493E−160
Cdca5	1.073990128	9.165655149	727.7176521	2.8086E−160	3.6913E−158
Rps27l	1.151450566	9.54350515	726.2661243	5.8091E−160	7.5734E−158
Cdc45	1.123918696	9.168465132	721.1692978	7.4541E−159	9.6403E−157
Slc25a5	0.764127042	10.39499188	716.7972352	6.6542E−158	8.5375E−156
Incenp	1.47758554	9.217026236	712.9734373	4.5142E−157	5.7462E−155
Nucks1	1.286634546	9.378701122	709.2481525	2.9151E−156	3.6817E−154
Tcf19	1.38178144	9.189300183	700.8400864	1.9635E−154	2.4606E−152
Prim1	1.368970463	9.192585042	691.3929603	2.2252E−152	2.7672E−150
Slbp	1.125615982	9.610102043	684.7426234	6.2169E−151	7.6719E−149
Rpl38	−0.602301624	11.67482758	672.1123304	3.4693E−148	4.2488E−146
Rfc5	1.29872706	9.203272872	669.8028531	1.1028E−147	1.3404E−145
Depdc1a	1.080566977	9.167299078	669.40795	1.3439E−147	1.6213E−145
Atp5b	0.684199477	10.2144056	667.0462036	4.385E−147	5.251E−145
Actb	1.341281009	13.40284709	666.0303963	7.2926E−147	8.6685E−145
Set	0.9980865	9.773450143	658.1483932	3.7758E−145	4.4555E−143
Fen1	1.346059401	9.228228642	652.6360738	5.9679E−144	6.991E−142
Rbbp7	1.176391939	9.398753469	651.1468968	1.258E−143	1.4631E−141
Mcm2	1.500969672	9.228064884	646.9215772	1.0438E−142	1.2053E−140
Rpl17	−0.466460143	12.29687914	646.8673029	1.0725E−142	1.2297E−140
Mrpl18	1.089849217	9.412606938	646.1342942	1.5482E−142	1.7626E−140
Hist1h1b	1.090360538	9.168316754	640.2582007	2.9362E−141	3.3193E−139
Fam64a	0.975294834	9.164201841	640.020908	3.3067E−141	3.7122E−139
Sgol1	1.052089005	9.166666095	636.43391	1.993E−140	2.222E−138
Cdc6	0.978089655	9.16484216	635.7066496	2.8687E−140	3.1764E−138
Mybl2	0.99941864	9.165876554	633.8085966	7.4215E−140	8.1616E−138
Shisa5	−0.780179318	11.05001528	633.6115951	8.191E−140	8.947E−138
Ddx39	1.198953115	9.33417475	630.1692678	4.5921E−139	4.9822E−137
Ndufa4	0.938937003	9.736118829	626.7178333	2.5862E−138	2.7873E−136
Hnrnpf	0.638042829	10.40327074	624.7187992	7.0379E−138	7.5347E−136
Banf1	1.165575172	9.354679405	619.6666195	8.8362E−137	9.3978E−135
Neil3	0.927084379	9.16396466	617.4284759	2.7105E−136	2.864E−134
Ncapd2	1.219901417	9.183814831	616.4156886	4.5013E−136	4.7252E−134
Cep55	1.064886567	9.16709682	610.2205471	1.0018E−134	1.0448E−132
Lockd	1.459848715	9.293704619	608.8913956	1.9493E−134	2.02E−132
H2-D1	−0.53825284	12.28212341	606.8538604	5.4081E−134	5.5686E−132
Cit	1.144554276	9.172719925	604.7868245	1.5228E−133	1.558E−131
Nrm	1.336446732	9.221031657	603.5070411	2.8906E−133	2.939E−131
Cbx3	1.370284119	9.517713266	603.3545264	3.1201E−133	3.1525E−131
Vps37b	−1.31771025	10.60451234	603.0754448	3.5881E−133	3.6028E−131
Ckap2l	0.940613678	9.164154324	599.4326761	2.2243E−132	2.2196E−130
Siva1	1.268781533	9.267321464	597.7669302	5.1228E−132	5.0807E−130
Ddx5	−0.748471247	11.19882055	596.8397774	8.1503E−132	8.034E−130
Cox5b	0.721979233	10.04400742	596.6538048	8.946E−132	8.7649E−130
Dhfr	1.14149443	9.174522367	594.1002916	3.214E−131	3.13E−129
Tagln2	0.894454006	10.30009936	591.5405549	1.1583E−130	1.1213E−128
Phgdh	1.224257094	9.327085258	589.7968759	2.7739E−130	2.6692E−128
Pnrc1	−0.970278369	10.57662978	589.1253447	3.8829E−130	3.7143E−128
Hnrnpab	1.039331347	9.483542457	585.1329548	2.8679E−129	2.7272E−127
Orc6	1.275932538	9.234245434	582.8772248	8.8762E−129	8.3914E−127
Rpa3	1.251758221	9.261572437	579.603602	4.5741E−128	4.2991E−126
Bub1	0.865618965	9.163406287	565.9473494	4.2745E−125	3.9943E−123
Ywhae	0.856367486	9.677989159	564.7314682	7.8591E−125	7.3017E−123
Eif1	−0.551908921	11.85871741	564.4588485	9.009E−125	8.3223E−123
Atpif1	0.97015635	9.536110894	564.2183893	1.0162E−124	9.3341E−123
Coro1a	0.724915443	10.77406128	561.0456488	4.9792E−124	4.5476E−122
Chaf1a	1.055816166	9.171628848	557.4474793	3.0191E−123	2.742E−121
Nudt21	0.915354374	9.525574065	556.9359865	3.9008E−123	3.5229E−121
Usp1	1.247336539	9.280558501	556.4284151	5.0299E−123	4.5174E−121
Kif2c	0.832711735	9.162579143	554.3565171	1.42E−122	1.2682E−120
Kifc1	1.023267071	9.168333886	552.2123696	4.1563E−122	3.6918E−120
Melk	0.932950445	9.165498099	551.2116811	6.8612E−122	6.0611E−120
Cenph	0.913153757	9.165027676	548.8637447	2.2242E−121	1.9541E−119
Dlgap5	1.093157682	9.173768452	546.4514966	7.4463E−121	6.5068E−119
Gins2	1.150040727	9.177204875	542.5356577	5.2943E−120	4.6015E−118
Rps17	0.641426861	10.61650637	541.2097388	1.0286E−119	8.8924E−118
Rpl37	−0.446037144	12.07327741	536.8593604	9.0923E−119	7.8184E−117
Tpi1	1.264543892	9.324340119	533.6405003	4.5598E−118	3.9002E−116
E2f1	1.124053463	9.176359719	532.0684582	1.0022E−117	8.527E−116
Mxd3	0.855249103	9.163935023	525.4969701	2.6954E−116	2.2813E−114
Dtymk	1.209633615	9.241120176	524.6423187	4.1357E−116	3.4822E−114
Fignl1	1.011624926	9.16854214	524.1311225	5.3428E−116	4.4752E−114
Rpl19	−0.3918592	12.11778681	523.3530167	7.8896E−116	6.5744E−114
Snrpd1	0.928277472	9.48039714	521.1514562	2.377E−115	1.9706E−113
2700029M09Rik	1.118173547	9.300983612	519.4396362	5.6035E−115	4.6217E−113
Ubb	−0.799096052	12.90434358	518.3005588	9.9147E−115	8.1361E−113
Btg2	−1.147482427	10.53608889	515.3700463	4.3039E−114	3.514E−112
Rps16	−0.424371382	12.35159808	514.640466	6.2028E−114	5.039E−112
Ncapg2	0.92687554	9.167047467	512.6513438	1.6802E−113	1.3581E−111
Trip13	0.861097481	9.164683183	504.775635	8.6876E−112	6.9872E−110
Hnrnpa2b1	0.646022506	10.12102555	501.1795627	5.2641E−111	4.2128E−109
Prelid1	0.84830737	9.694516794	499.9674286	9.6618E−111	7.6942E−109
Mis18bp1	0.989123396	9.167160156	499.953746	9.7282E−111	7.7092E−109
Kif23	1.213665525	9.183868072	499.4902839	1.2271E−110	9.6766E−109
Cenpk	0.977765263	9.169824327	499.0265271	1.548E−110	1.2148E−108
Cd53	−0.807204644	10.54707895	498.8751605	1.67E−110	1.3042E−108
Rfc3	1.195377368	9.204736752	498.7666346	1.7633E−110	1.3705E−108
Nek2	0.822261208	9.163065177	498.6012871	1.9156E−110	1.4817E−108
Rbm39	−0.637569471	10.67924352	496.9893908	4.2956E−110	3.3068E−108
Rps23	−0.406286702	12.48558878	495.1050408	1.1041E−109	8.4595E−108
Kif4	0.767602407	9.162351714	493.2798993	2.7552E−109	2.1009E−107
Calm3	0.837078543	9.648791113	492.9071306	3.3209E−109	2.5205E−107
Mcm4	1.237704698	9.249504159	492.3921324	4.2985E−109	3.2472E−107
Lrr1	0.734760355	9.161832843	490.4959146	1.1115E−108	8.3574E−107
Tubg1	1.161123937	9.198088185	489.4483765	1.8786E−108	1.406E−106
Tcp11l2	−1.634422416	9.433736844	488.1472401	3.6054E−108	2.6859E−106
Aurka	1.068308243	9.172368587	484.3164126	2.4576E−107	1.8225E−105
Ppp1ca	0.632645325	10.2987092	481.41766	1.0502E−106	7.7522E−105
Bub3	0.978303874	9.426163753	481.1590552	1.1955E−106	8.7845E−105
Gimap6	−0.955890984	10.46579288	476.4855883	1.243E−105	9.0926E−104
Srsf3	0.779744858	9.795217966	474.5266694	3.317E−105	2.4154E−103
Pkm	0.696135927	10.16306624	472.559179	8.8895E−105	6.4443E−103
Dnmt1	1.166056603	9.204828421	470.7607517	2.1889E−104	1.5797E−102
Rpl27	−0.473037067	11.47321822	470.6997649	2.2568E−104	1.6215E−102
Rad54l	0.7727084	9.162948533	470.3781788	2.6514E−104	1.8966E−102
Ckap2	0.975820995	9.166713898	468.4327904	7.0276E−104	5.0048E−102
Cox5a	0.656023439	10.08238974	466.6749309	1.6956E−103	1.2023E−101
Hdgf	0.972628235	9.445842742	464.44492	5.1833E−103	3.6591E−101
Gltp	0.950180258	9.448373052	463.8695222	6.9155E−103	4.8607E−101
Dpy30	1.023120178	9.328389705	461.7599758	1.9902E−102	1.3928E−100
1500009L16Rik	1.477260477	9.247571334	460.2967524	4.143E−102	2.8869E−100
Fth1	−0.680771391	11.58497142	456.9938832	2.1681E−101	1.5043E−99
Actg1	0.643649634	12.10129241	456.1278088	3.3462E−101	2.3118E−99
Mtch1	1.10643288	9.287149805	453.1033746	1.5231E−100	1.04779E−98
Cbfb	1.032820636	9.370135648	452.9002844	1.6863E−100	1.15512E−98
Bub1b	0.959966682	9.170515641	452.1480922	2.4583E−100	1.67683E−98
Diaph3	0.970096611	9.171298634	449.7795334	8.0556E−100	5.47168E−98
Lsm3	0.997787164	9.359624215	448.7499742	1.3494E−99	9.1277E−98
Aunip	0.670434396	9.161326688	437.7231237	3.38833E−97	2.28232E−95
Mif	0.805872116	9.844056396	436.030808	7.91233E−97	5.3075E−95
Rpl23a	−0.403001699	12.17600595	433.3491727	3.03352E−96	2.02644E−94
Lbr	0.95205731	9.432005712	432.6024105	4.4104E−96	2.93409E−94
Apitd1	0.909142965	9.168446716	428.856621	2.88234E−95	1.90967E−93
Hprt	0.783237884	9.584874345	428.8234294	2.93069E−95	1.93377E−93
Gpr132	−1.004205471	9.86576297	428.4891485	3.46518E−95	2.27716E−93
Txn1	0.701081293	10.00315511	427.6708888	5.22182E−95	3.41765E−93
Dctpp1	1.094803772	9.308632593	425.8304762	1.31339E−94	8.56142E−93
Lsm6	0.903925819	9.407177719	421.4776028	1.16367E−93	7.55498E−92
Rnaseh2b	1.068717641	9.200404519	421.2669066	1.29327E−93	8.36282E−92
Gltscr2	−0.679984369	10.29702999	420.75614	1.67057E−93	1.07595E−91
Rabac1	−0.958867451	9.787137327	420.4818867	1.91672E−93	1.22959E−91
Fkbp2	1.050724632	9.308168075	420.4200596	1.97704E−93	1.26327E−91
Cks2	1.338981401	9.526677109	419.9007985	2.56471E−93	1.63233E−91
Rps13	−0.378713374	11.92563194	414.2002714	4.46526E−92	2.8308E−90
Ifngr1	−0.847815544	11.1133823	413.3409323	6.86908E−92	4.33772E−90
B2m	−0.355443938	12.79997004	412.3439791	1.13216E−91	7.12156E−90
Rps9	−0.383350015	11.99561226	412.0841273	1.28964E−91	8.08074E−90
Cdca2	0.821439849	9.166105864	411.4821296	1.74384E−91	1.08845E−89
Dtl	1.106896693	9.18924485	411.1634528	2.04585E−91	1.27205E−89
Atp5f1	0.643350443	9.822922483	409.6484511	4.37169E−91	2.70777E−89
Ptpn18	−0.758941589	10.23424984	409.0895315	5.78512E−91	3.56955E−89
Cdk4	0.985774613	9.357013312	408.7739438	6.77655E−91	4.16539E−89
Sumo2	0.540187794	10.26363646	405.7481332	3.08788E−90	1.89086E−88
Tmsb4x	0.414119715	14.2494783	405.2692031	3.92567E−90	2.39481E−88
Ndc80	0.962619823	9.175406644	404.1370231	6.92418E−90	4.20813E−88
Nme1	0.836072856	9.654201349	402.2147578	1.81473E−89	1.09876E−87
Ypel3	−1.161475289	9.689654982	401.7638557	2.27493E−89	1.37226E−87
Exosc8	0.957856248	9.341378608	400.5883908	4.10062E−89	2.46434E−87
Jund	−1.055752186	11.83099851	400.4895616	4.30887E−89	2.5799E−87
Metap2	0.915717569	9.437531426	399.7303403	6.30429E−89	3.76071E−87
Akap13	−0.793215709	10.30793282	398.3535435	1.25704E−88	7.47107E−87
Sdf2l1	0.994414931	9.406656647	396.5991925	3.02869E−88	1.79348E−86
Sapcd2	0.764844708	9.163945742	395.3862743	5.56287E−88	3.2821E−86
Lsm4	0.755115667	9.643812444	395.3395144	5.6948E−88	3.34771E−86
Gm9843	−0.915259848	10.49271816	392.3295433	2.57476E−87	1.5081E−85
Rps21	−0.62326269	10.92456287	390.9949889	5.02652E−87	2.93353E−85
Kif15	0.84331882	9.168692803	390.6634871	5.9352E−87	3.45139E−85
Ccne1	0.880144523	9.170524832	388.3596153	1.88362E−86	1.09142E−84
Cbx5	1.024894498	9.19230852	384.5739452	1.25648E−85	7.2544E−84
Rpl28	0.498102261	10.72710227	383.8744651	1.78419E−85	1.02645E−83
Hnrnpk	0.53146514	10.15656035	383.3645686	2.30383E−85	1.3207E−83
Psmb2	0.681940819	9.694383479	379.5347498	1.57128E−84	8.97573E−83
Cmc2	1.041743071	9.281104329	379.2509403	1.81152E−84	1.03116E−82
Spag5	0.706452348	9.163496664	374.1589094	2.3264E−83	1.3196E−81
Psat1	1.006005575	9.197437084	372.7504146	4.71356E−83	2.66432E−81
Poc1a	0.77141726	9.16662515	371.2310014	1.00964E−82	5.68707E−81
Nans	0.88765801	9.365818631	368.675622	3.63541E−82	2.04063E−80
Snrpb	0.57851806	9.840444383	365.151612	2.12744E−81	1.19004E−79
Ppih	0.980938815	9.212614072	363.5653328	4.71252E−81	2.62699E−79
Orai1	−1.016728243	9.884536331	362.5648516	7.78216E−81	4.32325E−79
Hnrnpa1	0.775375728	9.626739462	362.0919788	9.86428E−81	5.46116E−79
H2-Q7	−0.697290381	10.62132196	361.8112175	1.13553E−80	6.26519E−79
Rpl9	−0.352804756	11.84254424	361.6211449	1.24907E−80	6.86818E−79
Actr3	0.58213293	10.23457831	361.0728975	1.64424E−80	9.01042E−79
Paics	1.00190604	9.271004075	360.0098018	2.80188E−80	1.53024E−78
Pa2g4	0.925734895	9.357958	359.9198753	2.9311E−80	1.59543E−78
Rfc2	1.00323133	9.292032711	359.229939	4.1425E−80	2.24724E−78
Atp5a1	0.627339286	9.818566382	358.8898969	4.91255E−80	2.65606E−78
Psmd13	0.861321347	9.383420226	358.355887	6.42077E−80	3.45994E−78
Rpl27a	−0.355187932	11.74011835	356.7387685	1.4445E−79	7.75805E−78
Gpsm2	0.900753226	9.172278225	356.3796708	1.72946E−79	9.25778E−78
Dck	0.997033102	9.191785175	356.3011689	1.79889E−79	9.59766E−78
Ssr2	0.86771444	9.385650464	355.9665601	2.12749E−79	1.13135E−77
Cmtm7	0.934755685	9.513680523	355.7956012	2.3179E−79	1.22856E−77
Ssrp1	0.866024797	9.399511454	355.7340231	2.39058E−79	1.26295E−77
Atp5j	0.57633364	9.979028433	355.6056347	2.54953E−79	1.34253E−77
E2f8	0.654183684	9.162243958	354.7642703	3.88751E−79	2.04044E−77
Gnai2	0.652274503	10.17405449	353.6515535	6.79163E−79	3.55318E−77
Lilr4b	−1.271690435	9.778014426	353.5422247	7.17432E−79	3.74129E−77
Pkmyt1	0.925729349	9.188417389	353.5314431	7.21321E−79	3.74948E−77
Slc3a2	−0.909174492	10.08938712	352.8096247	1.03588E−78	5.36734E−77
Raly	0.620771468	9.75257472	352.2901969	1.34407E−78	6.94192E−77
Plk4	1.012850484	9.204610036	351.2839875	2.22605E−78	1.14606E−76
Ywhaq	0.759607883	9.638348777	350.7916279	2.84939E−78	1.46233E−76
Nhp2	0.965616532	9.336771458	347.9230005	1.20071E−77	6.14264E−76
Prdx4	0.95685906	9.185355071	347.3384828	1.60964E−77	8.20866E−76
Ttk	0.594320893	9.161194325	346.9284717	1.97705E−77	1.00506E−75
Ubald2	−0.910108518	10.61959322	346.3238081	2.67728E−77	1.35677E−75
Cox7a2	0.563324176	9.911912802	346.1469211	2.9256E−77	1.47798E−75
Nup62	1.005454222	9.206164865	346.0910614	3.00871E−77	1.51523E−75
Cdk2	0.981233292	9.192856049	345.9266664	3.26723E−77	1.64031E−75
Haus4	0.985440832	9.208147658	345.7031703	3.6547E−77	1.82916E−75
Hells	1.087821722	9.221371755	344.8659781	5.56121E−77	2.77477E−75
Rps24	−0.405347353	12.00637056	344.8094632	5.72106E−77	2.84574E−75
Tuba1c	1.190293172	9.28147513	343.4777414	1.11556E−76	5.53193E−75
Ect2	0.731575748	9.165310866	343.2551281	1.2473E−76	6.16632E−75
Chaf1b	0.954765111	9.189533469	343.1341221	1.32533E−76	6.53209E−75
Cotl1	0.615218959	10.46246128	341.9240189	2.4314E−76	1.19471E−74
Rps26	0.445540671	10.99491833	341.6432091	2.79905E−76	1.3712E−74
Capzb	0.553581167	10.15938328	340.7800705	4.31505E−76	2.10746E−74
Mrpl42	0.937339318	9.309229813	340.6852723	4.52513E−76	2.20341E−74
Il2rg	−0.835336928	10.13208397	338.9763865	1.0661E−75	5.17553E−74
4930579G24Rik	0.94917606	9.180623293	338.8571651	1.13178E−75	5.47794E−74
Junb	−0.943261022	11.88898263	336.5520948	3.59562E−75	1.73513E−73
Ncaph2	0.911927157	9.286995177	336.4469465	3.79031E−75	1.82363E−73
Emp3	0.793797327	9.865128415	334.8325828	8.51662E−75	4.08545E−73
Tnfaip3	−0.949263973	10.12331381	334.7605728	8.82979E−75	4.22315E−73
Gimap3	−0.902235267	9.895535563	334.5883792	9.62615E−75	4.59045E−73
Pgam1	0.94467201	9.352897068	334.0316833	1.27262E−74	6.05091E−73
Cenpp	0.638773234	9.162492986	333.9931832	1.29743E−74	6.15078E−73
Vim	0.855008339	10.47562831	333.5659031	1.60746E−74	7.59832E−73
Vdac1	0.887345388	9.320038733	332.2835275	3.058E−74	1.44127E−72
Psma4	0.770905394	9.544071463	331.5369072	4.44682E−74	2.08975E−72
Cdkn2a	1.028553278	9.187324767	331.0716756	5.61534E−74	2.63123E−72
Ncaph	0.74820308	9.167317127	328.5739561	1.9651E−73	9.18143E−72
Traf1	−0.842403186	10.10488831	328.4463672	2.09495E−73	9.75992E−72
Neurl3	−1.151353941	9.619302411	327.1367677	4.04028E−73	1.87687E−71
Vdac3	0.834505977	9.365333685	325.806207	7.87442E−73	3.6475E−71
Impdh2	0.851176704	9.378159405	325.6656739	8.44944E−73	3.90268E−71
Saraf	−0.801725651	10.21652778	324.5600821	1.47109E−72	6.77538E−71
Smc1a	0.940917599	9.298422522	323.9352535	2.01249E−72	9.24259E−71
Fdps	1.173461658	9.32579499	323.4946271	2.5102E−72	1.14957E−70
Foxm1	0.630168945	9.162231863	323.3252654	2.73274E−72	1.24795E−70
Rpl18	−0.347893772	11.80722476	320.9543542	8.97477E−72	4.07545E−70
Pold2	0.971125766	9.227590909	320.9547906	8.9728E−72	4.07545E−70
Ubc	−0.807279913	11.04900464	319.2561808	2.1034E−71	9.52481E−70
1700097N02Rik	1.145940071	9.227500037	317.3504743	5.47057E−71	2.47031E−69
Rnf26	0.918800269	9.202614329	315.8383443	1.16793E−70	5.25928E−69
Brip1	0.682303488	9.163572773	315.4570916	1.41406E−70	6.3499E−69
Cd3g	−0.510882198	11.10863423	313.5489424	3.68235E−70	1.649E−68
Anxa2	0.921408878	9.843831779	313.1314335	4.54019E−70	2.02753E−68
Got1	−1.503058838	9.856934685	312.1931746	7.26878E−70	3.23711E−68
Il7r	−1.159630154	9.752616304	312.1595397	7.39245E−70	3.27415E−68
Syce2	0.973513782	9.186518067	312.1627233	7.38066E−70	3.27415E−68
Ccr2	−1.363324439	9.897377867	310.7556679	1.49489E−69	6.60282E−68
Tubb4b	0.985482027	9.441615817	310.1736737	2.00166E−69	8.81714E−68
Bard1	0.7156241	9.16703328	309.8750016	2.32517E−69	1.02143E−67
Rps28	−0.497840868	11.70804915	309.4766684	2.83942E−69	1.24396E−67
Zfp367	0.842713939	9.17481005	309.4573584	2.86705E−69	1.25267E−67
H2-Q4	−0.898731428	9.753196254	307.5382342	7.50776E−69	3.27144E−67
E2f7	0.613202567	9.162536468	307.1197385	9.26146E−69	4.02475E−67
Hjurp	0.991807601	9.227531733	306.0744122	1.56461E−68	6.78108E−67
Hat1	0.94341255	9.268309904	306.0270499	1.60222E−68	6.92554E−67
Ndufc2	0.713850984	9.498050133	305.8636729	1.73906E−68	7.49698E−67
Tpt1	−0.370821499	11.78414713	303.762904	4.98859E−68	2.14483E−66

TABLE 3J
LPL-9 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Vps37b	−3.362309366	10.60466024	553.5415461	2.1358E−122	3.4528E−118
Ubald2	−3.004928151	10.62016629	523.2616369	8.2591E−116	6.6758E−112
Junb	−2.255821875	11.89138657	469.9759664	3.2434E−104	1.7478E−100
H3f3b	−1.178871544	12.34439093	430.2412867	1.44003E−95	5.81989E−92
Ifngr1	−1.844725191	11.11290817	395.5179928	5.20745E−88	1.68367E−84
Bhlhe40	−2.046123117	10.72362795	388.2228925	2.01724E−86	5.43512E−83
AW112010	1.174769842	11.38326993	356.4332675	1.68361E−79	3.88817E−76
Cd52	0.932440577	11.79358549	322.7676071	3.61464E−72	7.30427E−69
Tnfrsf4	−2.757825477	10.62218143	315.7136553	1.24331E−70	2.23326E−67
Eif1	−0.893416996	11.85895519	311.8836544	8.4896E−70	1.37243E−66
Odc1	−2.920870292	10.45345646	304.1215933	4.16711E−68	6.12414E−65
Btg1	−1.28118989	12.25019835	303.6088436	5.38941E−68	7.26043E−65
Tmsb4x	0.581187345	14.2491853	302.157629	1.1161E−67	1.38791E−64
Gramd3	−2.802981311	10.20645101	301.2956029	1.71991E−67	1.986E−64
Hspa5	−1.550719809	10.97847279	281.551035	3.44828E−63	3.71632E−60
Ctla4	−2.513468645	10.15301427	272.2227397	3.71946E−61	3.75805E−58
Jund	−1.558244203	11.83437558	255.6988809	1.48623E−57	1.41332E−54
Dusp5	−2.250898553	9.994499887	254.2297622	3.10702E−57	2.79045E−54
Pnrc1	−1.500131777	10.57796425	251.0077589	1.56582E−56	1.33226E−53
Ifrd1	−2.375646739	10.02595917	249.5366907	3.27677E−56	2.64861E−53
Prr7	−2.75505733	9.824432052	249.3588408	3.58277E−56	2.75805E−53
Nfkbia	−1.99916409	10.83378406	242.998769	8.72683E−55	6.41263E−52
Pim1	−1.845131276	10.82605822	235.7608354	3.3042E−53	2.32242E−50
Tnfaip3	−1.895396718	10.1251933	218.6736324	1.76077E−49	1.18602E−46
Bcl2a1b	−1.652180963	10.39213885	216.7889935	4.53742E−49	2.93408E−46
Tgif1	−2.501012681	9.720337198	214.475046	1.45073E−48	9.02017E−46
Icos	−1.845684668	10.25638736	210.0099268	1.36678E−47	8.1835E−45
Orai1	−2.063220862	9.884609199	204.7883085	1.88354E−46	1.08748E−43
Il21r	−1.962235376	10.19623449	203.4843995	3.62652E−46	2.0216E−43
Crem	−2.638056333	10.0668258	197.6552503	6.78459E−45	3.65599E−42
Cd160	2.206995649	9.33477913	182.0716813	1.71042E−41	8.91955E−39
Cytip	−1.413213899	10.18835805	178.9512357	8.2113E−41	4.14824E−38
Btg2	−1.410335764	10.53805397	177.5543337	1.6574E−40	8.11927E−38
Rgs2	−2.460498875	10.05981908	172.6649968	1.937E−39	9.20988E−37
Gna13	−1.697172725	9.985101538	171.227445	3.99104E−39	1.8434E−36
Ramp3	−3.194515909	9.93665422	169.8774295	7.86932E−39	3.53376E−36
Gpr132	−1.680424877	9.866138363	162.2711639	3.6095E−37	1.57706E−34
Rsrp1	0.967312622	10.002844	155.2107284	1.25934E−35	5.3575E−33
Hspa8	−0.8840235	12.33059378	150.107401	1.64242E−34	6.80805E−32
Kdm6b	−2.430981026	9.740743634	147.7492684	5.38196E−34	2.17512E−31
Dnaja1	−1.426863641	10.76378984	144.5283367	2.7232E−33	1.07374E−30
Tbc1d10c	1.212453764	9.522701275	142.6216867	7.11128E−33	2.73717E−30
Traf1	−1.340039639	10.10523686	141.5244384	1.23557E−32	4.64516E−30
Got1	−2.192776394	9.85564432	140.3055035	2.28248E−32	8.38605E−30
Serpinb9	−2.267244697	9.858124549	138.1940714	6.60916E−32	2.3743E−29
Tnfsf8	−2.583712667	10.01779871	137.396967	9.87356E−32	3.46991E−29
Arf4	−1.368873021	9.97476194	135.071322	3.18519E−31	1.09557E−28
Dgat1	−2.031965751	9.778611253	134.2108859	4.91298E−31	1.65465E−28
Fosl2	−2.219055063	9.531543255	133.6905648	6.38502E−31	2.10654E−28
Sub1	−0.8321836	11.1487442	132.4885171	1.16981E−30	3.78224E−28
Lmnb1	−1.713264533	9.781458041	132.1686548	1.37433E−30	4.35636E−28
Nr4a1	−2.090701396	9.630029378	131.7109619	1.73069E−30	5.38046E−28
Pde4b	−1.764328126	9.658595001	130.8028443	2.73461E−30	8.34108E−28
Srgn	−0.731632739	11.37077253	128.7034672	7.87464E−30	2.35744E−27
Rora	−1.510772327	9.982441992	126.5708186	2.30623E−29	6.77865E−27
Nr4a2	−2.221776331	9.521329297	124.4447829	6.73268E−29	1.94358E−26
Zc3h12a	−1.897723673	9.536850747	123.5261202	1.06969E−28	3.03379E−26
Ctsw	0.930564149	9.943520924	123.4280412	1.12389E−28	3.13256E−26
Cd48	1.086641614	9.721154005	122.8259103	1.52237E−28	4.1713E−26
Itm2b	0.58610183	10.97660085	122.7037866	1.61902E−28	4.36218E−26
Cd28	−1.127738832	10.3795945	122.4420043	1.84737E−28	4.89584E−26
Nfkbiz	−1.840698584	9.633469169	122.3528469	1.93228E−28	5.03827E−26
Samsn1	−1.744732813	9.795351469	121.9802503	2.33147E−28	5.98263E−26
Itgae	1.72002363	9.275517599	121.8280393	2.51738E−28	6.35875E−26
Rnf125	−1.773543349	9.561296235	121.7912041	2.56456E−28	6.37825E−26
Hif1a	−1.505670523	9.774250056	119.7969403	7.00793E−28	1.71652E−25
Slc3a2	−1.234943945	10.08971534	118.3977452	1.41883E−27	3.42341E−25
Cd7	1.838925955	9.494193586	117.2006182	2.59451E−27	6.16805E−25
Hilpda	−1.952428815	9.667484361	116.4590431	3.77087E−27	8.83476E−25
Gpr183	−1.695171481	9.68048749	114.4391392	1.04422E−26	2.41156E−24
Hsp90aa1	−1.439535496	10.76840824	113.1243036	2.02663E−26	4.61443E−24
Ubb	−0.634972292	12.9047583	113.0579016	2.09565E−26	4.70531E−24
Ptp4a1	−1.480320602	9.696547191	111.6659421	4.22885E−26	9.36488E−24
Sash3	1.316630069	9.280817169	109.2523432	1.42887E−25	3.12149E−23
Coro1a	0.627749664	10.77296532	106.2309167	6.56248E−25	1.41452E−22
Actb	0.907502265	13.40512845	105.5259815	9.36618E−25	1.99228E−22
Ddx5	−0.644534498	11.19926646	104.0441527	1.97857E−24	4.15398E−22
Cdkn1a	−1.967048903	9.693214366	103.6652262	2.39559E−24	4.96502E−22
Cnn2	0.823207984	9.902895339	100.8167278	1.00901E−23	2.06476E−21
Lmna	−2.182044064	9.713552635	99.72532929	1.75068E−23	3.53768E−21
Arhgap31	−1.622267935	9.6544108	96.82563034	7.57097E−23	1.51102E−20
Xist	−2.484105042	9.888219824	96.72908307	7.9493E−23	1.56717E−20
Hspe1	−1.341804559	10.27526821	96.08881383	1.09844E−22	2.13944E−20
Abi3	1.306134092	9.334710046	95.69364832	1.3411E−22	2.58098E−20
Rrad	−1.921524767	9.540636021	95.48107352	1.49312E−22	2.83974E−20
H2afz	−0.974226952	10.76535167	93.52885095	4.00322E−22	7.52513E−20
P2ry10	−1.511318756	9.588153587	92.98229741	5.27642E−22	9.80443E−20
Mxd1	−1.609829978	9.600690864	92.34661385	7.27504E−22	1.33646E−19
Bcl2a1d	−1.24869947	9.947927963	91.96777364	8.80995E−22	1.60024E−19
Prdx6	−0.967912422	10.1972206	91.5415933	1.09271E−21	1.96275E−19
Lilr4b	−1.440483077	9.778164612	91.48947472	1.12187E−21	1.99299E−19
Fam110a	−1.679558179	9.494286279	90.86306193	1.53967E−21	2.70547E−19
Hsp90ab1	−0.858760511	11.19689045	90.06409284	2.30568E−21	4.00792E−19
Coq10b	−1.53671868	9.509959599	88.75880416	4.46008E−21	7.67039E−19
Cd38	1.313844577	9.272488233	88.58034841	4.88114E−21	8.30616E−19
Neurl3	−1.473553701	9.619697122	88.3936069	5.36439E−21	9.03341E−19
Fth1	−0.567457067	11.58469958	86.84849168	1.17161E−20	1.95261E−18
Akap13	−0.848619293	10.30887901	86.79463258	1.20396E−20	1.98604E−18
Il4ra	−1.582100662	9.499604335	86.17634412	1.64585E−20	2.68755E−18
Satb1	−1.408753663	9.757012703	85.69752921	2.09675E−20	3.3896E−18
Dusp1	−1.530840947	9.939629974	85.67286338	2.12307E−20	3.39817E−18
Srsf5	−0.903198748	10.09111839	85.09898727	2.83796E−20	4.49789E−18
Cd3g	0.471720583	11.10947799	84.99935977	2.98462E−20	4.6844E−18
Ubc	−0.779495031	11.05009877	84.31851779	4.21152E−20	6.54648E−18
Rac2	0.462122743	11.09605968	84.20990673	4.44936E−20	6.85031E−18
Sh2d3c	1.218788569	9.19941797	83.84734452	5.34493E−20	8.15153E−18
Ppp1cc	−0.923264626	10.14021217	83.69132112	5.78386E−20	8.73849E−18
Ppp1r15a	−1.499647208	9.595479955	82.25975518	1.19327E−19	1.77601E−17
Emb	−1.047852737	10.25090288	82.25279597	1.19748E−19	1.77601E−17
Socs3	−1.700674574	9.492344664	81.83481982	1.47949E−19	2.17431E−17
Tnfrsf18	−1.027239187	10.0676873	81.19430596	2.04581E−19	2.9795E−17
Itk	−1.164677422	9.814304773	81.05650718	2.19355E−19	3.16615E−17
Gch1	−1.625035979	9.459439724	80.85130967	2.43357E−19	3.48151E−17
Rgcc	−2.013100019	9.563703364	80.57143357	2.80384E−19	3.97604E−17
Sp100	0.923940711	9.553726962	80.47733171	2.94059E−19	4.1337E−17
Herpud1	−1.409570605	9.555337805	80.10733411	3.54614E−19	4.94197E−17
1810041H14Rik	1.354825414	9.21120969	79.71596422	4.32294E−19	5.97304E−17
Susd3	1.085969427	9.369960996	79.55560648	4.68843E−19	6.42314E−17
Rinl	0.974544852	9.448193104	79.53459661	4.73855E−19	6.43726E−17
Ube2s	−0.993765017	10.00293497	78.4765122	8.09551E−19	1.0906E−16
Dusp10	−1.717465499	9.475523882	78.16195183	9.49295E−19	1.26829E−16
Cd3e	0.58619296	10.374978	77.43783083	1.36966E−18	1.81492E−16
Furin	−1.321937592	10.38150283	77.13934464	1.59312E−18	2.07696E−16
Gadd45b	−1.537760322	9.727376493	77.14809203	1.58608E−18	2.07696E−16
Rnf157	−1.556704338	9.351515537	75.91210474	2.96576E−18	3.83556E−16
Rel	−1.541336876	9.441996052	75.09801289	4.47917E−18	5.74684E−16
Fosb	−1.833251464	9.410902867	74.90950785	4.92791E−18	6.2728E−16
Nfkb2	−1.351023559	9.521792478	74.24075671	6.91478E−18	8.73316E−16
Mbnl1	0.718281043	9.849977707	73.3013403	1.11292E−17	1.39469E−15
Csrnp1	−1.52260673	9.467509493	72.98524101	1.30623E−17	1.62435E−15
Kdm2b	−1.451262627	9.446694828	72.83509919	1.40948E−17	1.73936E−15
Vgll4	−1.268334583	9.732088334	72.19282088	1.95164E−17	2.39017E−15
Sqstm1	−1.19547316	9.660274476	72.16222124	1.98214E−17	2.40927E−15
Ptpn7	1.086828727	9.307714169	70.44758814	4.72659E−17	5.70224E−15
Ptprcap	0.6964048	10.04011854	70.09358467	5.65566E−17	6.77255E−15
Fasl	−1.316167045	9.594289128	69.62504673	7.17204E−17	8.52523E−15
Gzma	1.647822529	10.7255561	69.16497394	9.05622E−17	1.06863E−14
Dnajb6	−0.842670368	10.02350611	69.03232018	9.6863E−17	1.1347E−14
Ctsd	0.815625996	9.641722886	68.78729408	1.09677E−16	1.27557E−14
Twf2	0.959303046	9.389086426	68.65428397	1.1733E−16	1.35482E−14
Dnajb1	−1.76825082	10.3180278	68.14703578	1.51747E−16	1.73982E−14
Arhgdib	0.495735889	10.73174892	67.9987325	1.63601E−16	1.86251E−14
D16Ertd472e	−1.176485153	9.623998584	67.7530717	1.85308E−16	2.09489E−14
Maff	−1.470538345	9.30528636	67.54649177	2.05777E−16	2.31013E−14
Arid5a	−1.145208968	9.656952379	67.29570725	2.3369E−16	2.6054E−14
Bcl11b	0.918496067	9.518633779	67.04751294	2.65042E−16	2.9347E−14
Lcp1	0.582999991	10.29118475	66.78424301	3.0291E−16	3.33118E−14
Gm12840	−1.432116469	10.16273225	65.97236177	4.57291E−16	4.99497E−14
Ifnar1	−1.245408007	9.536369908	65.79959531	4.99185E−16	5.41599E−14
Ccr9	1.552636581	9.278717469	65.07952837	7.19355E−16	7.75273E−14
Rbm39	−0.54358267	10.68058111	64.55664829	9.37965E−16	1.00418E−13
Cfl1	0.413893348	11.1128037	64.18560915	1.13233E−15	1.20429E−13
Cd226	1.090319319	9.268603322	63.99459494	1.24761E−15	1.31823E−13
Nmrk1	−1.462700729	9.470715907	63.44007075	1.65321E−15	1.73544E−13
Ptp4a2	−0.807378816	9.957611547	61.91530565	3.58552E−15	3.73958E−13
Ppp1r18	0.785511357	9.553224076	60.76888267	6.41845E−15	6.65132E−13
Clk1	−0.958741139	9.766510063	60.56036792	7.13563E−15	7.34742E−13
Peli1	1.000856627	9.756264686	60.39582424	7.75774E−15	7.93744E−13
Ndfip1	−1.004103122	9.657936964	59.4305111	1.2669E−14	1.28809E−12
Atp5l	0.440049168	10.47763691	59.3617818	1.31192E−14	1.32553E−12
Tsc22d4	0.825276707	9.491104749	59.08944213	1.50665E−14	1.51283E−12
H2-Q7	−0.595713074	10.6209645	59.05974548	1.52957E−14	1.52636E−12
Hmgb2	−0.75986792	10.71114671	58.85699736	1.69558E−14	1.68164E−12
Tgif2	−1.215191779	9.272991879	58.66690328	1.86757E−14	1.84092E−12
Ms4a4b	0.546195203	10.75186324	58.63792834	1.89527E−14	1.85691E−12
Dennd4a	−1.326848682	9.353141394	57.78339494	2.9263E−14	2.84979E−12
4930523C07Rik	−0.909932353	9.830309453	57.35236731	3.64325E−14	3.52675E−12
Med10	0.841244026	9.430585613	57.27171139	3.79576E−14	3.65251E−12
Nfkbie	−1.310554368	9.398336132	56.89961293	4.58636E−14	4.36616E−12
Gimap4	0.496815742	10.52507831	56.89744873	4.59141E−14	4.36616E−12
Ier2	−0.975482231	9.828762331	56.8735566	4.64753E−14	4.39369E−12
Relb	−1.186985542	9.473479165	56.23204924	6.44031E−14	6.05315E−12
Nkg7	0.586133805	11.21029847	56.16392406	6.66737E−14	6.23033E−12
Gabpb1	−1.283624775	9.477984036	55.60889581	8.84226E−14	8.21517E−12
Ninj1	−1.261893918	9.366255933	54.08307596	1.9219E−13	1.77539E−11
Tpt1	−0.325215434	11.78327961	53.9762298	2.0293E−13	1.86396E−11
Actn2	0.965714565	9.563403652	53.92498431	2.08292E−13	1.9024E−11
Lsp1	0.535349746	10.32145964	53.76099128	2.26424E−13	2.05639E−11
Rnf166	0.864754523	9.39636208	53.53747986	2.53706E−13	2.29129E−11
Tnfrsf1b	−1.199287429	9.452787431	53.05790689	3.23859E−13	2.90861E−11
Ptma	−0.475826165	11.28813239	52.50547005	4.29052E−13	3.83207E−11
Lck	0.468090608	10.31669256	51.95127581	5.68951E−13	5.02604E−11
Calm2	−0.601880603	10.41348638	51.95191835	5.68765E−13	5.02604E−11
3830406C13Rik	0.90926778	9.301772413	51.17445011	8.45115E−13	7.42507E−11
Asb2	0.928426346	9.480791591	50.85879632	9.92555E−13	8.67332E−11
Hmha1	0.652669475	9.750300427	50.06435076	1.48786E−12	1.29316E−10
Hspd1	−1.069494786	9.781010215	49.88364348	1.63139E−12	1.41032E−10
Areg	−1.923385968	9.386120367	49.80905363	1.6946E−12	1.45718E−10
Apol9b	0.886455736	9.167676629	49.50417242	1.9795E−12	1.69316E−10
Psmb8	0.434299989	10.43462791	49.35929888	2.13122E−12	1.81333E−10
Dok1	0.955105997	9.246169552	48.3539275	3.55831E−12	3.01171E−10
Tnfsf11	−1.406891552	9.546989381	48.2925552	3.67143E−12	3.09127E−10
Traf4	−1.236074371	9.35979803	48.17646755	3.89535E−12	3.26281E−10
Lilrb4a	−1.08433259	9.64690885	47.98172583	4.3021E−12	3.58494E−10
Ogt	0.704006931	9.590260945	47.88727385	4.51442E−12	3.74257E−10
Cks2	−1.25825363	9.525654391	47.68150363	5.014E−12	4.13553E−10
Sh3bgrl3	0.360547616	11.2447853	47.53739765	5.39646E−12	4.40602E−10
Abracl	0.55270054	9.935287369	47.53825866	5.39409E−12	4.40602E−10
Tnfrsf9	−1.42773064	9.401976428	47.34661806	5.94807E−12	4.83198E−10
Gm8369	−0.832266542	9.924762802	47.22681655	6.32294E−12	5.11084E−10
Pelo	0.94676423	9.234996852	47.03540285	6.9716E−12	5.60711E−10
Cnbp	−0.563596949	10.25781838	46.92285364	7.38367E−12	5.90913E−10
Il2rg	−0.677940365	10.13360006	46.75705615	8.03551E−12	6.39912E−10
Ccl5	0.919582539	13.31121661	46.4956193	9.18235E−12	7.27656E−10
Tob1	−1.175037157	9.420105584	46.44658961	9.41501E−12	7.42454E−10
Nrip1	−1.112584475	9.582654591	46.21144382	1.06155E−11	8.3306E−10
Wdr1	0.693500318	9.566573023	45.91086687	1.23758E−11	9.66505E−10
Arhgap30	0.83146301	9.369684229	45.82771058	1.29124E−11	1.00357E−09
Ctsa	0.775835324	9.447143126	45.51061925	1.51814E−11	1.17427E−09
Cd2	−0.606370172	10.31972667	45.00764771	1.96266E−11	1.51088E−09
Sh2d2a	−0.818274264	9.846355515	44.79805531	2.1844E−11	1.6736E−09
Cdc42	0.401636828	10.40470796	44.76997118	2.21595E−11	1.68977E−09
Pfn1	0.349264905	12.14557694	44.61396337	2.39974E−11	1.82132E−09
Batf	−0.991153728	9.653675216	44.57301579	2.45046E−11	1.85113E−09
Ptpn22	−0.694250299	10.09364713	44.48055916	2.56896E−11	1.93162E−09
Nhp2l1	−0.775628966	9.714941638	44.38193943	2.70168E−11	2.02201E−09
Uhrf2	−1.094311266	9.55449696	44.32834676	2.77666E−11	2.06855E−09
Ets1	−0.570424212	10.24999257	44.24122854	2.90302E−11	2.15276E−09
Snx18	−1.132431204	9.331532268	43.86391069	3.5202E−11	2.59852E−09
Mfsd6	−1.152082823	9.369452083	43.78578375	3.66357E−11	2.69205E−09
H2-D1	−0.274687932	12.28188438	43.52350373	4.18898E−11	3.06421E−09
Kpna1	−1.137981458	9.374079051	43.41627872	4.42492E−11	3.22222E−09
Marcksl1	−1.285775771	9.352433315	43.24937144	4.81892E−11	3.4934E−09
Thy1	0.455287107	10.28931692	43.22676676	4.87492E−11	3.51821E−09
Adam19	0.923901938	9.250780528	43.19470424	4.95546E−11	3.56044E−09
Socs1	−1.195444572	9.398296399	43.16486195	5.03162E−11	3.59917E−09
Lin54	−1.157900026	9.319410902	43.10713832	5.18228E−11	3.69061E−09
Cd3d	0.395146119	10.55258599	42.83010569	5.97062E−11	4.23338E−09
Dbnl	0.782581322	9.387216148	42.72872524	6.28821E−11	4.43909E−09
Hsph1	−1.264161017	9.472504163	42.69129717	6.40968E−11	4.50517E−09
Gm26917	0.710657091	9.523381771	42.21037434	8.19641E−11	5.73606E−09
Fam78a	0.879213037	9.208952851	42.13614851	8.51348E−11	5.93228E−09
Dtx1	1.008504624	9.250253022	41.95903475	9.32057E−11	6.4668E−09
Mxi1	−1.116673492	9.308242179	41.93517845	9.43498E−11	6.5182E−09
Nfkbid	−1.315772495	9.347313622	41.7580944	1.03294E−10	7.10573E−09
Klrc1	−1.210105703	9.658447581	41.54879294	1.14965E−10	7.8419E−09
Epsti1	0.569607008	9.946045371	41.54967136	1.14914E−10	7.8419E−09
Dnajb9	−1.084099427	9.393349046	41.13548499	1.42034E−10	9.64758E−09
Il2rb	−0.831902894	9.64634325	41.07264289	1.46675E−10	9.92112E−09
Mob3a	0.890516107	9.226348924	40.98635141	1.53296E−10	1.03258E−08
H2-K1	−0.346494479	11.60996193	40.85004492	1.64369E−10	1.10257E−08
Ifi47	0.925508886	9.281723133	40.83337968	1.65777E−10	1.10742E−08
Nr4a3	−1.021483749	9.253608924	40.74894056	1.73097E−10	1.15156E−08
Wdr89	−0.670857344	10.42583197	40.62234323	1.84683E−10	1.2236E−08
Cirbp	−0.732767081	9.8218496	40.59128835	1.87641E−10	1.23813E−08
Gm8797	−1.072905955	9.417561025	40.31410487	2.16242E−10	1.42104E−08
Ier5	−0.886024309	9.710443697	40.1094026	2.4013E−10	1.5558E−08
Slc38a2	−1.010291571	9.471424004	40.10955303	2.40112E−10	1.5558E−08
Slc25a3	−0.627950281	9.94947131	40.12853795	2.3779E−10	1.5558E−08
Frmd8	0.859836984	9.275205329	40.1056034	2.40598E−10	1.5558E−08
Eif5	−0.72406162	9.823473225	40.07275715	2.44678E−10	1.57588E−08
Apol9a	0.608753389	9.161172914	39.95832528	2.59439E−10	1.66432E−08
Adora2a	−1.033716215	9.426688183	39.33091525	3.57732E−10	2.28581E−08
Cxcl10	−1.475883536	9.358322387	39.21145346	3.80303E−10	2.42046E−08
Arhgef1	0.598116191	9.623554673	39.19793239	3.82946E−10	2.42772E−08
Gpx4	−0.613696802	10.07608511	38.75438539	4.80629E−10	3.0351E−08
Ncl	−0.572951664	10.07277318	38.52684203	5.40058E−10	3.39711E−08
Lamtor4	0.793961983	9.330433333	38.50931949	5.44928E−10	3.41446E−08
Fus	−0.642585145	9.89936241	38.25000659	6.22369E−10	3.88464E−08
Plscr1	−1.051442773	9.521572279	38.16059915	6.51549E−10	4.05113E−08
Tob2	−1.094490521	9.437073308	38.07654006	6.80231E−10	4.21326E−08
Zeb1	−1.072949092	9.369008588	37.96671919	7.19617E−10	4.4402E−08
Vcpkmt	−0.961449373	9.468530603	37.90218253	7.4382E−10	4.57209E−08

TABLE 3K
LPL-10 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Rps19	1.281201651	12.57926737	1233.273109	3.5827E−270	5.7917E−266
Rpl13	0.956829763	12.63772111	932.1398479	1.0119E−204	8.1792E−201
Rps18	0.920425672	12.47331244	739.6396686	7.1801E−163	3.8691E−159
Rpl32	0.868196367	12.44732277	680.1448306	6.2148E−150	2.5117E−146
Rps5	0.864582146	12.08884438	644.630062	3.2883E−142	1.0632E−138
Rps6	0.816445317	12.20836226	632.6674576	1.3142E−139	3.541E−136
Rps7	0.842852102	11.94308668	536.7798374	9.4618E−119	2.1851E−115
Rpl18a	0.690080812	12.84274248	470.7611511	2.1885E−104	4.4223E−101
Rpl14	0.747724362	11.87702392	412.2337163	1.19648E−91	2.14915E−88
Rplp0	0.729699393	12.38772174	401.1684565	3.06604E−89	4.95655E−86
Rps24	0.773043225	12.00582011	392.5932715	2.25592E−87	3.31538E−84
Rps29	0.813133225	12.24466527	380.4817947	9.77388E−85	1.3167E−81
Rpl23a	0.692286262	12.17553899	378.2544662	2.98534E−84	3.71238E−81
Rps4x	0.707695218	11.84790603	373.5198856	3.20491E−83	3.70075E−80
Rpl17	0.660157187	12.2966186	372.0304773	6.76238E−83	7.28804E−80
Rpl36a	0.941421878	11.04525672	352.1534326	1.43947E−78	1.45441E−75
Rps23	0.623074475	12.4852828	341.6130126	2.84176E−76	2.70235E−73
Rps27	0.711451235	13.23490481	297.9212211	9.347E−67	8.39465E−64
Rpl8	0.670651545	11.65215182	292.7571918	1.24681E−65	1.06083E−62
Rplp1	0.718154214	11.70321268	282.5577797	2.08075E−63	1.68187E−60
Rpl12	0.895952737	10.99231792	280.8502016	4.90144E−63	3.77317E−60
Rps14	0.541088503	12.65498313	275.4661899	7.305E−62	5.36785E−59
Rps16	0.581596764	12.35137902	275.2382377	8.19027E−62	5.75669E−59
Rpl35	0.847849209	11.18855297	272.1039925	3.94784E−61	2.6592E−58
Rps28	0.805119029	11.70739869	270.4060205	9.25591E−61	5.98524E−58
Rpl21	0.642166954	11.76870634	267.6073941	3.7703E−60	2.34426E−57
Rps15a	0.579920698	12.40379231	264.5275077	1.76872E−59	1.05901E−56
Rpl39	0.66324467	11.77723605	263.6273811	2.77878E−59	1.60435E−56
Rps20	0.841150732	11.06847766	256.9273917	8.02207E−58	4.47189E−55
Rpl9	0.584342695	11.84222479	253.9094837	3.64891E−57	1.96627E−54
Rpl3	0.564967956	12.09251912	252.5140514	7.35131E−57	3.83359E−54
Ly6c1	1.974532568	9.165759038	248.5554636	5.36247E−56	2.70906E−53
Rps3	0.53410579	11.96702894	245.5972451	2.36763E−55	1.15985E−52
Rpl4	0.586800423	11.68895541	240.4754949	3.09761E−54	1.47282E−51
Ccr7	3.247817647	9.273084775	237.8112414	1.18022E−53	5.45125E−51
Rps9	0.555129117	11.99535989	227.9727216	1.64993E−51	7.40912E−49
Rpl26	0.591538476	11.57420337	217.9166055	2.57534E−49	1.12522E−46
Rps27a	0.556559308	11.8096941	212.0951987	4.79472E−48	2.03978E−45
Tmsb4x	−0.655091827	14.24919003	211.3022905	7.1408E−48	2.95995E−45
Rpl36	0.577559407	11.87411097	210.065659	1.32905E−47	5.37135E−45
Rplp2	0.596131806	11.91002396	208.3252794	3.18603E−47	1.25623E−44
S100a11	−1.433669212	10.60258364	205.4071252	1.38023E−46	5.31259E−44
Rpl6	0.529407428	11.76076159	198.9458691	3.54707E−45	1.33353E−42
Rpl18	0.538143421	11.80687322	196.9817355	9.5172E−45	3.49671E−42
Rps2	0.652273398	11.63559296	194.8719464	2.74764E−44	9.87073E−42
Rpl10a	0.66732504	11.14212246	193.7961454	4.71798E−44	1.65806E−41
Rpl35a	0.546906986	11.7233953	192.9272701	7.30123E−44	2.51131E−41
Rps8	0.598624386	11.59252824	191.8021972	1.28517E−43	4.32834E−41
Rps13	0.504165936	11.92517909	186.704	1.66651E−42	5.49814E−40
Rpl29	0.634590575	11.21422123	182.0989711	1.68711E−41	5.45477E−39
Itm2b	−1.023345124	10.97660039	180.2597916	4.25302E−41	1.34812E−38
Furin	−2.579368689	10.38147822	173.642262	1.18497E−39	3.6839E−37
Rpl23	0.549575844	11.7085398	172.2636291	2.37021E−39	7.22957E−37
Igfbp4	1.65428633	9.162779494	171.5038314	3.47315E−39	1.03976E−36
Rpl37	0.48788775	12.07299733	169.5722666	9.17463E−39	2.69667E−36
Rps12	0.770181053	10.7705244	169.292508	1.05607E−38	3.04864E−36
Bcl2	1.810831323	9.436811299	163.9128841	1.58049E−37	4.4825E−35
Rpl37a	0.48494208	12.61560851	162.7899384	2.78043E−37	7.74973E−35
Rpl11	0.478674092	11.70900459	162.7464873	2.84187E−37	7.78673E−35
Rps15	0.534372575	11.49069149	155.5644172	1.05403E−35	2.83991E−33
Myl12a	−0.974884236	10.67826813	148.713865	3.31197E−34	8.77726E−32
Rpl19	0.420544487	12.11744557	144.6242094	2.59489E−33	6.76596E−31
Rpl27a	0.46078461	11.73981721	144.0432932	3.47637E−33	8.92046E−31
Cxcr6	−1.698970736	10.38992851	137.7218948	8.38322E−32	2.11755E−29
Rps26	0.623715151	10.99395953	136.8502614	1.3003E−31	3.23394E−29
Rps3a1	0.456678197	11.6738534	132.4041137	1.22062E−30	2.98978E−28
S100a10	−0.999677972	10.93991354	132.1604121	1.38005E−30	3.32983E−28
Rpl24	0.455232205	11.7722356	130.7827582	2.76242E−30	6.56725E−28
Eef1g	0.710194382	10.38511305	129.8469723	4.42619E−30	1.03701E−27
Malat1	−0.868303233	14.66863653	121.7575723	2.6084E−28	6.02392E−26
Ubb	−0.762236847	12.90475161	121.6648746	2.73317E−28	6.22316E−26
Klf2	1.82007794	9.96085156	120.599792	4.67547E−28	1.04977E−25
Lmnb1	−1.740434723	9.781467143	118.6227432	1.26668E−27	2.80509E−25
Rora	−1.598997856	9.982434473	118.1357505	1.61918E−27	3.53726E−25
Ly6c2	2.908662907	9.26599066	116.5377425	3.62416E−27	7.81176E−25
Rgs1	−1.547472527	11.08991268	116.1402089	4.42854E−27	9.41997E−25
Lgals3	−2.134870543	10.20014079	115.7963321	5.26703E−27	1.1058E−24
Rps11	0.40051847	12.26303456	114.4072626	1.06115E−26	2.19929E−24
Nkg7	−1.20400333	11.21028082	113.5760073	1.61375E−26	3.30227E−24
Actg1	−0.766856598	12.09916335	113.4831269	1.69114E−26	3.41738E−24
Rps21	0.618883175	10.92367777	112.720221	2.48475E−26	4.95908E−24
Rpl34	0.391798461	11.98010954	112.6674999	2.55171E−26	5.0306E−24
Hspa5	−0.993664741	10.97848639	111.8802176	3.79563E−26	7.3928E−24
Rpl5	0.611265768	10.56748783	107.8963541	2.83208E−25	5.4504E−23
Ms4a4c	1.513771908	9.182808698	106.6293484	5.36724E−25	1.02079E−22
AW112010	−0.988007877	11.38325918	105.2605754	1.07086E−24	2.01296E−22
Gm9493	0.730569756	10.33344069	103.3639123	2.78909E−24	5.18258E−22
Eef1b2	0.731249225	10.07534778	102.783618	3.73828E−24	6.86739E−22
Satb1	1.098437345	9.757020312	97.00843642	6.90326E−23	1.25391E−20
Bcl2a1b	−1.109097656	10.392145	96.86778072	7.4115E−23	1.33127E−20
H2-D1	−0.456289267	12.28188836	94.13284731	2.95042E−22	5.24138E−20
Rpl15	0.533360835	10.73579	93.09133191	4.9936E−22	8.77462E−20
Id2	−1.265718013	10.64562852	92.85856673	5.61682E−22	9.73731E−20
Rpsa	0.43236632	11.60003186	92.84273602	5.66193E−22	9.73731E−20
Actn2	−2.0324523	9.563395975	91.91238307	9.06003E−22	1.54173E−19
Hmgb2	−1.114787643	10.71118457	91.81149284	9.53391E−22	1.60547E−19
Sub1	−0.737071501	11.14875127	89.22633202	3.52131E−21	5.8686E−19
Rps10	0.438097308	11.22174231	88.54528471	4.96844E−21	8.19589E−19
Npm1	0.597146323	10.46909627	86.76885919	1.21975E−20	1.99177E−18
Prr13	−0.908211922	10.23791505	86.28709705	1.55621E−20	2.51576E−18
Fau	0.332341064	12.3016547	85.91336849	1.87994E−20	3.00901E−18
Rps25	0.439065454	11.11865132	83.92930223	5.12788E−20	8.12719E−18
H3f3b	−0.530510549	12.34438324	81.79231815	1.51165E−19	2.37256E−17
Gm8730	0.630359335	10.44458017	81.7380171	1.55376E−19	2.4152E−17
Hsp90aa1	−1.362572556	10.76842184	81.57324402	1.68885E−19	2.60019E−17
Rpl38	0.406994752	11.67453348	81.35408494	1.88691E−19	2.87772E−17
Eef1a1	0.337289144	12.38172177	81.20495197	2.03481E−19	3.07428E−17
Gzma	−3.37552039	10.72559232	80.50608545	2.89811E−19	4.33804E−17
Asb2	−1.791797421	9.480787244	79.5436343	4.71692E−19	6.99576E−17
Rpl13a	0.303669712	13.13151966	77.74308062	1.17354E−18	1.72467E−16
Srgn	−0.611233479	11.37079235	76.8364188	1.85721E−18	2.70483E−16
Cd3g	−0.586508979	11.10946418	76.75229222	1.93803E−18	2.79734E−16
Glrx	−1.532798827	9.565798465	76.67665283	2.0137E−18	2.88084E−16
Ehd1	−1.565102367	9.471456532	75.11001307	4.45203E−18	6.31329E−16
Cldnd1	−1.473759599	9.794845581	73.58230211	9.65263E−18	1.35691E−15
Lef1	1.198869799	9.289435172	73.37527093	1.07201E−17	1.49397E−15
Lsp1	−0.866196977	10.32146081	73.35557179	1.08276E−17	1.49606E−15
S1pr1	1.292942181	9.290336532	73.11132504	1.22539E−17	1.67879E−15
Rpl41	0.279576202	12.79518827	72.94991104	1.32982E−17	1.80655E−15
Lgals1	−0.901478041	11.62752559	72.79719209	1.43681E−17	1.93562E−15
Bcl2a1d	−1.192576834	9.947930815	72.58098997	1.60316E−17	2.14187E−15
Gnas	−0.711696987	10.37731863	72.1045167	2.04096E−17	2.70444E−15
Dnaja1	−1.075977432	10.76377534	70.94687086	3.66975E−17	4.82319E−15
Cfl1	−0.562064217	11.11281134	70.41556668	4.80393E−17	6.26294E−15
Lat	−0.633486956	10.61718655	69.93751294	6.12132E−17	7.91658E−15
Pfn1	−0.565983596	12.1455777	69.90284732	6.22985E−17	7.99299E−15
Dusp10	1.197430185	9.475524966	67.83386892	1.77868E−16	2.2641E−14
Ppp1ca	−0.731462957	10.29792302	66.3498649	3.77585E−16	4.76878E−14
Sidt1	1.119553649	9.182427708	66.2912716	3.88977E−16	4.87458E−14
Stx11	−1.479579129	9.444380704	63.84574775	1.34552E−15	1.67321E−13
Acot7	−1.179868494	9.577117541	63.70742047	1.4434E−15	1.78122E−13
Gzmb	−2.305535859	10.35028864	63.25612494	1.81502E−15	2.22285E−13
Prkar1a	−0.733240671	10.10978596	61.63694877	4.12996E−15	5.01991E−13
Hsp90ab1	−0.785617269	11.19690024	61.01970556	5.65064E−15	6.81703E−13
Arpc2	−0.510019831	10.79489599	60.85255662	6.15136E−15	7.36614E−13
Lilr4b	−1.22658672	9.778162201	60.71605134	6.59304E−15	7.83699E−13
Atp11b	1.060573176	9.338510173	60.4715511	7.46496E−15	8.80865E−13
Rpl10	0.383923631	11.48649796	60.42271086	7.65249E−15	8.96451E−13
Rpl13-ps3	0.784182986	9.661827958	60.21552598	8.50189E−15	9.88788E−13
Ccl5	−1.592460232	13.31119099	59.20789454	1.41864E−14	1.63812E−12
Gzmk	−1.83313636	9.363691919	58.79982239	1.74557E−14	2.00134E−12
Fam110a	−1.377632721	9.494282763	58.37016172	2.1716E−14	2.47226E−12
mt-Atp6	0.342233346	12.4713887	57.14770681	4.04279E−14	4.57033E−12
Cdkn1a	−1.510364992	9.693205615	56.90889505	4.56476E−14	5.12458E−12
B2m	−0.27669249	12.79981273	55.08980998	1.15146E−13	1.28376E−11
Ccr5	−1.45838306	9.514442093	55.02519732	1.18994E−13	1.31758E−11
Cyba	−0.620409355	10.43089398	54.4652912	1.58218E−13	1.73996E−11
Shfm1	−0.655842341	10.08130292	52.76367247	3.76195E−13	4.10917E−11
Rpl31	0.405514605	10.87146125	52.0602909	5.38224E−13	5.83955E−11
D16Ertd472e	−1.069168808	9.624003202	51.79827152	6.15059E−13	6.6287E−11
H2-K1	−0.434001092	11.60996642	51.75940054	6.27357E−13	6.71646E−11
Ctla4	−0.957465278	10.15301816	51.74174906	6.33023E−13	6.73253E−11
Odc1	−1.055185894	10.45347895	51.72816846	6.37417E−13	6.73495E−11
Lztfl1	−1.425717433	9.420903385	51.65487227	6.61662E−13	6.94574E−11
Pik3ip1	1.016427354	9.192060991	51.64159498	6.66152E−13	6.94775E−11
Hspa8	−0.563966934	12.33059948	50.45462778	1.21952E−12	1.26377E−10
Rpl22	0.405100818	10.6070495	49.87592861	1.63782E−12	1.68643E−10
Ddx5	−0.472190603	11.19925927	49.77420376	1.72497E−12	1.76493E−10
Tsc22d3	0.910948391	9.704543117	49.56953718	1.91464E−12	1.94667E−10
Gapdh	−0.589658183	10.56193028	49.41524912	2.07129E−12	2.09278E−10
Ubl5	−0.591958802	10.27392154	49.13961783	2.38377E−12	2.39354E−10
Rpl23a-ps3	0.503304075	10.7199609	48.2436768	3.7641E−12	3.7562E−10
Cd6	−0.869658646	9.931712402	47.92252282	4.43399E−12	4.39754E−10
Sh3bgrl3	−0.457786105	11.24479119	47.90991163	4.4626E−12	4.39893E−10
Tceb2	−0.592952025	10.20132116	47.42391532	5.71808E−12	5.60233E−10
Pde2a	0.987337446	9.177524209	47.36238186	5.90042E−12	5.71175E−10
Bhlhe40	−0.629828205	10.72360829	47.36525297	5.89179E−12	5.71175E−10
Maf	−1.20235901	9.568711542	47.31232275	6.05305E−12	5.82462E−10
Rpl30	0.364473767	10.96403143	47.01596378	7.04109E−12	6.73528E−10
S100a4	−1.45718699	9.866407172	46.84257616	7.69239E−12	7.31501E−10
Abracl	−0.751666052	9.935290448	46.8085049	7.8273E−12	7.39977E−10
Gnb2l1	0.413063836	10.54000009	46.77545408	7.96042E−12	7.48187E−10
Ifng	−1.860168053	9.686682514	46.5515956	8.92376E−12	8.33881E−10
Pkp3	−0.992944373	9.709717317	45.7083226	1.37238E−11	1.27506E−09
Smim3	−1.264653022	9.350059212	45.17112102	1.80548E−11	1.66785E−09
Gdi2	−0.736720685	9.887611627	44.73070501	2.26084E−11	2.07663E−09
Oaz1	−0.345126362	11.23125359	44.4427732	2.61902E−11	2.39204E−09
Il7r	0.762433294	9.753528328	44.19134887	2.97794E−11	2.70458E−09
Manf	−0.873653643	9.719335527	44.10873804	3.10631E−11	2.8054E−09
Lpxn	−0.856247558	9.719586419	43.85349118	3.53899E−11	3.17841E−09
Dynll1	−0.677834564	10.05622605	43.12939789	5.12366E−11	4.57619E−09
Dph5	0.964698786	9.213978081	43.09901238	5.20385E−11	4.62228E−09
Cd82	−0.685765836	10.1275368	42.58772697	6.75821E−11	5.97012E−09
Cd74	−1.790229737	9.434235572	42.16081243	8.40678E−11	7.38609E−09
Hcls1	−0.884940162	9.587943614	41.89048756	9.65311E−11	8.43525E−09
Arl6ip1	−0.744621815	9.94432139	41.67387503	1.0784E−10	9.37284E−09
Sh3bp5	0.906477381	9.188376986	41.65015897	1.09157E−10	9.43649E−09
Tank	−1.122428469	9.370123349	41.51736594	1.16829E−10	1.0046E−08
Tmem176a	−1.561868972	9.404491611	41.45307093	1.20735E−10	1.0327E−08
Ermn	−1.384380136	9.30459238	41.37987416	1.25341E−10	1.06646E−08
Ikzf3	−1.234027314	9.310526312	41.26331133	1.33043E−10	1.12606E−08
Clic1	−0.576996189	10.32552274	41.07895162	1.46202E−10	1.23099E−08
Gm8369	0.656116673	9.924740414	40.88479166	1.61473E−10	1.35252E−08
Uap1	−1.127448986	9.373339988	40.5920089	1.87572E−10	1.56304E−08
Ubald2	−0.647705139	10.62015695	40.48582272	1.98048E−10	1.64187E−08
Cd5	−0.942120559	9.629220038	40.26054766	2.22252E−10	1.83313E−08
Nr3c1	−1.154618397	9.448746596	40.15577128	2.34498E−10	1.92431E−08
Anxa2	−0.939195153	9.842340624	40.03380626	2.49605E−10	2.03794E−08
Tmem176b	−1.478158733	9.44810635	39.8238096	2.77936E−10	2.25785E−08
Ikzf2	−1.348475271	9.298837321	39.71435404	2.93957E−10	2.36423E−08
AB124611	0.925207051	9.180451135	39.72365158	2.92561E−10	2.36423E−08
Serpinb1a	−1.843570985	9.512641434	39.59191023	3.12977E−10	2.50475E−08
Stk24	−0.91383667	9.608549705	39.52447346	3.23974E−10	2.57998E−08
Efhd2	−0.999146886	9.465521733	39.13275436	3.95945E−10	3.13767E−08
Ucp2	−0.65915216	10.0128664	39.02218127	4.19018E−10	3.30431E−08
Calr	−0.677910097	10.0207225	38.16235309	6.50963E−10	5.10848E−08
Cdc42	−0.468486577	10.40471662	38.14980497	6.55163E−10	5.1166E−08
Fam101b	0.953455397	9.174681163	38.04046828	6.92924E−10	5.38549E−08
Serpina3g	−1.177709452	9.674291957	38.02477696	6.98519E−10	5.403E−08
Socs3	0.876228257	9.49233387	37.92020104	7.36982E−10	5.67336E−08
Hsp90b1	−0.822947909	9.703951568	37.82898625	7.72258E−10	5.91674E−08

TABLE 3L
LPL-11 vs. All
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Gata3	2.78725309	9.445536089	651.0499191	1.3206E−143	2.1349E−139
Ccl5	−5.30741133	13.31117347	348.0391179	1.1328E−77	9.15641E−74
Tnfsf8	2.436704618	10.01782193	323.7980169	2.15589E−72	1.16174E−68
Rpl37a	0.622775272	12.61561004	294.538539	5.10124E−66	2.06167E−62
Il5	1.913428082	9.162955407	286.2336147	3.2903E−64	1.06382E−60
Socs2	2.183612465	9.351639381	270.9835186	6.92719E−61	1.86642E−57
Cldnd1	1.666913086	9.794858969	252.1526177	8.81368E−57	2.03546E−53
Gpx4	1.087119142	10.07609679	226.2535433	3.91211E−51	7.48478E−48
Sub1	0.883083724	11.1487561	226.1278761	4.16696E−51	7.48478E−48
AW112010	−1.474129989	11.38325184	209.9972312	1.37553E−47	2.22368E−44
Ms4a4b	−1.446723816	10.75185359	195.3518584	2.15883E−44	3.1727E−41
Ramp3	2.145977545	9.936713117	192.8546395	7.57266E−44	1.02016E−40
Il4	2.011817772	9.174329336	191.3077471	1.64772E−43	2.049E−40
Itk	1.193676475	9.814313226	190.8271332	2.09791E−43	2.42249E−40
Samsn1	1.384203515	9.795369332	186.5931584	1.762E−42	1.89896E−39
Pfn1	−0.962844016	12.14557821	185.1929867	3.56178E−42	3.59874E−39
Hilpda	1.535712444	9.667495774	172.5446413	2.05786E−39	1.9569E−36
Nkg7	−1.499609631	11.21026875	166.4588249	4.39179E−38	3.94431E−35
Lgals7	2.061472613	9.201968358	164.5758087	1.13233E−37	9.63437E−35
Il1rl1	1.727815818	9.173799372	163.5329974	1.91329E−37	1.54652E−34
H2afz	1.030291278	10.7654377	151.5333042	8.01359E−35	6.16893E−32
Tnfrsf18	1.025507117	10.06770513	150.5249306	1.33114E−34	9.78146E−32
Rps9	0.436769402	11.99536279	149.9878754	1.74425E−34	1.22598E−31
Rpl23	0.492111858	11.70855206	147.5273126	6.0181E−34	4.05369E−31
Ptpn13	1.508179564	9.18673375	145.8278672	1.4157E−33	9.1545E−31
Fam213a	1.52409344	9.188402088	144.3827407	2.93029E−33	1.82197E−30
Fam46a	1.816227914	9.5043122	140.7033004	1.86819E−32	1.11856E−29
Actb	−1.645143094	13.40506597	136.9264382	1.25136E−31	7.22482E−29
Ms4a6b	−1.276285498	10.19495673	136.8462663	1.30292E−31	7.26309E−29
Dusp10	1.527437104	9.475525704	135.6542382	2.37485E−31	1.27972E−28
Crem	1.428290135	10.06687059	135.0047119	3.29386E−31	1.7177E−28
Gm8369	−1.539746047	9.92472512	126.5999821	2.27259E−29	1.14808E−26
Ptgir	1.113446316	9.163290516	126.4785278	2.41602E−29	1.18356E−26
Rpl21	0.435636427	11.76870978	125.261045	4.46212E−29	2.12161E−26
Rps28	0.55761229	11.70740612	123.962248	8.58618E−29	3.96583E−26
Tpt1	0.441970525	11.78330363	122.7748436	1.56206E−28	7.01453E−26
Got1	1.376458958	9.855680992	121.8512873	2.48806E−28	1.08708E−25
Calca	3.14777933	9.213255376	121.6092469	2.81089E−28	1.19581E−25
Eef1a1	0.393660221	12.38173251	121.482608	2.99616E−28	1.24195E−25
Spcs3	1.235400868	9.34767364	119.8851623	6.70309E−28	2.70905E−25
Tnfrsf4	1.148431166	10.62221384	117.9370243	1.78981E−27	7.05711E−25
9230102004Rik	0.982375521	9.161433502	116.704018	3.3327E−27	1.28277E−24
Rps12-ps3	0.943779186	9.914308593	115.0032374	7.85691E−27	2.95383E−24
Frmd4b	1.36706003	9.262065137	114.9482961	8.07763E−27	2.9678E−24
Rps12	0.623247383	10.77054436	114.1870765	1.18577E−26	4.2598E−24
Wdr89	0.942765197	10.42589899	111.5161523	4.56074E−26	1.6028E−23
Rplp2	0.431571166	11.91003287	109.5583778	1.22445E−25	4.21158E−23
Arpc3	0.640798492	10.54004275	108.871016	1.73198E−25	5.83315E−23
Serpina3g	−2.073186267	9.674281316	107.2026936	4.0189E−25	1.32591E−22
Rps21	0.584104575	10.92368799	107.0529425	4.33434E−25	1.40138E−22
Rpl23a	0.377714752	12.17554432	106.7452237	5.06241E−25	1.60469E−22
Lcp1	−0.975234565	10.29117732	105.6943068	8.60342E−25	2.67467E−22
Rps29	0.448556786	12.24466765	104.4778208	1.58963E−24	4.84867E−22
Epsti1	−1.239773795	9.946039862	104.081923	1.94121E−24	5.81142E−22
Serinc3	1.130652275	9.437689744	103.9755135	2.04832E−24	5.91306E−22
Bcl2a1b	0.824160134	10.3921492	103.9953976	2.02787E−24	5.91306E−22
Rps24	0.413547684	12.0058264	103.6828838	2.37434E−24	6.73395E−22
Lsp1	−0.985266793	10.32146161	103.541068	2.55052E−24	7.10892E−22
Tnfaip8	1.025889715	9.63021053	102.1887411	5.0476E−24	1.38304E−21
Arhgdib	−0.776390788	10.73175766	101.3554603	7.6873E−24	2.07122E−21
Gimap4	−0.848082586	10.52505641	100.3208288	1.29607E−23	3.43479E−21
Rps20	0.532114639	11.06849484	100.0530592	1.48369E−23	3.86859E−21
Rpl35a	0.383212685	11.72340173	98.87799881	2.68546E−23	6.89098E−21
Rps7	0.381427202	11.94309364	98.49929886	3.2514E−23	8.21283E−21
Rpl26	0.386577119	11.57421057	96.7395076	7.90755E−23	1.96667E−20
Ltb	−1.399434777	10.15519086	96.12700077	1.07745E−22	2.63911E−20
Rpl30	0.473159497	10.96404079	94.5744842	2.36041E−22	5.69529E−20
Gramd3	−1.361397858	10.20644171	91.6866376	1.01548E−21	2.41416E−19
Dgat1	1.136334074	9.778640319	91.23289682	1.27719E−21	2.99233E−19
Gzma	−3.702496857	10.72561706	90.72545605	1.65056E−21	3.81185E−19
Epas1	1.267743009	9.190648446	90.47197387	1.87616E−21	4.27182E−19
Fdx1	1.231395993	9.293641737	90.38007272	1.96536E−21	4.41277E−19
Cd48	−1.406318811	9.721163919	90.22654102	2.12394E−21	4.7035E−19
Rps23	0.329029763	12.48528629	90.09886224	2.26552E−21	4.94924E−19
Rps15	0.390713377	11.49069805	87.8944932	6.90406E−21	1.48815E−18
Il17rb	0.719078081	9.159374823	85.61480456	2.18632E−20	4.65054E−18
Rpl9-ps6	0.874151789	9.840821559	85.0333623	2.93373E−20	6.15931E−18
Gpr18	−1.78216716	9.406620641	84.12800323	4.63755E−20	9.61162E−18
Ipmk	1.273590944	9.271358545	83.86447633	5.29882E−20	1.08431E−17
Coro1a	−0.73247519	10.77299576	83.22874718	7.30871E−20	1.47691E−17
Abhd17c	1.101899836	9.339495287	82.97818141	8.29641E−20	1.6558E−17
Rpl9	0.330253784	11.84222846	82.11044546	1.28691E−19	2.53709E−17
Rps10	0.393627927	11.22175565	80.59909901	2.76486E−19	5.38514E−17
Gzmb	−2.701378123	10.35029484	80.36660647	3.11007E−19	5.9854E−17
Cd3e	−0.76840368	10.37494886	80.21369816	3.3603E−19	6.39089E−17
Gm9843	0.686156797	10.49140966	78.62252705	7.51871E−19	1.41334E−16
Ccr5	−1.657767592	9.514438228	78.43448041	8.26961E−19	1.53663E−16
Cfl1	−0.559969156	11.11281656	78.41189297	8.36471E−19	1.53663E−16
Rpl17	0.311214497	12.29662158	77.9954965	1.03276E−18	1.87591E−16
Il13	1.584467555	9.164846146	76.40414181	2.31166E−18	4.15225E−16
Rac2	−0.536378869	11.09605583	75.73073771	3.25107E−18	5.77547E−16
Rpl36a	0.451614988	11.04526124	73.03434504	1.27413E−17	2.23887E−15
Rps3a1	0.326717425	11.67386184	72.76462129	1.46072E−17	2.53914E−15
Rpl38	0.370765232	11.67453685	72.51121348	1.66086E−17	2.85632E−15
Rps27rt	0.626079443	11.16192697	72.33582672	1.81522E−17	3.08893E−15
Rpl6l	0.60326212	10.20612343	72.15571984	1.98868E−17	3.34886E−15
Fosl2	1.091970828	9.531552388	71.34388687	3.00086E−17	5.00123E−15
Vps37b	0.724244734	10.60465641	71.30913819	3.05418E−17	5.01342E−15
Dnajc15	−0.897639796	9.893114381	71.29881659	3.0702E−17	5.01342E−15
Cd7	−2.214869992	9.494180616	70.61890677	4.33344E−17	7.00544E−15
Klf2	−2.182862403	9.960838309	70.52757429	4.53878E−17	7.26474E−15
Rpl23a-ps3	0.582425672	10.71997612	70.42054103	4.79184E−17	7.59459E−15
Rpl13	0.292940011	12.63772195	69.15470278	9.1035E−17	1.42881E−14
Rpl6	0.305809539	11.76076847	69.07620569	9.47314E−17	1.47253E−14
Ell2	1.083692654	9.233842501	68.53144299	1.24871E−16	1.92253E−14
Cd200r1	1.056706352	9.188142445	68.15502474	1.51134E−16	2.28339E−14
Ctla2a	1.029049134	10.33550568	68.16832127	1.50118E−16	2.28339E−14
Nfkb1	0.863972112	9.53708087	68.04758287	1.59597E−16	2.38894E−14
Isy1	0.955123258	9.388775206	68.01603383	1.62171E−16	2.4052E−14
Cxcr3	−1.31367325	9.55137858	67.18697187	2.46941E−16	3.62913E−14
Abracl	−0.827023382	9.935292552	66.38855383	3.70246E−16	5.39225E−14
Elovl5	1.000670868	9.322047714	66.29789289	3.87673E−16	5.59564E−14
Rplp1	0.354849578	11.70322227	64.41465545	1.00806E−15	1.44214E−13
Ubac2	−1.232880489	9.42377083	64.35941478	1.03672E−15	1.47014E−13
Cyba	−0.621006408	10.43089692	64.18614099	1.13202E−15	1.59133E−13
Rpl10-ps3	0.822487389	9.578827067	64.11901202	1.17126E−15	1.63229E−13
Amica1	−1.523510324	9.335288888	63.701196	1.44797E−15	2.00067E−13
Rpl12	0.445699316	10.99232629	63.59632141	1.52714E−15	2.09218E−13
Emb	0.74683201	10.25092353	63.34678603	1.73338E−15	2.35477E−13
Rps6	0.277808542	12.20836688	63.27756685	1.79537E−15	2.41867E−13
Rpl19	0.270133762	12.11744948	63.03407253	2.03162E−15	2.71431E−13
Rpa2	−1.380531757	9.392692325	63.01445595	2.05195E−15	2.719E−13
Fau	0.274449368	12.3016555	62.71392745	2.39019E−15	3.14145E−13
Gnai2	−0.748009519	10.17430832	62.26042219	3.00912E−15	3.83955E−13
Rps27a	0.301110145	11.80970228	62.2783555	2.98184E−15	3.83955E−13
Elf1	0.782440901	9.573205604	62.2557001	3.01635E−15	3.83955E−13
Btg1	−0.611493	12.25013986	62.29398453	2.95827E−15	3.83955E−13
Limd2	−0.821889253	10.08911092	62.02700461	3.38779E−15	4.27868E−13
Rpl7	0.334243439	11.21182536	61.69813298	4.0036E−15	5.01722E−13
Rpl27a	0.292308559	11.73982066	61.44017246	4.56403E−15	5.67554E−13
Rpl22	0.408207942	10.60705713	61.37209441	4.7246E−15	5.83037E−13
Ptprc	−0.713573469	10.11543823	61.24768507	5.03277E−15	6.16362E−13
Rps13	0.284620979	11.92518428	60.88657604	6.04597E−15	7.34881E−13
Rpl5	0.439923342	10.56750057	60.78676801	6.3604E−15	7.6733E−13
Slc25a3	0.594192956	9.949500334	60.65326175	6.80672E−15	8.15092E−13
Rpl8	0.310489568	11.65215979	60.46534585	7.48853E−15	8.90144E−13
Srgn	0.449658173	11.37080589	60.20798913	8.53451E−15	1.00707E−12
Rpl27-ps3	0.779626572	9.836237785	59.40764719	1.2817E−14	1.50145E−12
Rpl39	0.322065417	11.77724389	59.04445308	1.5415E−14	1.7928E−12
Rpl41	0.244533547	12.79519234	59.0064913	1.57153E−14	1.81466E−12
Gm9493	0.537190778	10.33345076	58.58099131	1.95092E−14	2.23678E−12
Rps4x	0.289254484	11.84791468	58.37963616	2.16116E−14	2.46038E−12
Gzmk	−1.778766406	9.363688173	58.22977163	2.33223E−14	2.63656E−12
Chrne	1.080079344	9.215523871	58.15710461	2.41999E−14	2.71677E−12
Zfp36l2	−1.196447923	9.814176688	57.88375668	2.78074E−14	3.10024E−12
Rps5	0.281501081	12.08884857	57.86056343	2.81372E−14	3.11552E−12
Rps8	0.329920366	11.59253946	57.82162114	2.86998E−14	3.15619E−12
Ptprcap	−0.843038887	10.0401219	57.71648011	3.02756E−14	3.30699E−12
Hmha1	−0.896320622	9.750277921	57.60875529	3.19799E−14	3.46971E−12
Smap2	−1.082941862	9.515119635	57.58389709	3.23866E−14	3.49041E−12
Serp1	0.703010004	9.615297449	57.37262964	3.6059E−14	3.86047E−12
Lck	−0.584926841	10.3166673	57.19919538	3.93832E−14	4.18861E−12
Arpc1b	−0.514495687	10.55363485	56.87151403	4.65236E−14	4.91569E−12
Psmb8	−0.547617393	10.43462296	56.15435567	6.6999E−14	7.03316E−12
Tbc1d10c	−1.109015086	9.522686372	56.04149687	7.09574E−14	7.40063E−12
Gm2000	0.754104213	9.643824227	55.94423	7.45562E−14	7.72613E−12
Rps25	0.341236461	11.11865723	55.73810371	8.27978E−14	8.52554E−12
Prr13	−0.635092799	10.23790791	55.35597511	1.00564E−13	1.02893E−11
Arf4	0.613490192	9.974773579	55.29863988	1.0354E−13	1.05272E−11
Sp100	−1.052989046	9.553710362	55.27939258	1.04559E−13	1.05644E−11
Rpl11	0.271060468	11.70901048	55.22698927	1.07384E−13	1.07824E−11
Alyref	−1.276590695	9.471546257	54.26812572	1.74916E−13	1.74549E−11
Tnfsf11	1.195675235	9.546999328	54.14786369	1.85956E−13	1.84427E−11
Hnrnpf	−0.542960485	10.40307656	54.04990147	1.95462E−13	1.92673E−11
Rasgrp1	0.867495082	9.487696794	53.8710296	2.14091E−13	2.09758E−11
Rps14	0.245646052	12.65498328	53.84935221	2.16466E−13	2.10807E−11
Cd160	−1.612019875	9.334774618	53.43431062	2.67386E−13	2.58836E−11
Klrd1	−1.530760278	9.372671712	53.33075396	2.81859E−13	2.71222E−11
Slfn2	−0.780872487	10.08513601	53.26722348	2.91124E−13	2.7848E−11
Nt5e	0.983503956	9.297373639	52.50026078	4.30191E−13	4.09087E−11
Acbd7	0.727171497	9.16408021	52.47608183	4.3552E−13	4.11732E−11
Rpl36	0.291113805	11.87411161	52.39297427	4.54346E−13	4.27033E−11
Zrsr1	0.884462945	9.173204714	51.98113864	5.60363E−13	5.23632E−11
Ero1l	0.898463636	9.301152497	51.86195302	5.95431E−13	5.53203E−11
Rab4a	0.981396634	9.180878739	51.70674863	6.44409E−13	5.95286E−11
Rpl14	0.276260435	11.87702722	51.33644975	7.78173E−13	7.125E−11
Tnfrsf9	1.216186143	9.401994134	51.33156871	7.8011E−13	7.125E−11
Ccl1	2.8701985	9.258088506	51.06468191	8.93719E−13	8.11678E−11
Rpl10	0.340760182	11.48651267	51.00196212	9.22737E−13	8.3335E−11
Rps26-ps1	0.834947975	9.373764532	50.54920683	1.16214E−12	1.04373E−10
Rps27	0.313487317	13.23490088	50.2616202	1.34556E−12	1.20178E−10
Rps17	0.442764705	10.61490628	50.23389231	1.3647E−12	1.21219E−10
Gm11808	0.563530104	10.17399793	49.66892667	1.82006E−12	1.60782E−10
Eprs	0.923361989	9.384340903	49.48741908	1.99648E−12	1.75408E−10
Ccr4	1.037365927	9.227399089	49.14947696	2.37182E−12	2.07258E−10
Ptpn22	−0.744716395	10.09359672	48.95338111	2.62119E−12	2.27818E−10
Actr3	−0.58253223	10.23419091	48.85186728	2.76042E−12	2.38637E−10
Xist	1.36070209	9.88830013	48.50687321	3.29133E−12	2.8302E−10
Rpl28	0.392724036	10.72545285	48.30031575	3.65693E−12	3.12794E−10
Lgals3	−1.232792314	10.20014577	47.74671945	4.84995E−12	4.12654E−10
Bcl2a1a	1.056620671	9.252638693	47.53163715	5.41234E−12	4.58093E−10
Eif2s3y	−1.186564598	9.297554666	47.39179745	5.81254E−12	4.89404E−10
Anxa2	−0.978635221	9.842357829	47.37611672	5.85922E−12	4.90778E−10
Rpl18a	0.234079517	12.84274109	47.34965143	5.93887E−12	4.94885E−10
Fam49b	−0.709772908	9.757609288	47.31498589	6.04483E−12	5.01132E−10
Cd40lg	0.891889007	9.469095126	47.26266572	6.20835E−12	5.12062E−10
Grk6	−1.023874648	9.451805892	47.22787925	6.31952E−12	5.18585E−10
Set	−0.828366713	9.773721763	47.01187204	7.0558E−12	5.76081E−10
S100a4	−1.423147096	9.866428203	46.98623023	7.14872E−12	5.80735E−10
Arid5a	−0.881618443	9.656928977	46.45120687	9.39285E−12	7.59224E−10
Itgb2	−0.907516358	9.57508737	46.39812896	9.65076E−12	7.7619E−10
Rpl27	0.289912917	11.47261069	46.31227214	1.0083E−11	8.06943E−10
Pycard	−1.017137077	9.577060094	46.08847696	1.13031E−11	9.0013E−10
Spty2d1	0.853051885	9.326966648	46.00769813	1.17789E−11	9.33422E−10
Rhoc	0.987511986	9.24424751	45.56307656	1.47802E−11	1.16554E−09
Chst12	−1.147202534	9.307931568	45.51891285	1.51172E−11	1.18633E−09
Rps16	0.244105981	12.35138152	45.46537675	1.55361E−11	1.21332E−09
Tmem64	1.093268199	9.248121955	45.0264485	1.94391E−11	1.51083E−09
Irg1	1.166366825	9.171594961	45.00188351	1.96845E−11	1.52258E−09
Rps11	0.248211858	12.26303884	44.94510537	2.02636E−11	1.55991E−09
Klf6	−1.036319624	9.897270148	44.77739178	2.20757E−11	1.68841E−09
Gm6133	0.585153871	9.885540209	44.77154418	2.21417E−11	1.68841E−09
Sik2	0.906902057	9.224898712	44.5694824	2.45488E−11	1.86318E−09
Txk	−1.156179358	9.335431681	44.50879221	2.53217E−11	1.91286E−09
Sarnp	−0.827594901	9.551872587	44.48372488	2.56481E−11	1.92849E−09
Itm2c	0.701342323	9.518100312	44.45278354	2.60566E−11	1.95015E−09
Rpsa	0.289184479	11.60004787	43.86706712	3.51453E−11	2.61824E−09
Rps3	0.225942304	11.96703538	43.69704055	3.83351E−11	2.84278E−09
Ssu72	−0.929150446	9.444716001	43.50697036	4.22452E−11	3.10425E−09
Myo1f	−1.049004748	9.304637414	43.51237732	4.21286E−11	3.10425E−09
Gnb2l1	0.366860437	10.54001608	43.15062564	5.06837E−11	3.70748E−09
Pitpna	−0.910485352	9.510883804	43.13747045	5.10256E−11	3.71568E−09
Satb1	0.745579653	9.757025507	42.83945985	5.94214E−11	4.30765E−09
Gna13	0.591042418	9.985105007	42.61542934	6.66317E−11	4.80879E−09
Fth1	0.373781364	11.58470725	42.59490598	6.73345E−11	4.83791E−09
Gabpb1	0.835408177	9.477998587	42.55353038	6.8774E−11	4.91947E−09
Rpl15	0.344396098	10.73579943	42.1315169	8.53367E−11	6.07733E−09
Clic1	−0.535683728	10.32552855	42.07634585	8.77786E−11	6.22381E−09
Ifitm2	0.977337784	10.68417408	42.03733753	8.95472E−11	6.32148E−09
Tgfb1	0.671608382	9.751051801	41.86242946	9.79263E−11	6.88294E−09
Dnajb6	0.49894243	10.02351389	41.74117381	1.04192E−10	7.2916E−09
Rpl32	0.23664982	12.44732842	41.59727176	1.1215E−10	7.8147E−09
Ifng	−1.717507241	9.686677357	41.44701983	1.21109E−10	8.40278E−09
Rpl7a-ps5	0.835650714	9.342537523	41.40691188	1.2362E−10	8.54031E−09
Ctsw	−0.729741102	9.943517783	41.35806506	1.26747E−10	8.6871E−09
Plcxd2	−1.101786892	9.360411229	41.3569629	1.26819E−10	8.6871E−09
Ssr4	0.570246619	9.653687486	41.18546566	1.38448E−10	9.44369E−09
Ptp4a1	0.58771196	9.696533105	41.0105522	1.5141E−10	1.02844E−08
Cnn2	−0.693314256	9.902894206	40.62768913	1.84178E−10	1.24578E−08
Bcl2a1d	0.63858231	9.947932761	40.61758242	1.85133E−10	1.24703E−08
Rps18	0.241335122	12.47331521	40.48050608	1.98588E−10	1.3321E−08
Mndal	−0.841737872	9.573225112	40.46492083	2.00178E−10	1.33722E−08
Eef1b2	0.442727395	10.07535887	40.41960733	2.04875E−10	1.36296E−08
Cbx3	−1.070891558	9.518054426	40.379645	2.09108E−10	1.38543E−08
Capzb	−0.523447722	10.15887429	40.2640148	2.21858E−10	1.4639E−08
Nck2	0.781410509	9.181413604	40.15865483	2.34152E−10	1.53874E−08
Ywhah	−0.731211687	9.721925417	40.03745907	2.49139E−10	1.6306E−08
H2afy	−0.620358	9.930108471	39.94698726	2.6095E−10	1.70101E−08
Rab26os	0.808791054	9.199100322	39.7121166	2.94294E−10	1.91067E−08
Esm1	−1.379695329	9.307914728	39.65850624	3.02484E−10	1.95598E−08
Rbm3	−0.469825784	10.73094825	39.54036966	3.21347E−10	2.06968E−08
Stk4	0.758728411	9.393514541	39.37433961	3.49865E−10	2.24441E−08
Usmg5	0.4807315	10.06857914	39.35044395	3.54172E−10	2.26306E−08
Ppp1cc	0.49871973	10.14022773	39.20971704	3.80641E−10	2.42262E−08
Efhd2	−0.874966943	9.465518512	39.00726633	4.22231E−10	2.67678E−08
1810058I24Rik	−0.854214534	9.463226674	38.99196176	4.25554E−10	2.68731E−08
Tarm1	0.349845066	9.158101881	38.98305009	4.27501E−10	2.6891E−08
Ifi203	−0.937675411	9.466821262	38.51022019	5.44677E−10	3.41289E−08
Nfkbie	0.776225335	9.398337686	38.4527893	5.60944E−10	3.50124E−08
Sept7	−0.781596305	9.59369479	38.35737928	5.89049E−10	3.66253E−08
Rpl37	0.232492992	12.07300053	38.08056479	6.78829E−10	4.20458E−08
Riok1	0.83556849	9.379908874	38.03508968	6.94837E−10	4.2873E−08
Bin2	−0.817818919	9.612865616	37.72529296	8.14417E−10	5.00603E−08
Scamp3	−0.845996416	9.450290953	37.57880894	8.77931E−10	5.376E−08
Cd69	−1.012008029	9.886570775	37.5387415	8.96152E−10	5.46687E−08

TABLE 3M
LPL-0 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Hspala	−3.825403493	11.185063	645.7540972	1.8729E−142	1.5139E−138
Dnajb1	−2.99161603	10.75617704	646.5297575	1.2701E−142	1.5139E−138
Ubb	−0.822066561	12.91815268	545.542542	1.174E−120	6.3264E−117
Hsp90aa1	−1.66428051	10.89396783	533.0215097	6.2174E−118	2.5127E−114
Hsp90ab1	−1.143395141	11.28555087	489.4360578	1.8903E−108	6.1116E−105
Malat1	−0.834514356	15.05517862	480.5825476	1.5958E−106	4.2997E−103
Dnaja1	−1.340678809	11.00180648	424.3156706	2.80608E−94	6.48045E−91
Hspa8	−0.841935877	12.34011222	389.8667875	8.84867E−87	1.78809E−83
Hsph1	−1.682363639	9.992887058	286.2067369	3.33497E−64	5.99036E−61
Hspe1	−1.262621525	10.53897111	284.1409882	9.40213E−64	1.51995E−60
Jund	−0.757938516	12.16529797	274.712105	1.06649E−61	1.56736E−58
Hspa1b	−1.813713236	9.880656558	192.3062295	9.97577E−44	1.3439E−40
Rpl35	0.479975201	11.30628837	180.4188355	3.9262E−41	4.88238E−38
Hspd1	−1.057296091	10.15136767	143.4046976	4.79454E−33	5.53632E−30
Fosb	−1.249403116	9.939486915	142.5770614	7.27286E−33	7.83821E−30
Rbm3	0.507343098	10.86474429	133.5193484	6.96011E−31	7.03232E−28
Rpl27-ps3	0.733939207	10.1630502	126.7813677	2.07409E−29	1.97234E−26
Eef2	0.365125682	11.39715697	125.7387136	3.50754E−29	3.15016E−26
Zfp36l2	0.861788833	10.24225162	118.3228897	1.4734E−27	1.25363E−24
Rpl9-ps6	0.665300057	10.19128936	115.4607797	6.23806E−27	5.04223E−24
Gm8730	0.501024919	10.67600704	115.0937451	7.50637E−27	5.77848E−24
Rpl22l1	0.470188136	11.02604766	114.7398327	8.97303E−27	6.59354E−24
Rpl32	0.276004844	12.43016279	112.5208191	2.74765E−26	1.93124E−23
Rpl29	0.373802656	11.30509047	110.5431633	7.45054E−26	5.01856E−23
Rpl6l	0.518002583	10.48321852	101.9448287	5.70898E−24	3.69166E−21
Junb	−0.466016075	12.18505258	98.00914384	4.16455E−23	2.58939E−20
Rplp0	0.249731984	12.38724467	96.03494503	1.12873E−22	6.75819E−20
Chchd2	−0.452053053	10.66873479	94.44852779	2.51549E−22	1.45234E−19
Rgcc	−1.083204205	10.02460697	91.73836745	9.89281E−22	5.51473E−19
Rpl18	0.254662339	11.84337657	86.96767873	1.10309E−20	5.9442E−18
Ddx5	−0.364346068	11.32206669	82.20282545	1.22814E−19	6.40456E−17
Cacybp	−0.759965312	9.974878831	81.02462915	2.22922E−19	1.12617E−16
Lmna	−0.896054608	10.10046144	77.25333728	1.50377E−18	7.36666E−16
Gm9843	0.424425093	10.7167237	76.61162997	2.0811E−18	9.89504E−16
Cdkn1a	−0.802900828	10.20349727	74.35181316	6.53652E−18	3.01913E−15
Rps18-ps3	0.682699869	9.936337431	73.30477018	1.11099E−17	4.98897E−15
Cd160	0.933946071	9.842212445	72.70824087	1.50305E−17	6.56712E−15
Gzma	1.209224468	10.74237183	70.50937153	4.58085E−17	1.94879E−14
Rpl13a	0.174478619	13.13700027	69.64459685	7.1013E−17	2.94358E−14
Odc1	−0.554763585	10.71341295	69.11801272	9.27444E−17	3.74827E−14
Atf3	−0.87943707	9.821862051	68.15164877	1.51393E−16	5.96931E−14
Hspa5	−0.432882858	11.06371391	66.89489047	2.86376E−16	1.10228E−13
Gm9493	0.415290628	10.58239681	66.56840727	3.37959E−16	1.27057E−13
Epsti1	0.518154471	10.33595192	65.73125853	5.16797E−16	1.89876E−13
Eif3f	0.334919369	10.83491205	65.21112438	6.72886E−16	2.41731E−13
Kdm6b	−0.502890922	10.78968221	64.63386514	9.01918E−16	3.16965E−13
S100a4	0.92404098	10.00434996	63.64817399	1.48747E−15	5.11626E−13
Ccl5	0.726508356	13.19304376	63.37342879	1.71009E−15	5.75945E−13
Fam110a	−0.691881356	9.98944843	62.94516444	2.12542E−15	7.01216E−13
Ubald2	−0.420100725	10.91847462	61.80199233	3.7979E−15	1.22794E−12
Rps11	0.206504838	12.2866429	60.53858145	7.21504E−15	2.28703E−12
Rpl3	0.207637882	12.17538078	59.964028	9.6607E−15	3.00336E−12
Limd2	0.46356712	10.41509448	58.64505882	1.88842E−14	5.76003E−12
Rpl36-ps3	0.600107604	9.956192534	58.34228896	2.20258E−14	6.47399E−12
Rpl10-ps3	0.588938103	10.00304739	58.37673424	2.16435E−14	6.47399E−12
Gm2000	0.552978434	10.04573455	58.2135153	2.35158E−14	6.78851E−12
Crem	−0.555480946	10.37476775	58.14841144	2.4307E−14	6.89382E−12
Satb1	0.611847835	10.18239119	57.22454132	3.88789E−14	1.08365E−11
H2-Q6	−0.52349562	10.11218978	55.63954367	8.70547E−14	2.3853E−11
Rac2	0.278484799	11.27241752	55.32603535	1.02107E−13	2.75111E−11
Rpl24	0.215735106	11.83074602	55.08988222	1.15142E−13	3.05145E−11
H2-K1	−0.242269234	11.67413497	54.76242772	1.36016E−13	3.54652E−11
Ifrd1	−0.490058089	10.42505666	54.57837129	1.49371E−13	3.8329E−11
Eno1	0.480893285	10.2518593	54.42764048	1.61278E−13	4.07379E−11
Rgs10	0.584571469	10.06092484	53.57232916	2.49245E−13	6.19892E−11
Ptprcap	0.462562077	10.30191657	52.78189829	3.72721E−13	9.1294E−11
Rpl15	0.285131556	10.91329125	52.45039836	4.41253E−13	1.06467E−10
Fus	−0.436843347	10.31636377	51.74106738	6.33243E−13	1.50544E−10
Apobec3	0.580477188	9.941216731	51.13331646	8.6301E−13	2.02195E−10
Wdr89	0.360242636	10.60823124	51.02458523	9.12163E−13	2.10658E−10
Prr7	−0.512955962	10.2326335	49.73875281	1.75642E−12	3.9992E−10
Cd52	0.261151609	11.82769179	49.55775305	1.92617E−12	4.32479E−10
Actg1	0.279020484	11.92138436	49.3310168	2.16217E−12	4.78816E−10
Fth1	−0.254879504	11.68995556	49.06749956	2.47304E−12	5.40259E−10
Rpsa	0.221212609	11.63951649	48.74914351	2.90886E−12	6.26994E−10
Hmgb2	0.380619263	10.77568432	47.80559174	4.70648E−12	1.00112E−09
Gm10073	0.50591008	10.0938124	47.04184308	6.94873E−12	1.44648E−09
Ltb	0.46912106	10.47411608	47.03326566	6.9792E−12	1.44648E−09
Rpl7a-ps5	0.593867674	9.839399427	46.10042491	1.12344E−11	2.29893E−09
Bag3	−0.676847869	9.761603714	45.80267572	1.30785E−11	2.64283E−09
Rgs2	−0.602713321	10.33738405	45.56039753	1.48004E−11	2.95387E−09
mt-Nd1	−0.27246384	11.38477942	44.99146781	1.97895E−11	3.90142E−09
Selplg	0.361247701	10.47107152	44.61343362	2.40039E−11	4.67527E−09
Rps12-ps3	0.429501896	10.24219127	44.54830901	2.48158E−11	4.77585E−09
Itpkb	−0.536976006	10.03354471	43.56508254	4.10091E−11	7.79945E−09
Lcp1	0.358521569	10.53990253	43.01457134	5.43337E−11	1.02135E−08
Rps10	0.229905401	11.28625925	42.82120188	5.99786E−11	1.1145E−08
Shisa5	0.253218689	11.20411978	42.66916005	6.48263E−11	1.19089E−08
Cd7	0.905512708	9.951566624	42.42624652	7.33984E−11	1.33321E−08
Btf3	0.265152023	10.86771989	42.36584762	7.57004E−11	1.35975E−08
Eif1	−0.185728716	11.94746374	41.72703666	1.04948E−10	1.86438E−08
Gm10076	0.471465459	10.05875362	41.19742905	1.37603E−10	2.41793E−08
Arhgdib	0.291487089	10.83943531	41.11935386	1.43211E−10	2.48941E−08
Hmha1	0.438419112	10.13557056	40.84407814	1.64872E−10	2.83545E−08
Cnn2	0.404936534	10.25178545	40.75026013	1.7298E−10	2.94358E−08
Rps6	0.159056414	12.23920984	40.68855047	1.7853E−10	3.00637E−08
Itgae	0.677929929	9.8104067	40.59773584	1.87023E−10	3.11693E−08
Fam169b	0.616416705	9.830231324	40.37061673	2.10077E−10	3.46541E−08
Rps3	0.163758935	11.98064091	40.05254335	2.47223E−10	4.03697E−08
Slc25a5	0.318042836	10.56075782	39.92967324	2.63273E−10	4.25607E−08
B2m	−0.138337493	12.76834333	39.80722236	2.80307E−10	4.48657E−08
Cox4i1	0.260138703	10.88297738	39.75543771	2.87838E−10	4.56195E−08
Nr3c1	−0.562192365	9.957485177	39.24465631	3.7389E−10	5.86826E−08
Dedd2	−0.579408471	9.822902175	38.8738958	4.52086E−10	7.02733E−08
Ctla4	−0.411701514	10.49036865	38.58391272	5.24495E−10	8.07522E−08
Eif4a1	−0.320154261	10.60075837	38.51060462	5.4457E−10	8.3052E−08
Gltscr2	0.29072519	10.57741115	38.07787817	6.79765E−10	1.02702E−07
Il4ra	−0.505217024	10.00229239	37.82530316	7.73717E−10	1.15814E−07
Ctsw	0.38528809	10.29455423	37.78999709	7.87847E−10	1.16847E−07

TABLE 3N
LPL-1 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Gm9843	0.873546513	10.7197657	595.3267532	1.7389E−131	2.8111E−127
Rps27rt	0.66236952	11.52848942	503.5200918	1.6296E−111	1.3172E−107
Rpl27-ps3	1.093919351	10.0373069	498.0920313	2.4723E−110	1.3323E−106
Rpl23a-ps3	0.706965217	10.91927368	429.8668325	1.73729E−95	7.02125E−92
Gm8730	0.825757188	10.42923933	412.6161475	9.87786E−92	3.19371E−88
Wdr89	0.707321788	10.74901788	406.5956198	2.0192E−90	5.44041E−87
Rpl6l	0.823496109	10.31624825	405.0286107	4.4288E−90	1.0228E−86
Rpl9-ps6	0.947575445	10.03468303	373.6299221	3.0329E−83	6.12873E−80
Gm11808	0.822511826	10.38635863	367.3621485	7.02331E−82	1.26154E−78
Hsp90aa1	−1.123206902	11.09080685	278.1373372	1.91209E−62	3.09108E−59
Hsp90ab1	−0.798418537	11.45738705	277.329778	2.86743E−62	4.21409E−59
Gm9493	0.669365375	10.45191966	267.6617764	3.66879E−60	4.94247E−57
Ubb	−0.506909232	13.07324632	266.81113	5.62244E−60	6.99172E−57
Hspa8	−0.727896974	12.56632486	263.6950407	2.68601E−59	3.10157E−56
Gm2000	0.978296872	9.727076162	255.8188211	1.3994E−57	1.50818E−54
Gm6133	0.812351209	10.01774141	251.4273837	1.26841E−56	1.28157E−53
Gm10073	0.884912534	9.850676041	242.7892061	9.69501E−55	9.21939E−52
Uba52	0.636432939	10.43662801	223.7341252	1.38646E−50	1.24519E−47
Rpl35	0.477127259	11.02808234	202.7745708	5.18058E−46	4.40786E−43
Dnajb1	−1.547344284	10.51482327	202.0042358	7.6291E−46	6.1666E−43
Hspa1a	−2.383248273	10.75818044	185.9121194	2.48129E−42	1.91012E−39
Gm10076	0.89711374	9.682747299	184.0884505	6.20583E−42	4.56016E−39
Gm42418	1.003104559	9.481098691	164.784568	1.01946E−37	7.16548E−35
Rpl36-ps3	0.865876631	9.656996395	163.4954362	1.94979E−37	1.31335E−34
Lgals1	−0.600108402	11.14033101	159.5092037	1.44838E−36	9.3658E−34
Tmsb4x	−0.269818422	14.02813382	157.946803	3.17881E−36	1.97649E−33
Rps18-ps3	0.841244657	9.655928496	157.4523302	4.07672E−36	2.4409E−33
Rpl13-ps3	0.736506126	9.797721135	150.5036043	1.3455E−34	7.76836E−32
Dnaja1	−0.748586019	11.1271812	146.0105043	1.29135E−33	7.19862E−31
Chchd2	−0.473494251	10.6318899	141.6095467	1.18374E−32	6.37879E−30
Hspe1	−0.829543845	10.55971604	128.4300367	9.03775E−30	4.71304E−27
Rpl10-ps3	0.71087493	9.678396441	125.6681744	3.63446E−29	1.83609E−26
Gm10036	0.758004858	9.644830032	125.5491133	3.8592E−29	1.89054E−26
Fosb	−1.108477341	9.588519321	113.8078997	1.43564E−26	6.82607E−24
Rps12-ps3	0.548511272	10.07738295	110.8914873	6.24998E−26	2.88678E−23
Malat1	−0.323252323	14.85278289	110.8000382	6.54504E−26	2.93909E−23
Lmna	−0.973775479	10.04980932	110.2750726	8.52945E−26	3.72668E−23
Zfp36l2	0.805436207	9.84848683	109.5140802	1.25212E−25	5.32678E−23
Bcl2a1a	0.944045562	9.35889223	108.9881407	1.6326E−25	6.76733E−23
Gm26917	0.725412379	9.615524653	105.7709173	8.27715E−25	3.34521E−22
Rps27	0.173150148	13.46009077	101.4527607	7.31882E−24	2.88576E−21
Gm10263	0.861643794	9.385525775	98.05106258	4.07732E−23	1.56938E−20
AY036118	0.845409107	9.416058201	95.63098079	1.38423E−22	5.20407E−20
Rps28	0.25062322	11.89396748	94.87741825	2.02547E−22	7.44177E−20
Cd160	1.023014317	9.339544002	94.02040194	3.12288E−22	1.12188E−19
Hsph1	−0.968446806	9.627387402	89.34964071	3.30852E−21	1.16273E−18
Crip1	−0.674587136	11.33426017	84.59617783	3.65972E−20	1.25879E−17
Rpl7a-ps5	0.725809858	9.475578047	82.78303389	9.15726E−20	3.08409E−17
Rgcc	−0.973619288	9.813843394	81.09113895	2.15544E−19	7.1112E−17
Hspa1b	−1.064974481	9.37693802	77.03025429	1.68359E−18	5.44338E−16
Gm10250	0.721261574	9.432548691	75.60196203	3.47017E−18	1.09997E−15
B2m	−0.163151274	12.84650271	72.80837186	1.4287E−17	4.44159E−15
Rps26-ps1	0.661606304	9.479500689	69.45313485	7.82519E−17	2.38683E−14
Jund	−0.386316433	11.96429312	68.4310993	1.31389E−16	3.9334E−14
Sh3bgrl3	−0.284689974	11.2049149	67.6776059	1.92538E−16	5.65922E−14
Rpl15	0.290483657	10.7193633	66.70193998	3.15824E−16	9.11717E−14
H2-D1	−0.168989587	12.4810284	65.49651581	5.82168E−16	1.65111E−13
Rpl27	0.192059664	11.58272697	62.42809188	2.76353E−15	7.70263E−13
Rpl38	0.175857657	11.85262055	59.68977327	1.11052E−14	3.04283E−12
Ly6a	−0.476835045	10.45808259	58.56441313	1.96743E−14	5.30091E−12
Gm8186	0.616545383	9.46968788	58.47837647	2.05538E−14	5.44708E−12
Eef2	0.221539535	11.27929437	57.33667929	3.67242E−14	9.57554E−12
Gzma	0.973652374	10.76243447	56.49530585	5.63327E−14	1.44551E−11
Hspa5	−0.308894911	11.15772526	56.45869742	5.73913E−14	1.44967E−11
Cd7	1.070388028	9.401826218	56.08605501	6.93674E−14	1.72522E−11
Itgae	0.757627092	9.327390666	54.75135772	1.36785E−13	3.3504E−11
Eif3f	0.271500969	10.59751999	54.44295273	1.60027E−13	3.86118E−11
Gm9844	0.524290137	9.613183527	53.29612718	2.86872E−13	6.81995E−11
Calm1	−0.263318971	10.92853481	52.42032047	4.48064E−13	1.04977E−10
Odc1	−0.476042872	10.65279357	52.07968366	5.32935E−13	1.23077E−10
Ly6e	−0.272932191	10.89033101	51.71546392	6.41555E−13	1.46076E−10
Rps29	0.164848186	12.37594571	51.4604536	7.30539E−13	1.64026E−10
Btg2	0.336367777	10.74241813	51.38924928	7.57522E−13	1.67755E−10
Rgs2	−0.487746639	10.60753305	50.89975769	9.72056E−13	2.12355E−10
Ccl5	0.536522565	13.43614334	49.52632899	1.95727E−12	4.21884E−10
Manf	−0.477853237	9.744077147	48.59281074	3.15022E−12	6.70085E−10
Cacybp	−0.581354688	9.602687269	48.49367478	3.31356E−12	6.95675E−10
Bcl2a1d	0.434412334	10.08987012	48.36666838	3.53526E−12	7.32706E−10
Gm42726	0.594380731	9.300818507	47.76332445	4.80905E−12	9.84089E−10
Sertad1	−0.609477867	9.448224564	45.15697193	1.81857E−11	3.67488E−09
mt-Nd1	−0.233531752	11.10794853	44.9507962	2.02048E−11	4.03248E−09
Hspd1	−0.577954866	9.977292502	44.91936291	2.05318E−11	4.04776E−09
Ctla2a	−0.562767996	10.740003	44.73531038	2.25553E−11	4.39312E−09
Rpl32	0.141395026	12.38187309	44.34948815	2.74684E−11	5.28636E−09
Tubb4b	−0.503312119	9.606172658	42.96612383	5.5696E−11	1.05927E−08
Stk17b	0.337542743	10.09370635	42.23007718	8.11424E−11	1.52529E−08
Myl12a	−0.257568889	10.62761221	41.55518391	1.1459E−10	2.12927E−08
Apobec3	0.551355515	9.466440219	41.0441852	1.48826E−10	2.73401E−08
H2-K1	−0.161175353	11.86466227	40.58872572	1.87888E−10	3.4128E−08
Actb	−0.289918864	11.94107968	39.18869365	3.84762E−10	6.91118E−08
Cfl1	−0.207073499	10.90597825	38.85100187	4.57419E−10	8.12597E−08
Dynll1	−0.347573679	10.0825626	37.98225887	7.13909E−10	1.25252E−07

TABLE 3O
LPL-2 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Dnajb1	2.544628253	9.957159242	547.4793005	4.4499E−121	7.1937E−117
Ubb	−0.719181201	12.62430285	513.9811277	8.6306E−114	6.9761E−110
Hspa1a	−4.265472016	10.29821772	492.9716733	3.2152E−109	1.7326E−105
Hsp90aa1	−1.538726518	10.40571986	452.2223245	2.3685E−100	9.57241E−97
Hsp90ab1	−1.044511532	10.87430694	427.8486026	4.77686E−95	1.54445E−91
Malat1	−0.78769936	14.29544248	389.368725	1.13581E−86	3.06026E−83
Dnaja1	−1.160967215	10.50668275	365.4817217	1.80293E−81	4.16374E−78
Lmna	−1.944600206	9.721553983	326.4307695	5.75683E−73	1.16331E−69
Hspa8	−0.679127098	12.09728281	319.2408275	2.11966E−71	3.80738E−68
Gm8730	0.782167056	10.45597089	266.3217383	7.18771E−60	1.16196E−56
Rpl27-ps3	1.052879725	9.707945918	234.7431502	5.50789E−53	8.0946E−50
Rgcc	−1.710983657	9.519354512	214.546025	1.39991E−48	1.88592E−45
Jund	−0.675872249	11.72419218	198.2604689	5.00547E−45	6.22449E−42
Rpl35	0.509475196	11.16221273	190.7930532	2.13416E−43	2.46434E−40
Gm10076	1.043288877	9.547149104	169.9338009	7.64936E−39	8.24397E−36
Hspe1	−0.935945148	9.917574254	149.4990174	2.23082E−34	2.25396E−31
Rbm3	0.521950766	10.83382101	146.4106829	1.05575E−33	1.00395E−30
Hspa1b	−1.576600791	9.179262147	137.5708581	9.04572E−32	8.12406E−29
Rpl6l	0.618995521	10.05911577	131.643752	1.79029E−30	1.52326E−27
Rpl9-ps6	0.729047513	9.70611516	124.801031	5.62624E−29	4.54769E−26
Plac8	1.004128708	10.71893409	122.0396335	2.26272E−28	1.74187E−25
Rpl10-ps3	0.891923046	9.473250861	119.5256446	8.03499E−28	5.90425E−25
Rplp0	0.287615554	12.48158976	116.701297	3.33728E−27	2.34567E−24
Gm2000	0.840498181	9.539843664	112.8076916	2.37752E−26	1.60146E−23
AY036118	1.145148849	9.18956426	110.8745505	6.30361E−26	3.91939E−23
Rps11	0.296289107	12.28172419	110.9391621	6.10147E−26	3.91939E−23
Gm9843	0.526758847	10.31729062	106.9052174	4.66978E−25	2.79599E−22
Crip1	−0.542787363	12.45883867	104.3227143	1.71907E−24	9.92517E−22
Atf3	−1.251293523	9.18931171	99.85032275	1.64361E−23	9.16225E−21
Fosb	−1.291370796	9.247423493	98.57840948	3.12407E−23	1.68346E−20
Ccl5	1.130393144	13.95145733	98.22916805	3.7266E−23	1.94336E−20
H2-D1	−0.246378131	12.31206309	88.35060601	5.48228E−21	2.76958E−18
Gzma	1.72506778	11.40703532	87.10004234	1.03168E−20	5.054E−18
Capg	−0.678811855	9.911087478	86.82217942	1.18731E−20	5.64529E−18
Hsph1	−1.043326409	9.286330507	85.92665756	1.86734E−20	8.625E−18
AW112010	0.444670626	11.45893149	85.76333436	2.02812E−20	9.10739E−18
Rps12-ps3	0.611260131	9.758073988	83.06417161	7.94324E−20	3.47055E−17
Rpl23a-ps3	0.404080492	10.53373269	82.08567098	1.30314E−19	5.51089E−17
Cd160	1.385266485	9.322490009	82.0461108	1.32949E−19	5.51089E−17
Fth1	−0.334928954	11.36116368	81.30744771	1.93197E−19	7.80806E−17
Rpl32	0.226778788	12.46778482	77.92038215	1.07279E−18	4.22992E−16
Gm10073	0.679834085	9.542960393	77.36287093	1.42265E−18	5.47583E−16
Gimap4	0.436236853	10.55167371	76.30539368	2.43019E−18	9.13639E−16
Odc1	−0.775525139	9.944056332	75.38533617	3.87255E−18	1.42281E−15
Klf4	−0.945293516	9.141545035	75.21282828	4.22612E−18	1.51821E−15
Gm9493	0.455274074	10.19437568	74.04689103	7.62833E−18	2.68086E−15
Epsti1	0.517090643	10.10953489	72.18893093	1.9555E−17	6.72607E−15
Mat2a	−0.790901455	9.401350329	72.06029678	2.08721E−17	7.02956E−15
Chchd2	−0.376545479	10.32178394	71.90568348	2.25733E−17	7.44734E−15
Zfp36l2	0.756650171	9.849977864	69.90504138	6.22292E−17	2.01199E−14
Eef2	0.256530401	11.37716606	67.65949201	1.94315E−16	6.1594E−14
Hspd1	−0.730056082	9.56946388	67.51749258	2.08826E−16	6.36959E−14
Tnfsf11	−1.017394461	9.286194377	67.54703486	2.0572E−16	6.36959E−14
Rpsa	0.270139325	11.60964793	67.07276037	2.61669E−16	7.8336E−14
Ubc	−0.40985659	10.95640452	66.95470801	2.77817E−16	8.1658E−14
Limd2	0.51944246	10.09311916	66.50384614	3.49212E−16	1.0081E−13
Ddx5	−0.322175912	10.99872038	65.9875592	4.53778E−16	1.28698E−13
Slc25a5	0.364261547	10.54681028	65.80084048	4.9887E−16	1.3669E−13
Calm2	−0.417904584	10.28145878	65.82454295	4.92906E−16	1.3669E−13
Coro1a	0.345777346	10.98317648	65.24019964	6.63031E−16	1.78643E−13
Rpl7a-ps5	0.793213904	9.266019733	64.91202919	7.83175E−16	2.07554E−13
Kdm6b	−0.838775113	9.554589167	64.82078504	8.20293E−16	2.13885E−13
Cd7	1.097172739	9.645081853	64.25147561	1.0951E−15	2.81006E−13
mt-Co1	0.234930964	12.34097755	61.19238243	5.17614E−15	1.30746E−12
Gm11808	0.460625687	10.00121146	59.55269141	1.19063E−14	2.96119E−12
Ptprcap	0.468262667	10.14636839	59.11286349	1.48883E−14	3.64673E−12
Rpl29	0.262184011	11.36451206	57.9475349	2.69203E−14	6.49542E−12
Fam110a	−0.789509164	9.363253333	57.76260767	2.95738E−14	7.03075E−12
Rpl39l	−0.660080135	9.110893413	56.68255512	5.12159E−14	1.19994E−11
H2-K1	−0.262139741	11.50207541	55.74456131	8.25263E−14	1.90589E−11
Rpl15	0.305474683	10.64485513	55.5645479	9.044E−14	2.05923E−11
Rpl13-ps3	0.582154842	9.53708088	55.37789667	9.94484E−14	2.23289E−11
Rps6	0.187770999	12.12258817	54.28391249	1.73517E−13	3.84256E−11
Klrk1	−0.696235891	9.782659238	52.57186427	4.14789E−13	9.06146E−11
Tnfsf8	−0.869184457	9.70280662	52.09440691	5.28954E−13	1.13608E−10
Lrrc58	0.663763744	9.389936985	52.07540605	5.34097E−13	1.13608E−10
Wdr89	0.370232576	10.18931763	51.40555181	7.51258E−13	1.57725E−10
Gpr18	0.866864527	9.411218906	51.09750716	8.78898E−13	1.82157E−10
mt-Nd1	−0.317004366	11.02202855	50.93349268	9.55492E−13	1.95525E−10
Cdkn1a	−0.798684946	9.458316973	50.86367711	9.9009E−13	2.00072E−10
Pycard	0.551987428	9.777016154	49.94745009	1.57919E−12	3.15175E−10
Rpl24	0.19603573	11.85276508	48.38011829	3.5111E−12	6.922E−10
Rps26-ps1	0.687496784	9.283697606	47.81217608	4.6907E−12	9.13612E−10
Lgals1	−0.300166557	12.3861545	47.0816269	6.8091E−12	1.31043E−09
Rpl18	0.192896256	11.84986773	46.75524775	8.04293E−12	1.52967E−09
Tuba1b	−0.596743066	9.481069774	46.38393415	9.72093E−12	1.82731E−09
Anxa1	−0.789378766	9.401284199	45.91901426	1.23244E−11	2.26405E−09
Eif3f	0.262138365	10.76341364	45.93327111	1.2235E−11	2.26405E−09
Arhgdib	0.264978392	10.93540557	45.35015521	1.64775E−11	2.99298E−09
S100a11	−0.308609798	10.7547102	44.90204871	2.07141E−11	3.72071E−09
Gm10250	0.669139793	9.283272179	44.69993982	2.29664E−11	4.07995E−09
Actg1	0.251896211	12.51833862	44.01460144	3.25935E−11	5.72725E−09
Rgs10	0.575935498	9.586443461	43.44995322	4.34942E−11	7.56051E−09
Cox7a2l	0.343579985	10.15410532	42.93720549	5.65254E−11	9.72116E−09
Ctsw	0.398042723	10.07562032	42.7050428	6.3648E−11	1.07181E−08
Ifrd1	−0.475489987	9.932972127	42.71437436	6.33451E−11	1.07181E−08
Ccr5	0.70355753	9.447217476	42.05131782	8.89093E−11	1.48176E−08
B2m	−0.150244995	12.75753363	41.50989787	1.17276E−10	1.93457E−08
Gm10020	0.682288929	9.228632115	41.38530306	1.24994E−10	2.04106E−08
Hspa5	−0.33052293	10.94859063	41.32467722	1.28931E−10	2.0843E−08
Cd44	−0.53145037	9.521890103	40.78049304	1.70325E−10	2.72621E−08
Id2	−0.415453763	10.56572827	39.70676467	2.95102E−10	4.67707E−08
Shisa5	0.241620621	10.99844694	39.41549416	3.42568E−10	5.37665E−08
Srsf2	−0.454044438	9.706632291	39.33527525	3.56934E−10	5.54827E−08
Itgae	0.822282028	9.255556378	39.14463452	3.93543E−10	6.05907E−08
H2-Q7	−0.287318486	10.53297959	38.93031587	4.39207E−10	6.63571E−08
Nmrk1	−0.649473302	9.332536123	38.93242527	4.38732E−10	6.63571E−08
Gm10036	0.542587512	9.419981674	38.78703884	4.72656E−10	7.07496E−08
Sh3bgrl3	−0.213928684	11.44744765	38.64098235	5.09381E−10	7.55472E−08
Txn1	−0.357580971	10.03413913	38.5266841	5.40102E−10	7.93753E−08
Ly6e	−0.295951849	10.68171292	37.98408352	7.13241E−10	1.03876E−07
Pim1	−0.383839128	10.72396533	37.73340148	8.11039E−10	1.17065E−07
Rpl22l1	0.264217716	10.93780735	37.71481274	8.18804E−10	1.1714E−07

TABLE 3P
LPL-3 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Dnajb1	−1.946456328	9.715188532	322.0257087	5.244E−72	8.47744E−68
Ubb	−0.556526755	12.64332085	264.5357982	1.76138E−59	1.42372E−55
Hsp90ab1	−0.842446585	11.04093619	262.9635073	3.87754E−59	2.08948E−55
Malat1	−0.657557225	14.44411562	252.3465366	7.99619E−57	3.23166E−53
Dnaja1	−0.967904935	10.3986654	203.5095769	3.58093E−46	1.15779E−42
Hsp90aa1	−1.016819062	10.47401553	201.0128142	1.2555E−45	3.38273E−42
Hspa8	−0.556803701	11.95258518	176.2104498	3.25747E−40	7.5229E−37
Hspe1	−0.95327844	10.18983826	153.0812553	3.67718E−35	7.43066E−32
Hspa1a	−2.406354924	9.949094707	132.4560077	1.18913E−30	2.13594E−27
Cxcr6	1.050964818	10.1716772	103.8800633	2.14941E−24	3.47474E−21
Rpl27-ps3	0.677854872	9.862951638	103.2885245	2.89727E−24	4.25793E−21
Hsph1	−1.152569484	9.365951561	92.24800222	7.64673E−22	1.03014E−18
Rpl9-ps6	0.616176975	9.871909672	83.51828779	6.31293E−20	7.85037E−17
Fos	−1.398569273	9.446578559	82.92552785	8.52037E−20	9.83859E−17
Gm2000	0.661448135	9.750013041	74.89725018	4.9586E−18	5.34405E−15
Ifi27l2a	−0.89617847	10.07811554	73.7599711	8.82175E−18	8.91328E−15
Wdr89	0.433531407	10.46020145	71.56018478	2.68929E−17	2.55736E−14
Ddx5	−0.359798857	11.12189179	71.1737819	3.27106E−17	2.93778E−14
Gm11808	0.492106141	10.18664186	69.85758986	6.37444E−17	5.42364E−14
Rpl6l	0.439579948	10.33047525	69.08823159	9.41555E−17	7.61059E−14
Ubald2	−0.531794105	10.58366091	67.3611776	2.26057E−16	1.74021E−13
Jund	−0.444613048	11.60111081	67.18787324	2.46828E−16	1.7956E−13
Ccr2	0.982615192	9.627366071	67.12005026	2.55467E−16	1.7956E−13
Rps27	−0.22528728	13.41431811	64.64008117	8.99077E−16	6.05604E−13
Eno1	0.56244217	9.973825903	64.44188359	9.94221E−16	6.42903E−13
Hspd1	−0.744360435	9.701312261	61.89149549	3.62914E−15	2.25648E−12
Gm9843	0.399626408	10.54065217	61.2458297	5.03752E−15	3.01617E−12
Gm8730	0.384178175	10.58492916	59.65981313	1.12756E−14	6.51003E−12
Lgals1	0.584476207	11.42883276	59.05998416	1.52938E−14	8.5255E−12
Gm10263	0.879988604	9.287197141	58.8792496	1.67651E−14	9.03415E−12
S100a6	0.619339818	11.111098	55.07558334	1.15983E−13	6.04832E−11
mt-Nd1	−0.314291725	11.43254364	52.46700175	4.37539E−13	2.21039E−10
Actn1	−0.958369048	9.243454407	51.82637721	6.06318E−13	2.97022E−10
mt-Nd2	−0.461351834	10.07866988	51.42464038	7.43989E−13	3.53745E−10
Cacybp	−0.705432725	9.458629507	51.23131446	8.20985E−13	3.68668E−10
Arhgdib	0.320566828	10.84726184	51.2464166	8.14693E−13	3.68668E−10
Maff	−0.931067074	9.283544725	50.87231383	9.85743E−13	4.3069E−10
H1f0	1.005362161	9.473187573	47.65841621	5.0734E−12	2.15833E−09
Rpl7a-ps5	0.757646926	9.352518925	46.86769121	7.59444E−12	3.1156E−09
Gm10036	0.598995698	9.558547095	46.83834526	7.70902E−12	3.1156E−09
Fas	−0.830210368	9.383693055	46.49515393	9.18453E−12	3.62139E−09
Bcl2	−0.898899663	9.49783969	44.78359536	2.20059E−11	8.47016E−09
Vim	0.568575859	10.37415144	43.88211639	3.48761E−11	1.31118E−08
Chchd2	−0.336926527	10.38091917	43.82067836	3.59883E−11	1.32224E−08
Gm6133	0.42291287	9.939660004	43.76172027	3.70889E−11	1.3324E−08
Rpl10-ps3	0.525088242	9.670588182	42.35366951	7.61733E−11	2.67699E−08
mt-Cytb	−0.260378871	11.31880065	42.11921612	8.58752E−11	2.95374E−08
Gm10073	0.499465706	9.768923335	41.91880226	9.51433E−11	3.20435E−08
Eif1	−0.204726216	11.87265834	41.54646968	1.15102E−10	3.79743E−08
Ass1	0.620830747	9.695025993	41.49478969	1.18185E−10	3.82117E−08
Pfn1	0.254506795	12.11137348	41.2735189	1.3235E−10	4.19523E−08
Fus	−0.445839928	9.904223746	40.96169319	1.55242E−10	4.82625E−08
mt-Nd4	−0.299211404	10.74171325	40.51332524	1.9528E−10	5.89125E−08
Rpl13-ps3	0.498225143	9.711443418	40.49829211	1.96788E−10	5.89125E−08
Rbm3	0.313163413	10.72414562	40.41601225	2.05252E−10	6.03292E−08
Ltb4r1	0.861214833	9.337334137	39.74620311	2.89202E−10	8.33608E−08
Tmem176b	0.651358918	9.889767452	39.71457834	2.93923E−10	8.33608E−08
Gm9844	0.538387087	9.610551657	39.1486532	3.92734E−10	1.09464E−07
S100a4	0.676788049	10.14521787	39.10503468	4.01607E−10	1.1004E−07
Furin	0.614555215	10.39788225	38.37338333	5.84238E−10	1.57413E−07

TABLE 3Q
LPL-4 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Hsp90ab1	−1.377781478	11.67647139	543.8892971	2.6874E−120	4.3444E−116
Dnajb1	−2.622537269	11.47483313	463.2873417	9.2579E−103	7.4832E−99
Hspa8	−1.036886848	12.90024104	448.3195067	1.6743E−99	9.02236E−96
Hsp90aa1	−1.69852051	11.40941515	442.452405	3.16746E−98	1.28013E−94
Hspa1a	−2.91446732	12.86010883	434.4143608	1.77875E−96	5.75104E−93
Ubb	−0.8105054	13.50178123	308.2413372	5.27644E−69	1.42165E−65
Dnaja1	−1.298882131	11.23915542	290.2673755	4.34808E−65	1.00416E−61
Hspa1b	−1.994309739	9.932282948	251.5650814	1.1837E−56	2.39196E−53
Hspe1	−1.211796243	10.68337716	228.4069201	1.3267E−51	2.38304E−48
Hsph1	−1.515688729	9.910103763	186.9056674	1.50586E−42	2.43438E−39
Malat1	−0.537789313	15.00626926	185.1910359	3.56528E−42	5.23966E−39
Chchd2	−0.665375364	10.5846311	154.6624546	1.65943E−35	2.23553E−32
Cd160	1.665261637	9.620048846	144.2761916	3.09176E−33	3.84473E−30
Phlda1	−1.715829384	9.936081564	132.4571128	1.18847E−30	1.37234E−27
Zfp36l2	1.020511228	10.14841765	130.7330703	2.83244E−30	3.05262E−27
Hspd1	−1.116030522	10.09787646	130.1171232	3.86298E−30	3.90306E−27
Gm8730	0.618593594	10.48391426	128.1570741	1.03702E−29	9.86148E−27
Gm9843	0.551372502	10.68584472	121.7644479	2.59938E−28	2.33453E−25
Itgae	1.320358	9.521589264	120.7193127	4.4021E−28	3.74549E−25
Jund	−0.618823521	12.17587894	118.5549329	1.31073E−27	1.05947E−24
Ccl5	1.166637714	13.51206478	116.9541133	2.93787E−27	2.2616E−24
Ifrd1	−0.930802696	10.22453595	115.1395806	7.33487E−27	5.38979E−24
Rpl27-ps3	0.70516159	10.03539112	113.640381	1.5622E−26	1.09803E−23
Rpl35	0.424975548	11.14942572	104.8025375	1.34934E−24	9.08896E−22
Rpl23a-ps3	0.445117614	10.91295157	102.8250721	3.66087E−24	2.36726E−21
Cacybp	−0.880317879	9.788879867	98.96384198	2.57154E−23	1.59891E−20
Gzma	1.764487784	10.77239663	96.82803577	7.56178E−23	4.52754E−20
Rbm3	0.492723959	10.60453397	95.7412032	1.30927E−22	7.55916E−20
Cdkn1a	−1.206995923	9.907033741	95.52859803	1.4577E−22	8.12594E−20
Fosb	−1.066099038	9.880605281	90.88771259	1.52061E−21	8.19406E−19
Rpl9-ps6	0.616227778	10.05860333	90.30945314	2.03677E−21	1.06214E−18
Ubc	−0.604139188	11.71014404	87.02480623	1.07169E−20	5.41402E−18
Odc1	−0.946502247	10.10880077	85.58700716	2.21728E−20	1.0862E−17
Tsc22d3	0.824896603	10.1820943	79.58469358	4.61991E−19	2.19663E−16
Gm11808	0.505052668	10.40238007	79.36117782	5.17327E−19	2.38946E−16
Wdr89	0.474528645	10.61488511	75.52093649	3.61553E−18	1.62357E−15
Rpl6l	0.488489759	10.34341037	74.33251242	6.60074E−18	2.88399E−15
Atf3	−1.301093577	9.677121904	73.33073331	1.09647E−17	4.66462E−15
Bag3	−1.266132157	9.521354891	71.1109823	3.37685E−17	1.39975E−14
Cd7	1.383948283	9.71052912	66.63099706	3.27397E−16	1.32318E−13
Ubald2	−0.606943142	10.60239164	66.41228036	3.65816E−16	1.44239E−13
Gm10073	0.60015302	9.897815633	65.33692218	6.31275E−16	2.42981E−13
Dnaja4	−1.047867988	9.592869946	64.97318745	7.59241E−16	2.85439E−13
Rps27rt	0.349506577	11.36556647	63.84509364	1.34597E−15	4.94522E−13
Lmna	−1.039644505	9.877771656	63.70335194	1.44638E−15	5.19605E−13
Eif3f	0.348188622	10.67657857	59.9250672	9.85384E−15	3.46298E−12
Gm6133	0.493613949	10.06524373	59.86826662	1.01424E−14	3.48854E−12
Mat2a	−0.836955253	9.660876437	59.67147505	1.12089E−14	3.77508E−12
Gm9493	0.435772602	10.45868098	59.06053171	1.52895E−14	5.0443E−12
Tbc1d10c	0.639902903	9.791392088	58.49880807	2.03414E−14	6.57679E−12
Rps18-ps3	0.669636452	9.686630364	58.08106981	2.51535E−14	7.97317E−12
Rpl32	0.21253747	12.37847718	57.65394918	3.12535E−14	9.71623E−12
Gm2000	0.618749327	9.800115886	57.56436456	3.27098E−14	9.97712E−12
H2-D1	−0.216020929	12.2809488	55.65589398	8.63337E−14	2.58458E−11
Rpl3	0.212911971	12.08878792	55.29303986	1.03836E−13	3.05201E−11
Rpl13-ps3	0.557976851	9.854426518	54.57484183	1.49639E−13	4.30711E−11
B2m	−0.176603891	12.90330204	54.54582092	1.51865E−13	4.30711E−11
Rpl13a	0.170081845	13.15924144	53.72717786	2.30355E−13	6.42054E−11
Gm10036	0.640849878	9.721300594	53.68577585	2.3526E−13	6.44613E−11
Rgs1	0.534698556	11.99808529	53.54098127	2.53254E−13	6.82352E−11
Gm10076	0.596717543	9.779957709	53.44108257	2.66466E−13	7.06178E−11
Gm10263	0.780604259	9.452513074	53.10791718	3.15717E−13	8.23208E−11
Lcp1	0.396498657	10.52059347	52.01643536	5.5038E−13	1.41229E−10
Hist1h1c	0.957764201	9.701111152	51.90723574	5.81856E−13	1.46973E−10
Ctla4	−0.615817979	10.22784566	51.72555071	6.38267E−13	1.58742E−10
Coq10b	−0.664020777	9.717601992	49.10934376	2.42084E−12	5.9296E−10
Crem	−0.709446614	9.842415377	48.75660354	2.89781E−12	6.99195E−10
Klf4	−1.112826275	9.519315737	46.8956894	7.48672E−12	1.77986E−09
mt-Nd1	−0.32338555	10.96639023	46.25136642	1.04014E−11	2.43694E−09
Ccdc117	−0.779915449	9.506449603	44.82943889	2.14966E−11	4.96449E−09
Rpl36-ps3	0.580626548	9.694858712	44.65567952	2.34915E−11	5.34879E−09
Rgcc	−1.007094973	9.901750839	44.37211507	2.71527E−11	6.09654E−09
Rpl10-ps3	0.562706811	9.75031317	44.05381348	3.19471E−11	7.07475E−09
Rpl29	0.254087583	11.17785599	43.66475261	3.89728E−11	8.51398E−09
1810041H14Rik	0.786738522	9.425523912	42.88865415	5.79457E−11	1.249E−08
Eif2s3y	0.700036231	9.470445177	41.39992401	1.24062E−10	2.6305E−08
Rgs10	0.559350389	9.800303566	41.38062899	1.25293E−10	2.6305E−08
Cxcr6	0.490736441	10.46808826	41.26892433	1.32661E−10	2.74949E−08
Cxcl10	−1.054785352	9.738782804	41.18958781	1.38157E−10	2.82714E−08
Hspa5	−0.366763461	10.83492414	39.82661265	2.77538E−10	5.60834E−08
Apobec3	0.575215862	9.721277042	39.53476829	3.2227E−10	6.43188E−08
Slfn2	0.468248293	10.13448256	39.34340969	3.55451E−10	7.00758E−08
Dedd2	−0.668986564	9.545498301	38.99006944	4.25967E−10	8.2966E−08
Fth1	−0.247812637	11.54524749	38.79281379	4.7126E−10	9.0695E−08
Ptprcap	0.436049079	10.09758212	38.75789964	4.79765E−10	9.12456E−08
H2-K1	−0.215473813	11.62297555	38.21117955	6.34876E−10	1.19342E−07

TABLE 3R
LPL-5 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Ubb	−0.667747794	13.05670984	265.7156028	9.74321E−60	1.57509E−55
Hsp90aa1	−1.390021311	10.77771699	236.9250263	1.84164E−53	1.4886E−49
Hsp90ab1	−0.877553386	11.22553208	214.086737	1.76318E−48	9.50116E−45
Dnajb1	−2.034720283	10.05660873	212.4063054	4.10102E−48	1.65743E−44
Gm8730	0.851933726	10.24578436	206.9946236	6.21693E−47	2.01006E−43
Hspa1a	−3.201994123	10.61491682	204.4379641	2.24606E−46	6.05162E−43
Hspa8	−0.790773697	12.33316572	185.8795749	2.52221E−42	5.82487E−39
Dnaja1	−1.115058706	10.84366253	184.3752183	5.37272E−42	1.08569E−38
Rpl35	0.583624905	10.97458616	157.7700054	3.47453E−36	6.24103E−33
Hspe1	−1.122714984	10.26957624	131.5655283	1.86225E−30	3.01051E−27
Malat1	−0.529186268	14.79984657	126.899325	1.95441E−29	2.87227E−26
Gm9843	0.631738591	10.43647932	122.2523516	2.03268E−28	2.73835E−25
Rpl9-ps6	0.809660987	9.759551999	106.7457447	5.06108E−25	6.29365E−22
Rpl6l	0.633388877	10.12675606	100.075177	1.46721E−23	1.69421E−20
Gm9493	0.571951632	10.23323023	85.51740481	2.29671E−20	2.47524E−17
Rpl27-ps3	0.729614246	9.781981089	84.53046761	3.78339E−20	3.82265E−17
Rpl23a-ps3	0.473928723	10.60530193	83.90585402	5.18906E−20	4.9345E−17
Hsph1	−1.177413258	9.464086511	74.92950145	4.87826E−18	4.38122E−15
Gm11808	0.601111889	10.07554584	72.80397873	1.43188E−17	1.2183E−14
Gm2000	0.802070822	9.596573833	70.33377085	5.00731E−17	4.04741E−14
Hspd1	−0.890332867	9.826990882	67.99041097	1.64293E−16	1.26474E−13
Rpl32	0.263487778	12.19599702	64.29385621	1.07179E−15	7.87574E−13
Satb1	0.819131319	9.737592769	63.08567762	1.97908E−15	1.39103E−12
Rplp0	0.258058129	12.11340747	60.06163932	9.19327E−15	6.19244E−12
Ddx5	−0.338656579	11.43119638	58.94745616	1.61939E−14	1.04716E−11
Rpl24	0.266833972	11.64961557	58.38416317	2.1562E−14	1.34066E−11
Fosb	−1.074649073	9.490138093	57.46868713	3.43403E−14	2.05609E−11
Rps12-ps3	0.587568991	9.824084704	55.69125561	8.47946E−14	4.89568E−11
Rbm3	0.389737471	10.63055567	55.06584393	1.16559E−13	6.49756E−11
Rpl10-ps3	0.711450504	9.547172531	54.99892102	1.20596E−13	6.49852E−11
Gm10073	0.644880368	9.623688778	52.69248962	3.9008E−13	2.0342E−10
Jund	−0.397700454	12.17425697	52.22636503	4.94576E−13	2.49854E−10
Prr7	−0.639601864	10.04331603	52.06546063	5.36809E−13	2.62971E−10
Itgae	1.123657217	9.319838841	51.56974696	6.90982E−13	3.28542E−10
Eef2	0.29305387	11.17127454	50.2993106	1.31996E−12	6.05646E−10
Hspa1b	−1.112341319	9.284322097	50.25702435	1.34871E−12	6.05646E−10
Wdr89	0.439221506	10.3352908	49.53293438	1.95069E−12	8.52295E−10
Gm6133	0.523936873	9.843311357	47.94692977	4.37913E−12	1.86298E−09
Gm10263	0.852181403	9.264949602	47.75742561	4.82354E−12	1.99942E−09
Chchd2	−0.36297706	10.50692552	47.31500857	6.04476E−12	2.44299E−09
Cd160	1.185837125	9.397166234	45.0097638	1.96054E−11	7.73028E−09
AY036118	0.801085044	9.298633911	44.02645037	3.23968E−11	1.24697E−08
Rpl29	0.291653565	10.96053826	43.6349489	3.95709E−11	1.48768E−08
Rpsa	0.268788369	11.41599406	43.26500152	4.78058E−11	1.75643E−08
Rps18-ps3	0.697609539	9.437736028	42.05344044	8.88128E−11	3.19055E−08
Rpl13-ps3	0.566952616	9.614334098	40.26690495	2.2153E−10	7.78534E−08
Gm10076	0.592960428	9.574070265	39.75217493	2.88319E−10	9.91696E−08
Uba52	0.418146824	10.13486888	39.60024883	3.11644E−10	1.04959E−07
Rps27rt	0.320302058	10.99650998	39.32759785	3.58341E−10	1.18223E−07
Rps26-ps1	0.70530421	9.384930749	38.94602666	4.35686E−10	1.38104E−07
Rpl15	0.323801677	10.62581306	38.96325972	4.31857E−10	1.38104E−07
mt-Co1	0.23982267	12.12069306	38.69051414	4.96617E−10	1.5439E−07
Rps11	0.186996755	12.06257295	37.34887398	9.87779E−10	3.01291E−07

TABLE 3S
LPL-6 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Rpl27-ps3	1.000892179	9.677930454	232.0702931	2.10792E−52	3.40767E−48
Hsp90aa1	−1.210351983	10.47955889	202.9526524	4.73718E−46	3.60335E−42
Gm8730	0.756647108	10.38713922	202.2665877	6.68691E−46	3.60335E−42
Hspa1a	−3.243435226	9.933983278	198.1462725	5.3011E−45	2.14244E−41
Ubb	−0.574565023	12.67292372	180.0597604	4.70297E−41	1.52056E−37
Dnajb1	−1.702734682	9.424438564	179.4808902	6.29164E−41	1.69518E−37
Wdr89	0.640598855	10.29329469	176.5192226	2.78904E−40	6.4411E−37
Gm9843	0.665821745	10.37262602	158.7124543	2.16256E−36	4.37E−33
Rpl9-ps6	0.849063028	9.614175562	142.8508334	6.33644E−33	1.13817E−29
Rpl6l	0.667371325	10.05028615	139.6822252	3.12395E−32	5.05018E−29
Dnaja1	−0.936847633	10.37482583	137.9055231	7.64278E−32	1.12321E−28
Rpl35	0.474243562	11.1600212	133.1346392	8.44835E−31	1.13813E−27
Gm2000	0.900801116	9.411532299	131.3566669	2.06886E−30	2.5727E−27
Hsp90ab1	−0.638919781	11.00174478	119.0868662	1.00242E−27	1.15751E−24
Malat1	−0.541217017	14.12310599	110.177485	8.95985E−26	9.65633E−23
Rpl23a-ps3	0.532413845	10.61742407	109.6556439	1.16582E−25	1.17791E−22
Gm11808	0.647313204	9.982489755	106.0637432	7.14011E−25	6.78983E−22
Rpl10-ps3	0.93087986	9.304624268	102.2688908	4.84745E−24	4.35355E−21
Gm9493	0.557945752	10.19580436	100.6832828	1.07933E−23	9.18337E−21
Gm10073	0.803166764	9.440142111	94.98063058	1.92257E−22	1.55402E−19
Hspe1	−0.787573629	10.02870964	81.44687154	1.80037E−19	1.38594E−16
Rps18-ps3	0.874430698	9.141091849	81.14090097	2.10185E−19	1.54447E−16
Gm6133	0.609584976	9.693751155	79.56643779	4.66279E−19	3.27734E−16
Gm10076	0.78780773	9.320701955	76.68494977	2.00526E−18	1.35071E−15
Gm10036	0.810805014	9.213962076	74.61076882	5.73296E−18	3.70716E−15
Rpl7a-ps5	0.908100854	9.003418976	71.62566534	2.60151E−17	1.61754E−14
Gm9844	0.795707711	9.253843776	70.30676693	5.07633E−17	3.0394E−14
Rpl36-ps3	0.826670812	9.144263881	68.68823221	1.15327E−16	6.65849E−14
AY036118	1.000399497	8.8526315	58.45878653	2.07594E−14	1.11866E−11
Lrrc58	0.828432135	9.10202243	58.49410236	2.03901E−14	1.11866E−11
Gm10250	0.841380514	8.998216795	56.86543552	4.66677E−14	2.43364E−11
Rpl15	0.321012912	10.70053263	55.03639559	1.18318E−13	5.9773E−11
Lmna	−1.033273941	9.199192092	53.22605295	2.9729E−13	1.45636E−10
Rps12-ps3	0.511506106	9.706346193	53.00742095	3.32291E−13	1.57994E−10
Uba52	0.452683276	10.01489978	51.85402704	5.97839E−13	2.76133E−10
Rpl13-ps3	0.621729495	9.346679461	48.71691561	2.95705E−12	1.32788E−09
Rpl29	0.258694868	11.28929882	46.03406713	1.16214E−11	5.07763E−09
Jund	−0.427242629	11.18646997	44.56718827	2.45776E−11	1.04558E−08
Junb	−0.438372159	11.38076207	43.97788044	3.32108E−11	1.37663E−08
Gm42418	0.725684143	8.981321303	42.89367766	5.77971E−11	2.33587E−08
Rps27rt	0.353162983	10.92491058	39.91812858	2.64834E−10	1.04422E−07
Chchd2	−0.311772562	10.31406676	39.44480899	3.37464E−10	1.29891E−07
Rbm3	0.32207408	10.71438018	38.81533478	4.65854E−10	1.71628E−07
Rps26-ps1	0.718056862	9.019003364	38.80999724	4.67129E−10	1.71628E−07
Ddx5	−0.278755543	10.97294105	37.85862663	7.60613E−10	2.73246E−07
Cdkn1a	−0.79324254	9.191708702	37.79083713	7.87508E−10	2.76758E−07

TABLE 3T
LPL-7 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Gm9843	0.679076895	10.68936848	85.64667834	2.15137E−20	2.46863E−16
Wdr89	0.741913181	10.65124957	84.95385849	3.0541E−20	2.46863E−16
Hspa8	−0.660530188	12.56155791	81.61422367	1.65419E−19	8.9139E−16
Dnajb1	−1.649042898	10.57015052	80.42659398	3.01707E−19	1.12709E−15
Hsp90ab1	−0.784877451	11.53679216	80.14113929	3.48598E−19	1.12709E−15
Rpl27-ps3	0.886089505	10.09707719	79.75671931	4.23468E−19	1.14096E−15
Ubb	−0.498645077	13.14137294	79.18808927	5.64695E−19	1.30412E−15
Hsp90aa1	−1.001997476	11.1674382	72.06971016	2.07728E−17	4.19766E−14
Rps27rt	0.538171151	11.50969557	70.70374503	4.15104E−17	7.45619E−14
Dnaja1	−0.843376752	11.10860762	62.44563998	2.73902E−15	4.42789E−12
Rpl35	0.489450987	11.11111461	58.91362524	1.64747E−14	2.42119E−11
Malat1	−0.461372669	14.92882516	58.52275262	2.00954E−14	2.70718E−11
Gm8730	0.632965858	10.46529795	56.55413113	5.46724E−14	6.79872E−11
Rpl9-ps6	0.735601623	10.06584632	49.89813247	1.61939E−12	1.86993E−09
Rps18-ps3	0.949329603	9.757081417	49.11636357	2.41219E−12	2.5997E−09
Rpl23a-ps3	0.516177035	10.81532166	45.89587466	1.24708E−11	1.26002E−08
Gm11808	0.599716998	10.3153324	44.88415961	2.09042E−11	1.98787E−08
Rpl6l	0.570669176	10.35956478	44.21034092	2.94919E−11	2.6487E−08
Hspe1	−0.857543595	10.72567371	43.97285148	3.32962E−11	2.83298E−08
Zfp36l2	0.848268603	10.19106218	43.66380014	3.89918E−11	3.15171E−08
Rps12-ps3	0.693919785	10.07841838	42.55899212	6.85823E−11	5.27953E−08
Rpl13a	0.252632783	13.2005704	40.88104103	1.61783E−10	1.18881E−07
Rpl13-ps3	0.768495136	9.869026408	38.6191581	5.15108E−10	3.62054E−07

TABLE 3U
LPL-8 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Hspa1a	−4.46133106	9.487194307	303.1093704	6.92398E−68	1.11933E−63
Hsp90aa1	−1.392806426	10.0823126	226.1411471	4.13928E−51	3.34578E−47
Dnajb1	−1.900971523	8.769887068	179.91552	5.05668E−41	2.72488E−37
Rbm3	0.641674082	11.24281554	156.1928534	7.6829E−36	3.10504E−32
Gm8730	0.780025906	10.21672865	140.0001899	2.66178E−32	8.60607E−29
Hspa8	−0.674361493	11.79442321	131.7442211	1.70194E−30	4.58559E−27
Hspa1b	−2.527753243	8.164889167	119.0070748	1.04357E−27	2.41004E−24
Malat1	−0.913828296	12.8841938	103.0583966	3.25413E−24	6.48903E−21
Hsp90ab1	−0.711121034	10.61566746	102.851369	3.6126E−24	6.48903E−21
Ubb	−0.618061035	12.11138082	88.5469168	4.96434E−21	8.02535E−18
Rplp0	0.386720187	12.56982724	80.78667159	2.51448E−19	3.69537E−16
Hsph1	−1.509444326	8.280317907	75.08869481	4.50036E−18	6.06273E−15
Hspe1	−0.879787784	9.328717894	71.0337361	3.51169E−17	4.36692E−14
Ubc	−0.738216636	10.18004219	70.86468308	3.82586E−17	4.41777E−14
Rpl35	0.450528289	11.14097897	68.69089929	1.15171E−16	1.24124E−13
Dnaja1	−0.660080702	9.700853705	57.96742407	2.66495E−14	2.69259E−11
Rpl27-ps3	0.769290147	8.860371085	56.31921573	6.16104E−14	5.85878E−11
Gm2000	0.803158017	8.865313337	51.98860839	5.58236E−13	5.01358E−10
Gm10076	0.792181373	8.938297761	49.98552982	1.54884E−12	1.31782E−09
H2-K1	−0.515701257	10.79228433	47.79738871	4.72621E−12	3.8202E−09
H2-Q7	−0.62224609	9.790270068	47.25801338	6.2231E−12	4.79061E−09
Rpl3	0.295505002	11.93101795	45.77011002	1.32977E−11	9.7714E−09
Gm10073	0.771973453	8.899753731	44.51396459	2.52549E−11	1.77509E−08
Rpl10-ps3	0.794752736	8.799079764	43.51094877	4.21594E−11	2.83979E−08
Rpl13	0.295566129	12.2801827	43.04061266	5.36153E−11	3.46698E−08
Rpl32	0.300115748	12.37635341	42.59945259	6.71782E−11	4.17693E−08
Jund	−0.551080322	10.78767876	42.38224753	7.50683E−11	4.49465E−08
Rpl10a	0.389587396	11.15066686	41.45258432	1.20765E−10	6.73201E−08
Isg15	−1.276987474	8.306648902	41.51123525	1.17195E−10	6.73201E−08
Rps18-ps3	0.999323395	8.484337215	40.88283659	1.61634E−10	8.70994E−08
Fosb	−1.399459966	8.173149877	40.59851305	1.86949E−10	9.74908E−08
Rps18	0.315086971	12.25780987	40.12474383	2.38252E−10	1.17306E−07
Rpl18a	0.239964236	12.26488225	40.11487131	2.39459E−10	1.17306E−07
Rpl18	0.269829889	11.37724478	39.31803433	3.601E−10	1.71217E−07
Rps4x	0.281160834	11.75181977	39.26100381	3.70773E−10	1.71255E−07

TABLE 3V
LPL-9 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Hspa1a	−3.208006096	10.63021086	97.57359097	5.18914E−23	8.38877E−19
Ubb	−0.760618634	12.38390677	60.1939278	8.5957E−15	6.9479E−11
Gzma	2.923731333	12.03426076	56.95387224	4.46155E−14	2.40418E−10
Hspa1b	−2.544460073	9.795567163	53.74015844	2.28838E−13	9.24847E−10
Hsp90aa1	−1.50442418	10.20067248	42.7113425	6.34433E−11	2.05125E−07
Ccr9	2.221991151	9.9641527	40.55436946	1.9122E−10	5.15212E−07

TABLE 3W
LPL-10 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Hspa1a	−3.279080597	9.77749525	66.6687553	3.21186E−16	5.19229E−12
Malat1	−0.906756376	13.82786584	48.20036621	3.84816E−12	3.11047E−08
Dnajb1	−1.9736233	9.859710517	47.29375921	6.11065E−12	3.29282E−08
Ubb	−0.62876509	12.23504229	27.75960127	1.37365E−07	0.00055516
Dnaja1	−1.070648437	10.15612377	21.95233617	2.79506E−06	0.009037003

TABLE 3X
LPL-11 Ctrl vs. KO
GeneSymbol	logFC	logCPM	LR	PValue	FDR
Gm9843	1.152747768	10.86191498	107.7332038	3.07507E−25	4.97117E−21
Rps27rt	0.936042362	11.6006599	98.51241281	3.22994E−23	2.61076E−19
Uba52	1.259153747	10.29857567	89.76924229	2.67623E−21	1.25309E−17
Gm11808	1.174254179	10.36510957	89.13644101	3.685E−21	1.25309E−17
Rpl6l	1.12148656	10.43521049	89.03662136	3.87571E−21	1.25309E−17
Gm8730	1.178269708	10.48527954	88.52016702	5.03192E−21	1.35577E−17
Rpl23a-ps3	0.97111709	11.05711726	87.23097408	9.65597E−21	2.22998E−17
Rpl9-ps6	1.361164957	10.11088474	85.89170087	1.90065E−20	3.41399E−17
Gm9493	1.04400959	10.54876454	85.92861245	1.8655E−20	3.41399E−17
Rpl27-ps3	1.236714099	10.05185113	73.33936538	1.09169E−17	1.76482E−14
Gm2000	1.283533859	9.738432617	68.91660374	1.02716E−16	1.50956E−13
Rpl35	0.739766449	11.21870405	65.61762991	5.47468E−16	7.37531E−13
Gm10036	1.489161877	9.448810832	64.09537827	1.18539E−15	1.47408E−12
Wdr89	0.805998267	10.97502014	59.64331287	1.13705E−14	1.31297E−11
Gm10073	1.302016708	9.701129124	56.54648834	5.48853E−14	5.91517E−11
Gm10076	1.506003095	9.391444214	50.19653071	1.39094E−12	1.40537E−09
Rpl15	0.715629478	10.88701252	45.13720707	1.83702E−11	1.7469E−08
Rpl36-ps3	1.287158449	9.442853364	41.85453352	9.83225E−11	8.83046E−08
Gm6133	0.942044122	9.994215819	40.6518122	1.81918E−10	1.54784E−07

TABLE 3Y
GWAS
GeneSymbol	LPL-2 logFC	LPL-2 FDR	LPL-9 logFC	LPL-9 FDR	LPL-7 logFC	LPL-7 FDR	GWAS?
Zfp36l2	0.757	2.01E−14	1.283	6.35E−03	0.848	3.15E−08	TRUE
Tnfsf8	−0.869	1.14E−10	−0.918	4.04E−01	−0.359	9.46E−01	TRUE
Gpr18	0.867	1.82E−10	1.208	8.21E−02	0.102	1.00E+00	TRUE
Ctsw	0.398	1.07E−08	0.231	1.00E+00	0.379	2.95E−01	TRUE
Ccr5	0.704	1.48E−08	0.294	1.00E+00	0.239	7.62E−01	TRUE
Krtcap2	−0.312	3.46E−07	−0.676	5.81E−03	−0.003	1.00E+00	TRUE
Rpl3	0.149	2.99E−06	0.169	9.15E−01	0.195	2.69E−03	TRUE
Crem	−0.459	3.59E−05	−0.286	1.00E+00	−0.580	2.86E−02	TRUE
Cd28	−0.289	5.47E−05	0.156	1.00E+00	0.237	3.59E−01	TRUE
Lsp1	0.201	7.10E−04	−0.014	1.00E+00	0.098	1.00E+00	TRUE
Il7r	0.351	7.68E−04	0.540	8.46E−01	0.910	8.48E−04	TRUE
Irf1	−0.433	1.05E−03	0.143	1.00E+00	−0.190	1.00E+00	TRUE
Itga4	0.408	2.71E−03	0.595	9.15E−01	0.030	1.00E+00	TRUE
Apobr	−0.325	7.72E−03	−0.049	1.00E+00	0.009	1.00E+00	TRUE
Tnfrsf9	−0.127	9.01E−01	−0.515	9.15E−01	−0.836	8.81E−03	TRUE
Ccnd3	−0.283	1.64E−02	−0.302	1.00E+00	0.212	9.60E−01	TRUE
Csf2	−0.426	1.96E−02	−0.124	1.00E+00	0.000	1.00E+00	TRUE
Fermt3	0.314	2.58E−02	0.043	1.00E+00	0.117	1.00E+00	TRUE
Dpm3	−0.287	3.08E−02	0.124	1.00E+00	0.129	1.00E+00	TRUE
Gnb2	0.204	3.37E−02	−0.279	1.00E+00	0.375	7.83E−02	TRUE
Dap	0.340	3.38E−02	0.719	7.71E−01	−0.084	1.00E+00	TRUE
Cd74	−0.489	3.79E−02	−0.385	1.00E+00	−0.539	3.37E−01	TRUE
Fos	−0.534	4.09E−02	−0.878	8.71E−01	−0.802	3.89E−02	TRUE
St13	−0.293	4.51E−02	0.536	9.15E−01	−0.079	1.00E+00	TRUE
Fam213b	−0.144	5.40E−02	0.000	1.00E+00	0.051	1.00E+00	TRUE
Cd6	0.228	5.53E−02	−0.222	1.00E+00	−0.067	1.00E+00	TRUE
Dnajb4	−0.343	6.08E−02	−0.126	1.00E+00	−0.059	1.00E+00	TRUE
Ptprc	0.165	6.25E−02	0.265	1.00E+00	−0.053	1.00E+00	TRUE
Socs1	−0.338	6.39E−02	−0.358	1.00E+00	−0.233	9.77E−01	TRUE
Ncf4	0.292	6.51E−02	−0.207	1.00E+00	0.381	5.41E−01	TRUE
Rps14	−0.004	1.00E+00	−0.003	1.00E+00	0.138	6.58E−02	TRUE
Vmp1	0.273	6.92E−02	0.818	6.99E−01	0.202	9.46E−01	TRUE
Cd226	0.350	7.33E−02	0.189	1.00E+00	0.086	1.00E+00	TRUE
Hdac7	0.285	7.88E−02	0.174	1.00E+00	0.124	1.00E+00	TRUE
Pim3	−0.293	2.16E−01	−0.032	1.00E+00	−0.652	8.14E−02	TRUE
Traf3ip2	0.286	9.01E−02	0.462	7.75E−01	−0.003	1.00E+00	TRUE
Ets1	0.162	9.20E−02	−0.032	1.00E+00	0.108	9.68E−01	TRUE
Lpxn	0.211	9.69E−02	0.245	1.00E+00	0.258	7.35E−01	TRUE
Dnajb1	−2.545	7.19E−117	−1.766	3.18E−06	−1.649	1.13E−15	FALSE
Ubb	−0.719	6.98E−110	−0.761	6.95E−11	−0.499	1.30E−15	FALSE
Hspa1a	−4.265	1.73E−105	−3.208	8.39E−19	−1.733	5.26E−06	FALSE
Hsp90aa1	−1.539	9.57E−97	−1.504	2.05E−07	−1.002	4.20E−14	FALSE
Hsp90ab1	−1.045	1.54E−91	−0.600	2.04E−02	−0.785	1.13E−15	FALSE
Malat1	−0.788	3.06E−83	−0.680	1.62E−06	−0.461	2.71E−11	FALSE
Dnaja1	−1.161	4.16E−78	−0.342	9.15E−01	−0.843	4.43E−12	FALSE
Lmna	−1.945	1.16E−69	−1.519	8.60E−04	−0.532	2.38E−01	FALSE
Hspa8	−0.679	3.81E−68	0.219	9.15E−01	−0.661	8.91E−16	FALSE
Gm8730	0.782	1.16E−56	0.971	5.54E−06	0.633	6.80E−11	FALSE
Rpl27-ps3	1.053	8.09E−50	0.805	2.26E−01	0.886	1.14E−15	FALSE
Rgcc	−1.711	1.89E−45	−0.813	6.43E−01	−0.460	7.35E−01	FALSE
Jund	−0.676	6.22E−42	−0.962	8.04E−06	−0.377	2.69E−03	FALSE
Rpl35	0.509	2.46E−40	0.492	1.94E−02	0.489	2.42E−11	FALSE
Gm10076	1.043	8.24E−36	0.361	1.00E+00	0.608	6.02E−04	FALSE
Hspe1	−0.936	2.25E−31	−0.529	7.11E−01	−0.858	2.83E−08	FALSE
Rbm3	0.522	1.00E−30	0.689	2.20E−03	0.154	7.29E−01	FALSE
Hspa1b	−1.577	8.12E−29	−2.544	9.25E−10	−1.026	1.09E−03	FALSE
Rpl6I	0.619	1.52E−27	0.448	7.04E−01	0.571	2.65E−08	FALSE
Rpl9-ps6	0.729	4.55E−26	0.328	1.00E+00	0.736	1.87E−09	FALSE
Plac8	1.004	1.74E−25	0.891	8.71E−02	0.027	1.00E+00	FALSE
Rpl10-ps3	0.892	5.90E−25	0.219	1.00E+00	0.590	2.76E−03	FALSE
Rplp0	0.288	2.35E−24	0.335	8.03E−02	0.162	5.42E−02	FALSE
Gm2000	0.840	1.60E−23	0.555	8.76E−01	0.761	2.50E−06	FALSE
AY036118	1.145	3.92E−23	−0.264	1.00E+00	0.648	9.48E−03	FALSE
Rps11	0.296	3.92E−23	0.236	5.32E−01	0.243	1.39E−04	FALSE
Gm9843	0.527	2.80E−22	0.157	1.00E+00	0.679	2.47E−16	FALSE
Crip1	−0.543	9.93E−22	−0.131	1.00E+00	−0.778	1.45E−06	FALSE
Atf3	−1.251	9.16E−21	−0.652	6.82E−01	−0.067	1.00E+00	FALSE
Fosb	−1.291	1.68E−20	−0.525	4.01E−01	−0.170	1.00E+00	FALSE
Ccl5	1.130	1.94E−20	1.434	3.77E−04	−0.184	7.29E−01	FALSE
H2-D1	−0.246	2.77E−18	−0.296	1.15E−01	−0.151	8.69E−02	FALSE
Gzma	1.725	5.05E−18	2.924	2.40E−10	1.884	2.33E−06	FALSE
Capg	−0.679	5.65E−18	−0.770	1.12E−01	0.058	1.00E+00	FALSE
Hsph1	−1.043	8.62E−18	−0.588	9.15E−01	−0.608	5.42E−02	FALSE
AW112010	0.445	9.11E−18	0.011	1.00E+00	−0.335	2.06E−02	FALSE
Rps12-ps3	0.611	3.47E−17	0.168	1.00E+00	0.694	5.28E−08	FALSE
Rpl23a-ps3	0.404	5.51E−17	0.279	9.15E−01	0.516	1.26E−08	FALSE
Cd160	1.385	5.51E−17	1.394	4.54E−04	0.356	7.73E−01	FALSE
Fth1	−0.335	7.81E−17	−0.305	6.82E−01	−0.210	1.13E−01	FALSE
Wdr89	0.370	1.58E−10	0.105	1.00E+00	0.742	2.47E−16	FALSE
Rpl32	0.227	4.23E−16	0.259	2.34E−01	0.200	5.19E−04	FALSE
Gm10073	0.680	5.48E−16	0.067	1.00E+00	0.567	5.13E−04	FALSE
Gimap4	0.436	9.14E−16	0.030	1.00E+00	0.301	1.42E−02	FALSE
Odc1	−0.776	1.42E−15	−0.233	1.00E+00	−0.406	1.41E−01	FALSE
Klf4	−0.945	1.52E−15	0.000	1.00E+00	−0.373	9.46E−01	FALSE
Gm9493	0.455	2.68E−15	0.186	1.00E+00	0.476	8.63E−06	FALSE
Epsti1	0.517	6.73E−15	0.125	1.00E+00	0.223	8.69E−01	FALSE
Mat2a	−0.791	7.03E−15	0.545	9.50E−01	−0.246	8.90E−01	FALSE
Chchd2	−0.377	7.45E−15	−0.264	9.44E−01	−0.256	1.72E−01	FALSE
Eef2	0.257	6.16E−14	0.224	9.15E−01	0.279	5.69E−04	FALSE
Hspd1	−0.730	6.37E−14	−0.022	1.00E+00	−0.736	1.21E−04	FALSE
Tnfsf11	−1.017	6.37E−14	−0.485	1.00E+00	−0.517	2.38E−01	FALSE
Rps27rt	0.153	3.85E−02	0.017	1.00E+00	0.538	7.46E−14	FALSE
Rpsa	0.270	7.83E−14	0.161	9.96E−01	0.109	7.35E−01	FALSE
Ubc	−0.410	8.17E−14	−0.272	9.31E−01	−0.333	1.87E−02	FALSE
Limd2	0.519	1.01E−13	0.323	9.15E−01	0.021	1.00E+00	FALSE
Ddx5	−0.322	1.29E−13	0.096	1.00E+00	−0.242	1.87E−02	FALSE
Slc25a5	0.364	1.37E−13	0.436	4.18E−01	0.106	1.00E+00	FALSE
Calm2	−0.418	1.37E−13	−0.269	9.43E−01	−0.250	2.68E−01	FALSE
Coro1a	0.346	1.79E−13	−0.211	9.15E−01	0.026	1.00E+00	FALSE
Rpl7a-ps5	0.793	2.08E−13	0.495	9.82E−01	0.855	2.71E−05	FALSE
Kdm6b	−0.839	2.14E−13	−0.042	1.00E+00	−0.228	9.94E−01	FALSE
Cd7	1.097	2.81E−13	1.933	2.19E−05	−0.262	1.00E+00	FALSE
mt-Co1	0.235	1.31E−12	0.240	7.06E−01	0.134	5.30E−01	FALSE
Gm11808	0.461	2.96E−12	−0.153	1.00E+00	0.600	1.99E−08	FALSE
Ptprcap	0.468	3.65E−12	0.222	1.00E+00	−0.099	1.00E+00	FALSE
Rpl29	0.262	6.50E−12	0.377	2.07E−01	0.306	2.80E−04	FALSE
Fam110a	−0.790	7.03E−12	−0.231	1.00E+00	−0.585	1.38E−01	FALSE
Rpl39I	−0.660	1.20E−11	0.063	1.00E+00	−0.011	1.00E+00	FALSE
H2-K1	−0.262	1.91E−11	−0.387	1.01E−01	−0.129	5.03E−01	FALSE
Rpl15	0.305	2.06E−11	0.353	6.35E−01	0.300	5.49E−03	FALSE
Rpl13-ps3	0.582	2.23E−11	0.125	1.00E+00	0.768	3.62E−07	FALSE
Rps6	0.188	3.84E−11	0.218	6.23E−01	0.136	1.36E−01	FALSE
Klrk1	−0.696	9.06E−11	−1.397	1.40E−01	−0.182	1.00E+00	FALSE
Lrrc58	0.664	1.14E−10	0.153	1.00E+00	0.342	5.86E−01	FALSE
mt-Nd1	−0.317	1.96E−10	−0.384	4.52E−01	−0.093	9.89E−01	FALSE
Cdkn1a	−0.799	2.00E−10	−0.160	1.00E+00	−1.077	2.18E−05	FALSE
Pycard	0.552	3.15E−10	0.411	9.15E−01	0.196	9.47E−01	FALSE
Rpl24	0.196	6.92E−10	0.424	5.06E−03	0.103	7.35E−01	FALSE
Rps26-ps1	0.687	9.14E−10	0.339	1.00E+00	0.587	1.68E−02	FALSE
Lgals1	−0.300	1.31E−09	−0.372	8.36E−01	−0.200	8.31E−01	FALSE
Rpl18	0.193	1.53E−09	0.239	5.56E−01	0.107	6.97E−01	FALSE
Tuba1b	−0.597	1.83E−09	−0.023	1.00E+00	−0.159	1.00E+00	FALSE
Anxa1	−0.789	2.26E−09	−0.508	1.00E+00	−0.071	1.00E+00	FALSE
Eif3f	0.262	2.26E−09	0.628	1.66E−03	0.129	7.72E−01	FALSE
Rps18-ps3	0.518	1.84E−06	−0.035	1.00E+00	0.949	2.60E−09	FALSE
Arhgdib	0.265	2.99E−09	0.107	1.00E+00	0.070	1.00E+00	FALSE
S100a11	−0.309	3.72E−09	−0.571	2.09E−02	−0.140	9.38E−01	FALSE
Gm10250	0.669	4.08E−09	0.479	9.50E−01	0.594	2.22E−02	FALSE
Actg1	0.252	5.73E−09	−0.085	1.00E+00	−0.255	4.14E−02	FALSE
Rgs10	0.576	7.56E−09	0.509	8.47E−01	0.223	1.00E+00	FALSE
Cox7a2l	0.344	9.72E−09	0.562	2.23E−01	0.225	5.06E−01	FALSE
Ifrd1	−0.475	1.07E−08	−0.537	9.15E−01	−0.207	9.46E−01	FALSE
B2m	−0.150	1.93E−08	−0.197	5.39E−01	−0.153	8.64E−03	FALSE
Gm10020	0.682	2.04E−08	0.130	1.00E+00	0.394	4.80E−01	FALSE
Hspa5	−0.331	2.08E−08	−0.159	1.00E+00	−0.539	9.48E−07	FALSE
Cd44	−0.531	2.73E−08	−0.394	1.00E+00	0.199	9.77E−01	FALSE
Id2	−0.415	4.68E−08	−0.270	9.15E−01	−0.485	1.10E−02	FALSE
Shisa5	0.242	5.38E−08	0.220	9.15E−01	0.160	6.70E−01	FALSE
Srsf2	−0.454	5.55E−08	−0.145	1.00E+00	−0.231	7.35E−01	FALSE
Itgae	0.822	6.06E−08	1.438	2.78E−03	0.097	1.00E+00	FALSE
H2-Q7	−0.287	6.64E−08	−0.330	9.15E−01	−0.204	2.09E−01	FALSE
Nmrk1	−0.649	6.64E−08	−0.216	1.00E+00	−0.349	7.39E−01	FALSE
Gm10036	0.543	7.07E−08	0.284	1.00E+00	0.599	3.19E−03	FALSE
Sh3bgrl3	−0.214	7.55E−08	−0.185	9.15E−01	−0.135	8.78E−01	FALSE
Txn1	−0.358	7.94E−08	−0.019	1.00E+00	−0.413	1.07E−02	FALSE
Ly6e	−0.296	1.04E−07	−0.168	1.00E+00	−0.115	1.00E+00	FALSE
Pim1	−0.384	1.17E−07	1.112	7.90E−02	−0.147	1.00E+00	FALSE
Rpl22l1	0.264	1.17E−07	0.667	2.78E−03	0.241	1.31E−01	FALSE
Prr7	−0.462	1.18E−07	−0.038	1.00E+00	−0.359	6.64E−01	FALSE
Rpl13a	0.112	8.57E−04	0.204	5.26E−01	0.253	1.19E−07	FALSE
Ifitm1	−1.211	2.18E−07	−0.065	1.00E+00	−0.042	1.00E+00	FALSE
Sertad1	−0.661	2.31E−07	−0.315	1.00E+00	−0.515	1.82E−01	FALSE
Ybx1	−0.266	2.52E−07	−0.190	1.00E+00	−0.142	8.82E−01	FALSE
Cldnd1	−0.520	2.52E−07	−1.374	2.60E−04	−0.132	1.00E+00	FALSE
Tmem234	0.427	3.46E−07	0.378	9.96E−01	0.107	1.00E+00	FALSE
Bola2	−0.480	3.67E−07	−0.411	9.33E−01	−0.111	1.00E+00	FALSE
Serpinb6b	0.564	3.86E−07	0.097	1.00E+00	0.312	8.36E−01	FALSE
Gm6133	0.402	3.94E−07	0.500	8.71E−01	0.658	3.94E−07	FALSE
Rps3a1	0.171	4.56E−07	0.190	9.15E−01	0.229	1.32E−03	FALSE
Ccr9	0.870	4.80E−06	2.222	5.15E−07	0.716	1.43E−01	FALSE
Cacybp	−0.535	6.43E−07	−0.424	9.96E−01	−0.502	6.32E−02	FALSE
Tspan31	−0.578	7.07E−07	0.251	1.00E+00	−0.153	1.00E+00	FALSE
Gmfg	0.309	7.13E−07	0.002	1.00E+00	0.102	1.00E+00	FALSE
Gm12840	0.587	7.30E−07	0.093	1.00E+00	−0.072	1.00E+00	FALSE
Acp5	0.557	8.50E−07	0.657	7.11E−01	0.205	1.00E+00	FALSE
Cd69	−0.535	8.50E−07	−0.128	1.00E+00	0.325	7.35E−01	FALSE
Rps28	0.023	9.39E−01	0.234	8.27E−01	0.346	8.78E−07	FALSE
Cd82	−0.350	1.39E−06	−0.388	9.15E−01	0.045	1.00E+00	FALSE
Rps19	0.000	1.00E+00	0.135	1.00E+00	0.309	1.69E−06	FALSE
Gm10709	0.581	1.74E−06	0.044	1.00E+00	0.313	6.24E−01	FALSE
Cox4i1	0.210	1.86E−06	0.261	8.76E−01	0.053	1.00E+00	FALSE
Gzmb	0.744	1.86E−06	0.314	1.00E+00	−0.177	1.00E+00	FALSE
Il22	−0.801	2.21E−06	−0.122	1.00E+00	−0.588	3.81E−02	FALSE
Calm1	−0.233	2.38E−06	−0.152	1.00E+00	−0.075	1.00E+00	FALSE
Zc3h12a	−0.459	2.45E−06	−0.204	1.00E+00	0.018	1.00E+00	FALSE
Ier5l	−0.608	2.59E−06	0.058	1.00E+00	−0.481	4.56E−01	FALSE
Fus	−0.382	3.48E−06	−0.622	4.98E−01	−0.343	1.31E−01	FALSE
Klhl6	0.545	3.88E−06	0.258	1.00E+00	0.321	9.46E−01	FALSE
Atp2b1	−0.507	4.14E−06	−0.202	1.00E+00	−0.344	6.89E−01	FALSE
Tbc1d10c	0.448	4.33E−06	0.319	9.28E−01	0.419	1.97E−01	FALSE
H2-Q6	−0.388	4.58E−06	−0.416	9.15E−01	−0.205	8.35E−01	FALSE
Ctla2a	−0.437	5.15E−06	−0.890	2.05E−01	−0.240	8.18E−01	FALSE
Cnn2	0.317	5.69E−06	0.169	1.00E+00	0.139	1.00E+00	FALSE
Selplg	0.263	6.24E−06	0.320	9.15E−01	0.298	2.54E−01	FALSE
Apobec3	0.443	7.33E−06	0.324	1.00E+00	0.170	1.00E+00	FALSE
Crip2	−0.681	8.46E−06	0.156	1.00E+00	−0.339	6.80E−01	FALSE
Bcl2a1a	0.582	8.84E−06	0.326	9.15E−01	−0.028	1.00E+00	FALSE
Hist1h1c	0.371	9.01E−02	−0.174	1.00E+00	1.117	1.07E−05	FALSE
Ifitm2	−0.485	1.18E−05	−0.775	6.49E−01	−0.027	1.00E+00	FALSE
Eif5	−0.383	1.28E−05	−0.338	1.00E+00	−0.187	8.82E−01	FALSE
Ppia	−0.172	1.38E−05	−0.314	2.26E−01	−0.053	1.00E+00	FALSE
Satb1	0.475	1.39E−05	−0.205	1.00E+00	0.324	7.61E−01	FALSE
Rps5	0.028	8.66E−01	0.096	1.00E+00	0.258	1.39E−05	FALSE
Arhgap9	0.469	1.60E−05	0.213	1.00E+00	0.467	9.90E−02	FALSE
Eif2s3y	0.559	1.63E−05	0.762	6.37E−01	0.492	1.87E−01	FALSE
Sub1	−0.158	6.18E−03	−0.302	8.30E−01	−0.380	1.71E−05	FALSE
Tagln2	−0.242	9.64E−04	−0.971	1.72E−05	0.083	1.00E+00	FALSE
Jun	−0.681	1.22E−03	−1.899	2.03E−05	0.149	1.00E+00	FALSE
Rpl6	0.138	2.04E−05	0.169	9.15E−01	0.244	3.06E−04	FALSE
Ptges3	−0.451	2.22E−05	−0.287	1.00E+00	−0.122	1.00E+00	FALSE
Ccdc184	−0.532	2.42E−05	−0.178	9.15E−01	−0.033	1.00E+00	FALSE
Eif4a2	−0.402	2.49E−05	−0.396	9.15E−01	0.040	1.00E+00	FALSE
Rgs2	−0.520	2.53E−05	−0.607	9.15E−01	−0.616	3.81E−02	FALSE
Actn2	0.565	2.95E−05	0.175	1.00E+00	0.383	7.61E−01	FALSE
Jmjd1c	−0.520	3.37E−05	−0.004	1.00E+00	−0.343	7.35E−01	FALSE
Ass1	0.465	3.41E−05	1.193	8.71E−02	−0.025	1.00E+00	FALSE
Rpl21	0.004	1.00E+00	−0.013	1.00E+00	0.280	3.44E−05	FALSE
Tubb4b	−0.507	3.63E−05	0.023	1.00E+00	−0.338	7.29E−01	FALSE
Gramd1a	0.446	3.76E−05	0.451	9.15E−01	0.157	1.00E+00	FALSE
Rps10	0.160	4.16E−05	0.207	9.15E−01	0.232	9.89E−03	FALSE
mt-Cytb	−0.203	4.75E−05	−0.410	2.07E−01	−0.177	6.78E−01	FALSE
Hmgb2	0.286	4.75E−05	−0.076	1.00E+00	0.025	1.00E+00	FALSE
Rpl36-ps3	0.337	7.29E−03	0.158	1.00E+00	0.696	4.88E−05	FALSE
Sp100	0.392	5.36E−05	0.196	1.00E+00	0.355	2.26E−01	FALSE
Vgll4	−0.413	5.44E−05	0.179	1.00E+00	−0.248	8.30E−01	FALSE
Rinl	0.443	6.06E−05	−0.003	1.00E+00	0.315	6.24E−01	FALSE
Gem	−0.687	6.58E−05	−0.047	1.00E+00	−0.785	5.35E−02	FALSE
Stk17b	0.285	6.58E−05	0.217	1.00E+00	−0.007	1.00E+00	FALSE
Unc5cl	0.525	6.58E−05	0.511	9.15E−01	−0.257	8.90E−01	FALSE
Lck	0.228	6.70E−05	0.086	1.00E+00	0.178	5.86E−01	FALSE
Gltscr2	0.253	6.94E−05	0.453	7.11E−01	0.092	1.00E+00	FALSE
Ict1	0.464	6.94E−05	0.038	1.00E+00	0.288	7.39E−01	FALSE
Rpl10a	0.178	7.01E−05	0.338	4.62E−01	0.199	8.74E−02	FALSE
Gpi1	0.328	7.47E−05	0.231	1.00E+00	−0.080	1.00E+00	FALSE
Ltb	0.339	7.56E−05	0.547	7.11E−01	0.241	7.35E−01	FALSE
Tmsb4x	−0.094	5.14E−03	−0.213	2.65E−01	−0.251	8.21E−05	FALSE
Calr	−0.310	8.23E−05	−0.523	7.11E−01	−0.162	9.46E−01	FALSE
Cycs	−0.330	8.59E−05	−0.521	7.60E−01	−0.294	5.16E−01	FALSE
Cpm	−0.558	1.03E−04	0.220	9.96E−01	−0.358	5.63E−01	FALSE
Madd	0.465	1.10E−04	−0.029	1.00E+00	0.173	1.00E+00	FALSE
Anxa2	−0.351	1.11E−04	−0.462	9.15E−01	−0.193	9.77E−01	FALSE
Chn2	0.571	1.11E−04	0.645	8.59E−01	−0.004	1.00E+00	FALSE
Ube2s	−0.304	1.17E−04	−0.578	6.42E−01	−0.208	7.35E−01	FALSE
Atp5g1	−0.344	1.24E−04	−0.227	1.00E+00	−0.045	1.00E+00	FALSE
Tuba4a	−0.504	1.25E−04	−0.415	1.00E+00	−0.435	4.02E−01	FALSE
Gm9844	0.390	1.29E−04	−0.103	1.00E+00	0.307	7.04E−01	FALSE
Uba52	0.273	1.30E−04	−0.143	1.00E+00	0.420	5.40E−04	FALSE
Il21r	−0.350	1.39E−04	0.082	1.00E+00	−0.455	1.09E−01	FALSE
Rpl13	0.043	5.16E−01	0.116	1.00E+00	0.207	1.39E−04	FALSE
Rps24	−0.020	9.33E−01	0.172	9.15E−01	0.242	1.48E−04	FALSE
mt-Nd2	−0.311	1.70E−04	−0.428	9.15E−01	−0.059	1.00E+00	FALSE
Eif4a1	−0.219	1.85E−04	0.476	5.04E−01	−0.152	8.26E−01	FALSE
Ifi27	−0.389	1.90E−04	−0.811	1.03E−01	−0.310	6.69E−01	FALSE
Fau	0.018	9.31E−01	0.069	1.00E+00	0.200	1.92E−04	FALSE
Bcl2l1	−0.508	1.97E−04	0.300	1.00E+00	−0.394	6.06E−01	FALSE
Furin	−0.428	2.07E−04	−0.818	5.16E−01	−0.120	1.00E+00	FALSE
Serf2	−0.177	2.12E−04	−0.289	6.92E−01	−0.081	1.00E+00	FALSE
Gm10263	0.514	2.21E−04	0.320	1.00E+00	0.319	7.35E−01	FALSE
Rasal3	0.453	2.31E−04	0.084	1.00E+00	0.217	9.46E−01	FALSE
Frmd4b	−0.570	2.34E−04	0.034	1.00E+00	−0.402	3.83E−01	FALSE
Tnfrsf4	−0.387	2.59E−04	−0.559	9.15E−01	−0.768	7.68E−04	FALSE
H1f0	0.574	2.68E−04	−0.545	9.15E−01	0.441	7.35E−01	FALSE
Bin2	0.322	2.72E−04	0.800	2.52E−01	0.338	4.67E−01	FALSE
Lztfl1	0.556	2.81E−04	0.477	9.59E−01	0.462	5.49E−01	FALSE
Rpl18a	0.033	6.68E−01	0.190	7.11E−01	0.194	2.95E−04	FALSE
Klrc2	−0.516	3.06E−04	−0.324	1.00E+00	−0.068	1.00E+00	FALSE
Rps23	−0.023	9.01E−01	0.175	8.17E−01	0.192	3.35E−04	FALSE
Irf7	−0.557	3.50E−04	−0.108	1.00E+00	−0.188	1.00E+00	FALSE
Ypel3	0.379	3.68E−04	−0.191	1.00E+00	0.089	1.00E+00	FALSE
Sap30	−0.491	3.79E−04	−0.177	1.00E+00	0.023	1.00E+00	FALSE
Csk	0.418	3.92E−04	0.021	1.00E+00	0.031	1.00E+00	FALSE
Uhrf2	−0.455	4.30E−04	−0.840	5.49E−01	−0.097	1.00E+00	FALSE
Romo1	−0.379	4.47E−04	−0.138	1.00E+00	−0.258	7.62E−01	FALSE
Agr2	−0.159	4.57E−04	0.061	1.00E+00	0.000	1.00E+00	FALSE
Il17a	−0.068	5.25E−01	−1.985	4.62E−04	−0.031	1.00E+00	FALSE
Tnf	−0.450	4.66E−04	0.257	1.00E+00	−0.009	1.00E+00	FALSE
Gimap5	0.365	4.76E−04	0.260	1.00E+00	0.304	4.85E−01	FALSE
Maff	−0.514	5.01E−04	0.000	1.00E+00	0.057	1.00E+00	FALSE
Ptma	−0.190	5.61E−04	−0.201	1.00E+00	−0.178	3.32E−01	FALSE
Ppid	−0.465	5.99E−04	−0.153	1.00E+00	−0.236	9.46E−01	FALSE
Rpl17	0.019	9.31E−01	0.113	1.00E+00	0.194	6.89E−04	FALSE
Rpl31	0.157	8.80E−03	0.091	1.00E+00	0.336	6.95E−04	FALSE
Ccl1	−0.840	7.05E−04	−0.183	1.00E+00	−0.043	1.00E+00	FALSE
Nr3c1	−0.464	7.10E−04	−0.208	1.00E+00	−0.183	1.00E+00	FALSE
Rasgrp4	−0.291	3.75E−02	−1.110	7.22E−04	0.070	9.80E−01	FALSE
Rnf166	0.410	7.68E−04	0.114	1.00E+00	0.282	7.35E−01	FALSE
Coq10b	−0.414	7.70E−04	−0.038	1.00E+00	−0.243	7.99E−01	FALSE
Chka	−0.447	8.50E−04	0.061	1.00E+00	−0.138	1.00E+00	FALSE
Cotl1	0.231	8.55E−04	0.017	1.00E+00	−0.043	1.00E+00	FALSE
Cd47	0.207	9.38E−04	0.187	1.00E+00	0.210	7.35E−01	FALSE
Ralgds	−0.442	9.42E−04	0.199	1.00E+00	−0.194	9.77E−01	FALSE
Arpc5	0.235	9.42E−04	0.010	1.00E+00	−0.173	8.55E−01	FALSE
Samsn1	−0.352	9.42E−04	−0.418	1.00E+00	−0.180	1.00E+00	FALSE
Dgka	0.449	9.42E−04	−0.189	1.00E+00	0.185	1.00E+00	FALSE
Cd40lg	−0.455	9.53E−04	−0.173	1.00E+00	−0.187	1.00E+00	FALSE
BC021614	0.460	9.64E−04	0.777	7.25E−01	0.087	1.00E+00	FALSE
Tsc22d3	0.336	9.41E−03	0.415	1.00E+00	0.729	9.86E−04	FALSE
Sfn	−0.582	9.92E−04	−0.544	7.82E−01	−0.498	4.50E−01	FALSE
Hnrnpa3	0.229	1.00E−03	−0.019	1.00E+00	0.038	1.00E+00	FALSE
Gm42726	0.400	1.15E−03	0.275	9.15E−01	0.553	4.64E−02	FALSE
Ccnd2	−0.336	1.15E−03	−0.198	1.00E+00	−0.473	8.21E−02	FALSE
Rps29	0.070	2.05E−01	0.193	9.15E−01	0.241	1.22E−03	FALSE
Rpl14	−0.002	1.00E+00	0.048	1.00E+00	0.222	1.23E−03	FALSE
Gm5424	0.407	1.24E−03	0.493	6.82E−01	0.013	1.00E+00	FALSE
Eif1	−0.128	1.29E−03	−0.146	1.00E+00	−0.063	9.81E−01	FALSE
Bag3	−0.406	1.29E−03	−0.115	1.00E+00	−0.500	1.69E−01	FALSE
Eif5a	−0.213	1.36E−03	−0.025	1.00E+00	−0.186	7.35E−01	FALSE
Slc5a3	−0.354	1.41E−03	0.000	1.00E+00	−0.174	1.00E+00	FALSE
Traf4	−0.468	1.42E−03	0.135	1.00E+00	−0.030	1.00E+00	FALSE
Traf3ip3	0.439	1.42E−03	0.463	9.74E−01	0.429	3.54E−01	FALSE
Mrps6	−0.503	1.42E−03	0.144	1.00E+00	−0.431	6.93E−01	FALSE
Nfkbia	−0.266	1.43E−03	−0.226	1.00E+00	0.030	1.00E+00	FALSE
Rps27	−0.114	1.53E−03	0.050	1.00E+00	0.173	1.69E−02	FALSE
Cd38	0.495	1.66E−03	0.176	1.00E+00	−0.090	1.00E+00	FALSE
Gimap7	0.261	1.67E−03	0.433	7.11E−01	−0.016	1.00E+00	FALSE
Lcp1	0.222	1.68E−03	0.064	1.00E+00	0.139	9.46E−01	FALSE
Gpr171	0.316	1.71E−03	0.317	1.00E+00	0.039	1.00E+00	FALSE
Gpsm3	0.278	1.72E−03	−0.308	9.34E−01	0.162	9.46E−01	FALSE
Tuba1a	−0.333	1.72E−03	−0.654	5.39E−01	−0.328	6.03E−01	FALSE
Gm8186	0.417	1.72E−03	0.148	1.00E+00	0.284	7.56E−01	FALSE
Ctbp1	0.350	1.72E−03	0.181	1.00E+00	0.040	1.00E+00	FALSE
Tcf7	0.426	1.76E−03	−0.109	1.00E+00	0.256	9.37E−01	FALSE
Ndufs5	−0.348	1.76E−03	−0.573	7.11E−01	−0.148	1.00E+00	FALSE
Fasl	−0.351	1.76E−03	0.453	1.00E+00	−0.156	1.00E+00	FALSE
Ier3ip1	−0.331	1.76E−03	−0.268	1.00E+00	0.084	1.00E+00	FALSE
Itpkb	−0.409	1.80E−03	0.716	8.04E−01	−0.035	1.00E+00	FALSE
Rpl4	0.115	1.80E−03	0.137	1.00E+00	0.137	2.87E−01	FALSE
Ccnl1	−0.372	2.03E−03	0.028	1.00E+00	−0.276	7.39E−01	FALSE
Cd48	0.286	2.03E−03	0.114	1.00E+00	−0.043	1.00E+00	FALSE
Hnrnpab	−0.358	2.03E−03	0.257	1.00E+00	−0.292	7.35E−01	FALSE
Insig1	−0.488	2.03E−03	0.553	9.68E−01	−0.456	3.80E−01	FALSE
Tceb2	−0.198	2.03E−03	−0.050	1.00E+00	−0.130	9.46E−01	FALSE
Gm5093	0.340	2.15E−02	−0.071	1.00E+00	0.630	2.06E−03	FALSE
Tpm4	0.336	2.10E−03	−0.086	1.00E+00	0.312	7.35E−01	FALSE
Ahsa1	−0.379	2.15E−03	0.328	1.00E+00	−0.250	8.11E−01	FALSE
Haghl	0.414	2.15E−03	−0.073	1.00E+00	0.013	1.00E+00	FALSE
Rpl8	0.118	2.22E−03	0.207	8.72E−01	0.226	2.89E−03	FALSE
Tob1	−0.420	2.23E−03	0.073	1.00E+00	−0.367	7.29E−01	FALSE
Nop10	−0.316	2.23E−03	−0.495	7.75E−01	−0.339	3.59E−01	FALSE
Nsa2	0.337	2.28E−03	0.175	1.00E+00	0.020	1.00E+00	FALSE
Nasp	−0.429	2.31E−03	−0.047	1.00E+00	0.232	9.46E−01	FALSE
Il4ra	−0.403	2.35E−03	0.012	1.00E+00	−0.137	1.00E+00	FALSE
Rac2	0.145	2.40E−03	−0.118	1.00E+00	0.090	9.46E−01	FALSE
Gm11273	0.410	2.41E−03	0.413	1.00E+00	0.163	1.00E+00	FALSE
Cd4	−0.070	9.13E−01	−0.953	2.41E−03	0.120	1.00E+00	FALSE
Arf4	−0.256	2.52E−03	−0.236	1.00E+00	−0.350	1.59E−01	FALSE
Supt4a	0.231	2.64E−03	0.021	1.00E+00	0.131	9.97E−01	FALSE
Tmsb10	−0.111	2.66E−03	−0.469	8.84E−03	0.103	8.47E−01	FALSE
Nab1	0.378	2.66E−03	0.461	1.00E+00	0.123	1.00E+00	FALSE
Rps18	0.107	3.65E−03	0.136	9.37E−01	0.206	2.69E−03	FALSE
Gm10260	0.230	2.14E−01	0.200	1.00E+00	0.643	2.69E−03	FALSE
Ly6a	−0.125	5.25E−01	−0.565	2.23E−01	−0.647	2.74E−03	FALSE
Ppp1cc	0.008	1.00E+00	0.247	1.00E+00	−0.500	2.74E−03	FALSE
Gm26917	0.351	3.02E−03	0.441	9.15E−01	0.539	9.89E−03	FALSE
Gm10269	0.401	3.16E−03	0.159	1.00E+00	0.267	7.97E−01	FALSE
Sema4d	0.376	3.19E−03	0.077	1.00E+00	−0.148	1.00E+00	FALSE
Rpl34	0.044	5.40E−01	0.073	1.00E+00	0.193	3.32E−03	FALSE
Ap2s1	0.315	3.87E−03	−0.121	1.00E+00	0.012	1.00E+00	FALSE
Lag3	−0.110	9.31E−01	−0.703	8.71E−01	−1.023	3.92E−03	FALSE
Hbegf	−0.210	3.96E−03	0.000	1.00E+00	−0.054	9.77E−01	FALSE
Tsix	0.391	3.96E−03	0.221	9.15E−01	0.099	1.00E+00	FALSE
Btf3	0.145	4.03E−03	0.201	9.75E−01	0.079	1.00E+00	FALSE
Gm42418	0.397	4.06E−03	−0.702	7.35E−01	0.160	1.00E+00	FALSE
3830403N18Rik	0.436	4.08E−03	0.617	6.82E−01	0.045	9.46E−01	FALSE
Hk2	−0.498	4.17E−03	−0.358	9.17E−01	0.037	1.00E+00	FALSE
Csf1	−0.559	4.41E−03	−0.831	2.44E−01	−0.107	1.00E+00	FALSE
Cxcr3	0.369	4.42E−03	0.544	8.76E−01	0.085	1.00E+00	FALSE
Mt1	0.658	4.42E−03	0.321	9.15E−01	−0.354	9.46E−01	FALSE
Nkg7	0.163	4.42E−03	0.126	1.00E+00	−0.166	4.19E−01	FALSE
Nudc	−0.360	4.43E−03	0.092	1.00E+00	−0.028	1.00E+00	FALSE
Vasp	0.214	4.50E−03	0.150	1.00E+00	0.011	1.00E+00	FALSE
Cd9	−0.494	4.78E−03	−0.244	1.00E+00	0.244	9.77E−01	FALSE
Gzmk	0.579	7.04E−03	1.524	5.05E−03	0.280	3.28E−01	FALSE
Actr3	0.192	5.14E−03	0.060	1.00E+00	−0.017	1.00E+00	FALSE
Lef1	0.365	2.75E−02	−0.360	1.00E+00	0.708	5.26E−03	FALSE
Gm20186	0.449	5.31E−03	−0.193	1.00E+00	0.177	1.00E+00	FALSE
1810041H14Rik	0.428	5.38E−03	1.449	1.80E−02	−0.083	1.00E+00	FALSE
Pdlim2	0.408	5.65E−03	1.038	1.88E−01	0.589	4.34E−02	FALSE
1600014C10Rik	0.431	5.93E−03	0.217	1.00E+00	−0.037	1.00E+00	FALSE
Cyp51	−0.427	5.93E−03	0.596	9.15E−01	−0.344	7.35E−01	FALSE
Prdx1	−0.237	5.93E−03	−0.475	7.11E−01	−0.336	1.78E−01	FALSE
Sigmar1	−0.319	5.95E−03	−0.198	1.00E+00	−0.106	1.00E+00	FALSE
1810058124Rik	0.323	6.04E−03	−0.052	1.00E+00	0.148	1.00E+00	FALSE
Rps7	0.104	6.04E−03	0.186	9.15E−01	0.176	2.29E−02	FALSE
Eno1	0.233	6.04E−03	−0.361	9.15E−01	0.324	2.78E−01	FALSE
Ndufa6	0.227	6.06E−03	0.140	1.00E+00	0.180	8.39E−01	FALSE
Gm10146	0.151	6.18E−03	−0.119	1.00E+00	0.076	1.00E+00	FALSE
Dusp14	−0.426	6.18E−03	0.324	9.15E−01	−0.222	9.77E−01	FALSE
Il18r1	0.033	1.00E+00	−1.158	6.35E−03	0.235	9.46E−01	FALSE
Cuedc2	0.428	6.51E−03	−0.185	1.00E+00	0.051	1.00E+00	FALSE
Gyg	0.417	6.55E−03	0.060	1.00E+00	0.031	1.00E+00	FALSE
Ptafr	−0.416	6.56E−03	−0.186	9.15E−01	0.025	1.00E+00	FALSE
Rpl13a-ps1	0.322	4.64E−02	−0.227	1.00E+00	0.637	6.57E−03	FALSE
Klrb1f	0.353	6.58E−03	0.484	9.15E−01	0.020	1.00E+00	FALSE
Psme2b	0.400	6.68E−03	−0.054	1.00E+00	0.240	9.46E−01	FALSE
Rras2	0.450	6.68E−03	−0.666	8.71E−01	0.120	1.00E+00	FALSE
Naca	0.143	6.88E−03	0.104	1.00E+00	0.081	1.00E+00	FALSE
Rps4x	0.084	5.61E−02	0.223	7.11E−01	0.200	6.95E−03	FALSE
Arl6ip1	−0.237	7.04E−03	−0.085	1.00E+00	0.120	1.00E+00	FALSE
Fabp5	−0.413	7.29E−03	0.290	1.00E+00	−0.114	1.00E+00	FALSE
Bhlhe40	−0.178	7.29E−03	0.584	9.15E−01	0.150	9.46E−01	FALSE
Ifi27l2a	−0.453	7.29E−03	−0.400	1.00E+00	−0.400	5.03E−01	FALSE
Gch1	−0.354	7.34E−03	−0.211	1.00E+00	−0.177	1.00E+00	FALSE
Pdcd6ip	0.333	7.47E−03	0.094	1.00E+00	0.163	1.00E+00	FALSE
Tmem30a	0.354	7.50E−03	0.730	6.80E−01	−0.044	1.00E+00	FALSE
Nkiras2	0.385	7.50E−03	0.432	9.94E−01	−0.114	1.00E+00	FALSE
mt-Nd4	−0.178	7.50E−03	−0.397	6.32E−01	−0.183	7.35E−01	FALSE
5730508B09Rik	0.411	7.56E−03	0.289	1.00E+00	0.126	1.00E+00	FALSE
Myl6	−0.135	7.97E−03	−0.218	9.15E−01	−0.269	3.29E−02	FALSE
Atp5e	−0.169	8.21E−03	−0.317	9.14E−01	−0.217	4.85E−01	FALSE
Wdr1	0.295	8.31E−03	−0.266	1.00E+00	0.122	1.00E+00	FALSE
Atp5c1	0.206	8.34E−03	0.374	8.76E−01	0.219	7.35E−01	FALSE
Itgb1	−0.468	8.89E−03	−0.618	8.72E−01	0.090	1.00E+00	FALSE
Cox5b	0.196	9.36E−03	0.240	1.00E+00	−0.081	1.00E+00	FALSE
Serpinb9	0.353	9.55E−03	−0.480	9.50E−01	0.299	8.20E−01	FALSE
Plcxd2	0.420	9.75E−03	0.231	1.00E+00	0.296	8.28E−01	FALSE
Lmnb1	−0.311	9.75E−03	−0.390	1.00E+00	−0.461	5.14E−02	FALSE
Adrbk1	0.381	9.85E−03	−0.165	1.00E+00	0.340	6.97E−01	FALSE
Nop56	−0.353	9.85E−03	−0.093	1.00E+00	−0.215	9.46E−01	FALSE
Cox6a1	−0.185	1.01E−02	−0.139	1.00E+00	−0.212	6.21E−01	FALSE
Eif3e	0.189	1.05E−02	0.450	6.82E−01	0.126	9.63E−01	FALSE
Pabpc1	0.143	1.07E−02	0.174	1.00E+00	0.076	1.00E+00	FALSE
Ier5	−0.307	1.09E−02	−0.209	1.00E+00	−0.233	9.46E−01	FALSE
Ywhae	0.259	1.09E−02	0.123	1.00E+00	−0.257	7.35E−01	FALSE
Ndufs2	0.339	1.09E−02	0.051	1.00E+00	0.250	8.90E−01	FALSE
Gpr87	0.190	1.10E−02	0.000	1.00E+00	0.049	7.35E−01	FALSE
Tox	−0.224	1.14E−02	−0.463	8.31E−01	0.143	1.00E+00	FALSE
Dnajb6	−0.216	1.16E−02	−0.168	1.00E+00	−0.067	1.00E+00	FALSE
Atp8a2	0.389	1.16E−02	0.651	8.72E−01	0.250	8.07E−01	FALSE
Upf3a	0.388	1.19E−02	−0.135	1.00E+00	0.269	8.90E−01	FALSE
Qrfp	0.330	1.20E−02	0.048	1.00E+00	0.024	1.00E+00	FALSE
PhIda1	−0.420	1.21E−02	−1.539	1.35E−02	−0.750	3.16E−02	FALSE
Mta3	0.395	1.22E−02	0.655	8.76E−01	0.344	7.29E−01	FALSE
Kcnk5	−0.422	1.24E−02	0.004	1.00E+00	−0.163	1.00E+00	FALSE
Myo1g	0.320	1.24E−02	0.229	1.00E+00	0.108	1.00E+00	FALSE
Leprotl1	0.262	1.27E−02	−0.297	1.00E+00	0.065	1.00E+00	FALSE
Cbfa2t3	−0.182	1.29E−02	0.000	1.00E+00	0.000	1.00E+00	FALSE
Fis1	0.262	1.32E−02	0.128	1.00E+00	0.027	1.00E+00	FALSE
Gpx1	−0.347	1.39E−02	−0.165	1.00E+00	−0.418	3.81E−01	FALSE
Ctla4	−0.212	1.36E−01	−0.682	8.76E−01	−0.553	1.42E−02	FALSE
Bptf	−0.374	1.45E−02	−0.037	1.00E+00	−0.242	9.46E−01	FALSE
Rplp2	−0.097	1.45E−02	−0.067	1.00E+00	0.169	8.47E−02	FALSE
S1pr4	0.281	1.55E−02	0.045	1.00E+00	0.322	5.96E−01	FALSE
Ndufa10	0.312	1.56E−02	−0.009	1.00E+00	−0.005	1.00E+00	FALSE
Zfp706	0.270	1.59E−02	−0.057	1.00E+00	−0.138	1.00E+00	FALSE
Lcn4	0.424	1.59E−02	−0.167	1.00E+00	0.295	5.47E−01	FALSE
Ndufa5	−0.315	1.60E−02	−0.163	1.00E+00	−0.082	1.00E+00	FALSE
Hnrnpf	0.157	1.61E−02	0.229	9.64E−01	0.005	1.00E+00	FALSE
Pglyrp1	0.344	1.61E−02	0.297	1.00E+00	0.190	1.00E+00	FALSE
Ccni	0.337	1.61E−02	0.026	1.00E+00	0.053	1.00E+00	FALSE
Usp28	−0.102	1.65E−02	0.000	1.00E+00	−0.008	1.00E+00	FALSE
Adrb2	−0.424	1.65E−02	0.065	1.00E+00	−0.173	1.00E+00	FALSE
Cox7c	−0.160	1.65E−02	−0.563	2.25E−02	−0.196	5.04E−01	FALSE
Klra3	0.342	1.66E−02	0.176	1.00E+00	0.000	1.00E+00	FALSE
Traf1	−0.207	1.67E−02	−0.224	1.00E+00	0.048	1.00E+00	FALSE
Idi1	−0.396	1.67E−02	0.034	1.00E+00	−0.128	1.00E+00	FALSE
Capzb	0.178	1.67E−02	−0.097	1.00E+00	−0.183	7.35E−01	FALSE
Jtb	0.329	1.68E−02	−0.142	1.00E+00	−0.236	9.46E−01	FALSE
Tiparp	−0.384	1.70E−02	0.238	1.00E+00	−0.154	1.00E+00	FALSE
Arpp19	−0.196	1.71E−02	−0.612	1.15E−01	−0.077	1.00E+00	FALSE
Creg1	−0.356	1.77E−02	−0.250	1.00E+00	−0.091	1.00E+00	FALSE
Ten1	0.365	1.77E−02	0.388	1.00E+00	0.065	1.00E+00	FALSE
Grcc10	0.340	1.81E−02	−0.682	5.39E−01	0.383	5.47E−01	FALSE
Grk6	0.312	1.82E−02	0.307	1.00E+00	0.284	7.35E−01	FALSE
2210011C24Rik	−0.347	1.84E−02	−0.271	1.00E+00	−0.095	1.00E+00	FALSE
Racgap1	0.399	1.87E−02	0.222	1.00E+00	0.518	1.15E−01	FALSE
Bcl3	0.382	1.92E−02	0.215	1.00E+00	0.069	1.00E+00	FALSE
Slc7a5	−0.363	1.92E−02	0.493	6.82E−01	−0.261	9.46E−01	FALSE
Rnf44	0.380	1.93E−02	0.634	7.11E−01	−0.204	9.97E−01	FALSE
Rcn2	−0.368	1.94E−02	−0.171	1.00E+00	−0.038	1.00E+00	FALSE
G3bp2	−0.325	1.94E−02	0.028	1.00E+00	−0.415	2.68E−01	FALSE
Arf6	−0.223	1.95E−02	0.089	1.00E+00	−0.014	1.00E+00	FALSE
Sqstm1	−0.262	1.95E−02	0.318	1.00E+00	−0.488	8.47E−02	FALSE
Cmtm7	0.296	1.97E−02	1.027	8.51E−02	0.302	6.14E−01	FALSE
Rhof	−0.357	2.01E−02	0.368	1.00E+00	−0.245	9.46E−01	FALSE
Atp1b3	0.309	2.02E−02	−0.247	1.00E+00	0.171	1.00E+00	FALSE
H2afx	−0.371	2.02E−02	0.061	1.00E+00	0.075	1.00E+00	FALSE
Tmem176a	−0.510	2.04E−02	−0.984	5.60E−01	0.024	1.00E+00	FALSE
Tiprl	−0.311	2.06E−02	0.187	1.00E+00	−0.049	1.00E+00	FALSE
Gla	−0.349	2.10E−02	0.000	1.00E+00	0.021	1.00E+00	FALSE
Mgst2	0.388	2.10E−02	−0.115	1.00E+00	−0.022	1.00E+00	FALSE
Lgals3	−0.235	2.11E−02	−0.463	9.15E−01	0.243	9.55E−01	FALSE
Rgs3	0.392	2.11E−02	−0.055	1.00E+00	−0.033	1.00E+00	FALSE
Pttg1	−0.339	2.11E−02	−0.324	1.00E+00	−0.268	7.97E−01	FALSE
Ncald	0.356	2.13E−02	0.427	1.00E+00	−0.122	1.00E+00	FALSE
Gadd45b	−0.198	4.60E−01	0.177	1.00E+00	−0.729	2.24E−02	FALSE
Malt1	0.138	7.69E−01	−0.002	1.00E+00	0.595	2.26E−02	FALSE
Dgat1	−0.058	9.75E−01	−0.018	1.00E+00	−0.636	2.27E−02	FALSE
Ubxn1	0.282	2.27E−02	−0.490	9.15E−01	0.257	7.41E−01	FALSE
Minos1	−0.224	2.30E−02	−0.557	4.66E−01	0.016	1.00E+00	FALSE
Dctpp1	−0.347	2.43E−02	−0.144	1.00E+00	−0.639	3.29E−02	FALSE
Arrb2	0.318	2.45E−02	0.438	9.15E−01	0.178	1.00E+00	FALSE
Ifngr1	0.031	9.32E−01	−0.282	1.00E+00	0.312	2.50E−02	FALSE
Mcpt1	−0.103	2.50E−02	−0.176	9.15E−01	0.000	1.00E+00	FALSE
Kcnab2	0.335	2.61E−02	−0.066	1.00E+00	0.257	9.26E−01	FALSE
Nme1	−0.256	2.61E−02	−0.026	1.00E+00	−0.321	6.24E−01	FALSE
Ehd3	0.385	2.62E−02	−0.101	1.00E+00	0.040	1.00E+00	FALSE
Slbp	−0.286	2.62E−02	−0.230	1.00E+00	−0.194	9.46E−01	FALSE
Sparc	−0.187	2.63E−02	0.000	1.00E+00	−0.042	1.00E+00	FALSE
Ywhab	0.282	2.72E−02	−0.069	1.00E+00	0.027	1.00E+00	FALSE
Umps	−0.356	2.75E−02	0.090	1.00E+00	0.140	1.00E+00	FALSE
Zfand2b	0.348	2.78E−02	−0.257	1.00E+00	0.097	1.00E+00	FALSE
Vamp4	0.345	2.78E−02	−0.247	1.00E+00	−0.037	1.00E+00	FALSE
Pcgf1	0.323	2.78E−02	0.091	1.00E+00	−0.006	1.00E+00	FALSE
Srgap3	−0.127	2.79E−02	0.000	1.00E+00	−0.087	7.97E−01	FALSE
H2-DMa	0.363	2.83E−02	−0.277	1.00E+00	−0.222	9.46E−01	FALSE
Dkkl1	−0.357	2.83E−02	−0.728	7.11E−01	−0.088	1.00E+00	FALSE
Camk2n1	−0.374	2.84E−02	0.020	1.00E+00	−0.148	1.00E+00	FALSE
Dnajb9	−0.335	2.84E−02	−0.029	1.00E+00	−0.028	1.00E+00	FALSE
Irf2	0.347	2.86E−02	0.340	1.00E+00	0.224	9.01E−01	FALSE
Gas7	−0.410	2.91E−02	−0.252	1.00E+00	−0.095	1.00E+00	FALSE
Eef1a1	0.015	9.92E−01	0.083	1.00E+00	0.160	2.91E−02	FALSE
Dtx1	0.383	2.92E−02	1.064	2.57E−01	0.003	1.00E+00	FALSE
Tra2b	−0.246	2.98E−02	−0.198	1.00E+00	−0.211	7.41E−01	FALSE
Zfp207	−0.006	1.00E+00	1.181	3.02E−02	0.121	1.00E+00	FALSE
Wac	−0.329	3.02E−02	0.143	1.00E+00	−0.013	1.00E+00	FALSE
H2-Q10	−0.344	3.05E−02	0.052	1.00E+00	−0.276	9.46E−01	FALSE
Ino80b	0.357	3.06E−02	0.345	1.00E+00	0.163	1.00E+00	FALSE
Dnajb2	−0.299	3.06E−02	−0.203	1.00E+00	−0.143	1.00E+00	FALSE
Abhd2	−0.391	3.07E−02	0.058	1.00E+00	−0.104	1.00E+00	FALSE
Hmha1	0.213	3.07E−02	−0.187	1.00E+00	0.225	7.12E−01	FALSE
Rbm39	−0.145	3.08E−02	0.144	1.00E+00	−0.057	1.00E+00	FALSE
Cox17	−0.225	3.08E−02	−0.523	4.52E−01	−0.216	7.61E−01	FALSE
Lpcat4	0.358	3.10E−02	0.324	9.15E−01	0.187	9.97E−01	FALSE
Rps3	0.083	3.10E−02	0.221	6.98E−01	0.147	6.94E−02	FALSE
Eef1b2	0.105	4.60E−01	0.269	1.00E+00	0.352	3.11E−02	FALSE
Pltp	0.026	1.00E+00	−1.002	3.15E−02	0.104	1.00E+00	FALSE
Pcbd2	−0.363	3.18E−02	−0.327	1.00E+00	−0.114	1.00E+00	FALSE
Eif3h	0.148	3.18E−02	0.241	9.75E−01	0.194	6.12E−01	FALSE
Fam103a1	0.235	3.20E−02	0.525	8.76E−01	−0.045	1.00E+00	FALSE
H2-Ke6	−0.334	3.20E−02	0.192	1.00E+00	0.039	1.00E+00	FALSE
Ube2v1	0.305	3.32E−02	−0.059	1.00E+00	0.246	8.36E−01	FALSE
Tbc1d22a	0.117	7.96E−01	−1.021	3.39E−02	0.012	1.00E+00	FALSE
Gimap6	0.179	3.39E−02	0.096	1.00E+00	−0.086	1.00E+00	FALSE
Mien1	−0.260	3.43E−02	−0.462	9.15E−01	−0.345	5.06E−01	FALSE
Cbwd1	0.228	3.43E−02	0.007	1.00E+00	0.168	9.56E−01	FALSE
Kxd1	0.305	3.43E−02	0.388	1.00E+00	0.295	7.35E−01	FALSE
Rpl39	0.101	3.43E−02	0.185	9.15E−01	0.134	4.67E−01	FALSE
Dedd2	−0.264	1.92E−01	−0.225	1.00E+00	−0.657	3.47E−02	FALSE
Tbc1d17	0.340	3.50E−02	0.289	1.00E+00	0.240	9.46E−01	FALSE
Rpl23a	−0.080	3.50E−02	0.004	1.00E+00	0.100	5.96E−01	FALSE
Coro1b	0.310	3.50E−02	0.281	1.00E+00	0.261	8.78E−01	FALSE
Tmem71	0.354	3.62E−02	−0.056	1.00E+00	0.410	5.04E−01	FALSE
Tmem9b	0.291	3.64E−02	0.253	1.00E+00	0.108	1.00E+00	FALSE
S100a6	−0.059	8.25E−01	−0.248	1.00E+00	−0.564	3.72E−02	FALSE
Fam49b	0.219	3.75E−02	0.090	1.00E+00	−0.029	1.00E+00	FALSE
Fundc2	0.288	3.77E−02	0.126	1.00E+00	0.407	3.32E−01	FALSE
Smim24	0.243	3.77E−02	−0.154	9.15E−01	0.055	1.00E+00	FALSE
Pdia6	−0.296	3.79E−02	−0.657	7.11E−01	−0.255	8.90E−01	FALSE
Klrc1	−0.278	3.82E−02	−0.712	8.76E−01	0.430	7.35E−01	FALSE
Pelp1	−0.266	3.85E−02	−0.372	9.96E−01	−0.099	1.00E+00	FALSE
Ncl	−0.195	3.85E−02	0.012	1.00E+00	−0.067	1.00E+00	FALSE
Efcab7	0.106	3.88E−02	0.055	1.00E+00	−0.062	1.00E+00	FALSE
Arl4a	−0.350	3.88E−02	0.488	9.15E−01	−0.074	1.00E+00	FALSE
Id3	−0.404	3.89E−02	−0.430	1.00E+00	0.036	1.00E+00	FALSE
Gm27166	−0.090	3.95E−02	−0.218	1.00E+00	0.000	1.00E+00	FALSE
Tnfaip8	−0.284	3.97E−02	−0.300	1.00E+00	0.123	1.00E+00	FALSE
Rps26	0.132	4.28E−02	0.146	1.00E+00	−0.003	1.00E+00	FALSE
Map2k3	−0.280	4.28E−02	−0.009	1.00E+00	−0.411	4.91E−01	FALSE
Pfn1	0.098	4.30E−02	−0.050	1.00E+00	−0.053	1.00E+00	FALSE
Acoxl	0.266	4.33E−02	0.135	1.00E+00	−0.180	9.46E−01	FALSE
Cxcl10	−0.504	4.35E−02	−0.424	8.76E−01	0.135	1.00E+00	FALSE
Mbd2	−0.321	4.35E−02	−0.438	1.00E+00	−0.068	1.00E+00	FALSE
Fcrls	−0.105	4.35E−02	0.064	1.00E+00	−0.074	9.46E−01	FALSE
Arpc1b	0.128	4.42E−02	−0.038	1.00E+00	−0.078	1.00E+00	FALSE
Tomm7	−0.200	4.43E−02	−0.506	5.07E−01	−0.005	1.00E+00	FALSE
Idh2	0.319	4.43E−02	0.190	1.00E+00	0.073	1.00E+00	FALSE
Gbp2	0.396	4.43E−02	−0.357	1.00E+00	−0.043	1.00E+00	FALSE
Rpl28	0.143	4.43E−02	0.150	1.00E+00	0.112	9.46E−01	FALSE
Pgk1	0.324	4.46E−02	0.573	8.76E−01	0.211	7.35E−01	FALSE
Caprin1	0.343	4.49E−02	0.070	1.00E+00	−0.007	1.00E+00	FALSE
Rpl7	0.101	4.51E−02	0.178	9.96E−01	0.157	3.06E−01	FALSE
Chmp6	0.336	4.53E−02	0.110	1.00E+00	0.248	9.40E−01	FALSE
Mtx2	−0.324	4.55E−02	−0.280	1.00E+00	0.122	1.00E+00	FALSE
Cmc1	−0.009	1.00E+00	−0.099	1.00E+00	−0.605	4.62E−02	FALSE
Gm4950	0.216	3.59E−01	0.474	9.96E−01	0.569	4.66E−02	FALSE
Clic1	0.142	4.69E−02	0.072	1.00E+00	0.102	1.00E+00	FALSE
Junb	−0.182	4.71E−02	−0.519	7.11E−01	−0.132	9.47E−01	FALSE
Rasl11a	−0.452	4.71E−02	0.081	1.00E+00	−0.054	1.00E+00	FALSE
Celf2	0.236	4.81E−02	0.202	1.00E+00	0.116	1.00E+00	FALSE
Rps15a	−0.038	6.52E−01	0.006	1.00E+00	0.153	4.90E−02	FALSE
Mapkap1	0.130	7.72E−01	−1.060	4.90E−02	−0.216	1.00E+00	FALSE
Man1a	−0.336	5.01E−02	−0.184	1.00E+00	−0.014	1.00E+00	FALSE
Vcpip1	−0.311	5.17E−02	0.086	1.00E+00	−0.164	1.00E+00	FALSE
Zfp280d	0.083	9.31E−01	0.025	1.00E+00	0.564	5.20E−02	FALSE
Pstpip1	0.278	5.28E−02	0.256	1.00E+00	0.157	1.00E+00	FALSE
Gramd3	0.212	5.32E−02	0.502	9.26E−01	0.260	5.46E−01	FALSE
Edaradd	−0.285	5.32E−02	0.033	1.00E+00	−0.097	7.83E−01	FALSE
Mrpl46	−0.108	8.72E−01	−0.102	1.00E+00	−0.596	5.35E−02	FALSE
Ecm1	−0.279	5.39E−02	−0.297	1.00E+00	−0.129	1.00E+00	FALSE
Gmfb	0.328	5.39E−02	0.229	1.00E+00	−0.132	1.00E+00	FALSE
Rps16	−0.068	1.32E−01	−0.051	1.00E+00	0.154	5.42E−02	FALSE
Atp6v0e	−0.084	6.84E−01	−0.439	7.11E−01	−0.408	5.42E−02	FALSE
Ppp2ca	−0.214	5.53E−02	−0.178	1.00E+00	−0.029	1.00E+00	FALSE
Spint2	−0.307	5.56E−02	−0.062	1.00E+00	−0.036	1.00E+00	FALSE
Gm10031	0.188	5.60E−02	0.051	1.00E+00	0.033	1.00E+00	FALSE
Fam134b	0.334	5.61E−02	−0.002	1.00E+00	0.052	1.00E+00	FALSE
Wdr45b	−0.324	5.61E−02	−1.048	1.03E−01	0.043	1.00E+00	FALSE
Lypla1	0.291	5.63E−02	0.042	1.00E+00	0.041	1.00E+00	FALSE
B4galnt4	0.211	5.68E−02	0.102	1.00E+00	−0.115	7.35E−01	FALSE
Gstt2	0.331	5.77E−02	0.544	9.15E−01	−0.080	1.00E+00	FALSE
Sh2d2a	0.242	5.78E−02	0.730	5.39E−01	0.125	1.00E+00	FALSE
Mllt3	−0.024	1.00E+00	−1.062	5.81E−02	0.144	1.00E+00	FALSE
H2-DMb1	0.138	5.85E−02	−0.045	1.00E+00	−0.032	1.00E+00	FALSE
BC055324	−0.090	5.85E−02	0.000	1.00E+00	0.094	7.35E−01	FALSE
Csrnp1	−0.331	5.85E−02	0.202	1.00E+00	−0.254	9.40E−01	FALSE
Zyg11b	0.329	5.85E−02	0.333	1.00E+00	−0.155	1.00E+00	FALSE
Hadha	0.321	5.85E−02	0.074	1.00E+00	−0.224	9.61E−01	FALSE
Dnaja4	−0.385	5.87E−02	−0.358	1.00E+00	−0.514	3.37E−01	FALSE
Abcg2	−0.115	5.89E−02	0.000	1.00E+00	−0.043	1.00E+00	FALSE
Unc119b	0.327	5.90E−02	0.779	6.82E−01	−0.031	1.00E+00	FALSE
Ablim1	0.278	5.90E−02	−0.098	1.00E+00	−0.153	1.00E+00	FALSE
Zmym2	−0.045	1.00E+00	0.119	1.00E+00	0.465	5.96E−02	FALSE
Ncf1	0.280	5.96E−02	0.136	1.00E+00	0.163	7.21E−01	FALSE
Tomm22	0.220	5.97E−02	0.135	1.00E+00	0.040	1.00E+00	FALSE
Srsf5	−0.179	5.98E−02	0.235	1.00E+00	−0.080	1.00E+00	FALSE
Plin2	−0.345	5.99E−02	−0.147	1.00E+00	−0.199	9.84E−01	FALSE
Tlk1	0.321	5.99E−02	0.084	1.00E+00	0.095	1.00E+00	FALSE
Cenpl	−0.337	5.99E−02	−0.048	1.00E+00	−0.152	1.00E+00	FALSE
Galnt3	−0.232	6.00E−02	0.000	1.00E+00	−0.059	9.46E−01	FALSE
Gm16286	0.160	5.25E−01	0.064	1.00E+00	−0.520	6.01E−02	FALSE
Ctnna1	−0.336	6.03E−02	−0.153	1.00E+00	0.048	1.00E+00	FALSE
Ift52	0.337	6.05E−02	0.630	8.76E−01	−0.119	1.00E+00	FALSE
Alg6	−0.185	6.08E−02	−0.153	1.00E+00	0.014	1.00E+00	FALSE
Orc4	0.330	6.08E−02	−0.195	1.00E+00	0.140	1.00E+00	FALSE
Otud1	−0.266	6.17E−02	0.000	1.00E+00	0.036	1.00E+00	FALSE
Ipo11	−0.273	6.20E−02	−0.683	2.94E−01	−0.156	9.77E−01	FALSE
Gm12216	0.333	6.20E−02	−0.090	1.00E+00	0.204	1.00E+00	FALSE
D3Ertd751e	−0.267	6.20E−02	−0.170	1.00E+00	−0.156	1.00E+00	FALSE
Tnfrsf13c	0.174	6.20E−02	0.051	1.00E+00	0.014	1.00E+00	FALSE
Hist1h1e	0.316	6.21E−02	0.546	6.92E−01	0.235	6.69E−01	FALSE
Emp1	−0.334	6.44E−02	−0.323	1.00E+00	0.118	1.00E+00	FALSE
Pcbp2	0.180	6.44E−02	0.128	1.00E+00	0.016	1.00E+00	FALSE
Tspan3	0.337	6.51E−02	0.000	1.00E+00	0.270	7.96E−01	FALSE
Xpa	0.315	6.52E−02	0.152	1.00E+00	0.172	1.00E+00	FALSE
Tmem173	0.320	6.52E−02	−0.293	1.00E+00	−0.230	9.46E−01	FALSE
Ndufa4	0.236	6.53E−02	0.088	1.00E+00	−0.274	4.85E−01	FALSE
Mrto4	−0.325	6.54E−02	−0.203	1.00E+00	−0.130	1.00E+00	FALSE
Zfp277	0.321	6.64E−02	0.146	1.00E+00	0.274	8.15E−01	FALSE
Nrp1	−0.342	6.68E−02	0.285	8.76E−01	0.057	7.35E−01	FALSE
Yme1l1	−0.313	6.68E−02	−0.138	1.00E+00	−0.183	1.00E+00	FALSE
Eva1b	0.313	6.72E−02	0.297	1.00E+00	0.073	1.00E+00	FALSE
Pkp4	0.176	6.72E−02	−0.113	1.00E+00	0.002	1.00E+00	FALSE
Etfb	−0.269	6.77E−02	−0.375	9.96E−01	−0.039	1.00E+00	FALSE
Psmc2	−0.280	6.77E−02	0.033	1.00E+00	−0.148	1.00E+00	FALSE
Fmnl1	0.284	6.82E−02	0.332	1.00E+00	0.254	8.90E−01	FALSE
Ddit4	−0.349	6.85E−02	−0.244	1.00E+00	−0.132	1.00E+00	FALSE
Atpif1	−0.254	6.92E−02	−0.100	1.00E+00	0.157	1.00E+00	FALSE
Uqcrh	0.127	6.93E−02	0.100	1.00E+00	−0.025	1.00E+00	FALSE
Sfpq	0.230	6.95E−02	0.870	2.05E−01	−0.057	1.00E+00	FALSE
Psmb10	0.243	6.95E−02	−0.180	1.00E+00	0.238	8.20E−01	FALSE
Rab5c	−0.261	6.96E−02	−0.087	1.00E+00	−0.038	1.00E+00	FALSE
Phf3	−0.305	6.96E−02	0.196	1.00E+00	−0.109	1.00E+00	FALSE
Dusp5	−0.200	6.98E−02	−0.086	1.00E+00	−0.135	1.00E+00	FALSE
Psmb1	0.145	6.98E−02	0.181	1.00E+00	0.144	8.93E−01	FALSE
Mrpl43	0.282	6.98E−02	−0.374	1.00E+00	−0.221	9.57E−01	FALSE
Dusp12	0.086	9.05E−01	−0.202	1.00E+00	0.547	6.99E−02	FALSE
Rpn2	−0.264	7.05E−02	−0.278	1.00E+00	−0.187	9.77E−01	FALSE
Magohb	0.328	7.05E−02	0.218	1.00E+00	−0.065	1.00E+00	FALSE
Pcna	−0.291	7.34E−02	−0.023	1.00E+00	−0.035	1.00E+00	FALSE
Nrros	−0.379	7.36E−02	−0.237	1.00E+00	0.068	1.00E+00	FALSE
Banf1	−0.297	7.43E−02	0.297	1.00E+00	−0.039	1.00E+00	FALSE
Zfp40	0.101	7.43E−02	−0.176	9.15E−01	0.048	9.46E−01	FALSE
Tmem109	−0.320	7.47E−02	−0.005	1.00E+00	−0.051	1.00E+00	FALSE
Lbh	0.297	7.49E−02	0.253	1.00E+00	−0.370	6.10E−01	FALSE
Surf1	0.304	7.50E−02	0.341	1.00E+00	0.176	1.00E+00	FALSE
Ppp1ca	0.139	7.50E−02	−0.055	1.00E+00	−0.015	1.00E+00	FALSE
Arid4b	−0.315	7.50E−02	−0.382	1.00E+00	0.147	1.00E+00	FALSE
Akr1a1	0.223	7.50E−02	0.014	1.00E+00	0.033	1.00E+00	FALSE
Ctsb	−0.040	1.00E+00	−0.149	1.00E+00	−0.485	7.51E−02	FALSE
Amd1	−0.337	7.59E−02	−0.231	1.00E+00	−0.155	1.00E+00	FALSE
Tulp3	0.134	7.60E−02	0.058	1.00E+00	−0.043	1.00E+00	FALSE
Hsd17b7	−0.260	7.72E−02	−0.222	1.00E+00	−0.024	1.00E+00	FALSE
Nsun3	0.221	7.72E−02	0.333	1.00E+00	0.163	1.00E+00	FALSE
Tgfbr1	−0.276	7.74E−02	0.522	9.15E−01	−0.067	1.00E+00	FALSE
Lsm2	−0.308	7.80E−02	−0.321	1.00E+00	−0.023	1.00E+00	FALSE
Fam118b	0.255	7.84E−02	0.261	1.00E+00	0.244	7.35E−01	FALSE
Impact	−0.321	7.84E−02	0.441	1.00E+00	−0.186	1.00E+00	FALSE
Lamtor1	0.291	7.84E−02	−0.066	1.00E+00	−0.020	1.00E+00	FALSE
R3hdm4	0.273	7.87E−02	−0.385	1.00E+00	−0.149	1.00E+00	FALSE
Ilk	0.286	7.88E−02	−0.143	1.00E+00	0.310	7.35E−01	FALSE
mt-Nd3	−0.253	9.74E−02	−0.472	9.15E−01	−0.548	7.90E−02	FALSE
Mdh1	−0.024	1.00E+00	−0.038	1.00E+00	−0.428	7.90E−02	FALSE
Rpl27	0.089	7.95E−02	0.094	1.00E+00	0.133	3.83E−01	FALSE
Enc1	−0.105	7.96E−02	0.059	1.00E+00	−0.067	9.46E−01	FALSE
Cd3d	0.025	1.00E+00	−0.443	7.99E−02	−0.055	1.00E+00	FALSE
Rnf2	0.314	8.02E−02	0.039	1.00E+00	0.139	1.00E+00	FALSE
Rnf167	−0.155	6.14E−01	−0.996	8.03E−02	0.336	6.95E−01	FALSE
Ptpn1	−0.048	9.95E−01	0.347	1.00E+00	−0.471	8.07E−02	FALSE
Grhpr	0.283	8.07E−02	0.106	1.00E+00	0.037	1.00E+00	FALSE
Polr2f	−0.285	8.11E−02	−0.614	8.71E−01	0.012	1.00E+00	FALSE
Vcp	−0.107	6.84E−01	−0.592	6.37E−01	−0.475	8.19E−02	FALSE
Atl2	−0.280	8.20E−02	0.000	1.00E+00	0.188	1.00E+00	FALSE
Etv5	−0.078	8.20E−02	0.109	1.00E+00	−0.018	1.00E+00	FALSE
Postn	−0.077	8.20E−02	0.000	1.00E+00	−0.022	1.00E+00	FALSE
Gm18025	0.197	8.27E−02	0.000	1.00E+00	0.093	1.00E+00	FALSE
Pot1a	0.288	8.27E−02	−0.438	9.15E−01	0.031	1.00E+00	FALSE
Sdhb	0.224	8.27E−02	−0.064	1.00E+00	0.014	1.00E+00	FALSE
Bmyc	−0.252	8.27E−02	−0.049	1.00E+00	0.074	1.00E+00	FALSE
Hamp	−0.072	8.27E−02	0.000	1.00E+00	0.000	1.00E+00	FALSE
Btg1	0.124	1.23E−01	0.404	6.60E−01	0.229	8.31E−02	FALSE
Il4	0.110	8.33E−02	−0.335	7.11E−01	0.000	1.00E+00	FALSE
Nrg4	−0.070	8.33E−02	−0.175	9.15E−01	−0.011	1.00E+00	FALSE
Eif2a	0.296	8.33E−02	0.207	1.00E+00	0.297	7.42E−01	FALSE
Xbp1	−0.236	1.17E−01	0.226	1.00E+00	−0.512	8.36E−02	FALSE
Btg3	0.296	8.36E−02	−0.102	1.00E+00	0.404	4.24E−01	FALSE
Skap1	−0.084	7.23E−01	−0.735	8.40E−02	0.052	1.00E+00	FALSE
Lysmd2	0.341	8.45E−02	0.142	1.00E+00	−0.156	1.00E+00	FALSE
Golm1	0.316	8.45E−02	−0.067	1.00E+00	0.027	1.00E+00	FALSE
1700025G04Rik	0.329	8.48E−02	−0.016	1.00E+00	0.461	1.30E−01	FALSE
Arf5	0.066	7.56E−01	0.088	1.00E+00	−0.329	8.50E−02	FALSE
Rpl9	−0.078	8.62E−02	0.056	1.00E+00	0.032	1.00E+00	FALSE
Thap3	0.316	8.66E−02	0.168	1.00E+00	0.162	1.00E+00	FALSE
Hmgb3	−0.281	8.66E−02	0.003	1.00E+00	0.093	1.00E+00	FALSE
Sirt2	0.269	8.67E−02	0.180	1.00E+00	−0.080	1.00E+00	FALSE
Rbm8a2	0.307	8.67E−02	0.102	1.00E+00	0.086	1.00E+00	FALSE
Elmsan1	0.171	5.18E−01	0.276	9.15E−01	0.478	8.68E−02	FALSE
Gm12355	0.215	1.99E−01	0.329	8.80E−01	0.461	8.69E−02	FALSE
Chst11	0.008	1.00E+00	0.199	1.00E+00	−0.507	8.69E−02	FALSE
Gm6576	0.212	8.76E−02	0.170	1.00E+00	0.201	8.03E−01	FALSE
Rpe	0.309	8.76E−02	0.388	1.00E+00	0.361	5.96E−01	FALSE
Exph5	−0.115	8.76E−02	0.059	1.00E+00	0.000	1.00E+00	FALSE
Snx5	0.265	8.76E−02	−0.061	1.00E+00	−0.016	1.00E+00	FALSE
Rpl35a	0.035	7.86E−01	0.041	1.00E+00	0.175	8.83E−02	FALSE
Aars	−0.293	8.93E−02	−0.280	1.00E+00	−0.119	1.00E+00	FALSE
Rlim	−0.306	8.95E−02	0.121	1.00E+00	−0.249	9.46E−01	FALSE
Gm17056	−0.239	8.96E−02	0.000	1.00E+00	0.080	1.00E+00	FALSE
Zdhhc16	0.279	8.96E−02	−0.225	1.00E+00	0.031	1.00E+00	FALSE
Kras	0.260	8.97E−02	0.619	9.15E−01	−0.045	1.00E+00	FALSE
Rnf7	0.268	8.97E−02	−0.266	1.00E+00	0.129	1.00E+00	FALSE
Casc4	0.109	8.97E−02	0.180	1.00E+00	−0.067	1.00E+00	FALSE
Ggt5	0.181	9.01E−02	0.333	1.00E+00	0.026	1.00E+00	FALSE
Cks1brt	−0.077	9.01E−02	0.000	1.00E+00	0.000	1.00E+00	FALSE
Taf1b	0.308	9.01E−02	−0.219	1.00E+00	0.114	1.00E+00	FALSE
Tmed10	−0.232	9.01E−02	−0.182	1.00E+00	−0.131	1.00E+00	FALSE
Eif4e3	0.323	9.01E−02	0.310	1.00E+00	0.201	1.00E+00	FALSE
Sh2d1a	0.280	9.01E−02	−0.024	1.00E+00	0.126	1.00E+00	FALSE
Brd2	−0.280	9.01E−02	−0.274	1.00E+00	−0.020	1.00E+00	FALSE
Ruben	−0.152	9.01E−02	0.058	1.00E+00	0.035	1.00E+00	FALSE
Arrdc1	0.297	9.01E−02	0.108	1.00E+00	0.098	1.00E+00	FALSE
Fam46a	−0.371	9.01E−02	−0.161	1.00E+00	0.079	1.00E+00	FALSE
Neat1	0.270	9.01E−02	0.623	9.15E−01	0.504	9.18E−02	FALSE
Mrps21	0.263	9.01E−02	−0.402	9.31E−01	0.113	1.00E+00	FALSE
5330426L24Rik	0.102	9.01E−02	0.169	1.00E+00	0.000	1.00E+00	FALSE
Aprt	0.225	9.01E−02	−0.208	1.00E+00	−0.072	1.00E+00	FALSE
Hivep2	0.311	9.01E−02	−0.315	1.00E+00	0.408	4.29E−01	FALSE
Commd8	0.258	9.01E−02	0.346	1.00E+00	0.158	1.00E+00	FALSE
Dcaf15	0.314	9.05E−02	−0.192	1.00E+00	0.250	8.20E−01	FALSE
Gm5426	0.146	9.14E−02	−0.126	1.00E+00	−0.044	1.00E+00	FALSE
Zfos1	0.253	9.20E−02	0.560	9.15E−01	−0.034	1.00E+00	FALSE
Htatsf1	−0.306	9.20E−02	0.455	9.15E−01	−0.208	9.77E−01	FALSE
Gmppa	0.080	9.31E−01	−0.438	9.96E−01	0.486	9.29E−02	FALSE
Acat2	−0.316	9.35E−02	0.199	1.00E+00	0.179	1.00E+00	FALSE
Abtb1	0.305	9.43E−02	−0.168	1.00E+00	0.284	7.36E−01	FALSE
Cers4	−0.066	1.00E+00	−1.014	9.45E−02	−0.577	1.21E−01	FALSE
Ranbp1	−0.239	9.48E−02	0.214	1.00E+00	−0.069	1.00E+00	FALSE
Rpl26	0.073	2.14E−01	0.036	1.00E+00	0.161	9.52E−02	FALSE
Mif4gd	0.264	9.63E−02	0.345	1.00E+00	0.042	1.00E+00	FALSE
Hspa9	−0.286	9.69E−02	0.368	1.00E+00	−0.011	1.00E+00	FALSE
Gpr15	−0.155	9.74E−02	−0.349	7.11E−01	0.053	1.00E+00	FALSE
Sprtn	−0.143	9.77E−02	0.000	1.00E+00	−0.093	1.00E+00	FALSE
Usp16	−0.308	9.85E−02	−0.380	1.00E+00	−0.080	1.00E+00	FALSE
Ptpn6	0.294	9.87E−02	0.292	1.00E+00	−0.008	1.00E+00	FALSE
Gm26532	−0.361	9.87E−02	0.102	1.00E+00	−0.009	1.00E+00	FALSE
Hba-a2	0.025	9.31E−01	0.062	1.00E+00	0.176	9.90E−02	FALSE
Sit1	−0.284	9.92E−02	0.223	1.00E+00	−0.047	1.00E+00	FALSE
Skil	−0.267	9.94E−02	0.407	1.00E+00	−0.085	1.00E+00	FALSE
Kat8	0.275	9.94E−02	0.712	4.66E−01	−0.165	9.89E−01	FALSE
Rhoh	−0.058	9.95E−01	−0.435	9.96E−01	−0.488	9.97E−02	FALSE

TABLE 4
Table detailing the ranking procedure used to prioritize genes for follow-up study. Gathers, for each
gene, the final score used for ranking in addition to the component statistics used in computing this
score. Details on the formula used are provided in the methods section. The scores above 2 are shown.
	Final	In-Vivo	In-Vivo	In-Vitro
Gene	Score	Cluster	Tissue	Summary	GWAS?	LPL-9_logFC	LPL-9_FDR	LPL-9_Geno_logFC
Gpr18	6.04	0.87	0.96	1.34	1	0.05	9.16E−01	−1.21
Gzmb	5.33	0.74	1.73	2.11	0	−0.18	8.28E−01	−0.31
Itgb1	5.07	1.75	0.00	1.57	0	−0.52	1.23E−01	0.62
Ccr3	5.00	0.00	0.00	3.00	1	0.02	9.16E−01	−0.06
Gzma	5.00	1.73	1.55	0.00	0	1.65	1.07E−14	−2.92
Il22	4.80	0.00	2.00	2.80	0	−1.98	6.26E−05	0.12
Zfp36l2	4.80	0.76	1.28	0.00	1	−0.51	3.71E−03	−1.28
Zbtb38	4.72	0.30	0.21	1.90	1	0.61	1.07E−03	−0.38
Cd74	4.58	0.29	0.47	1.53	1	−0.71	3.68E−02	0.39
Ccr5	4.55	0.70	1.14	0.00	1	−0.01	9.77E−01	−0.29
Cd160	4.15	1.39	1.38	0.00	0	2.21	8.92E−39	−1.39
Map3k8	4.11	0.27	1.57	0.00	1	−1.07	1.04E−07	−0.05
Tnfsf8	4.00	0.00	2.00	0.00	1	−2.58	3.47E−29	0.92
Ifitm1	4.00	2.00	0.00	0.00	0	0.42	7.73E−01	0.06
Nfkbiz	4.00	0.00	2.00	0.00	1	−1.84	5.04E−26	0.00
Fosl2	4.00	0.00	2.00	0.00	1	−2.22	2.11E−28	−0.04
Crem	4.00	0.00	2.00	0.00	1	−2.64	3.66E−42	0.29
Ccdc85b	4.00	0.24	0.31	1.20	1	0.49	5.14E−03	0.25
Fos	3.94	0.00	1.94	0.00	1	−0.39	3.85E−01	0.88
Gpr183	3.77	0.21	1.35	0.00	1	−1.70	2.41E−24	−0.09
S100a4	3.76	1.53	0.71	0.00	0	0.21	5.67E−01	−0.64
1110008f13rik	3.63	0.32	0.00	3.00	0	−0.24	3.26E−01	−0.22
Lsp1	3.63	0.61	0.41	0.00	1	0.54	2.06E−11	0.01
Litaf	3.61	0.00	1.61	0.00	1	−0.08	9.16E−01	−0.60
Cd7	3.60	1.10	1.40	0.00	0	1.84	6.17E−25	−1.93
Dusp2	3.59	0.36	0.42	2.46	0	0.71	8.19E−05	−1.01
Plac8	3.59	1.00	1.58	0.00	0	−0.08	9.16E−01	−0.89
H1f0	3.56	0.57	0.75	1.67		0.24	5.20E−01	0.55
S1pr1	3.56	0.88	0.42	1.37	0	−0.16	8.29E−01	−0.60
Ncf4	3.53	0.62	0.29	0.00	1	0.30	2.08E−01	0.21
Smim3	3.46	0.00	1.46	0.00	1	−0.48	4.13E−02	−0.11
Tesc	3.43	0.00	0.47	2.96	0	0.01	9.59E−01	−0.05
Rbms1	3.39	0.29	0.18	2.64	0	0.00	9.81E−01	−0.27
Lpxn	3.39	0.21	0.97	0.00	1	−0.02	9.16E−01	−0.25
Tnfrsf9	3.37	0.00	1.37	0.00	1	−1.43	4.83E−10	0.51
Pmm1	3.37	0.14	0.15	0.95	1	0.16	7.88E−01	−0.41
Tob2	3.32	0.00	1.32	0.00	1	−1.09	4.21E−08	0.30
Ifng	3.32	0.00	1.69	1.63	0	−1.20	7.19E−06	0.66
Cd226	3.32	0.55	0.23	0.00	1	1.09	1.32E−13	−0.19
Ctsw	3.28	0.47	0.35	0.00	1	0.93	3.13E−26	−0.23
Itga4	3.26	0.41	0.44	0.00	1	0.25	3.38E−01	−0.60
Cd28	3.23	0.08	1.08	0.00	1	−1.13	4.90E−26	−0.16
Klf2	3.21	1.25	0.71	0.00	0	−0.39	2.50E−01	−1.19
Ly6c2	3.19	1.60	0.00	0.00	0	−0.73	1.12E−01	−0.47
Ccr9	3.19	1.11	0.97	0.00	0	1.55	7.75E−14	−2.22
Ets1	3.19	0.16	0.87	0.00	1	−0.57	2.15E−09	0.03
Il7r	3.19	0.35	0.48	0.00	1	0.43	2.27E−03	−0.54
Ptpn22	3.18	0.00	1.18	0.00	1	−0.69	1.93E−09	−0.57
Gm12840	3.17	0.59	2.00	0.00	0	−1.43	4.99E−14	−0.09
Zfp36l1	3.17	0.00	1.17	0.00	1	−0.78	3.31E−05	−0.69
Atxn2l	3.17	0.00	0.07	1.10	1	−0.12	8.69E−01	−0.04
Pde4b	3.17	0.00	2.00	1.17	0	−1.76	8.34E−28	−0.20
Selp	3.16	0.00	0.00	1.16	1	0.00	9.16E−01	0.00
Anxa6	3.16	0.48	0.20	0.00	1	0.30	2.42E−02	0.22
Peli1	3.14	0.00	0.92	2.22	0	−1.00	7.94E−13	0.23
Odc1	3.12	0.00	2.00	1.12	0	−2.92	6.12E−65	0.23
Pglyrp1	3.12	1.21	0.70	0.00	0	0.12	8.90E−01	−0.30
Pim3	3.12	0.00	1.12	0.00	1	−1.08	4.71E−07	0.03
Pim1	3.11	0.56	2.00	0.00	0	−1.85	2.32E−50	−1.11
Mt1	3.08	0.69	0.65	1.06	0	−0.74	9.16E−03	−0.32
Stat3	3.08	0.00	1.08	0.00	1	−0.85	1.15E−07	0.28
Stat5a	3.07	0.00	0.47	0.60	1	−0.41	9.10E−02	−0.12
Vmp1	3.05	0.27	0.51	0.00	1	−0.11	8.77E−01	−0.82
Ier2	3.05	0.21	0.43	2.19	0	−0.98	4.39E−12	−0.26
Tnip1	3.02	0.13	0.77	0.00	1	−0.88	1.43E−06	0.41
Timp1	3.00	0.00	0.00	3.00	0	0.00	9.16E−01	0.00
Amdhd1	3.00	0.00	0.00	3.00	0	−0.03	7.89E−01	0.00
Rora	2.99	0.12	1.63	1.12	0	−1.51	6.78E−27	0.19
Gm5111	2.99	0.00	0.02	2.97	0	0.04	7.22E−01	−0.06
Fermt3	2.99	0.31	0.36	0.00	1	0.41	1.78E−02	−0.04
Dap	2.96	0.34	0.28	0.00	1	0.06	9.16E−01	−0.72
Hist1h1c	2.94	0.52	1.90	0.00	0	−1.01	9.38E−06	0.17
Cfl1	2.93	0.21	0.14	0.38	1	0.41	1.20E−13	0.33
Ipmk	2.92	0.00	0.92	0.00	1	−0.84	4.49E−05	−0.25
Klrd1	2.90	1.28	0.34	0.00	0	0.21	6.79E−01	1.08
Gfi1	2.89	0.40	0.09	0.00	1	0.81	5.66E−07	−0.52
S100a6	2.89	1.20	0.50	0.00	0	0.44	3.37E−04	0.25
Rorc	2.89	0.00	0.07	0.82	1	0.05	9.16E−01	0.05
Stat4	2.87	0.00	0.87	0.00	1	−0.54	2.67E−03	0.11
Fdps	2.86	0.36	0.15	0.00	1	0.71	7.75E−05	−0.21
Gpr65	2.86	0.00	0.86	0.00	1	−0.53	2.06E−02	−0.36
Rapgef6	2.85	0.22	0.41	0.00	1	0.44	1.06E−02	−0.40
Tmem160	2.84	0.27	0.20	2.12	0	0.16	4.72E−01	0.20
Rasgrp1	2.84	0.00	0.84	0.00	1	−0.60	1.41E−03	−0.39
Pnkd	2.83	0.31	0.21	0.00	1	0.63	1.17E−04	−0.58
Ccnd3	2.82	0.41	0.00	0.00	1	0.58	9.30E−06	0.30
Panx1	2.82	0.20	0.00	2.42	0	−0.11	9.10E−01	0.22
Thap11	2.81	0.31	0.13	2.06	0	0.62	2.48E−04	−0.56
Lysmd2	2.80	0.34	0.25	1.86	0	0.26	4.08E−01	−0.14
Ubac2	2.80	0.25	0.29	0.00	1	0.51	7.50E−04	−0.24
Lgals3	2.79	1.40	0.00	0.00	0	−0.27	2.98E−01	0.46
Cyb5r4	2.78	0.32	0.29	1.86	0	0.22	4.11E−01	0.13
Upf3a	2.78	0.39	0.34	1.66	0	0.22	5.09E−01	0.13
Gm10076	2.78	1.04	0.69	0.00	0	0.07	9.16E−01	−0.36
Ccdc69	2.77	0.30	0.18	0.00	1	0.59	2.73E−04	−0.40
Ccl5	2.76	1.13	0.50	0.00	0	0.92	7.28E−10	−1.43
Gramd3	2.75	0.42	1.92	0.00	0	−2.80	1.99E−64	−0.50
Errfi1	2.75	0.00	0.75	0.00	1	−0.85	6.10E−05	0.00
Itgae	2.75	0.86	1.03	0.00	0	1.72	6.36E−26	−1.44
Il2ra	2.74	0.00	0.74	0.00	1	−0.71	7.84E−04	−0.03
Gpx4	2.72	0.00	0.72	0.00	1	−0.61	3.04E−08	0.17
Ndfip1	2.72	0.00	0.72	0.00	1	−1.00	1.29E−12	−0.02
Syt11	2.72	0.31	0.11	0.00	1	0.61	6.33E−04	−0.13
Dph5	2.71	0.00	0.00	0.71	1	−0.34	1.73E−01	0.43
Slc39a8	2.70	0.00	0.08	0.62	1	0.25	2.07E−01	0.49
Rnf187	2.69	0.00	0.00	2.69	0	−0.03	9.16E−01	−0.04
Fam53b	2.68	0.27	0.14	0.00	1	0.54	4.97E−03	−0.40
Prdx5	2.68	0.15	0.37	0.00	1	0.30	3.27E−02	0.36
Ccrl2	2.67	0.00	0.67	0.00	1	−0.50	4.03E−02	0.57
Ep300	2.67	0.00	0.00	0.67	1	−0.02	9.22E−01	−0.09
Hdac7	2.66	0.28	0.10	0.00	1	0.19	5.54E−01	−0.17
Cd6	2.66	0.23	0.21	0.00	1	0.16	4.22E−01	0.22
Traf3ip2	2.66	0.29	0.09	0.00	1	−0.01	9.79E−01	−0.46
Gnb2	2.66	0.20	0.25	0.00	1	0.14	4.84E−01	0.28
Tet2	2.66	0.00	0.66	0.00	1	−0.33	2.15E−01	0.29
Fam189b	2.66	0.33	0.00	0.00	1	0.66	1.50E−05	−0.30
Skap2	2.65	0.26	0.13	0.00	1	0.53	4.39E−03	0.03
Lgals1	2.64	1.11	0.17	0.25	0	0.03	9.16E−01	0.37
Socs1	2.64	0.00	0.64	0.00	1	−1.20	3.60E−09	0.36
Itgav	2.64	0.00	0.64	0.00	1	−0.46	5.45E−02	−0.44
Dnajb4	2.63	0.00	0.63	0.00	1	−0.35	2.20E−01	0.13
Cdkn1a	2.63	0.00	2.00	0.63	0	−1.97	4.97E−22	0.16
Arhgef2	2.62	0.20	0.23	0.00	1	0.40	5.38E−02	0.01
Dnmt3a	2.62	0.26	0.11	0.00	1	0.51	2.67E−03	−0.34
Jund	2.61	0.00	2.00	0.61	0	−1.56	1.41E−54	0.96
Scamp3	2.61	0.19	0.23	0.00	1	0.38	2.05E−02	−0.28
Tmem30a	2.61	0.35	0.35	1.55	0	0.22	3.63E−01	−0.73
Ash1l	2.60	0.30	0.00	0.00	1	0.60	6.06E−04	−0.13
Lsm14a	2.60	0.17	0.26	0.00	1	0.34	7.25E−02	−0.04
Slain2	2.60	0.00	0.00	0.60	1	−0.16	7.57E−01	0.25
Muc1	2.60	0.11	0.38	0.00	1	−0.31	1.19E−01	−0.12
Adamts14	2.59	0.00	0.00	2.59	0	0.00	9.16E−01	0.00
Ptk2b	2.59	0.25	0.09	0.00	1	0.50	3.11E−03	0.23
Stk11	2.59	0.00	0.59	0.00	1	−0.38	7.50E−02	−0.01
Ccr2	2.58	0.17	0.23	0.00	1	−0.82	5.53E−07	0.19
Itgal	2.57	0.23	0.11	0.00	1	0.47	4.68E−03	−0.85
Elf1	2.57	0.00	0.57	0.00	1	−0.12	8.01E−01	−0.44
Ptprc	2.57	0.20	0.16	0.00	1	0.05	9.16E−01	−0.26
Rbx1	2.56	0.21	0.14	0.00	1	0.42	4.59E−05	0.23
Traf3ip3	2.56	0.44	0.45	1.23	0	0.79	1.50E−07	−0.46
Ccdc88b	2.55	0.24	0.08	0.00	1	0.48	1.39E−02	−0.36
Tsen34	2.55	0.23	0.00	2.09	0	0.46	2.92E−03	−0.30
Ay036118	2.54	1.15	0.25	0.00	0	−0.70	9.08E−04	0.26
Il24	2.54	0.00	0.00	2.54	0
H2-q10	2.54	0.00	0.06	2.48	0	−0.40	9.22E−02	−0.05
Scand1	2.54	0.16	0.38	1.83	0	0.11	7.40E−01	−0.08
Tab2	2.54	0.14	0.26	0.00	1	0.14	7.87E−01	0.31
Nfkb1	2.53	0.00	0.53	0.00	1	−0.80	1.07E−06	0.41
Rusc1	2.51	0.20	0.11	0.00	1	0.40	5.20E−02	−0.38
Esyt1	2.51	0.48	0.24	1.32	0	0.50	2.99E−03	0.14
Commd7	2.51	0.21	0.08	0.00	1	0.42	1.69E−02	0.43
Rfng	2.50	0.21	0.14	1.94	0	0.42	1.91E−02	−0.41
Rpl27-ps3	2.50	1.05	0.40	0.00	0	−0.39	1.47E−02	−0.81
Gigyf1	2.50	0.25	0.00	0.00	1	0.50	3.73E−03	0.04
Rgcc	2.49	0.00	1.58	0.92	0	−2.01	3.98E−17	0.81
Rpl3	2.49	0.15	0.19	0.00	1	0.03	8.98E−01	−0.17
Mrpl20	2.49	0.16	0.16	0.00	1	−0.12	8.00E−01	−0.15
Gm2a	2.48	0.15	0.18	0.00	1	0.30	9.19E−02	0.11
Mus81	2.47	0.17	0.13	0.00	1	0.34	6.54E−02	−0.25
Lpp	2.47	0.00	0.00	0.47	1	0.02	9.32E−01	0.11
Chp1	2.47	0.16	0.14	0.00	1	0.24	3.53E−01	−0.58
Mob4	2.46	0.11	0.24	0.00	1	−0.16	6.52E−01	−0.20
Lamp1	2.46	0.00	0.08	2.38	0	0.17	5.79E−01	−0.15
Phf5a	2.46	0.16	0.14	0.00	1	−0.18	5.90E−01	−0.06
Fnip1	2.46	0.11	0.25	0.00	1	−0.35	5.02E−02	0.12
Calm3	2.45	0.19	0.07	0.00	1	0.38	3.36E−03	0.27
Lrp10	2.45	0.21	0.20	1.82	0	0.43	9.66E−03	0.00
Stat5b	2.45	0.00	0.45	0.00	1	−0.42	7.05E−02	−0.17
Bach2	2.45	0.00	0.00	0.45	1	−0.19	9.99E−02	0.00
Prkab1	2.44	0.22	0.00	0.00	1	0.44	1.85E−02	−0.07
Hvcn1	2.44	0.39	0.00	1.65	0	0.79	3.23E−07	−0.51
Tmem150a	2.44	0.00	0.00	2.44	0	−0.01	9.16E−01	0.00
Nfkbia	2.44	0.22	2.00	0.00	0	−2.00	6.41E−52	0.23
Ifitm3	2.43	1.07	0.28	0.00	0	−0.15	8.69E−01	−0.26
Egfp_ires_il23r	2.43	0.00	0.00	2.43	0
Bad	2.43	0.15	0.13	0.00	1	0.25	3.65E−01	−0.14
Zbtb46	2.42	0.10	0.21	0.00	1	−0.24	4.01E−02	0.00
Cacna1s	2.42	0.00	0.10	0.32	1	−0.02	9.16E−01	0.12
Vamp3	2.42	0.15	0.11	0.00	1	−0.12	8.75E−01	−0.20
Fyn	2.41	0.21	0.00	0.00	1	0.41	6.91E−03	0.01
Stx6	2.41	0.00	0.29	2.12	0	−0.54	9.36E−03	0.33
Ikzf3	2.41	0.00	0.41	0.00	1	0.03	9.16E−01	0.01
Mgat2	2.41	0.17	0.00	2.07	0	−0.13	7.90E−01	0.01
Serpinb9	2.41	0.35	1.70	0.00	0	−2.27	2.37E−29	0.48
Dennd1b	2.41	0.20	0.00	0.00	1	0.41	4.95E−02	0.56
Bloc1s4	2.40	0.00	0.27	2.13	0	−0.32	2.26E−01	0.29
Anxa1	2.40	1.20	0.00	0.00	0	−0.39	2.24E−01	0.51
Smad3	2.39	0.15	0.10	0.00	1	−0.17	6.80E−01	−0.20
Tmem258	2.39	0.16	0.08	0.00	1	0.31	1.20E−02	−0.15
Lmna	2.39	0.20	1.99	0.00	0	−2.18	3.54E−21	1.52
Sp140	2.38	0.15	0.09	0.00	1	0.07	9.16E−01	−0.07
Actn2	2.38	0.56	1.25	0.00	0	0.97	1.90E−11	−0.17
Acbd6	2.38	0.00	0.22	2.16	0	−0.20	5.59E−01	−0.03
Ahnak	2.38	0.50	0.16	1.22	0	−0.68	6.25E−06	−0.15
Arpc2	2.37	0.16	0.06	0.00	1	−0.21	6.08E−03	0.10
Erp29	2.37	0.19	0.00	0.00	1	0.09	9.16E−01	−0.38
Nhp2l1	2.37	0.00	0.37	0.00	1	−0.78	2.02E−09	0.23
Ctbp1	2.36	0.35	0.32	1.34	0	−0.18	5.38E−01	−0.18
Gba	2.36	0.11	0.13	0.00	1	0.19	5.83E−01	−0.11
Lztfl1	2.35	0.56	1.24	0.00	0	0.50	7.25E−03	−0.48
Ptpn2	2.35	0.00	0.35	0.00	1	−0.50	1.46E−02	0.14
Usp36	2.35	0.00	0.35	0.00	1	−0.33	2.19E−01	0.35
Grb7	2.34	0.00	0.34	0.00	1	−0.23	3.56E−01	0.28
Fndc3a	2.34	0.00	0.34	0.00	1	−0.27	3.66E−01	0.38
Mt2	2.33	0.41	0.21	1.32	0	−0.12	9.16E−01	−0.21
Dctn4	2.33	0.00	0.33	0.00	1	−0.13	8.69E−01	−0.49
Nusap1	2.33	0.00	0.33	0.00	1	−0.47	2.85E−02	−0.06
Rbm22	2.33	0.16	0.00	0.00	1	0.31	1.24E−01	−0.08
Crip1	2.32	1.16	0.00	0.00	0	−0.16	4.44E−01	0.13
Anp32b	2.32	0.00	0.19	2.13	0	−0.03	9.16E−01	0.09
Aurkaip1	2.31	0.16	0.00	0.00	1	0.31	4.66E−02	0.23
Ripk2	2.31	0.21	0.36	1.53	0	−0.31	2.52E−01	−0.29
Nubp1	2.31	0.12	0.37	1.70	0	0.05	9.16E−01	−0.11
Camta1	2.31	0.00	0.31	0.00	1	0.15	7.66E−01	0.04
Ube2j2	2.30	0.00	0.30	0.00	1	−0.51	1.26E−03	−0.09
Kif3b	2.30	0.00	0.00	0.30	1	0.21	2.31E−01	0.43
Brap	2.30	0.00	0.30	0.00	1	−0.36	1.42E−01	−0.02
Gm8096	2.30	0.00	0.00	2.30	0
Ermn	2.30	0.00	1.01	1.29	0	−0.82	2.08E−03	0.18
Plagl2	2.29	0.00	0.00	0.29	1	0.11	8.12E−01	−0.24
Plek	2.29	0.44	0.00	1.42	0	−0.17	7.62E−01	−0.02
D030056l22rik	2.29	0.00	0.23	2.06	0	−0.22	5.63E−01	0.12
Ccr1	2.28	0.00	0.28	0.00	1	−0.25	3.19E−01	0.33
Krtcap2	2.28	0.14	0.00	0.00	1	0.15	2.54E−01	0.68
Sh2b1	2.28	0.00	0.28	0.00	1	0.00	9.89E−01	0.10
Abi3	2.27	0.65	0.97	0.00	0	1.31	2.58E−20	−0.41
Ccnl2	2.27	0.00	0.27	0.00	1	−0.11	8.44E−01	−0.32
Kbtbd7	2.27	0.14	0.00	0.00	1	0.27	3.02E−02	0.32
Csf2	2.27	0.00	0.27	0.00	1	−0.27	4.91E−01	0.12
Pycard	2.27	0.82	0.63	0.00	0	0.67	2.06E−07	−0.41
Dock7	2.27	0.00	0.00	0.27	1	0.00	9.16E−01	0.00
Herpud1	2.26	0.00	1.16	1.10	0	−1.41	4.94E−17	−0.99
Arf6	2.26	0.12	0.39	1.63	0	−0.07	8.95E−01	−0.09
Zyx	2.26	0.87	0.52	0.00	0	0.34	1.46E−01	−0.27
Zfp91	2.25	0.00	0.25	0.00	1	−0.19	6.33E−01	0.28
Fam171b	2.25	0.13	0.00	0.00	1	0.25	6.60E−03	−0.05
Maml2	2.25	0.12	0.00	0.00	1	0.28	3.01E−01	0.08
Ifngr2	2.24	0.00	0.24	0.00	1	−0.35	7.19E−03	0.00
Bhlhe40	2.24	0.12	2.00	0.00	0	−2.05	5.44E−83	−0.58
Cisd1	2.23	0.00	0.23	0.00	1	0.29	2.94E−01	0.39
Zfp420	2.22	0.00	0.00	2.22	0	0.05	9.16E−01	0.32
Zc3h12a	2.22	0.11	2.00	0.00	0	−1.90	3.03E−26	0.20
Plcg2	2.22	0.08	0.05	0.00	1	0.14	3.14E−01	−0.27
2310036o22rik	2.21	0.00	0.13	2.09	0	0.10	8.00E−01	0.13
Eif3c	2.21	0.11	0.00	0.00	1	−0.03	9.16E−01	0.00
Slc15a3	2.21	0.00	0.52	1.69	0	−0.62	2.28E−03	−0.01
Acap3	2.21	0.10	0.00	0.00	1	0.14	7.00E−01	0.20
Tef	2.21	0.00	0.21	0.00	1	−0.20	4.12E−01	0.03
Emp3	2.20	0.93	0.34	0.00	0	0.17	4.01E−01	−0.30
Ssr2	2.20	0.00	0.20	0.00	1	−0.02	9.16E−01	−0.24
Usp1	2.19	0.00	0.19	0.00	1	0.05	9.16E−01	0.13
Rpl10-ps3	2.18	0.89	0.40	0.00	0	−0.20	4.07E−01	−0.22
Plcxd2	2.18	0.42	1.34	0.00	0	−0.89	1.41E−05	−0.23
Adcy7	2.18	0.00	0.18	0.00	1	0.18	6.40E−01	−0.04
Irf1	2.18	0.00	0.18	0.00	1	0.00	9.81E−01	−0.14
Aamp	2.17	0.00	0.17	0.00	1	−0.08	9.16E−01	0.39
Gm8730	2.17	0.78	0.61	0.00	0	0.03	9.16E−01	−0.97
Zgpat	2.17	0.00	0.17	0.00	1	0.23	4.47E−01	−0.28
St13	2.17	0.00	0.17	0.00	1	0.03	9.16E−01	−0.54
Cdc42se2	2.17	0.00	0.17	0.00	1	−0.02	9.36E−01	−0.44
Anxa2	2.16	0.69	0.00	0.77	0	−0.14	6.71E−01	0.46
Cpsf3l	2.16	0.00	0.16	0.00	1	0.30	2.53E−01	0.25
Gm2000	2.15	0.84	0.47	0.00	0	−0.16	5.62E−01	−0.56
Trim46	2.15	0.08	0.00	0.00	1	0.00	9.76E−01	−0.12
Dusp16	2.15	0.00	0.15	0.00	1	−0.16	1.48E−01	0.00
Zmat5	2.15	0.00	0.15	0.00	1	0.30	1.96E−01	0.39
Ptprk	2.15	0.00	0.15	0.00	1	0.17	6.28E−01	−0.02
Zdhhc7	2.15	0.15	0.00	1.85	0	0.14	7.96E−01	0.64
Il2	2.14	0.00	0.14	0.00	1	0.21	6.26E−01	0.62
Msto1	2.14	0.00	0.14	0.00	1	0.22	3.66E−01	0.22
Il10	2.14	0.00	0.14	0.00	1	−0.26	1.52E−01	0.00
Sbno2	2.14	0.00	0.14	0.00	1	−0.14	4.66E−01	−0.06
Snx17	2.14	0.00	0.14	0.00	1	0.15	7.29E−01	0.11
Kif11	2.14	0.00	0.14	0.00	1	−0.14	3.28E−01	−0.06
Ndfip2	2.13	0.00	0.08	2.05	0	−0.02	9.43E−01	−0.19
Card9	2.13	0.07	0.00	0.00	1	0.13	1.78E−02	0.26
Lsm4	2.13	0.15	0.25	1.59	0	0.29	4.77E−02	0.35
Ormdl3	2.13	0.00	0.13	0.00	1	−0.22	5.67E−01	−0.44
S100a10	2.13	0.71	0.00	0.70	0	0.24	4.32E−03	0.34
Notch2	2.13	0.00	0.13	0.00	1	0.28	3.07E−01	−0.29
Senp7	2.12	0.00	0.12	0.00	1	0.27	2.72E−01	−0.03
Cd48	2.12	0.80	0.52	0.00	0	1.09	4.17E−26	−0.11
Ssbp4	2.12	0.13	0.26	1.61	0	0.12	7.93E−01	0.07
Cul1	2.12	0.00	0.12	0.00	1	−0.24	4.52E−01	0.14
Mettl10	2.12	0.00	0.12	0.00	1	0.32	1.67E−01	0.29
Rabep2	2.11	0.00	0.11	0.00	1	0.25	3.59E−01	0.27
Pkig	2.11	0.00	0.11	0.00	1	−0.11	7.47E−01	0.45
Desi1	2.11	0.00	0.11	0.00	1	−0.05	9.16E−01	−0.44
Furin	2.11	0.00	2.00	0.11	0	−1.32	2.08E−16	0.82
Tcof1	2.11	0.00	0.11	0.00	1	0.16	7.20E−01	−0.17
Glipr2	2.11	0.84	0.43	0.00	0	0.28	1.81E−01	−0.10
Tgfbr3	2.11	0.00	0.11	0.00	1	−0.12	6.95E−01	−0.12
Tyk2	2.10	0.00	0.10	0.00	1	0.24	2.94E−01	−0.66
Kif21b	2.10	0.00	0.10	0.00	1	0.32	1.73E−01	0.12
Tufm	2.10	0.00	0.10	0.00	1	0.25	3.89E−01	−0.14
Zmiz1	2.10	0.00	0.10	0.00	1	0.04	9.16E−01	−0.32
Il21	2.10	0.00	0.10	0.00	1	−0.08	8.15E−01	−0.06
Ttpal	2.10	0.00	0.10	0.00	1	0.05	9.16E−01	−0.33
Rps6kb1	2.10	0.00	0.10	0.00	1	−0.15	7.63E−01	−0.71
Camk2g	2.10	0.00	0.10	0.00	1	0.07	9.16E−01	0.16
Tom1	2.10	0.00	0.10	0.00	1	0.20	4.19E−01	−0.14
Actr1a	2.10	0.00	0.10	0.00	1	0.15	7.74E−01	−0.30
Rgs14	2.10	0.00	0.10	0.00	1	−0.03	9.16E−01	−0.10
Ublcp1	2.10	0.00	0.10	0.00	1	−0.04	9.16E−01	0.10
Otud3	2.09	0.00	0.09	0.00	1	0.01	9.56E−01	0.22
Tmem180	2.09	0.00	0.09	0.00	1	−0.03	9.16E−01	−0.27
Ergic1	2.09	0.00	0.09	0.00	1	0.02	9.53E−01	−0.05
Aa467197	2.09	0.97	0.16	0.00	0	0.42	4.68E−02	−0.01
Tdp2	2.09	0.00	0.25	1.84	0	−0.56	1.00E−02	0.04
Rac1	2.09	0.07	0.06	1.88	0	−0.22	1.23E−01	0.22
Phlda3	2.09	0.00	0.00	2.09	0	−0.08	9.16E−01	0.12
Trmt112	2.09	0.00	0.09	0.00	1	0.13	6.94E−01	−0.19
Ccny	2.08	0.00	0.08	0.00	1	−0.18	6.57E−01	−0.22
Slc43a3	2.08	0.00	0.08	0.00	1	0.03	9.16E−01	−0.32
Ezh2	2.08	0.00	0.08	0.00	1	−0.30	2.75E−01	−0.19
Rps14	2.08	0.00	0.08	0.00	1	−0.06	2.70E−01	0.00
Spred2	2.08	0.00	0.08	0.00	1	−0.13	6.12E−01	0.12
Rn7s2	2.08	0.00	0.00	2.08	0
Rn7s1	2.08	0.00	0.00	2.08	0
Rpap2	2.08	0.00	0.08	0.00	1	0.19	4.73E−01	0.10
Cit	2.08	0.00	0.08	0.00	1	−0.08	8.92E−01	−0.16
Ascc2	2.08	0.00	0.08	0.00	1	0.01	9.56E−01	−0.15
Ksr1	2.08	0.00	0.08	0.00	1	−0.02	9.16E−01	−0.18
Edem2	2.08	0.00	0.08	0.00	1	0.35	1.30E−01	−0.12
Blzf1	2.08	0.00	0.08	0.00	1	−0.04	9.16E−01	0.00
Ppp5c	2.08	0.00	0.08	0.00	1	0.22	4.78E−01	−0.09
Smurf1	2.08	0.00	0.08	0.00	1	−0.17	3.56E−01	0.18
Nop9	2.08	0.00	0.08	2.00	0	−0.23	4.77E−01	0.05
Slc30a7	2.08	0.00	0.08	0.00	1	0.07	9.16E−01	−0.29
Tnfrsf8	2.08	0.00	0.00	2.08	0	−0.04	6.49E−01	0.00
Adcy3	2.08	0.00	0.08	0.00	1	0.14	6.08E−01	−0.10
Pdcd1	2.07	0.00	0.00	2.07	0	−0.01	9.93E−01	0.18
Fen1	2.07	0.00	0.07	0.00	1	−0.19	5.90E−01	−0.08
Themis	2.07	0.00	0.07	0.00	1	0.21	4.38E−01	−0.47
Nudt22	2.07	0.00	0.07	0.00	1	0.28	2.11E−01	−0.10
Cyth1	2.07	0.00	0.07	0.00	1	−0.12	8.69E−01	0.11
Tmbim1	2.07	0.00	0.07	0.00	1	0.00	9.82E−01	0.35
Ndufaf1	2.07	0.00	0.07	0.00	1	0.24	3.44E−01	0.13
Klrc1	2.07	0.87	0.33	0.00	0	−1.21	7.84E−09	0.71
Pomc	2.07	0.00	0.07	0.00	1	−0.07	8.21E−01	0.17
Cpeb4	2.07	0.00	0.07	0.00	1	0.06	9.16E−01	0.41
Cul2	2.07	0.00	0.07	0.00	1	−0.03	9.16E−01	0.19
Hgfac	2.07	0.03	0.00	0.00	1	−0.02	9.09E−01	0.00
Pofut1	2.07	0.00	0.07	0.00	1	0.16	5.63E−01	−0.20
Clasp2	2.07	0.00	0.06	2.00	0	0.08	9.16E−01	−0.05
Nme7	2.06	0.00	0.06	0.00	1	0.16	4.96E−01	0.66
Ndst1	2.06	0.00	0.06	0.00	1	−0.11	2.93E−01	0.00
Gpr137	2.06	0.00	0.06	0.00	1	0.01	9.61E−01	−0.18
Ncoa5	2.06	0.00	0.06	0.00	1	0.24	3.02E−01	−0.10
Mapkapk5	2.06	0.00	0.06	0.00	1	−0.10	6.31E−01	−0.06
Auh	2.05	0.00	0.05	0.00	1	0.16	7.47E−01	−0.32
Gpx3	2.05	0.00	0.05	0.00	1	−0.06	5.82E−01	0.00
Tmem116	2.05	0.03	0.00	0.00	1	−0.01	9.16E−01	0.00
Hint1	2.05	0.00	0.05	0.00	1	−0.11	5.88E−01	−0.01
Mtmr3	2.05	0.00	0.05	0.00	1	−0.04	9.16E−01	−0.20
Ube2l3	2.05	0.00	0.05	0.00	1	0.06	9.16E−01	0.13
Il23r	2.05	0.00	0.05	0.00	1	0.01	9.16E−01	−0.07
Asb2	2.05	0.46	1.12	0.00	0	0.93	8.67E−11	0.94
Snx32	2.05	0.00	0.05	0.00	1	0.15	3.44E−01	0.02
Fgfr1op	2.04	0.00	0.04	0.00	1	−0.14	6.79E−01	0.01
Ccl2	2.04	0.00	0.04	0.00	1	−0.04	7.20E−01	0.00
Slc16a10	2.04	0.00	0.04	0.00	1	0.04	9.16E−01	−0.12
Batf	2.04	0.19	0.76	0.90	0	−0.99	1.85E−09	−0.11
Trpt1	2.04	0.00	0.04	0.00	1	0.09	7.33E−01	0.28
Jazf1	2.04	0.00	0.04	0.00	1	−0.11	2.74E−01	0.00
Tubd1	2.04	0.00	0.04	0.00	1	−0.01	9.16E−01	−0.06
Rtel1	2.04	0.00	0.04	0.00	1	0.11	6.34E−01	0.22
Srm	2.04	0.00	0.08	1.96	0	−0.02	9.16E−01	−0.37
Thada	2.03	0.00	0.03	0.00	1	−0.09	8.72E−01	0.43
Tppp	2.03	0.00	0.03	0.00	1	0.02	9.16E−01	0.18
Ppp4c	2.03	0.16	0.24	1.47	0	0.12	6.55E−01	−0.24
Per3	2.03	0.00	0.03	0.00	1	0.09	7.22E−01	0.05
Hormad2	2.03	0.00	0.03	0.00	1	−0.04	6.91E−01	0.00
Gm20186	2.03	0.45	1.13	0.00	0	−1.00	1.94E−06	0.19
Ccdc122	2.02	0.00	0.02	0.00	1	0.05	7.03E−01	−0.06
Fasl	2.02	0.19	1.65	0.00	0	−1.32	8.53E−15	−0.45
Sh2d2a	2.02	0.24	1.54	0.00	0	−0.82	1.67E−09	−0.73
Atp6v0a1	2.02	0.00	0.02	0.00	1	−0.03	8.25E−01	0.00
Fosl1	2.01	0.00	0.01	0.00	1	−0.01	9.16E−01	0.00
Itgb8	2.01	0.00	0.01	0.00	1	−0.02	9.16E−01	0.00
Amz1	2.01	0.00	0.01	0.00	1	0.05	6.82E−01	0.15
Cxcl5	2.01	0.00	0.01	0.00	1	−0.01	9.16E−01	0.00
Nkx2-3	2.01	0.00	0.01	0.00	1	−0.01	9.16E−01	0.00
Thbs3	2.01	0.00	0.01	0.00	1	−0.01	9.16E−01	0.00
Pf4	2.01	0.00	0.01	0.00	1	0.03	8.56E−01	−0.06
Ephx4	2.01	0.00	0.01	0.00	1	−0.01	9.16E−01	0.00
Osmr	2.01	0.00	0.01	0.00	1	0.00	9.16E−01	0.00
Ccl11	2.01	0.00	0.01	0.00	1	−0.01	9.16E−01	0.00
Fndc4	2.01	0.00	0.01	0.00	1	−0.01	9.16E−01	0.00
Ccl7	2.01	0.00	0.01	0.00	1	−0.01	9.16E−01	0.00
Ptrf	2.01	0.00	0.01	0.00	1	−0.01	9.16E−01	0.00
Mei1	2.00	0.00	0.00	0.00	1	0.00	9.16E−01	0.00
Lamb1	2.00	0.00	0.00	0.00	1	0.00	9.16E−01	0.00
Gene	LPL-9_Geno_FDR	LPL-2_logFC	LPL-2_FDR	LPL-2_Geno_logFC	LPL-2_Geno_FDR
Gpr18	8.21E−02	0.30	2.12E−06	−0.87	1.82E−10
Gzmb	1.00E+00	0.46	9.03E−09	−0.74	1.86E−06
Itgb1	8.72E−01	1.75	1.74E−200	0.47	8.89E−03
Ccr3	1.00E+00	0.00	8.83E−01	0.02	9.32E−01
Gzma	2.40E−10	1.16	4.89E−41	−1.73	5.05E−18
Il22	1.00E+00	−1.76	3.12E−27	0.80	2.21E−06
Zfp36l2	6.35E−03	0.22	9.29E−06	−0.76	2.01E−14
Zbtb38	1.00E+00	−0.09	3.49E−01	−0.17	5.91E−01
Cd74	1.00E+00	0.29	3.04E−03	0.49	3.79E−02
Ccr5	1.00E+00	−0.08	4.32E−01	−0.70	1.48E−08
Cd160	4.54E−04	0.24	1.01E−02	−1.39	5.51E−17
Map3k8	1.00E+00	0.27	4.85E−06	0.10	9.09E−01
Tnfsf8	4.04E−01	−0.74	3.11E−27	0.87	1.14E−10
Ifitm1	1.00E+00	3.16	1.00E−167	1.21	2.18E−07
Nfkbiz	1.00E+00	−0.17	1.07E−03	0.20	3.50E−01
Fosl2	1.00E+00	−0.70	4.61E−36	0.14	6.91E−01
Crem	1.00E+00	−0.94	1.07E−66	0.46	3.59E−05
Ccdc85b	1.00E+00	0.06	4.76E−01	−0.25	1.73E−01
Fos	8.71E−01	−1.04	1.20E−32	0.53	4.09E−02
Gpr183	1.00E+00	0.21	5.21E−06	−0.09	8.27E−01
S100a4	8.76E−01	1.53	2.23E−210	0.10	6.18E−01
1110008f13rik	1.00E+00	0.32	2.97E−13	0.06	9.31E−01
Lsp1	1.00E+00	0.61	9.93E−121	−0.20	7.10E−04
Litaf	9.15E−01	−0.23	6.76E−04	0.29	1.70E−01
Cd7	2.19E−05	0.76	1.54E−22	−1.10	2.81E−13
Dusp2	2.07E−01	0.22	2.20E−03	−0.21	5.56E−01
Plac8	8.71E−02	0.32	8.98E−09	−1.00	1.74E−25
H1f0	9.15E−01	0.39	4.24E−09	−0.57	2.68E−04
S1pr1	9.15E−01	0.88	1.61E−61	−0.15	6.60E−01
Ncf4	1.00E+00	0.62	2.05E−37	−0.29	6.51E−02
Smim3	1.00E+00	−0.11	1.78E−01	0.23	4.28E−01
Tesc	1.00E+00	−0.34	4.70E−12	0.04	1.00E+00
Rbms1	1.00E+00	0.29	7.80E−10	−0.15	5.25E−01
Lpxn	1.00E+00	−0.04	6.22E−01	−0.21	9.69E−02
Tnfrsf9	9.15E−01	−0.34	8.09E−06	0.13	9.01E−01
Pmm1	1.00E+00	0.14	5.91E−02	−0.09	9.31E−01
Tob2	1.00E+00	−0.75	9.68E−37	−0.03	1.00E+00
Ifng	9.15E−01	−0.11	4.38E−01	0.25	4.83E−01
Cd226	1.00E+00	0.22	3.24E−04	−0.35	7.33E−02
Ctsw	1.00E+00	0.41	2.35E−33	−0.40	1.07E−08
Itga4	9.15E−01	0.40	1.49E−15	−0.41	2.71E−03
Cd28	1.00E+00	0.08	6.50E−02	0.29	5.47E−05
Klf2	5.50E−01	1.25	4.15E−91	−0.23	2.36E−01
Ly6c2	8.72E−01	1.60	2.37E−58	0.29	6.52E−01
Ccr9	5.15E−07	−0.39	8.08E−05	−0.87	4.80E−06
Ets1	1.00E+00	−0.13	1.64E−05	−0.16	9.20E−02
Il7r	8.46E−01	0.14	5.94E−03	−0.35	7.68E−04
Ptpn22	6.92E−01	−0.12	2.54E−03	−0.03	1.00E+00
Gm12840	1.00E+00	0.09	3.27E−01	−0.59	7.30E−07
Zfp36l1	8.94E−01	−0.35	2.80E−10	−0.11	7.89E−01
Atxn2l	1.00E+00	0.01	8.67E−01	0.02	1.00E+00
Pde4b	1.00E+00	−0.05	4.58E−01	−0.04	1.00E+00
Selp	1.00E+00	0.01	5.37E−01	0.03	5.25E−01
Anxa6	1.00E+00	0.48	6.74E−49	0.01	1.00E+00
Peli1	1.00E+00	0.00	9.94E−01	0.18	2.36E−01
Odc1	1.00E+00	−1.00	1.42E−103	0.78	1.42E−15
Pglyrp1	1.00E+00	1.21	4.44E−123	−0.34	1.61E−02
Pim3	1.00E+00	−0.48	3.57E−14	0.29	2.16E−01
Pim1	7.90E−02	−0.11	1.68E−02	0.38	1.17E−07
Mt1	9.15E−01	0.69	2.54E−19	−0.66	4.42E−03
Stat3	1.00E+00	−0.26	1.03E−07	0.19	3.44E−01
Stat5a	1.00E+00	−0.11	1.64E−01	0.16	7.24E−01
Vmp1	6.99E−01	−0.01	9.62E−01	−0.27	6.92E−02
Ier2	1.00E+00	0.21	2.69E−07	−0.03	1.00E+00
Tnip1	1.00E+00	0.13	3.16E−02	0.14	6.52E−01
Timp1	1.00E+00	0.00	5.52E−01	0.00	1.00E+00
Amdhd1	1.00E+00	0.01	6.41E−01	−0.02	1.00E+00
Rora	1.00E+00	0.12	9.23E−03	0.16	2.68E−01
Gm5111	1.00E+00	0.01	5.23E−01	−0.04	5.70E−01
Fermt3	1.00E+00	0.19	2.35E−04	−0.31	2.58E−02
Dap	7.71E−01	0.15	1.25E−02	−0.34	3.38E−02
Hist1h1c	1.00E+00	0.52	2.52E−16	−0.37	9.01E−02
Cfl1	2.14E−01	0.15	5.96E−13	0.02	1.00E+00
Ipmk	1.00E+00	−0.36	1.89E−08	0.16	6.84E−01
Klrd1	2.07E−01	1.28	3.41E−111	−0.26	1.92E−01
Gfi1	9.92E−01	−0.01	9.97E−01	−0.11	8.05E−01
S100a6	1.00E+00	1.20	1.69E−261	0.06	8.25E−01
Rorc	1.00E+00	−0.11	3.02E−04	−0.02	9.31E−01
Stat4	1.00E+00	−0.28	2.49E−08	0.25	1.02E−01
Fdps	1.00E+00	−0.09	2.97E−01	0.06	1.00E+00
Gpr65	1.00E+00	−0.33	1.74E−07	0.02	1.00E+00
Rapgef6	1.00E+00	−0.02	8.37E−01	−0.07	9.35E−01
Tmem160	1.00E+00	0.27	2.30E−12	−0.02	1.00E+00
Rasgrp1	1.00E+00	−0.39	6.41E−14	−0.07	9.31E−01
Pnkd	9.15E−01	0.08	2.94E−01	−0.11	8.44E−01
Ccnd3	1.00E+00	0.41	1.47E−21	0.28	1.64E−02
Panx1	1.00E+00	0.20	5.88E−04	−0.06	1.00E+00
Thap11	9.15E−01	0.15	1.28E−02	−0.22	3.96E−01
Lysmd2	1.00E+00	−0.01	8.99E−01	−0.34	8.45E−02
Ubac2	1.00E+00	0.03	7.34E−01	−0.21	2.85E−01
Lgals3	9.15E−01	1.40	2.98E−233	0.23	2.11E−02
Cyb5r4	1.00E+00	0.32	4.83E−11	−0.07	9.31E−01
Upf3a	1.00E+00	0.12	9.45E−02	−0.39	1.19E−02
Gm10076	1.00E+00	−0.09	8.50E−02	−1.04	8.24E−36
Ccdc69	1.00E+00	0.08	3.35E−01	−0.10	8.77E−01
Ccl5	3.77E−04	0.81	6.76E−48	−1.13	1.94E−20
Gramd3	9.26E−01	0.42	2.99E−26	−0.21	5.32E−02
Errfi1	1.00E+00	−0.25	4.81E−04	0.26	2.86E−01
Itgae	2.78E−03	0.27	2.71E−04	−0.82	6.06E−08
Il2ra	1.00E+00	0.03	7.88E−01	0.22	5.25E−01
Gpx4	1.00E+00	−0.35	2.78E−26	0.11	5.10E−01
Ndfip1	1.00E+00	−0.14	2.09E−03	0.14	4.52E−01
Syt11	1.00E+00	0.10	2.17E−01	−0.05	1.00E+00
Dph5	9.15E−01	−0.02	7.93E−01	0.11	8.35E−01
Slc39a8	9.15E−01	−0.07	2.01E−01	−0.08	7.03E−01
Rnf187	1.00E+00	−0.11	5.11E−02	0.02	1.00E+00
Fam53b	1.00E+00	0.19	2.10E−03	0.04	1.00E+00
Prdx5	9.15E−01	−0.07	2.29E−01	0.11	6.80E−01
Ccrl2	5.56E−01	−0.15	8.31E−02	0.24	4.99E−01
Ep300	1.00E+00	0.06	5.04E−01	−0.13	7.40E−01
Hdac7	1.00E+00	0.02	7.59E−01	−0.28	7.88E−02
Cd6	1.00E+00	−0.05	4.17E−01	−0.23	5.53E−02
Traf3ip2	7.75E−01	0.08	2.19E−01	−0.29	9.01E−02
Gnb2	1.00E+00	0.17	7.24E−07	−0.20	3.37E−02
Tet2	1.00E+00	−0.17	1.02E−02	0.11	8.71E−01
Fam189b	1.00E+00	−0.09	2.93E−01	−0.08	9.31E−01
Skap2	1.00E+00	0.04	6.97E−01	−0.06	1.00E+00
Lgals1	8.36E−01	1.11	0.00E+00	0.30	1.31E−09
Socs1	1.00E+00	−0.29	3.38E−06	0.34	6.39E−02
Itgav	9.15E−01	−0.36	1.44E−09	0.30	1.07E−01
Dnajb4	1.00E+00	−0.31	3.77E−06	0.34	6.08E−02
Cdkn1a	1.00E+00	−0.69	6.69E−31	0.80	2.00E−10
Arhgef2	1.00E+00	0.16	1.31E−02	−0.19	5.25E−01
Dnmt3a	1.00E+00	−0.06	4.56E−01	−0.08	9.31E−01
Jund	8.04E−06	−0.12	1.18E−03	0.68	6.22E−42
Scamp3	1.00E+00	0.09	1.62E−01	−0.09	8.64E−01
Tmem30a	6.80E−01	0.14	1.32E−02	−0.35	7.50E−03
Ash1l	1.00E+00	−0.03	7.62E−01	0.02	1.00E+00
Lsm14a	1.00E+00	0.10	1.22E−01	−0.15	6.13E−01
Slain2	1.00E+00	0.02	8.45E−01	−0.14	6.99E−01
Muc1	1.00E+00	0.11	9.34E−02	0.02	1.00E+00
Adamts14	1.00E+00	0.00	7.34E−01	0.00	1.00E+00
Ptk2b	1.00E+00	0.02	8.39E−01	−0.06	1.00E+00
Stk11	1.00E+00	−0.34	1.06E−11	0.11	8.41E−01
Ccr2	1.00E+00	0.17	2.17E−03	0.11	7.02E−01
Itgal	4.62E−01	0.06	5.02E−01	0.06	9.60E−01
Elf1	9.15E−01	0.01	9.24E−01	0.01	1.00E+00
Ptprc	1.00E+00	0.20	4.24E−12	−0.17	6.25E−02
Rbx1	1.00E+00	0.06	1.77E−01	−0.07	8.72E−01
Traf3ip3	9.74E−01	0.27	6.92E−07	−0.44	1.42E−03
Ccdc88b	1.00E+00	0.10	2.07E−01	0.12	8.72E−01
Tsen34	1.00E+00	−0.01	8.73E−01	−0.08	8.78E−01
Ay036118	1.00E+00	−0.29	8.27E−06	−1.15	3.92E−23
Il24
H2-q10	1.00E+00	−0.07	5.33E−01	0.34	3.05E−02
Scand1	1.00E+00	0.16	8.97E−05	−0.17	2.65E−01
Tab2	1.00E+00	0.14	3.65E−02	0.09	9.31E−01
Nfkb1	1.00E+00	−0.15	5.50E−03	0.14	5.92E−01
Rusc1	1.00E+00	0.13	5.06E−02	−0.09	9.12E−01
Esyt1	1.00E+00	0.48	8.09E−24	−0.13	6.89E−01
Commd7	9.96E−01	0.04	6.83E−01	−0.10	9.01E−01
Rfng	1.00E+00	0.01	9.19E−01	−0.19	4.61E−01
Rpl27-ps3	2.26E−01	−0.28	1.77E−10	−1.05	8.09E−50
Gigyf1	1.00E+00	−0.10	1.28E−01	−0.11	7.49E−01
Rgcc	6.43E−01	0.04	7.34E−01	1.71	1.89E−45
Rpl3	9.15E−01	−0.02	4.86E−01	−0.15	2.99E06
Mrpl20	1.00E+00	0.16	1.55E−03	−0.03	1.00E+00
Gm2a	1.00E+00	−0.21	3.51E−05	0.15	5.25E−01
Mus81	1.00E+00	0.13	1.54E−02	−0.03	1.00E+00
Lpp	1.00E+00	0.06	3.71E−01	−0.18	5.12E−01
Chp1	9.15E−01	0.16	4.42E−03	0.00	1.00E+00
Mob4	1.00E+00	0.11	5.09E−02	0.10	8.35E−01
Lamp1	1.00E+00	−0.06	4.76E−01	−0.03	1.00E+00
Phf5a	1.00E+00	0.16	2.65E−03	−0.24	1.51E−01
Fnip1	1.00E+00	0.11	8.89E−02	−0.01	1.00E+00
Calm3	1.00E+00	−0.05	4.72E−01	0.08	8.45E−01
Lrp10	1.00E+00	0.13	2.73E−02	−0.14	5.81E−01
Stat5b	1.00E+00	−0.12	1.09E−01	0.02	1.00E+00
Bach2	1.00E+00	−0.04	4.97E−01	−0.04	1.00E+00
Prkab1	1.00E+00	−0.02	8.52E−01	0.27	1.41E−01
Hvcn1	9.15E−01	−0.18	5.47E−03	0.21	4.56E−01
Tmem150a	1.00E+00	0.01	5.10E−01	−0.01	1.00E+00
Nfkbia	1.00E+00	0.22	5.16E−08	0.27	1.43E−03
Ifitm3	1.00E+00	1.07	9.58E−66	0.02	1.00E+00
Egfp_ires_il23r
Bad	1.00E+00	0.15	1.86E−02	−0.05	1.00E+00
Zbtb46	1.00E+00	0.10	2.77E−02	−0.08	8.94E−01
Cacna1s	1.00E+00	−0.05	2.78E−01	−0.01	1.00E+00
Vamp3	1.00E+00	0.15	1.23E−02	0.05	1.00E+00
Fyn	1.00E+00	−0.06	4.94E−01	−0.06	9.32E−01
Stx6	1.00E+00	−0.25	1.19E−05	−0.05	1.00E+00
Ikzf3	1.00E+00	−0.24	5.66E−04	0.17	6.73E−01
Mgat2	1.00E+00	0.17	1.12E−03	0.16	5.10E−01
Serpinb9	9.50E−01	0.26	8.45E−06	−0.35	9.55E−03
Dennd1b	9.15E−01	−0.02	8.68E−01	−0.16	5.86E−01
Bloc1s4	1.00E+00	0.00	9.85E−01	0.18	5.25E−01
Anxa1	1.00E+00	1.20	1.76E−91	0.79	2.26E−09
Smad3	1.00E+00	0.15	1.68E−02	0.01	1.00E+00
Tmem258	1.00E+00	−0.02	7.37E−01	0.06	9.31E−01
Lmna	8.60E−04	0.20	1.46E−02	1.94	1.16E−69
Sp140	1.00E+00	0.15	2.19E−02	−0.23	3.43E−01
Actn2	1.00E+00	0.15	3.07E−02	−0.56	2.95E−05
Acbd6	1.00E+00	0.01	8.54E−01	−0.20	4.30E−01
Ahnak	1.00E+00	0.50	1.39E−39	0.16	3.54E−01
Arpc2	1.00E+00	0.16	4.07E−15	−0.02	9.72E−01
Erp29	1.00E+00	0.19	6.28E−04	−0.03	1.00E+00
Nhp2l1	1.00E+00	−0.23	1.13E−09	0.19	1.40E−01
Ctbp1	1.00E+00	0.03	6.83E−01	−0.35	1.72E−03
Gba	1.00E+00	0.11	9.45E−02	−0.20	4.53E−01
Lztfl1	9.59E−01	−0.32	1.88E−07	−0.56	2.81E−04
Ptpn2	1.00E+00	0.04	6.83E−01	−0.13	7.03E−01
Usp36	1.00E+00	−0.15	4.22E−02	−0.16	6.31E−01
Grb7	9.96E−01	−0.19	4.07E−04	0.15	5.18E−01
Fndc3a	9.96E−01	−0.03	7.34E−01	0.08	9.31E−01
Mt2	9.78E−01	0.41	1.92E−10	−0.40	3.25E−01
Dctn4	9.15E−01	0.03	7.34E−01	0.05	1.00E+00
Nusap1	1.00E+00	−0.43	6.53E−13	0.12	4.14E−01
Rbm22	1.00E+00	0.16	1.75E−03	−0.19	3.93E−01
Crip1	1.00E+00	1.16	3.21E−287	0.54	9.93E−22
Anp32b	1.00E+00	−0.20	1.65E−05	0.14	5.25E−01
Aurkaip1	1.00E+00	0.04	6.22E−01	0.04	1.00E+00
Ripk2	1.00E+00	0.21	1.59E−04	−0.15	6.84E−01
Nubp1	1.00E+00	0.12	6.45E−02	−0.28	1.17E−01
Camta1	1.00E+00	−0.05	5.65E−01	−0.08	9.33E−01
Ube2j2	1.00E+00	0.05	4.56E−01	−0.04	1.00E+00
Kif3b	9.15E−01	0.00	9.36E−01	−0.09	7.23E−01
Brap	1.00E+00	−0.08	3.33E−01	−0.04	1.00E+00
Gm8096
Ermn	1.00E+00	−0.10	4.16E−01	−0.13	9.31E−01
Plagl2	1.00E+00	−0.05	5.51E−01	−0.10	8.23E−01
Plek	1.00E+00	0.44	1.16E−12	0.01	1.00E+00
D030056l22rik	1.00E+00	−0.29	3.39E−06	0.22	3.86E−01
Ccr1	7.11E−01	−0.20	1.53E−03	0.17	4.25E−01
Krtcap2	5.81E−03	0.14	3.21E−06	0.31	3.46E−07
Sh2b1	1.00E+00	0.01	8.91E−01	−0.13	8.16E−01
Abi3	9.96E−01	−0.51	3.25E−16	−0.12	8.68E−01
Ccnl2	1.00E+00	0.06	4.38E−01	−0.02	1.00E+00
Kbtbd7	1.00E+00	0.03	4.57E−01	0.06	8.26E−01
Csf2	1.00E+00	0.07	7.09E−01	0.43	1.96E−02
Pycard	9.15E−01	0.82	8.39E−90	−0.55	3.15E−10
Dock7	1.00E+00	0.00	6.83E−01	0.00	1.00E+00
Herpud1	2.44E−01	0.06	4.49E−01	0.22	1.99E−01
Arf6	1.00E+00	0.12	1.50E−03	0.22	1.95E−02
Zyx	1.00E+00	0.87	1.51E−71	−0.22	2.86E−01
Zfp91	1.00E+00	−0.04	6.57E−01	0.09	9.35E−01
Fam171b	1.00E+00	0.02	5.51E−01	0.02	1.00E+00
Maml2	1.00E+00	0.12	7.23E−02	0.02	1.00E+00
Ifngr2	1.00E+00	−0.22	6.48E−06	0.04	1.00E+00
Bhlhe40	9.15E−01	0.12	1.44E−04	0.18	7.29E−03
Cisd1	1.00E+00	−0.01	8.15E−01	0.07	9.58E−01
Zfp420	7.11E−01	−0.01	7.62E−01	0.02	1.00E+00
Zc3h12a	1.00E+00	0.11	6.00E−02	0.46	2.45E−06
Plcg2	9.15E−01	0.08	1.03E−02	−0.07	8.19E−01
2310036o22rik	1.00E+00	0.03	6.28E−01	−0.11	6.52E−01
Eif3c	1.00E+00	0.11	4.69E−02	−0.06	9.31E−01
Slc15a3	1.00E+00	−0.18	1.93E−02	−0.01	1.00E+00
Acap3	1.00E+00	0.10	4.53E−02	0.13	6.52E−01
Tef	1.00E+00	0.02	7.34E−01	0.18	4.17E−01
Emp3	1.00E+00	0.93	4.59E−187	0.05	9.01E−01
Ssr2	1.00E+00	0.06	5.51E−01	−0.06	9.83E−01
Usp1	1.00E+00	−0.10	1.51E−01	0.18	5.37E−01
Rpl10-ps3	1.00E+00	−0.25	1.60E−07	−0.89	5.90E−25
Plcxd2	1.00E+00	−0.30	1.20E−06	−0.42	9.75E−03
Adcy7	1.00E+00	0.03	7.34E−01	−0.06	9.85E−01
Irf1	1.00E+00	0.07	4.01E−01	0.43	1.05E−03
Aamp	1.00E+00	−0.10	7.72E−02	0.06	9.31E−01
Gm8730	5.54E−06	0.05	1.49E−01	−0.78	1.16E−56
Zgpat	1.00E+00	0.03	6.95E−01	−0.18	5.25E−01
St13	9.15E−01	−0.30	3.36E−10	0.29	4.51E−02
Cdc42se2	9.52E−01	−0.01	8.95E−01	−0.06	9.35E−01
Anxa2	9.15E−01	0.69	3.68E−70	0.35	1.11E−04
Cpsf3l	1.00E+00	0.09	2.85E−01	−0.04	1.00E+00
Gm2000	8.76E−01	−0.23	7.20E−07	−0.84	1.60E−23
Trim46	1.00E+00	0.08	4.53E−02	−0.06	9.31E−01
Dusp16	1.00E+00	0.02	6.23E−01	−0.03	1.00E+00
Zmat5	1.00E+00	0.05	5.51E−01	−0.04	1.00E+00
Ptprk	1.00E+00	0.06	5.33E−01	−0.18	5.86E−01
Zdhhc7	8.47E−01	0.15	1.69E−02	0.13	7.72E−01
Il2	8.72E−01	−0.23	8.82E−04	0.01	1.00E+00
Msto1	1.00E+00	0.02	7.46E−01	−0.14	5.96E−01
Il10	1.00E+00	−0.26	2.62E−05	−0.02	1.00E+00
Sbno2	1.00E+00	0.03	6.75E−01	−0.11	6.35E−01
Snx17	1.00E+00	−0.02	8.03E−01	−0.26	1.84E−01
Kif11	1.00E+00	−0.13	8.65E−06	−0.10	3.77E−01
Ndfip2	1.00E+00	0.07	3.33E−01	−0.07	9.31E−01
Card9	9.96E−01	−0.01	7.34E−01	0.02	5.25E−01
Lsm4	9.15E−01	0.02	7.43E−01	−0.12	5.91E−01
Ormdl3	9.96E−01	−0.22	4.71E−04	−0.04	1.00E+00
S100a10	5.39E−01	0.71	2.92E−237	0.06	6.52E−01
Notch2	1.00E+00	−0.14	3.79E−02	0.02	1.00E+00
Senp7	1.00E+00	0.00	9.90E−01	−0.12	8.32E−01
Cd48	1.00E+00	0.80	2.02E−100	−0.29	2.03E−03
Ssbp4	1.00E+00	0.13	1.85E−02	0.14	5.70E−01
Cul1	1.00E+00	−0.05	5.74E−01	−0.09	9.31E−01
Mettl10	1.00E+00	0.11	1.33E−01	0.05	1.00E+00
Rabep2	1.00E+00	0.10	1.23E−01	−0.08	9.31E−01
Pkig	4.59E−01	−0.09	4.74E−02	0.10	7.03E−01
Desi1	1.00E+00	−0.04	6.83E−01	−0.15	6.87E−01
Furin	5.16E−01	−0.61	7.81E−32	0.43	2.07E−04
Tcof1	1.00E+00	−0.05	6.22E−01	−0.01	1.00E+00
Glipr2	1.00E+00	0.84	2.28E−92	−0.01	1.00E+00
Tgfbr3	1.00E+00	−0.05	4.97E−01	−0.05	9.06E−01
Tyk2	4.66E−01	0.07	3.28E−01	−0.03	1.00E+00
Kif21b	1.00E+00	0.00	9.79E−01	−0.07	9.62E−01
Tufm	1.00E+00	0.02	7.86E−01	0.01	1.00E+00
Zmiz1	1.00E+00	0.05	5.75E−01	−0.24	3.12E−01
Il21	1.00E+00	−0.13	8.93E−04	0.04	8.72E−01
Ttpal	1.00E+00	0.05	5.37E−01	−0.04	1.00E+00
Rps6kb1	7.31E−01	−0.10	1.94E−01	0.03	1.00E+00
Camk2g	1.00E+00	0.07	4.32E−01	−0.14	7.13E−01
Tom1	1.00E+00	0.07	3.82E−01	−0.05	9.90E−01
Actr1a	1.00E+00	−0.03	7.34E−01	−0.16	6.52E−01
Rgs14	1.00E+00	0.03	7.34E−01	−0.04	1.00E+00
Ublcp1	1.00E+00	0.05	5.51E−01	−0.19	4.10E−01
Otud3	1.00E+00	0.03	6.85E−01	−0.11	7.40E−01
Tmem180	9.15E−01	−0.01	9.00E−01	−0.02	1.00E+00
Ergic1	1.00E+00	−0.17	1.27E−03	0.16	4.65E−01
Aa467197	1.00E+00	0.97	4.55E−86	0.14	6.47E−01
Tdp2	1.00E+00	0.03	7.93E−01	0.27	2.02E−01
Rac1	1.00E+00	0.07	7.04E−02	−0.05	9.27E−01
Phlda3	1.00E+00	0.01	9.18E−01	0.17	3.67E−01
Trmt112	1.00E+00	0.00	9.68E−01	0.02	1.00E+00
Ccny	1.00E+00	−0.07	4.44E−01	−0.11	8.67E−01
Slc43a3	9.15E−01	−0.03	6.07E−01	−0.14	4.53E−01
Ezh2	1.00E+00	−0.27	4.40E−06	−0.08	9.31E−01
Rps14	1.00E+00	−0.06	7.47E−06	0.00	1.00E+00
Spred2	1.00E+00	−0.05	4.68E−01	−0.01	1.00E+00
Rn7s2
Rn7s1
Rpap2	1.00E+00	−0.02	7.66E−01	−0.14	5.25E−01
Cit	1.00E+00	−0.08	4.93E−03	0.21	3.02E−01
Ascc2	1.00E+00	0.04	6.64E−01	−0.06	9.35E−01
Ksr1	1.00E+00	0.06	2.37E−01	−0.09	8.29E−01
Edem2	1.00E+00	0.02	7.93E−01	−0.06	1.00E+00
Blzf1	1.00E+00	0.02	8.41E−01	−0.04	1.00E+00
Ppp5c	1.00E+00	0.00	9.71E−01	0.08	9.31E−01
Smurf1	9.15E−01	0.02	7.34E−01	−0.18	2.27E−01
Nop9	1.00E+00	−0.01	9.08E−01	−0.23	3.48E−01
Slc30a7	1.00E+00	0.09	1.87E−01	−0.02	1.00E+00
Tnfrsf8	1.00E+00	−0.01	6.87E−01	−0.02	9.96E−01
Adcy3	1.00E+00	−0.01	8.94E−01	−0.08	8.75E−01
Pdcd1	1.00E+00	−0.01	9.71E−01	0.37	1.36E−01
Fen1	1.00E+00	−0.21	2.53E−04	0.04	1.00E+00
Themis	9.15E−01	−0.02	8.61E−01	0.07	9.31E−01
Nudt22	1.00E+00	0.01	9.16E−01	0.07	9.33E−01
Cyth1	1.00E+00	−0.02	8.30E−01	0.07	9.53E−01
Tmbim1	9.15E−01	−0.01	9.43E−01	−0.02	1.00E+00
Ndufaf1	1.00E+00	0.04	6.31E−01	−0.09	8.87E−01
Klrc1	8.76E−01	0.87	4.48E−57	0.28	3.82E−02
Pomc	9.15E−01	0.03	6.62E−01	−0.18	1.32E−01
Cpeb4	8.76E−01	−0.04	5.59E−01	0.04	9.44E−01
Cul2	1.00E+00	−0.11	9.35E−02	0.02	1.00E+00
Hgfac	1.00E+00	0.03	2.80E−02	0.00	1.00E+00
Pofut1	1.00E+00	−0.10	6.46E−02	0.02	1.00E+00
Clasp2	1.00E+00	−0.04	4.34E−01	−0.01	1.00E+00
Nme7	3.48E−01	0.04	5.71E−01	−0.04	9.97E−01
Ndst1	1.00E+00	−0.03	4.51E−01	0.01	1.00E+00
Gpr137	1.00E+00	0.02	6.96E−01	−0.03	1.00E+00
Ncoa5	1.00E+00	−0.05	4.56E−01	−0.16	3.19E−01
Mapkapk5	1.00E+00	0.02	6.95E−01	0.01	1.00E+00
Auh	1.00E+00	−0.04	6.83E−01	−0.21	4.42E−01
Gpx3	1.00E+00	−0.01	7.93E−01	0.04	9.02E−01
Tmem116	1.00E+00	0.03	4.43E−02	0.01	1.00E+00
Hint1	1.00E+00	−0.05	2.86E−01	0.03	9.94E−01
Mtmr3	1.00E+00	−0.04	6.89E−01	0.04	1.00E+00
Ube2l3	1.00E+00	0.04	5.15E−01	0.01	1.00E+00
Il23r	1.00E+00	−0.06	3.06E−02	0.01	1.00E+00
Asb2	1.01E−01	−0.82	1.21E−45	0.23	4.53E−01
Snx32	1.00E+00	0.03	4.97E−01	0.02	1.00E+00
Fgfr1op	1.00E+00	−0.07	2.95E−01	−0.05	1.00E+00
Ccl2	1.00E+00	−0.02	6.93E−01	0.01	1.00E+00
Slc16a10	1.00E+00	−0.04	1.79E−01	−0.06	5.37E−01
Batf	1.00E+00	0.19	1.01E−04	−0.08	9.31E−01
Trpt1	9.96E−01	−0.01	9.76E−01	0.02	1.00E+00
Jazf1	1.00E+00	−0.02	7.34E−01	−0.05	8.91E−01
Tubd1	1.00E+00	−0.03	3.98E−01	−0.02	1.00E+00
Rtel1	1.00E+00	0.05	3.81E−01	−0.08	8.67E−01
Srm	9.15E−01	−0.06	3.16E−01	0.06	9.41E−01
Thada	8.76E−01	−0.23	1.60E−07	−0.03	9.94E−01
Tppp	9.15E−01	0.00	9.14E−01	0.10	5.10E−01
Ppp4c	1.00E+00	0.16	7.01E−05	−0.14	4.53E−01
Per3	1.00E+00	−0.09	1.74E−03	−0.01	1.00E+00
Hormad2	1.00E+00	−0.03	9.85E−02	−0.02	5.72E−01
Gm20186	1.00E+00	−0.20	8.04E−03	−0.45	5.31E−03
Ccdc122	1.00E+00	0.01	4.72E−01	−0.03	8.72E−01
Fasl	1.00E+00	0.19	2.41E−04	0.35	1.76E−03
Sh2d2a	5.39E−01	−0.13	6.69E−03	−0.24	5.78E−02
Atp6v0a1	1.00E+00	−0.01	7.06E−01	0.02	9.94E−01
Fosl1	1.00E+00	−0.01	5.87E−01	−0.01	9.31E−01
Itgb8	1.00E+00	−0.01	6.74E−01	−0.01	9.31E−01
Amz1	9.15E−01	0.00	8.96E−01	0.03	8.33E−01
Cxcl5	1.00E+00	0.00	6.83E−01	−0.01	9.31E−01
Nkx2-3	1.00E+00	0.00	9.18E−01	0.05	2.36E−01
Thbs3	1.00E+00	−0.01	1.82E−01	0.00	1.00E+00
Pf4	1.00E+00	−0.02	7.34E−01	−0.01	1.00E+00
Ephx4	1.00E+00	0.00	9.01E−01	0.00	1.00E+00
Osmr	1.00E+00	0.00	4.97E−01	0.00	1.00E+00
Ccl11	1.00E+00	−0.01	2.61E−01	0.00	1.00E+00
Fndc4	1.00E+00	−0.01	2.98E−01	0.00	1.00E+00
Ccl7	1.00E+00	−0.01	2.61E−01	0.00	1.00E+00
Ptrf	1.00E+00	0.01	6.89E−01	0.02	7.31E−01
Mei1	1.00E+00	0.00	4.97E−01	0.00	1.00E+00
Lamb1	1.00E+00	0.00	4.20E−01	0.00	1.00E+00
	Gene	logFC_LPL_TissueDE	FDRLPL_TissueDE	LPL_Geno_logFc	LPLGeno_FDR
	Gpr18	0.96	1.73E−191	−0.43	2.85E−23
	Gzmb	1.73	0.00E+00	−0.07	3.72E−01
	Itgb1	−2.90	0.00E+00	−0.02	8.68E−01
	Ccr3	−0.01	1.50E−01	0.01	3.64E−01
	Gzma	0.25	3.52E−05	−1.55	6.24E−128
	Il22	2.34	1.69E−284	0.09	5.63E−01
	Zfp36l2	1.28	0.00E+00	−0.77	1.26E−128
	Zbtb38	−0.02	7.35E−01	−0.21	4.35E−07
	Cd74	0.47	2.30E−23	0.35	1.00E−07
	Ccr5	1.14	4.43E−273	−0.19	4.51E−06
	Cd160	0.54	3.27E−37	−1.38	3.92E−160
	Map3k8	1.57	0.00E+00	−0.05	2.66E−01
	Tnfsf8	2.00	0.00E+00	0.25	1.80E−07
	Ifitm1	−1.25	2.03E−53	0.27	7.06E−02
	Nfkbiz	2.36	0.00E+00	0.24	1.85E−13
	Fosl2	2.34	0.00E+00	0.42	1.93E−30
	Crem	3.18	0.00E+00	0.87	1.52E−146
	Ccdc85b	−0.08	3.66E−03	−0.31	1.45E−22
	Fos	1.94	0.00E+00	0.90	3.74E−58
	Gpr183	1.35	0.00E+00	0.03	5.64E−01
	S100a4	−1.82	0.00E+00	−0.71	9.86E−65
	1110008f13rik	−0.29	3.34E−38	−0.02	7.17E−01
	Lsp1	−0.86	0.00E+00	−0.41	5.73E−94
	Litaf	1.61	0.00E+00	0.31	5.15E−14
	Cd7	−0.36	9.57E−25	−1.40	5.09E−150
	Dusp2	−0.23	8.06E−13	−0.42	2.72E−20
	Plac8	1.58	0.00E+00	−0.29	8.95E−15
	H1f0	0.30	2.02E−17	−0.75	1.19E−64
	S1pr1	−0.73	1.05E−149	−0.42	4.66E−22
	Ncf4	−0.29	2.67E−26	−0.29	6.15E−15
	Smim3	1.46	0.00E+00	0.20	2.60E−06
	Tesc	0.47	2.25E−70	0.09	1.66E−02
	Rbms1	−0.42	3.83E−72	−0.18	1.11E−07
	Lpxn	0.97	0.00E+00	−0.04	2.29E−01
	Tnfrsf9	1.37	6.99E−304	0.50	1.36E−26
	Pmm1	−0.02	5.25E−01	−0.15	2.31E−04
	Tob2	1.32	0.00E+00	0.38	7.86E−22
	Ifng	1.69	0.00E+00	0.45	4.62E−16
	Cd226	−0.30	8.07E−26	−0.23	6.66E−08
	Ctsw	0.32	2.47E−57	−0.35	3.78E−45
	Itga4	−0.39	1.20E−42	−0.44	9.68E−35
	Cd28	1.08	0.00E+00	0.11	1.52E−06
	Klf2	−1.77	0.00E+00	−0.71	1.06E−46
	Ly6c2	−2.35	0.00E+00	−0.04	8.54E−01
	Ccr9	0.97	9.81E−132	−0.93	5.85E−62
	Ets1	0.87	0.00E+00	0.03	1.65E−01
	Il7r	−0.06	6.14E−02	−0.48	7.56E−56
	Ptpn22	1.18	0.00E+00	−0.14	5.52E−08
	Gm12840	2.19	0.00E+00	−0.09	5.83E−02
	Zfp36l1	1.17	0.00E+00	−0.19	8.62E−07
	Atxn2l	0.07	2.08E−02	0.01	8.40E−01
	Pde4b	2.14	0.00E+00	−0.02	6.98E−01
	Selp	0.00	2.17E−01	0.00	9.89E−01
	Anxa6	−0.83	0.00E+00	−0.20	3.31E−15
	Peli1	0.92	0.00E+00	0.12	2.03E−05
	Odc1	3.27	0.00E+00	0.72	2.42E−135
	Pglyrp1	−1.58	0.00E+00	−0.70	2.94E−61
	Pim3	1.12	2.33E−266	0.33	3.82E−14
	Pim1	2.65	0.00E+00	0.14	3.43E−07
	Mt1	0.65	1.10E−60	−0.23	8.28E−05
	Stat3	1.08	0.00E+00	0.50	5.92E−61
	Stat5a	0.47	7.41E−57	0.24	1.92E−09
	Vmp1	0.51	1.96E−93	−0.22	2.35E−11
	Ier2	0.43	6.68E−88	−0.02	5.61E−01
	Tnip1	0.77	2.23E−173	0.22	1.10E−10
	Timp1	0.00	5.92E−02	0.00	4.94E−01
	Amdhd1	0.00	7.11E−01	0.00	8.98E−01
	Rora	1.63	0.00E+00	0.12	3.53E−05
	Gm5111	0.01	7.54E−02	−0.02	6.99E−03
	Fermt3	−0.46	4.11E−84	−0.36	5.96E−27
	Dap	−0.33	2.26E−36	−0.28	2.10E−15
	Hist1h1c	1.90	0.00E+00	−0.48	4.45E−25
	Cfl1	−0.48	0.00E+00	−0.14	3.20E−22
	Ipmk	0.92	4.46E−219	0.27	5.98E−10
	Klrd1	−1.07	1.81E−199	−0.34	2.65E−12
	Gfi1	−0.01	7.95E−01	−0.09	7.38E−02
	S100a6	−1.05	0.00E+00	−0.50	2.02E−69
	Rorc	0.02	2.72E−01	−0.07	3.21E−03
	Stat4	0.87	7.48E−245	0.35	3.64E−28
	Fdps	−0.05	1.34E−01	−0.15	1.10E−03
	Gpr65	0.86	4.47E−166	0.17	1.39E−04
	Rapgef6	0.41	8.06E−51	−0.10	1.05E−02
	Tmem160	−0.11	6.65E−08	−0.20	8.36E−13
	Rasgrp1	0.84	1.94E−202	0.12	2.14E−03
	Pnkd	−0.24	4.02E−19	−0.21	3.09E−08
	Ccnd3	−1.12	0.00E+00	0.02	7.93E−01
	Panx1	−0.17	1.23E−09	0.01	8.01E−01
	Thap11	−0.29	2.70E−26	−0.13	6.17E−04
	Lysmd2	0.09	1.88E−03	−0.25	2.67E−09
	Ubac2	0.29	3.46E−29	−0.17	2.34E−06
	Lgals3	−0.30	1.46E−24	0.05	3.04E−01
	Cyb5r4	−0.50	2.63E−95	−0.29	9.44E−17
	Upf3a	0.02	5.65E−01	−0.34	8.61E−21
	Gm10076	0.20	5.88E−17	−0.69	1.02E−153
	Ccdc69	−0.49	4.22E−76	−0.18	1.53E−07
	Ccl5	0.23	5.28E−10	−0.50	1.70E−33
	Gramd3	1.92	0.00E+00	−0.22	1.66E−13
	Errfi1	0.75	2.26E−126	0.43	1.84E−24
	Itgae	0.83	3.08E−116	−1.03	1.01E−109
	Il2ra	0.74	2.94E−134	0.22	9.64E−07
	Gpx4	0.72	0.00E+00	0.22	6.61E−24
	Ndfip1	0.72	8.87E−237	0.19	8.28E−12
	Syt11	−0.61	4.65E−99	−0.11	1.72E−02
	Dph5	−0.39	2.02E−42	0.06	2.10E−01
	Slc39a8	0.08	6.23E−05	0.01	8.96E−01
	Rnf187	−0.15	1.19E−11	−0.05	2.23E−01
	Fam53b	−0.83	4.51E−193	−0.14	1.68E−03
	Prdx5	0.37	1.56E−69	0.12	4.74E−05
	Ccrl2	0.67	3.95E−127	0.14	2.06E−02
	Ep300	−0.06	4.74E−02	0.00	9.89E−01
	Hdac7	−0.21	2.97E−15	−0.10	1.22E−02
	Cd6	0.21	1.47E−23	−0.04	3.00E−01
	Traf3ip2	−0.30	2.68E−31	−0.09	2.46E−02
	Gnb2	−0.28	9.03E−64	−0.25	5.08E−28
	Tet2	0.66	2.79E−130	0.14	6.32E−04
	Fam189b	−0.31	1.60E−32	−0.07	1.12E−01
	Skap2	−0.02	4.09E−01	−0.13	1.54E−03
	Lgals1	−1.15	0.00E+00	−0.17	1.87E−14
	Socs1	0.64	5.14E−93	0.46	3.55E−32
	Itgav	0.64	5.62E−112	0.24	8.61E−09
	Dnajb4	0.63	7.45E−98	0.38	1.46E−19
	Cdkn1a	2.23	0.00E+00	0.77	1.83E−88
	Arhgef2	−0.77	1.60E−174	−0.23	6.78E−10
	Dnmt3a	−0.20	1.16E−14	−0.11	3.41E−03
	Jund	2.11	0.00E+00	0.61	1.37E−184
	Scamp3	−0.26	1.01E−30	−0.23	3.47E−13
	Tmem30a	−0.08	2.09E−03	−0.35	1.16E−26
	Ash1l	−0.29	2.45E−23	−0.05	2.62E−01
	Lsm14a	−0.33	4.06E−43	−0.26	1.10E−14
	Slain2	−0.04	1.61E−01	−0.06	2.29E−01
	Muc1	0.38	1.56E−88	0.16	8.62E−06
	Adamts14	0.00	4.18E−01	0.00	3.99E−01
	Ptk2b	0.09	1.97E−03	0.01	9.09E−01
	Stk11	0.59	2.94E−110	0.28	3.12E−17
	Ccr2	0.23	3.04E−18	0.03	4.65E−01
	Itgal	−0.19	2.04E−14	−0.11	6.79E−03
	Elf1	0.57	2.94E−128	−0.05	1.85E−01
	Ptprc	0.02	2.51E−01	−0.16	3.89E−15
	Rbx1	−0.46	3.93E−187	−0.14	4.63E−09
	Traf3ip3	−0.85	2.40E−253	−0.45	4.63E−34
	Ccdc88b	0.06	3.10E−02	−0.08	9.71E−02
	Tsen34	−0.38	5.90E−55	−0.05	1.20E−01
	Ay036118	0.21	4.92E−12	−0.25	9.09E−11
	Il24
	H2-q10	0.06	5.93E−02	0.34	4.29E−19
	Scand1	0.38	4.88E−74	−0.12	3.10E−05
	Tab2	0.26	1.01E−20	−0.01	8.65E−01
	Nfkb1	0.53	7.48E−97	0.20	7.58E−10
	Rusc1	0.11	1.24E−04	−0.05	3.89E−01
	Esyt1	−0.90	6.87E−301	−0.24	3.30E−11
	Commd7	−0.23	7.48E−19	−0.08	4.85E−02
	Rfng	−0.05	9.05E−02	−0.14	2.09E−05
	Rpl27-ps3	−0.04	8.61E−02	−0.40	1.29E−45
	Gigyf1	−0.02	7.64E−01	−0.03	5.00E−01
	Rgcc	1.58	0.00E+00	1.13	9.68E−131
	Rpl3	0.05	1.55E−11	−0.19	6.04E−99
	Mrpl20	−0.25	3.76E−28	−0.16	1.68E−06
	Gm2a	0.18	5.94E−14	0.01	7.98E−01
	Mus81	−0.25	1.10E−24	−0.13	2.72E−05
	Lpp	−0.08	8.01E−03	−0.05	3.01E−01
	Chp1	0.14	4.48E−07	−0.03	5.50E−01
	Mob4	0.24	4.38E−22	0.00	9.70E−01
	Lamp1	−0.09	1.99E−03	−0.08	6.29E−02
	Phf5a	−0.12	1.13E−06	−0.14	4.68E−05
	Fnip1	0.25	4.48E−27	0.08	5.52E−02
	Calm3	−0.41	2.42E−100	−0.07	2.01E−02
	Lrp10	−0.42	1.30E−69	−0.20	1.15E−08
	Stat5b	0.45	8.98E−58	0.03	5.23E−01
	Bach2	0.00	8.46E−01	−0.02	4.95E−01
	Prkab1	−0.35	6.30E−38	0.08	4.65E−02
	Hvcn1	0.04	1.62E−01	−0.01	8.83E−01
	Tmem150a	0.00	4.94E−01	0.00	9.89E−01
	Nfkbia	2.07	0.00E+00	0.12	8.93E−05
	Ifitm3	−0.83	1.03E−104	−0.28	5.76E−08
	Egfp_ires_il23r
	Bad	−0.41	1.49E−50	−0.13	1.83E−03
	Zbtb46	0.21	2.32E−49	−0.02	7.54E−01
	Cacna1s	0.10	1.50E−12	0.07	5.13E−02
	Vamp3	0.11	1.11E−04	0.00	9.72E−01
	Fyn	−0.07	4.20E−03	−0.03	4.63E−01
	Stx6	0.29	1.07E−25	0.10	1.24E−02
	Ikzf3	0.41	2.25E−36	0.33	4.87E−15
	Mgat2	−0.26	4.37E−28	0.05	3.30E−01
	Serpinb9	1.70	0.00E+00	0.21	1.47E−07
	Dennd1b	−0.03	3.51E−01	−0.04	3.92E−01
	Bloc1s4	0.27	2.06E−22	0.04	3.99E−01
	Anxa1	−1.54	0.00E+00	0.09	2.17E−01
	Smad3	0.10	2.25E−04	−0.01	8.89E−01
	Tmem258	−0.20	4.26E−30	−0.08	3.54E−03
	Lmna	1.99	0.00E+00	1.14	3.52E−154
	Sp140	−0.08	9.86E−03	−0.09	6.70E−02
	Actn2	1.25	0.00E+00	−0.55	1.65E−44
	Acbd6	0.22	5.41E−17	−0.04	4.00E−01
	Ahnak	0.16	3.21E−12	0.09	5.88E−03
	Arpc2	−0.07	4.13E−12	−0.06	2.31E−05
	Erp29	−0.16	2.63E−10	−0.03	5.61E−01
	Nhp2l1	0.37	1.56E−79	0.24	1.76E−23
	Ctbp1	−0.21	4.08E−23	−0.32	5.84E−28
	Gba	−0.08	5.03E−03	−0.13	8.46E−04
	Lztfl1	1.24	0.00E+00	−0.30	3.32E−13
	Ptpn2	0.35	1.25E−39	0.04	4.25E−01
	Usp36	0.35	5.76E−37	0.05	3.77E−01
	Grb7	0.34	2.65E−72	0.17	1.68E−05
	Fndc3a	0.34	2.71E−37	0.09	4.78E−02
	Mt2	0.21	1.44E−13	−0.16	3.94E−05
	Dctn4	0.33	2.12E−33	−0.10	2.80E−02
	Nusap1	−0.73	1.52E−56	−0.33	1.32E−09
	Rbm22	0.03	3.51E−01	−0.07	1.15E−01
	Crip1	−0.76	0.00E+00	0.11	1.42E−04
	Anp32b	−0.48	1.60E−118	−0.19	2.26E−10
	Aurkaip1	−0.26	5.78E−38	−0.05	1.47E−01
	Ripk2	0.36	9.55E−40	0.05	3.16E−01
	Nubp1	−0.12	1.43E−05	−0.37	1.05E−25
	Camta1	0.31	1.48E−28	−0.19	1.30E−06
	Ube2j2	0.30	1.69E−44	0.00	9.68E−01
	Kif3b	−0.10	1.34E−06	−0.03	2.61E−01
	Brap	0.30	4.45E−28	0.01	8.00E−01
	Gm8096
	Ermn	1.01	4.90E−162	−0.05	6.77E−01
	Plagl2	−0.01	8.42E−01	−0.03	4.69E−01
	Plek	−0.25	1.29E−15	0.20	5.12E−05
	D030056l22rik	0.23	5.67E−14	0.18	5.19E−05
	Ccr1	0.28	7.44E−31	0.20	6.92E−06
	Krtcap2	−0.07	9.75E−06	0.14	1.66E−11
	Sh2b1	0.28	5.19E−22	−0.14	9.77E−04
	Abi3	0.97	2.99E−212	−0.09	6.99E−02
	Ccnl2	0.27	6.75E−30	−0.12	4.01E−04
	Kbtbd7	0.01	7.26E−01	0.00	9.31E−01
	Csf2	0.27	9.13E−25	0.10	3.81E−01
	Pycard	−1.19	0.00E+00	−0.63	4.09E−86
	Dock7	0.00	4.69E−01	0.00	9.89E−01
	Herpud1	1.16	0.00E+00	0.13	1.68E−04
	Arf6	0.39	1.96E−101	0.04	1.73E−01
	Zyx	−1.05	0.00E+00	−0.52	4.55E−41
	Zfp91	0.25	9.43E−19	0.01	9.89E−01
	Fam171b	0.00	9.50E−01	−0.02	2.29E−01
	Maml2	−0.07	1.11E−02	−0.04	3.99E−01
	Ifngr2	0.24	7.48E−36	0.07	2.88E−02
	Bhlhe40	2.48	0.00E+00	0.02	4.83E−01
	Cisd1	−0.22	1.92E−15	−0.23	3.43E−09
	Zfp420	0.01	4.10E−01	0.01	6.99E−01
	Zc3h12a	2.18	0.00E+00	0.27	2.84E−16
	Plcg2	0.01	9.88E−01	−0.05	1.75E−02
	2310036o22rik	−0.31	3.53E−60	−0.13	6.10E−06
	Eif3c	−0.15	1.10E−11	−0.04	2.64E−01
	Slc15a3	0.52	3.74E−74	0.26	8.00E−09
	Acap3	−0.13	1.29E−08	−0.01	9.21E−01
	Tef	0.21	2.35E−22	0.06	1.33E−01
	Emp3	−1.21	0.00E+00	−0.34	2.78E−39
	Ssr2	−0.40	1.17E−65	−0.20	9.50E−09
	Usp1	−0.30	5.06E−26	−0.19	2.01E−06
	Rpl10-ps3	−0.35	1.51E−57	−0.40	8.76E−41
	Plcxd2	1.34	0.00E+00	−0.10	5.09E−02
	Adcy7	0.01	8.47E−01	−0.18	2.99E−06
	Irf1	0.18	1.70E−09	0.26	5.53E−11
	Aamp	0.17	2.36E−13	0.15	2.87E−06
	Gm8730	−0.08	1.81E−08	−0.61	8.94E−278
	Zgpat	−0.03	3.39E−01	−0.17	1.52E−05
	St13	0.17	5.97E−12	0.22	1.00E−12
	Cdc42se2	0.17	2.04E−12	−0.09	1.19E−02
	Anxa2	−0.54	2.39E−116	0.15	1.29E−05
	Cpsf3l	−0.45	9.24E−61	−0.16	9.05E−05
	Gm2000	−0.37	7.22E−67	−0.47	4.20E−62
	Trim46	0.00	9.99E−01	−0.01	7.82E−01
	Dusp16	0.15	3.73E−34	0.04	2.24E−01
	Zmat5	−0.35	2.87E−41	−0.15	1.08E−04
	Ptprk	−0.03	1.26E−01	−0.15	3.37E−06
	Zdhhc7	−0.08	3.65E−03	0.00	9.65E−01
	Il2	0.14	1.06E−05	0.06	2.32E−01
	Msto1	−0.13	2.19E−07	−0.14	5.82E−06
	Il10	0.14	2.17E−05	0.27	1.69E−08
	Sbno2	0.14	2.71E−19	0.02	6.45E−01
	Snx17	−0.21	2.10E−16	−0.14	1.67E−04
	Kif11	−0.28	2.26E−31	−0.14	3.85E−07
	Ndfip2	0.08	2.32E−03	−0.08	3.29E−02
	Card9	−0.01	1.41E−01	0.00	8.89E−01
	Lsm4	−0.35	5.60E−77	−0.25	6.16E−21
	Ormdl3	0.13	1.24E−05	0.16	7.45E−05
	S100a10	−0.84	0.00E+00	−0.03	1.80E−01
	Notch2	−0.03	5.11E−01	−0.13	3.92E−03
	Senp7	−0.20	5.37E−13	−0.12	1.26E−03
	Cd48	−1.55	0.00E+00	−0.52	2.68E−69
	Ssbp4	0.26	2.33E−29	−0.15	2.08E−06
	Cul1	0.12	3.32E−05	−0.01	8.54E−01
	Mettl10	−0.20	5.48E−13	−0.12	3.84E−03
	Rabep2	−0.27	7.52E−23	−0.11	2.82E−03
	Pkig	0.11	4.31E−08	0.06	1.22E−01
	Desi1	0.11	3.42E−04	−0.11	9.85E−03
	Furin	3.23	0.00E+00	0.30	1.88E−17
	Tcof1	−0.40	4.30E−48	−0.11	1.01E−02
	Glipr2	−1.36	0.00E+00	−0.43	3.68E−38
	Tgfbr3	0.11	1.03E−08	0.00	9.89E−01
	Tyk2	−0.09	6.73E−04	−0.10	4.23E−03
	Kif21b	−0.27	1.72E−21	−0.10	1.08E−02
	Tufm	−0.39	1.54E−46	−0.10	1.12E−02
	Zmiz1	−0.23	2.23E−15	−0.10	1.92E−02
	Il21	0.10	5.13E−06	0.07	1.23E−01
	Ttpal	0.10	1.87E−04	−0.10	1.11E−02
	Rps6kb1	0.10	5.80E−04	0.14	2.52E−04
	Camk2g	−0.16	4.70E−08	−0.10	2.24E−02
	Tom1	−0.06	1.33E−02	−0.10	4.27E−03
	Actr1a	−0.19	3.12E−12	−0.10	2.29E−02
	Rgs14	−0.39	3.10E−46	−0.10	2.57E−02
	Ublcp1	−0.15	3.40E−09	−0.10	6.49E−03
	Otud3	0.09	1.54E−07	0.00	9.81E−01
	Tmem180	0.09	1.18E−05	0.01	8.13E−01
	Ergic1	0.09	2.69E−04	0.05	3.21E−01
	Aa467197	−0.49	3.65E−58	−0.16	3.18E−04
	Tdp2	0.25	2.02E−16	0.08	1.26E−01
	Rac1	−0.03	7.10E−02	−0.06	9.85E−03
	Phlda3	−0.24	1.02E−25	0.04	3.99E−01
	Trmt112	−0.22	2.35E−26	−0.09	7.80E−03
	Ccny	0.07	1.27E−02	−0.08	5.36E−02
	Slc43a3	−0.14	1.56E−10	−0.08	1.18E−03
	Ezh2	−0.52	5.20E−63	−0.08	4.97E−02
	Rps14	0.08	4.48E−27	0.00	9.98E−01
	Spred2	0.08	2.35E−05	0.06	5.38E−02
	Rn7s2
	Rn7s1
	Rpap2	−0.10	4.04E−05	−0.08	1.47E−02
	Cit	−0.45	5.44E−71	−0.08	5.23E−03
	Ascc2	−0.11	3.83E−06	−0.08	2.40E−02
	Ksr1	−0.08	1.46E−04	−0.08	3.19E−03
	Edem2	−0.33	1.05E−32	−0.08	7.89E−02
	Blzf1	0.08	2.57E−03	0.08	4.28E−02
	Ppp5c	−0.21	1.24E−13	−0.08	8.53E−02
	Smurf1	0.08	1.11E−04	−0.04	2.94E−01
	Nop9	−0.04	2.17E−01	−0.08	8.95E−02
	Slc30a7	−0.27	1.11E−24	−0.08	4.46E−02
	Tnfrsf8	0.01	2.34E−01	0.01	7.17E−01
	Adcy3	−0.27	4.90E−33	−0.08	1.04E−02
	Pdcd1	−0.14	5.58E−05	0.38	1.56E−12
	Fen1	−0.29	1.27E−22	−0.07	8.71E−02
	Themis	0.07	1.93E−02	−0.07	7.05E−02
	Nudt22	−0.26	9.63E−24	−0.07	4.38E−02
	Cyth1	0.07	1.27E−02	−0.01	9.32E−01
	Tmbim1	0.07	5.46E04	0.06	9.22E−02
	Ndufaf1	−0.21	3.92E−16	−0.07	6.18E−02
	Klrc1	0.33	8.00E−22	0.15	2.72E−03
	Pomc	0.07	6.94E−06	−0.03	2.65E−01
	Cpeb4	0.07	8.20E−05	0.04	2.26E−01
	Cul2	0.07	1.47E−02	0.06	2.27E−01
	Hgfac	−0.01	2.52E−02	0.00	6.98E−01
	Pofut1	0.01	6.89E−01	−0.07	5.41E−02
	Clasp2	−0.02	3.61E−01	−0.06	4.22E−02
	Nme7	−0.15	1.54E−13	−0.06	1.67E−02
	Ndst1	0.06	3.15E−07	−0.02	7.44E−01
	Gpr137	0.06	3.32E−04	0.00	9.89E−01
	Ncoa5	−0.18	2.59E−15	−0.06	8.44E−02
	Mapkapk5	−0.01	5.29E−01	−0.06	3.66E−02
	Auh	0.05	8.17E−02	−0.02	7.13E−01
	Gpx3	0.05	1.20E−10	0.01	7.82E−01
	Tmem116	0.00	4.95E−01	0.00	9.13E−01
	Hint1	−0.21	1.37E−47	−0.05	2.25E−02
	Mtmr3	0.05	5.19E−02	0.03	4.45E−01
	Ube2l3	−0.05	1.87E−02	−0.05	9.69E−02
	Il23r	0.05	2.13E−05	0.01	3.99E−01
	Asb2	1.12	3.45E−261	0.22	4.47E−08
	Snx32	−0.14	2.89E−16	−0.05	2.48E−02
	Fgfr1op	0.04	8.22E−02	−0.01	9.15E−01
	Ccl2	0.04	4.18E−11	0.02	4.55E−01
	Slc16a10	0.04	4.30E−05	−0.02	3.99E−01
	Batf	0.76	4.63E−195	−0.09	2.50E−02
	Trpt1	0.04	7.43E−03	0.01	8.02E−01
	Jazf1	0.04	1.18E−02	−0.02	3.32E−01
	Tubd1	−0.14	2.33E−19	−0.04	2.75E−02
	Rtel1	−0.08	8.41E−06	−0.04	3.22E−02
	Srm	−0.46	6.71E−57	−0.08	5.19E−02
	Thada	0.03	4.55E−02	0.04	3.99E−01
	Tppp	0.03	3.23E−05	0.05	8.78E−04
	Ppp4c	−0.27	3.36E−47	−0.24	1.20E−20
	Per3	0.03	5.93E−02	0.00	8.86E−01
	Hormad2	0.03	1.67E−04	−0.01	6.21E−01
	Gm20186	1.13	8.50E−290	−0.13	8.29E−03
	Ccdc122	0.00	8.24E−01	−0.02	1.13E−02
	Fasl	1.65	0.00E+00	0.26	4.15E−15
	Sh2d2a	1.54	0.00E+00	−0.08	8.11E−03
	Atp6v0a1	0.02	1.45E−02	0.01	9.38E−01
	Fosl1	0.01	7.04E−05	0.01	2.56E−01
	Itgb8	0.01	9.57E−02	0.01	4.42E−01
	Amz1	0.01	2.39E−02	0.01	2.94E−01
	Cxcl5	0.01	2.03E−04	0.00	3.64E−01
	Nkx2-3	0.01	5.48E−04	0.01	1.81E−01
	Thbs3	0.01	4.77E−03	0.02	4.17E−03
	Pf4	0.01	7.65E−02	0.00	8.61E−01
	Ephx4	0.00	8.43E−01	−0.01	9.78E−02
	Osmr	0.00	2.42E−01	−0.01	3.74E−02
	Ccl11	0.01	3.59E−03	0.01	1.30E−01
	Fndc4	0.01	4.96E−03	0.01	4.45E−01
	Ccl7	0.01	2.68E−03	0.01	2.94E−01
	Ptrf	0.01	1.09E−02	0.01	5.60E−01
	Mei1	0.00	4.07E−02	0.00	7.56E−01
	Lamb1	0.00	1.95E−02	0.00	7.59E−01
	Headings description (All logFC are log2 based):
	Final Score: Total score used to rank genes
	In-Vivo Cluster: Combined score for in-vivo cluster-specific results
	In-Vivo Tissue: Combined score for in-vivo tissue-specific results
	In-Vitro Summary: Combined score for in-vitro results
	GWAS?: Whether or not the gene is associated with an IBD GWAS loci
	LPL-9_logFC: logFC of the gene's expression in the LPL-9 cluster vs LPL remainder comparison
	LPL-9_FDR: FDR value for the gene in the LPL-9 cluster vs LPL remainder comparison
	LPL-9_Geno_logFC: logFC of the gene's expression in the LPL-9 within-cluster Wild Type vs Knockout comparison
	LPL-9_Geno_FDR: FDR value for the gene in the LPL-9 within-cluster Wild Type vs Knockout comparison
	LPL-2_logFC: logFC of the gene's expression in the LPL-2 cluster vs LPL remainder comparison
	LPL-2_FDR: FDR value for the gene in the LPL-2 cluster vs LPL remainder comparison
	LPL-2_Geno_logFC: logFC of the gene's expression in the LPL-2 within-cluster Wild Type vs Knockout comparison
	LPL-2_Geno_FDR: FDR value for the gene in the LPL-2 within-cluster Wild Type vs Knockout comparison
	logFC_LPL_TissueDE: logFC of the gene's expression in the LPL vs. Spleen comparison
	FDR_LPL_TissueDE: FDR value for the gene in the LPL vs. Spleen comparison
	LPL_Geno_logFC: logFC of the gene's expression in the within-LPL Wild Type vs Knockout comparison
	LPL_Geno_FDR: FDR value for the gene in the within-LPL Wild Type vs Knockout comparison

Various modifications and variations of the described methods, pharmaceutical compositions, and kits of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific embodiments, it will be understood that it is capable of further modifications and that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention that are obvious to those skilled in the art are intended to be within the scope of the invention. This application is intended to cover any variations, uses, or adaptations of the invention following, in general, the principles of the invention and including such departures from the present disclosure come within known customary practice within the art to which the invention pertains and may be applied to the essential features herein before set forth.

Claims

1. A method of treating an autoimmune disease caused by pathogenic Th1 cells comprising administering one or more agents capable of inhibiting the expression, activity and/or function of one or more genes selected from the group consisting of CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW.

2. The method of claim 1, wherein the one or more agents inhibit the expression, activity and/or function of CD160.

3. The method of claim 1, wherein the one or more agents inhibit the expression, activity and/or function of GPR18.

4. The method of any one of claims 1 to 3, wherein the one or more agents comprises an antibody, antibody fragment, intrabody, small molecule, small molecule degrader, antibody-like protein scaffold, aptamer, polypeptide, genetic modifying agent, or any combination thereof.

5. The method of claim 4, wherein the genetic modifying agent comprises an RNA-guided nuclease system, RNAi system, a zinc finger nuclease, a TALE, or a meganuclease.

6. The method of claim 5, wherein the RNA-guided nuclease system is a CRISPR system or IscB system.

7. The method of claim 6, wherein the CRISPR system comprises a CRISPR-Cas base editing system, a prime editor system, or a CAST system.

8. A method of treating an autoimmune disease caused by pathogenic Th1 cells comprising administering Th1 cells modified to have decreased expression of IL-23R.

9. A method of detecting a Th1 inflammatory response for diagnosis or monitoring of a treatment of a subject suffering from an autoimmune disease caused by colitogenic Th1 cells comprising detecting in a sample obtained from the subject Th1 cells expressing one or more genes selected from the group consisting of: a. IL23R, CD160, GPR18, GZMB, ITGB1, CCR3, GZMA, IL22, ZFP36L2, ZBTB38, CD74, CCR5, MAP3K8, TNFSF8, IFITM1, NFKBIZ, FOSL2, CREM, CCDC85B, FOS, GPR183, S100A4, 1110008F13RIK, LSP1, LITAF, CD7, DUSP2, PLAC8, H1F0, S1PR1, NCF4, SMIM3, TESC, RBMS1, LPXN, TNFRSF9, PMM1, TOB2, IFNG, CD226, and CTSW, wherein the expression of one or more genes are increased in an inflammatory response; orb. clusters 2, 9 and 7 in Table 3, wherein the expression of one or more genes or program from cluster 2 and/or 9 are increased in an inflammatory response and the expression of one or more genes or program in cluster 7 are decreased in an inflammatory response.

10. The method of claim 9, wherein the treatment comprises one or more agents capable of inhibiting the expression, activity and/or function of CD160, GPR18, IL-23, or IL-12 and IL-23.

11. The method of claim 9 or 10, wherein the Th1 cells are detected by immunohistochemistry (IHC), fluorescence activated cell sorting (FACS), fluorescently bar-coded oligonucleotide probes, RNA FISH (fluorescent in situ hybridization), RNA-seq, or any combination thereof.

12. The method of claim 11, wherein the Th1 cell expression is inferred from bulk RNA-seq.

13. The method of claim 11, wherein the Th1 cell expression is determined by single cell RNA-seq.

14. The method of any of claims 9 to 13, wherein the sample is obtained by biopsy.

15. The method of any of claims 1 to 14, wherein the autoimmune disease is inflammatory bowel disease (IBD) or type 1 diabetes.

16. A method of obtaining IL-23R+ Th1 cells comprising differentiating naïve CD4+ T cells in vitro with IL-12 and IL-21.

17. The method of claim 16, further comprising differentiating with IL-23.

18. A method of treating cancer comprising administering to a subject in need thereof Th1 cells differentiated according to claim 16 or 17.

19. The method of claim 18, wherein the naïve CD4+ T cells are obtained from the subject.

20. A method of screening for drugs capable of shifting pathogenic Th1 cells to non-pathogenic Th1 cells comprising: a. treating Th1 cells obtained according to claim 16 or 17 with a drug candidate;b. detecting expression of one or more genes or program selected from cluster 2, 9 or 7 in Table 3; andc. identifying the drug, wherein the expression of one or more genes or program from cluster 2 or 9 decrease, and/or the expression of one or more genes or program in cluster 7 increase as compared to cells not contacted with the drug candidate.