Myelin oligodendrocyte glycoprotein peptides

Information

  • Patent Grant
  • 9862751
  • Patent Number
    9,862,751
  • Date Filed
    Monday, January 13, 2014
    10 years ago
  • Date Issued
    Tuesday, January 9, 2018
    7 years ago
Abstract
There is provided a peptide which is capable of binding to an MHC molecule in vitro and being presented to a T cell without antigen processing (i.e. an apitope) which peptide comprises a portion of the region 40-60 of myelin oligodendrocyte glycoprotein (MOG). In particular there is provided an apitope which is selected from the following myelin oligodendrocyte glycoprotein peptides: MOG 41-55, 43-57, 44-58 and 45-59. There is also provided the use of such a peptide in a pharmaceutical composition and a method to treat and/or prevent a disease using such a peptide.
Description

The present invention relates to peptides from myelin oligodendrocyte glycoprotein (MOG). In particular, the invention relates to peptides which comprise a portion of the region 40-60 of MOG which are capable of binding to an MHC molecule and being presented to a T-cell in vitro without antigen processing. The invention also relates to the use of such peptides in the treatment and/or prevention of a disease.


BACKGROUND

Multiple sclerosis (MS) is a chronic degenerative disease affecting the central nervous system, characterized by demyelination of nerve axons. MS may cause numerous physical and mental symptoms, and often progresses to both physical and cognitive disability. Disease onset usually occurs in young adults (20-40 yrs), is more common in women, and affects more than 1 million people around the world.


The disease course of MS is varied and may lie dormant or progress steadily over time. Several subtypes of MS have been described based on patterns of progression. A person with MS can suffer almost any neurological symptom or sign, including changes in sensation such as loss of sensitivity or tingling, pricking or numbness (hypoesthesia and paraesthesia), muscle weakness, clonus, muscle spasms, or difficulty in moving; difficulties with coordination and balance (ataxia); problems in speech (dysarthria) or swallowing (dysphagia), visual problems (nystagmus, optic neuritis including phosphenes, or diplopia), fatigue, acute or chronic pain, and bladder and bowel difficulties.


MS is currently believed to be an immune-mediated disorder in which the body's own immune system attacks and damages myelin.


There is no known cure for MS. Several current therapies have proven beneficial in restoring function after an attack (relapse), preventing or reducing the degree or frequency of new attacks (relapses), or preventing or reducing the extent of disability. However, many current MS therapies have been associated with adverse effects or are poorly tolerated. There is thus a need for alternative therapies for MS which are effective at treating MS and at alleviating or reducing the symptoms of MS.


SUMMARY OF THE INVENTION

The present inventors have identified a number of peptides derivable from myelin oligodendrocyte glycoprotein which can be presented by fixed antigen presenting cells to T-cells. These peptides may be useful in the prevention and/or treatment of demyelinating diseases such as multiple sclerosis.


In a first aspect, therefore, the present invention provides a peptide which is capable of binding to an MHC molecule in vitro and being presented to a T cell without antigen processing (i.e. an apitope), which comprises a portion of the region 40-60 of myelin oligodendrocyte glycoprotein (MOG).


The peptide may comprise a portion of the region 41-59 of myelin oligodendrocyte glycoprotein.


The peptide may be selected from the following myelin oligodendrocyte glycoprotein peptides: MOG 41-55, 43-57, 44-58 and 45-59.


The peptide may be MOG 41-55.


In a second aspect there is provided a peptide according to the first aspect of the invention for use in the treatment and/or prevention of a demyelinating disease.


In a third aspect, the present invention provides a pharmaceutical composition comprising one or more peptide(s) according to the first aspect of the invention.


In a fourth aspect the present invention provides a method for treating and/or preventing a demyelinating disease in a subject in need of same which comprises the step of administering a peptide according to the first aspect of the invention to the subject.


In a fifth aspect, the present invention relates to the use of a peptide according to the first aspect of the invention in the manufacture of a medicament for use in the prevention and/or treatment of a demyelinating disease.


In connection with the second, fourth and fifth aspects of the invention, the disease may be multiple sclerosis.





BRIEF DESCRIPTION OF THE FIGURES


FIG. 1 is a graph to show the peptide specificity of various MOG-specific hybridoma clones.



FIG. 2 shows the results of a recall proliferation assay to test the effect of treatment of mice with ROK5 (MOG 41-55) prior to immunisation with MOG35-55 followed by an in vitro recall with MOG35-55.



FIG. 3 shows the cytokine profiles from supernatants from splenocytes from mice pretreated in vivo with ROK5 or PBS and immunisation with MOG35-55 followed by an in vitro recall with MOG35-55.



FIG. 4 schematically illustrates the in vivo EAE prevention protocols.



FIG. 5 shows that the peptide MOG35-55 induces EAE in a murine model.



FIG. 6 shows that both mouse and human ROK5 apitopes can reduce the severity of the disease induced by MOG35-55.



FIG. 7 shows that huROK5 reduced the severity of disease and caused a delay in the peak of disease burden.





DETAILED DESCRIPTION

In a first aspect, the present invention relates to a peptide.


Peptides


The term “peptide” is used in the normal sense to mean a series of residues, typically L-amino acids, connected one to the other typically by peptide bonds between the α-amino and carboxyl groups of adjacent amino acids The term includes modified peptides and synthetic peptide analogues.


A peptide of the present invention is of a length that is capable of binding to a major histocompatibility complex (MHC) class I or II molecule in vitro and being presented to a T cell without antigen processing. In other words the peptides are capable of binding directly into the peptide binding groove of the MHC molecule without requiring any trimming at one or both ends.


Peptides that bind to MHC class I molecules are typically 7 to 13, more usually 8 to 10 amino acids in length. The binding of the peptide is stabilised at its two ends by contacts between atoms in the main chain of the peptide and invariant sites in the peptide-binding groove of all MHC class I molecules. There are invariant sites at both ends of the groove which bind the amino and carboxy termini of the peptide. Variations in peptide length are accommodated by a kinking in the peptide backbone, often at proline or glycine residues that allow the required flexibility.


Peptides which bind to MHC class 11 molecules are typically between 8 and 20 amino acids in length, more usually between 10 and 17 amino acids in length. These peptides lie in an extended conformation along the MHC II peptide-binding groove which (unlike the MHC class I peptide-binding groove) is open at both ends. The peptide is held in place mainly by main-chain atom contacts with conserved residues that line the peptide-binding groove.


The peptide of the present invention may be made using chemical methods (Peptide Chemistry, A practical Textbook. Mikos Bodansky, Springer-Verlag, Berlin.). For example, peptides can be synthesized by solid phase techniques (Roberge J Y et al (1995) Science 269: 202-204), cleaved from the resin, and purified by preparative high performance liquid chromatography (e.g., Creighton (1983) Proteins Structures And Molecular Principles, WH Freeman and Co, New York N.Y.). Automated synthesis may be achieved, for example, using the ABI 43 1 A Peptide Synthesizer (Perkin Elmer) in accordance with the instructions provided by the manufacturer.


The peptide may alternatively be made by recombinant means, or by cleavage from a longer polypeptide. For example, the peptide may be obtained by cleavage from myelin basic protein. The composition of a peptide may be confirmed by amino acid analysis or sequencing (e.g., the Edman degradation procedure).


Myelin Oligodendrocyte Glycoprotein (MOG)


Myelin oligodendrocyte glycoprotein (MOG) is a type I integral membrane protein possessing a single extracellular Ig variable domain (Ig-V). The amino acid sequence of MOG is highly conserved among animal species (>90%), indicative of an important biological function. MOG is specifically expressed in the CNS on the outermost lamellae of the myelin sheath as well as the cell body and processes of oligodendrocytes.


The sequence of mature MOG (lacking the 29 amino acid signal peptide) is given below (SEQ ID NO: 5).









SEQ ID No. 5


GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHL





YRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFF





RDHSYQEEAAMELKVEDPFYWVSPGVLVLLAVLPVLLLQITVGLVFLCLQ





YRLRGKLRAEIENLHRTFDPHFLRVPCWKITLFVIVPVLGPLVALIICYN





WLHRRLAGQFLEELRNPF






The peptide of the invention is derivable from region 40-60 of myelin oligodendrocyte glycoprotein (MOG). The peptide may be derivable from a fragment of the antigen which arises by natural processing of the antigen by an antigen presenting cell.


Region 40-60 of MOG has the following sequence:











SEQ ID No. 6



YRPPFSRVVHLYRNGKDQDGD






The peptide may comprise the minimal epitope from the following peptides: MOG 41-55, 43-57, 44-58 and 45-59.


The sequences of MOG 41-55, 43-57, 44-58 and 45-59 are:











(SEQ ID No. 1)










MOG 41-55:
RPPFSRVVHLYRNGK













(SEQ ID No. 2)










MOG 43-57:
PFSRVVHLYRNGKDQ













(SEQ ID No. 3)










MOG 44-58:
FSRVVHLYRNGKDQD













(SEQ ID No. 4)










MOG 45-59:
SRVVHLYRNGKDQDG






The peptide may comprise the minimal epitope from MOG 41-55. The peptide may consist of MOG 41-55.


Apitopes


In an adaptive immune response, T lymphocytes are capable of recognising internal epitopes of a protein antigen. Antigen presenting cells (APC) take up protein antigens and degrade them into short peptide fragments. A peptide may bind to a major histocompatibility complex (MHC) class I or II molecule inside the cell and be carried to the cell surface. When presented at the cell surface in conjunction with an MHC molecule, the peptide may be recognised by a T cell (via the T cell receptor (TCR)), in which case the peptide is a T cell epitope.


T cell epitopes play a central role in the adaptive immune response to any antigen, whether self or foreign. The central role played by T cell epitopes in hypersensitivity diseases (which include allergy, autoimmune diseases and transplant rejection) has been demonstrated through the use of experimental models. It is possible to induce inflammatory or allergic diseases by injection of synthetic peptides (based on the structure of T cell epitopes) in combination with adjuvant.


By contrast, it has been shown to be possible to induce immunological tolerance towards particular peptide epitopes by administration of peptide epitopes in soluble form. Administration of soluble peptide antigens has been demonstrated as an effective means of inhibiting disease in experimental autoimmune encephalomyelitis (EAE—a model for multiple sclerosis (MS)) (Metzler and Wraith (1993) Int. Immunol. 5:1159-1165; Liu and Wraith (1995) Int. Immunol. 7:1255-1263; Anderton and Wraith (1998) Eur. J. Immunol. 28:1251-1261); and experimental models of arthritis, diabetes, and uveoretinitis (reviewed in Anderton and Wraith (1998) as above). This has also been demonstrated as a means of treating an ongoing disease in EAE (Anderton and Wraith (1998) as above).


The use of tolerogenic peptides to treat or prevent disease has attracted considerable attention. One reason for this is that it has been shown that certain tolerogenic epitopes can down-regulate responses of T cells for distinct antigens within the same tissue. This phenomenon, known as “bystander suppression” means that it should be possible to induce tolerance to more than one epitope (preferably all epitopes) within a given antigen, and to more than one antigen for a given disease, using a particular tolerogenic peptide (Anderton and Wraith (1998) as above). This would obviate the need to identify all of the pathogenic antigens within a particular disease.


Peptides are also a favourable option for therapy because of their relatively low cost and the fact that peptide analogues can be produced with altered immunological properties. Peptides may thus be modified to alter their interactions with either MHC or TCR.


One possible problem with this approach is that it has been shown that not all peptides which act as T cell epitopes are capable of inducing tolerance. The myelin basic protein (MBP) peptide 89-101 is an immunodominant antigen after immunisation and is also a very effective immunogen both in terms of priming for T cell reactivity and induction of EAE. However, this peptide has been shown to be ineffective at inducing tolerance when administered in solution (Anderton and Wraith (1998), as above).


A number of explanations for the observed hierarchy in the ability of T cell epitopes to induce tolerance have been proposed (reviewed in Anderton and Wraith (1998) as above).


In particular, it has been proposed that there is a correlation between the affinity of the peptide for the MHC and tolerogenicity (Liu and Wraith (1995) as above), but this does not tally with some of the observations. For example, MBP [89-101], which is not tolerogenic, binds to I-AS with relatively high affinity. It is thus not straightforward to predict which peptides will induce tolerance.


The present inventors have shown that if a peptide epitope is of an appropriate size to be presented by immature APC without antigen processing, it can induce immunological tolerance (International patent application number PCT/GB01/03702). The observation that some T cell epitopes are tolerogenic and others are incapable of inducing tolerance can therefore be explained by the fact that some epitopes require antigen processing before they are capable of being presented by an MHC molecule. These epitopes which require further processing do not induce tolerance when administered in a soluble form, despite their capacity to induce disease when injected in combination with adjuvant.


The epitopes which do not require further processing are capable of inducing tolerance, and have been termed “apitopes” (Antigen Processing Independent epiTOPES) by the inventors.


Antigen Processing Independent Presentation Systems (APIPS)


The peptides of the present invention are capable of binding to an MHC molecule in vitro and being presented to a T cell without antigen processing.


It is possible to test whether a peptide is capable of binding to an MHC molecule without antigen processing using a “processing free” system. Such a system should be capable of presenting antigen via MHC molecules to T cells, but incapable of processing antigen. Thus peptides may be tested for their capacity to bind to an MHC molecule in vitro and being presented to a T cell without antigen processing using an antigen processing independent presentation system (APIPS).


Examples of APIPS include:


a) fixed APC (with or without antibodies to CD28);


b) Lipid membranes containing Class I or II MHC molecules (with or without antibodies to CD28); and


c) purified natural or recombinant MHC in plate-bound form (with or without antibodies to CD28).


It is known to use fixed APC to investigate T cell responses, for example in studies to investigate the minimal epitope within a polypeptide, by measuring the response to truncated peptides (Fairchild et al (1996) Int. Immunol. 8:1035-1043). APC may be fixed using, for example formaldehyde (usually paraformaldehyde) or glutaraldehyde.


Lipid membranes (which may be planar membranes or liposomes) may be prepared using artificial lipids or may be plasma membrane/microsomal fractions from APC.


In use, the APIPS may be applied to the wells of a tissue culture plate. Peptide antigens are then added and binding of the peptide to the MHC portion of the AMPS is detected by addition of selected T cell lines or clones. Activation of the T cell line or clone may be measured by any of the methods known in the art, for example via 3H-thymidine incorporation or cytokine secretion.


If a peptide is capable of being presented to a T cell by an APIPS, then it is capable of binding to the MHC molecule without antigen processing, and is an apitope.


Tolerance


The peptides of the present invention are capable of inducing tolerance to myelin oligodendrocyte glycoprotein (MOG).


As used herein, the term “tolerogenic” means capable of inducing tolerance.


Tolerance is the failure to respond to an antigen. Tolerance to self antigens is an essential feature of the immune system, when this is lost, autoimmune disease can result. The adaptive immune system must maintain the capacity to respond to an enormous variety of infectious agents while avoiding autoimmune attack of the self antigens contained within its own tissues. This is controlled to a large extent by the sensitivity of immature T lymphocytes to apoptotic cell death in the thymus (central tolerance). However, not all self antigens are detected in the thymus, so death of self-reactive thymocytes remains incomplete. There are thus also mechanisms by which tolerance may be acquired by mature self-reactive T lymphocytes in the peripheral tissues (peripheral tolerance). A review of the mechanisms of central and peripheral tolerance is given in Anderton et al (1999) (Immunological Reviews 169:123-137).


Tolerance may result from or be characterised by the induction of anergy in at least a portion of CD4+ T cells. In order to activate a T cell, a peptide must associate with a “professional” APC capable of delivering two signals to T cells. The first signal (signal 1) is delivered by the MHC-peptide complex on the cell surface of the APC and is received by the T cell via the TCR. The second signal (signal 2) is delivered by costimulatory molecules on the surface of the APC, such as CD80 and CD86, and received by CD28 on the surface of the T cell. It is thought that when a T cell receives signal 1 in the absence of signal 2, it is not activated and, in fact, becomes anergic. Anergic T cells are refractory to subsequent antigenic challenge, and may be capable of suppressing other immune responses. Anergic T cells are thought to be involved in mediating T cell tolerance.


Peptides which require processing before they can be presented in conjunction with MHC molecules do not induce tolerance because they have to be handled by mature antigen presenting cells. Mature antigen presenting cells (such as macrophages, B cells and dendritic cells) are capable of antigen processing, but also of delivering both signals 1 and 2 to a T cell, leading to T cell activation. Apitopes, on the other hand, will be able to bind class II MHC on immature APC. Thus they will be presented to T cells without costimulation, leading to T cell anergy and tolerance.


Of course, apitopes are also capable of binding to MHC molecules at the cell surface of mature APC. However, the immune system contains a greater abundance of immature than mature APC (it has been suggested that less than 10% of dendritic cells are activated, Summers et al. (2001) Am. J. Pathol. 159: 285-295). The default position to an apitope will therefore be anergy/tolerance, rather than activation.


It has been shown that, when tolerance is induced by peptide inhalation, the capacity of antigen-specific CD4+ T cells to proliferate is reduced. Also, the production of IL-2, IFN-γ and IL-4 production by these cells is down-regulated, but production of IL-10 is increased. Neutralisation of IL-10 in mice in a state of peptide-induced tolerance has been shown to restore completely susceptibility to disease. It has been proposed that a population of regulatory cells persist in the tolerant state which produce IL-10 and mediate immune regulation (Burkhart et al (1999) Int. Immunol. 11:1625-1634).


The induction of tolerance can therefore be monitored by various techniques including:


(a) reduced susceptibility to contract the disease for which the peptide is a target epitope in vivo;


(b) the induction of anergy in CD4+ T cells (which can be detected by subsequent challenge with antigen in vitro);


(c) changes in the CD4+ T cell population, including

    • (i) reduction in proliferation;
    • (ii) down-regulation in the production of IL-2, IFN-γ and IL-4; and
    • (iii) increase in the production of IL-10.


      Target Diseases


The peptide of the invention may be used in the treatment and/or prevention of a disease.


The disease may be a demyelinating diseases, such as adrenoleukodystrophy, vanishing white matter disease, or multiple sclerosis (MS).


The peptides of the present invention are particularly useful in the treatment and/or prevention of multiple sclerosis (MS). Multiple sclerosis (MS) is a chronic inflammatory disease characterised by multiple demyelinating lesions disseminated throughout the CNS white matter and occurring at various sites and times (McFarlin and McFarland, 1982 New England J. Medicine 307:1183-1188 and 1246-1251). MS is thought to be mediated by autoreactive T cells.


Pharmaceutical Composition


In a second aspect, the present invention relates to a pharmaceutical composition comprising one or more peptide(s) of the first aspect of the invention.


The present inventors predict that, despite “bystander suppression” it may be necessary to target a number of different T cell clones in order to induce tolerance effectively. Hence a plurality of peptides may be administered to an individual in order to prevent or treat a disease.


The pharmaceutical composition may, for example comprise between 1 and 20 apitopes, for example 1 to 15, 2 to 8 or 4 to 6 apitopes.


Where there are two or more apitopes, the pharmaceutical composition may be in the form of a kit, in which some or each of the apitopes are provided separately for simultaneous, separate or sequential administration.


Alternatively (or in addition) if the pharmaceutical composition (or any part thereof) is to be administered in multiple doses, each dose may be packaged separately.


The pharmaceutical composition may comprise a therapeutically or prophylactically effective amount of the or each apitope and optionally a pharmaceutically acceptable carrier, diluent or excipient.


Also, in the pharmaceutical compositions of the present invention, the or each apitope may be admixed with any suitable binder(s), lubricant(s), suspending agent(s), coating agent(s), or solubilising agent(s).


Administration


The peptide may be administered in soluble form in the absence of adjuvant.


The peptide may be administered by a mucosal route.


Studies have shown that peptide, when given in soluble form intraperitoneally (i.p.), intravenously (i.v.) or intranasally (i.n.) or orally can induce T cell tolerance (Anderton and Wraith (1998) as above; Liu and Wraith (1995) as above; Metzler and Wraith (1999) Immunology 97:257-263).


The peptide may be administered intranasally.


Studies in mice have demonstrated that the duration of peptide administration required to induce tolerance depends on the precursor frequency of T cells in the recipient (Burkhart et al (1999) as above). In many experimental studies, it has been shown that repeated doses of peptide are required to induce tolerance (Burkhart et al (1999) as above). The exact dose and number of doses of peptide will therefore depend on the individual, however, in a preferred embodiment a plurality of doses is administered.


If a plurality of peptides is administered simultaneously, they may be in the form of a “cocktail” which is suitable for administration in single or multiple doses. Alternatively it may be preferable to give multiple doses but vary the relative concentrations of the peptides between doses.


In a preferred embodiment a “dose escalation” protocol may be followed, where a plurality of doses is given to the patient in ascending concentrations. Such an approach has been used, for example, for phospholipase A2 peptides in immunotherapeutic applications against bee venom allergy (Müller et al (1998) J. Allergy Clin Immunol. 101:747-754 and Akdis et al (1998) J. Clin. Invest. 102:98-106).


EXAMPLES

The following examples serve to illustrate the present invention, but should not be construed as a limitation thereof. The invention particularly relates to the specific embodiments described in these examples


Example 1—Identification of Apitopes within Myelin Oligodendrocyte Glycoprotein (MOG)

Materials and Methods


Antigens


A nucleic acid sequence encoding the 125-amino acid N-terminal portion of human MOG, which represents the extracellular domain, was cloned into a bacterial expression vector (pET system). This recombinant human MOG extracellular domain (rhMOGED) was expressed in a bacterial system as a fusion protein with a His tag on the C-terminus.


A panel of 15-mer overlapping peptides spanning rhMOGED was synthesized using standard F-moc chemistry. The 15mers peptides were displaced by 5aa and overlapping by 10aa.


Generation of T Cell Clones


MOG-specific hybridoma T cell clones were generated by immunisation of DR2+ mice. DR2+ mice were immunised with either a pool of MOG overlapping peptides or rhMOGED in complete Freunds adjuvant (CFA). After 10 days, the spleen and draining lymph nodes were removed, CD4+ T cells were purified and restimulated with antigen/CFA in vitro. A week later. T cells were restimulated in vitro with antigen to increase the number of activated antigen-specific cells.


After 3 days, activated T cells were fused with the thymoma cell line BW 5147. Hybridoma clones were then selected using HAT selection medium and screened for peptide specificity by IL-2 ELISA.


Proliferation Assay


Live or p-formaldehyde fixed Mgar (HLA-DR2+ve) cells were incubated with peptides in serum or in serum alone, together with T cells for 48 hours. The T cell proliferative response was measured by IL-2 production.


Results


The response of various MOG-specific hybridoma clones to presentation of nested MOG peptides is shown in FIG. 1. The peptide MOG 41-55 (“ROK5”) was defined as an apitope as it could be presented by fixed APC to T cells without further processing. A detailed study was then carried out using overlapping peptides in the region 25-60, using peptides that are displaced by one amino acid. The peptides MOG 41-55, 43-57, 44-58 and 45-59 were identified as apitopes (FIG. 1).


The sequences of these peptides are given in Table 1.









TABLE 1







Sequence of MOG peptides identified as apitopes









Peptide
MOG
Amino acid sequence





ROK5
MOG 41-55
RPPFSRVVHLYRNGK (SEQ ID NO: 1)





ROK19
MOG 43-57
PFSRVVHLYRNGKDQ (SEQ ID NO: 2)





ROK20
MOG 44-58
FSRVVHLYRNGKDQD (SEQ ID NO: 3)





ROK21
MOG 45-59
SRVVHLYRNGKDQDG (SEQ ID NO: 4)









Example 2—Ex Vivo Tolerance Assay

In order to determine whether the peptides identified as apitopes are capable of inducing tolerance to antigen, an ex vivo study was performed. HLA-DR2 transgenic mice were immunised with either 100 μg ROK5 (MOG 41-55), 100 μg MOG 35-55 or PBS on days −8, −4 and −2. On day 0, mice were challenged with 100 μg MOG 35-55 by injection in the tail base in combination with CFA.


On day 10, splenocytes and draining lymph nodes were harvested and their respective cell populations isolated and a recall proliferation assay was set up with MOG 35-55. Cells from individual mice were treated separately and data is plotted separately in FIG. 2. For the recall response cells were treated ex vivo with a dose range of MOG35-55 (100, 10, 1, 0.1, 0.01, 0 μg) and proliferation via 3H-thymidine incorporation determined.


Stimulation index (compared to proliferation with no antigen) was calculated for each condition.


As shown in FIG. 2, ROK5 (MOG 41-55) was able to suppress the immune response to challenge with MOG 35-55.


The effect of ROK5 pre-treatment on various cytokine profiles was also investigated. As shown in FIG. 3, the production of IFNγ, IL-2, GM-CSF, IL6 by splenocytes are clearly affected by the ROK5 pretreatment.


Example 3—ROK5 EAE Prevention

EAE (experimental autoimmune encephalomyelitis) is a widely studied model of MS, and can be induced in a wide range of genetically susceptible laboratory animal species (including rodents and primates) by immunization with myelin or myelin components (including MOG) in strong adjuvants.


To test the capacity of ROK5 to prevent MOG-induced EAE in HLA-DR2 transgenic mice, the disease model was established in this strain of mice. To induce the disease, the encephalitogenic MOG peptide, mouse MOG 35-55 (mMOG35-55) was used. Then, ROK5 was tested in EAE prevention experiments as follows:


Experiment 1: with 3 ROK5 dose pre-treatments, followed by immunisation with mMOG35-55.


Experiment 2: with 5 ROK5 dose pre-treatments, followed by immunisation with mMOG35-55.


In each experiment, 10 mice were used per group.











Peptides sequences:



(SEQ ID No. 7)










mMOG35-55:
MEVGWYRSPFSRVVHLYRNGK













(SEQ ID No. 1)










hROK5 (41-55):
RPPFSRVVHLYRNGK













(SEQ ID No. 8 )










mROK5 (41-55):
RSPFSRVVHLYRNGK






Human and mouse MOG differ by an amino-acid substitution in position 42, substitution of a proline for a serine. Both MOG35-55 peptides are immunogenic, but the mouse MOG35-55 is more encephalitogenic, therefore mouse MOG35-55 was chosen to induce EAE in the model.


In vivo EAE prevention protocols are described in FIGS. 4A and 4B.


MOG-Induced EAE Model:


Two groups of DR2 transgenic mice were setup, at day zero, animals (n=7) in group “100 μg” received 100 μg mMOG35-55 in Complete Freund's Adjuvant (CFA) (100 μl s.c., base of the tail injection), animals (n=8) in group “200 μg” received 200 μg mMOG35-55 in CFA. At day zero and day 2, all animals received an injection of Pertussis toxin (200 ng in PBS, i.p.). Every day, clinical EAE was scored and animal body weight measured.


As shown in FIGS. 5A, 5B and table 2 below, both doses of mMOG35-55 can induce EAE with a good incidence.











TABLE 2





Group
Incidence
Mean day of onset

















100 ug
4/7
12.25


200 ug
7/8
12










ROK5 EAE Prevention Experiments:


On this basis, the ability of ROK5 to prevent MOG-induced EAE was tested.


A/First Experiment


A first experiment was performed where animals were pretreated 3 times (3 days apart) with either mouse ROK5, human ROK5 or PBS, 100 μg in 100 μl in CFA (s.c. injection in the flank), then all animals were immunised with 200 μg mMOG35-55 in CFA (s.c. injection at the base of the tail) and with 200 ng Pertussis toxin (200 ng in PBS, i.p.) at day zero and day 2.


Every day, clinical EAE was scored and animal body weight measured. FIG. 6 shows that both mouse and human ROK5 apitope can reduce the severity of the disease induced by MOG. Interestingly, human ROK5 is more efficient.


As shown in FIGS. 6A and 6B, experiment 1 shows that both mouse and human ROK5 apitopes can reduce the severity of the disease induced by MOG35-55.


B/Second Experiment


A second experiment was performed where animals were pretreated 5 times (3 days apart) with either human ROK5 or PBS, 100 μg in 100 μl in CFA (s.c. injection in the flank), then all animals were immunised with 200 μg mMOG35-55 in CFA (s.c. injection at the base of the tail) and with 200 ng Pertussis toxin (200 ng in PBS, i.p.) at day zero and day 2. Every day, clinical EAE was scored.


In Experiment 2 (FIG. 7), huROK5 reduced the severity of disease and caused a delay in the peak of disease burden.


As a conclusion, Human ROK5 apitope was able to reduce disease severity in both EAE experiments.


Various modifications and variations of the described methods and system of the invention will be apparent to those skilled in the art without departing from the scope and spirit of the invention. Although the invention has been described in connection with specific preferred embodiments, it should be understood that the invention as claimed should not be unduly limited to such specific embodiments. Indeed, various modifications of the described modes for carrying out the invention which are obvious to those skilled in chemistry or molecular biology or related fields are intended to be covered by the present invention. All publications mentioned in the above specification are herein incorporated by reference.

Claims
  • 1. A method for treating a demyelinating disease in a subject in need of same which comprises the step of administering a peptide selected from: MOG 41-55, 43-57, 44-58 and 45-59 to the subject.
  • 2. The method according to claim 1, wherein the disease is multiple sclerosis.
  • 3. The method according to claim 1 wherein the peptide is MOG 41-55.
  • 4. A pharmaceutical composition comprising two or more peptides selected from: MOG 41-55, 43-57, 44-58 and 45-59.
Priority Claims (1)
Number Date Country Kind
1300684.6 Jan 2013 GB national
PCT Information
Filing Document Filing Date Country Kind
PCT/IB2014/058233 1/13/2014 WO 00
Publishing Document Publishing Date Country Kind
WO2014/111840 7/24/2014 WO A
US Referenced Citations (26)
Number Name Date Kind
8128934 Suzumura et al. Mar 2012 B2
8148084 O'Connor et al. Apr 2012 B2
8188218 Siahaan et al. May 2012 B2
8202835 Hillman Jun 2012 B2
8231878 Colonna et al. Jul 2012 B2
8263064 Karin et al. Sep 2012 B2
8293468 Prat et al. Oct 2012 B2
20080103091 Siahaan et al. May 2008 A1
20080281001 Wood et al. Nov 2008 A1
20090048167 Hillman Feb 2009 A1
20090227018 Watson et al. Sep 2009 A1
20100003242 Sabbadini et al. Jan 2010 A1
20100310568 Prat et al. Dec 2010 A1
20110189178 Desjarlais et al. Aug 2011 A1
20120034696 Wood et al. Feb 2012 A1
20120045832 Trapp et al. Feb 2012 A1
20120058111 Ehlers et al. Mar 2012 A1
20120076808 Wang et al. Mar 2012 A1
20120077686 Weiner et al. Mar 2012 A1
20120082665 Sabbadini Apr 2012 A1
20120135016 Eisenbach-Schwartz et al. May 2012 A1
20120172297 Ben-Nun et al. Jul 2012 A1
20120177645 Langermann et al. Jul 2012 A1
20120195921 Loftis et al. Aug 2012 A1
20120230959 Abbot et al. Sep 2012 A1
20130236473 Hirano et al. Sep 2013 A1
Foreign Referenced Citations (79)
Number Date Country
2010286351 Mar 2012 AU
2010286361 Mar 2012 AU
2012201067 Mar 2012 AU
2012202713 May 2012 AU
2012202776 May 2012 AU
2006318791 Jul 2012 AU
2011202900 Aug 2012 AU
2492848 Jan 2012 CA
2614171 Apr 2012 CA
2363269 Jun 2012 CA
102388307 Mar 2012 CN
102666581 Sep 2012 CN
102741279 Oct 2012 CN
1964574 Sep 2008 EP
2233502 Sep 2010 EP
2402022 Jan 2012 EP
2411417 Feb 2012 EP
2420833 Feb 2012 EP
2431468 Mar 2012 EP
1456380 Apr 2012 EP
2436693 Apr 2012 EP
2473521 Jul 2012 EP
2473523 Jul 2012 EP
1625148 Sep 2012 EP
2500438 Sep 2012 EP
1991259 Oct 2012 EP
2510948 Oct 2012 EP
185932 Feb 2014 IL
443CHENP2010 Jul 2010 IN
251127 Mar 2012 IN
2012506451 Mar 2012 JP
2012506453 Mar 2012 JP
2012508865 Apr 2012 JP
5010798 Aug 2012 JP
2012162545 Aug 2012 JP
572644 Jun 2012 NZ
2441067 Jan 2012 RU
WO-1995006727 Mar 1995 WO
WO-1995007096 Mar 1995 WO
WO-9735879 Oct 1997 WO
WO-1999012966 Mar 1999 WO
WO-0131037 May 2001 WO
WO-0172325 Oct 2001 WO
WO-0216410 Feb 2002 WO
WO-03029276 Apr 2003 WO
WO-03037368 May 2003 WO
WO-2004104026 Dec 2004 WO
WO-2005044982 May 2005 WO
WO-2006057003 Jun 2006 WO
WO-2006097914 Sep 2006 WO
WO-2007039552 Apr 2007 WO
WO-2007055378 May 2007 WO
WO-2007061805 May 2007 WO
WO-2007094003 Aug 2007 WO
WO-2007096396 Aug 2007 WO
WO-2007131210 Nov 2007 WO
WO-2007149982 Dec 2007 WO
WO-2008055059 May 2008 WO
WO-2008070344 Jun 2008 WO
WO-2008149354 Dec 2008 WO
WO-2009050283 Apr 2009 WO
WO-2010045265 Apr 2010 WO
WO-2010055510 May 2010 WO
WO-2010109010 Sep 2010 WO
WO-2010126908 Nov 2010 WO
WO-2011071059 Jun 2011 WO
WO-2011097527 Aug 2011 WO
WO-2012017439 Feb 2012 WO
WO-2012019041 Feb 2012 WO
WO-2012021856 Feb 2012 WO
WO-2012031258 Mar 2012 WO
WO-2012036214 Mar 2012 WO
WO-2012041867 Apr 2012 WO
WO-2012045324 Apr 2012 WO
WO-2012056407 May 2012 WO
WO-2012092485 Jul 2012 WO
WO-2012103365 Aug 2012 WO
WO-2012117076 Sep 2012 WO
WO-2014041867 Mar 2014 WO
Non-Patent Literature Citations (25)
Entry
T Hart et al., Modelling of multiple sclerosis: lessons learned in a non-human primate, Oct. 2004, The Lancet Neurology 3(10):588-597.
Werkerle et al., Animal models of multiple sclerosis, 2006, Drug Discovery Today: Disease Models 3(4):359-367.
Ransohoff, R. M., Animal models of multiple sclerosis: the good, the bad and the bottom line, Aug. 2012, Nature Neuroscience15(8):1074-1077.
Behan et al., The sad plight of multiple sclerosis research (low on fact, high on fiction): critical data to support it being a neurocristopathy, 2010, Inflammopharmacology 18:265-290.
International Search Report and Written Opinion, International Application No. PCT/IB2014/058233, mailed Jul. 11, 2014.
Leech et al., Recognition of a high affinity MHC class I-restricted epitope of myelin oligodendrocyte glycoprotein by CD8? T cells derived from autoantigen-deficient mice, Front Immunol., 2:17 (2011), 10 pages.
McFarlin et al., Multiple sclerosis (first of two parts), N. Engl. J. Med., 307(19):1183-8 (1982).
McFarlin et al., Multiple sclerosis (second of two parts), N. Engl. J. Med., 307(20):1246-51 (1982).
Metzler et al., Inhibition of experimental autoimmune encephalomyelitis by inhalation but not oral administration of the encephalitogenic peptide: influence of MHC binding affinity, Int. Immunol., 5(9):1159-65 (1993).
Metzler et al., Inhibition of T-cell responsiveness by nasal peptide administration: influence of the thymus and differential recovery of T-cell-dependent functions, Immunology, 97(2):257-63 (1999).
Muller et al., Successful immunotherapy with T-cell epitope peptides of bee venom phospholipase A2 induces specific T-cell anergy in patients allergic to bee venom, J. Allergy Clin. Immunol., 101(6 Pt 1):747-54 (1998).
Summers et al., Phenotypic characterization of five dendritic cell subsets in human tonsils, Am. J. Pathol., 159(1):285-95 (2001).
Madsen et al., A humanized model for multiple sclerosis using HLA-DR2 and a human T-cell receptor, Nature Genet., 23:343-7 (1999).
Roberge et al., A Strategy for a Convergent Synthesis of N-Linked Glycopeptides on a Solid Support, Science, 269:202-4 (1995).
Akdis et al., Role of interleukin 10 in specific immunotherapy, J. Clin. Invest., 102(1):98-106 (1998).
Anderton et al., Hierarchy in the ability of T cell epitopes to induce peripheral tolerance to antigens from myelin, Eur. J. Immunol., 28(4):1251-61 (1998).
Anderton et al., Mechanisms of central and peripheral T-cell tolerance: lessons from experimental models of multiple sclerosis, Immunol. Rev., 169:123-37 (1999).
Burkhart et al., Peptide-induced T cell regulation of experimental autoimmune encephalomyelitis: a role for IL-10, Int. Immunol., 11(10):1625-34 (1999).
Fairchild et al., The nature of cryptic epitopes within the self-antigen myelin basic protein, Int. Immunol., 8(7):1035-43 (1996).
Greer et al., Correlation of blood T cell and antibody reactivity to myelin proteins with HLA type and lesion localization in multiple sclerosis, J. Immunol., 180(9):6402-10 (2008).
International Preliminary Report on Patentability, International Application No. PCT/IB2014/058233, dated Jul. 21, 2015.
International Search Report and Written Opinion, International Application No. PCT/IB2014/058233, dated Jul. 11, 2014.
Leech et al., Recognition of a high affinity MHC class I-restricted epitope of myelin oligodendrocyte glycoprotein by CD8? T cells derived from autoantigen-deficient mice, Front Immunol., 2:17 (2011).pp. 123-137.
Liu et al., Affinity for class II MHC determines the extent to which soluble peptides tolerize autoreactive T cells in naive and primed adult mice—implications for autoimmunity, Int. Immunol., 7(8):1255-63 (1995).
Leadbetter et al., Experimental autoimmune encephalomyelitis induced with a combination of myelin basic protein and myelin oligodendrocyte glycoprotein is ameliorated by administration of a single myelin basic protein peptide. J. Immunol. 161: 504-12 (1998).
Related Publications (1)
Number Date Country
20150353616 A1 Dec 2015 US