Patent Application
20080004302
The invention will now be further described with reference to the following illustrative examples in which, unless stated otherwise:
A mixture of 2-chloro-N-(5-methyl-1H-pyrazol-3-yl)pyrimidin-4-amine (0.209 g, 1.0 mmol), (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.446 g, 3.0 mmol) and N,N-diisopropylethylamine (0.693 ml, 4.0 mmol) in n-butanol (10 ml) was heated at 115° C. for 18 hours. The mixture was evaporated under vacuum and the residue was then partitioned between water (20 ml) and diethyl ether (20 ml). The mixture was filtered and the residue washed with water and then allowed to dry to leave compound 1 in table 1 (0.264 g, 93% yield).
1H NMR (300 MHz, DMSO): 2.17 (s, 3H), 2.18 (s, 3H), 4.53 (d, 2H), 6.11 (s, 1H), 6.14-6.42 (m, 2H), 7.19 (s, 1H), 7.83 (d, 1H), 9.32 (s, 1H), 11.84 (s, 1H).
MS: m/z 286 (MH+).
2-chloro-N-(5-methyl-1H-pyrazol-3-yl)pyrimidin-4-amine and (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting materials, can be prepared by the method described in the literature (Barlaam, Bernard; Pape, Andrew; Thomas, Andrew. Preparation of pyrimidine derivatives as modulators of insulin-like growth factor-1 receptor (IGF-1). WO2003048133).
Prepared using an analogous method to example 1 but starting with N-[(3-methylisoxazol-5-yl)methyl]methanamine hydrochloride (also known as N-methyl-1-(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.489 g, 3.0 mmol) to give example 2 in table 1 (0.127 g, 42% yield).
1H NMR (300 MHz, DMSO): 2.18 (s, 3H), 2.19 (s, 3H), 3.13 (s, 3H), 4.89 (s, 2H), 6.01-6.23 (m, 2H), 6.33 (s, 1H), 7.90 (d, 1H), 9.39 (s, 1H), 11.86 (s, 1H).
MS: m/z 300 (MH+).
A mixture of 2-chloro-N-(5-methyl-1H-pyrazol-3-yl)pyrimidin-4-amine (0. 105 g, 0.5 mmol), (3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.11 4 g, 0.65 mmol) and N,N-diisopropylethylamine (0.218 ml, 1.25 mmol) in 2-methoxyethanol (4 ml) was heated at 200° C. in a Emrys Optimiser microwave for 2 hours. The mixture was concentrated and the residue purified by preparative hplc eluting with a gradient of acetonitrile in water (containing 1% ammonia). The fractions containing product were combined and evaporated to leave compound 3 in table 1 (0.028 g, 18% yield).
1H NMR (300 MHz, DMSO): 0.61-0.75 (m, 2H), 0.89-1.01 (m, 2H), 1.87-2.01 (m, 1H), 2.18 (s, 3H), 4.50 (s, 2H), 6.01 (s, 1H), 6.07-6.37 (m, 2H), 7.13 (s, 1H), 7.82 (s, 1H), 9.31 (s, 1H), 11.84 (s, 1H).
MS: m/z 312 (MH+).
(3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride), used as starting material, can be prepared by the method described in the literature (Nowak, Thorsten; Thomas, Andrew Peter. Preparation of 4-(pyrazol-3-ylamino)pyrimidines for use in the treatment of cancer. WO2005040159).
Prepared in an analogous way to example 3 but using 5-(aminomethyl)isoxazole-3-carboxamide (also known as 5-(aminomethyl)-1,2-oxazole-3-carboxamide; 0. 124 g, 0.88 mmol) to give compound 4 in table 1 (0.048 g, 31% yield).
1H NMR(300 MHz, DMSO): 2.18 (s, 3H), 4.61 (d, 2H), 6.19 (s, 1H), 6.31 (s, 1H), 6.52 (s, 1H), 7.26 (s, 1H), 7.73 (s, 1H), 7.83 (d, 1H), 8.03 (s, 1H), 9.34 (s, 1H), 11.84 (s, 1H).
MS: m/z 315 (MH+).
5-(aminomethyl)isoxazole-3-carboxamide (also known as 5-(aminomethyl)-1,2-oxazole-3-carboxamide), used as starting material, can be prepared by the method described in the literature (Baucke, Dorit; Lange, Udo; Mack, Helmut; Seitz, Werner; Zierke, Thomas; Hoffken, Hans Wolfgang; Homberger, Wilfried. Preparation of amidino-substituted peptides as thrombin inhibitors. WO9806741).
Prepared in an analogous way to example 3 but starting with [5-[(2-chloropyrimidin-4-yl)amino]-2H-pyrazol-3-yl]methanol (0.095 g, 0.42 mmol) and (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.088 g, 0.59 mmol) to give compound 5 in table 1 (0.044 g, 35% yield).
1H NMR (300 MHz, DMSO): 2.17 (s, 3H), 4.42 (s, 2H), 4.53 (s, 2H), 5.19 (s, 1H), 6.12 (s, 1H), 6.26-6.43 (m, 2H), 7.17 (s, 1H), 7.83 (d, 1H), 9.35 (s, 1H), 12.04 (s, 1H).
MS: m/z 302 (MH+).
[5-[(2-chloropyrimidin-4-yl)amino]-2H-pyrazol-3-yl]methanol, used as starting material, was prepared as follows:
1H NMR (300 MHz, DMSO): 4.46 (d, 2H), 5.28 (d, 1H), 6.25 (s, 1H), 7.15 (s, 1H), 8.16 (s, 1H), 10.32 (s, 1H), 12.32 (s, 1H).
MS: m/z 226 (MH+).
(5-amino-2H-pyrazol-3-yl)methanol, used as starting material, was prepared as follows:
1H NMR (500 MHz, CDCl3): 4.52 (s, 2H), 6.85 (s, 1H), 13.87 (s, 1H).
1H NMR (400 MHz, DMSO): 4.27 (d, 2H), 4.53 (s, 2H), 4.95 (t, 1H), 5.29 (s, 1H), 11.20 (s, 1H).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
Prepared in an analogous way to example 3 but starting with 2-chloro-N-(5-propyl-1H-pyrazol-3-yl)pyrimidin-4-amine (0.10 g, 0.42 mmol) and (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.088 g, 0.59 mmol) to give compound 6 in table 1 (0.068 g, 52% yield).
1H NMR (300 MHz, DMSO): 0.90 (t, 3H), 1.53-1.65 (m, 2H), 2.17 (s, 3H), 4.53 (d, 2H), 6.11 (s, 1H), 6.14-6.46 (m, 2H), 7.19 (s, 1H), 7.82 (d, 1H), 9.34 (s, 1H), 11.85 (s, 1H); (2 Protons under DMSO).
MS: m/z 314 (MH+).
2-chloro-N-(5-propyl-1H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material, was prepared as follows:
1H NMR (300 MHz, DMSO): 0.91 (t, 3H), 1.54-1.67 (m, 2H), 2.55 (t, 2H), 6.08 (s, 1H), 7.20 (s, 1H), 8.15 (d, 1H), 10.27 (s, 1H), 12.14 (s, 1H).
MS: m/z 238 (MH+).
5-propyl-1H-pyrazol-3-amine, used as starting material, can be prepared by the method described in the literature (Barlaam, Bernard; Pape, Andrew; Thomas, Andrew. Preparation of pyrimidine derivatives as modulators of insulin-like growth factor-1 receptor (IGF-1). WO2003048133).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
Prepared in an analogous way to example 6 but starting with (3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0. 1 14 g, 0.65 mmol) to give compound 7 in table 1 (0.058 g, 34% yield).
1H NMR (300 MHz, DMSO): 0.63-0.75 (m, 2H), 0.82-1.01 (m, 5H), 1.50-1.67 (m, 2H), 1.86-2.01 (m, 1H), 4.51 (s, 2H), 5.99 (s, 1H), 6.05-6.41 (m, 2H), 7.15 (s, 1H), 7.82 (s, 1H), 9.33 (s, 1H), 11.85 (s, 1H); 2 Protons under DMSO.
MS: m/z 340 (MH+).
(3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as in Example 3.
Prepared in an analogous way to example 6 but starting with 5-(aminomethyl)isoxazole-3-carboxamide (also known as 5-(aminomethyl)-1,2-oxazole-3-carboxamide) to give compound 8 in table 1 (0.040 g, 23% yield).
1H NMR (300 MHz, DMSO): 0.90 (t, 3H), 1.55-1.62 (m, 2H), 4.62 (d, 2H), 6.23 (s, 1H), 11.86 (s, 1H); 2 protons under DMSO.
MS: m/z 343 (MH+).
5-(aminomethyl)-1,2-oxazole-3-carboxamide, used as starting material, can be prepared as described in Example 4.
Prepared in an analogous way to example 3 but starting with 2-chloro-N-(5-cyclopropyl-1H-pyrazol-3-yl)pyrimidin-4-amine (0. 11 8 g, 0.5 mmol) and (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.097 g, 0.65 mmol) to give example 9 in table 1 (0.020 g, 10% yield).
1H NMR (300 MHz, DMSO): 0.60-0.71 (m, 2H), 0.80-0.95 (m, 2H), 1.77-1.88 (m, 1H), 2.18 (s, 3H), 4.52 (s, 2H), 6.02-6.20 (m, 2H), 6.26 (s, 1H), 7.20 (s, 1H), 7.81 (s, 1H), 9.33 (s, 1H), 11.90 (s, 1H).
MS: m/z 312 (MH+).
2-chloro-N-(5-cyclopropyl-1H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material, can be prepared by the method described in the literature (Nowak, Thorsten; Thomas, Andrew Peter. Preparation of 4-(pyrazol-3-ylamino)pyrimidines for use in the treatment of cancer. WO2005040159).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
Prepared in an analogous way to example 9 but starting with (3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.097 g, 0.55 mmol). After the reaction was complete the mixture was concentrated and the residue triturated with water. The resultant precipitate was filtered and the residue washed first with water and then with diethyl ether and then allowed to dry under vacuum to give example 10 in table 1 (0.086 g, 52% yield).
1H NMR (300 MHz, DMSO): 0.65-0.72 (m, 4H), 0.89-0.99 (m, 4H), 1.79-1.88 (m, 1H), 1.90-1.99 (m, 1H), 4.54 (d, 2H), 6.02 (s, 1H), 6.13 (s, 1H), 6.28 (s, 1H), 6.72 (s, 1H), 7.82 (d, 1H), 9.64 (s, 1H), 11.99 (s, 1H).
MS: m/z 338 (MH+).
(3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as in Example 3.
Prepared in an analogous way to example 9 but starting with 5-(aminomethyl)isoxazole-3-carboxamide (also known as 5-(aminomethyl)-1,2-oxazole-3-carboxamide; 0.124 g, 0.88 mmol) to give example 11 in table 1 (0.014 g, 8% yield).
1H NMR (300 MHz, DMSO): 0.63-0.68 (m, 2H), 0.84-0.94 (m, 2H), 1.79-1.88 (m, 1H), 4.62 (d, 2H), 6.13 (s, 1H), 6.27 (s, 1H), 6.51 (s, 1H), 7.28 (s, 1H), 7.74 (s, 1H), 7.83 (d, 1H), 8.03 (s, 1H), 9.36 (s, 1H), 11.91 (s, 1H).
MS: m/z 341 (MH+).
5-(aminomethyl)-1,2-oxazole-3-carboxamide, used as starting material, can be prepared as described in Example 4.
Prepared in an analogous way to Example 3, from [5-[(2-chloropyrimidin-4-yl)amino]-2H-pyrazol-3-yl]methanol (113mg, 0.50 mmol) and 5-(aminomethyl)isoxazole-3-carboxamide (99mg, 0.70 mmol) to give the title compound as a solid (6.5 mg, 4% yield).
MS: m/z 331 (MH).
[5-[(2-chloropyrimidin-4-yl)amino]-2H-pyrazol-3-yl]methanol used as a starting material was prepared as described in Example 5.
5-(aminomethyl)isoxazole-3-carboxamide, used as starting material, can be prepared by the method described in Example 4.
4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (200 mg, 0.890 mmol) was dissolved in ethanol (5 ml) and 5-cyclopentyl-2H-pyrazol-3-amine (135 mg, 0.890 mmol) was added. The solution was heated to 80° C. for 18 h. The solution was allowed to cool to room temperature and then filtered. The solid was added to water (10 ml) and concentrated ammonia solution (3 drops) was added. The precipitate was collected by filtration, washed with water (2 ml) and dried in vacuo to yield the title compound as a colourless solid (180.8 mg, 60% yield).
1H NMR (399.902 MHz, DMSO with D-4 AcOD) δ 1.55 (m, 6H), 1.87 (m, 2H), 2.09 (s, 3H), 2.90 (m, 1H), 4.47 (d, J=5.2 Hz, 2H), 6.03 (s, 1H), 6.13 (bs, 1H), 6.18 (bs, 1H), 7.75 (d, J=5.9 Hz, 1H)
MS: m/z 340 (MH+)
(4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine used as a starting material was prepared as follows:—
To a solution containing 2-[(3-methyl1,2-oxazol-5-yl)methylamino]pyrimidin-4-ol (8.8 g) and diisopropylethylamine (9.6 ml) in toluene (40 ml) was added phosphorous oxychloride (4.8 ml) dropwise. The gummy suspension was heated at 80° C. for 2 h. The reaction was allowed to cool to r.t and then poured portionwise into saturated sodium bicarbonate solution The product was extracted with ethyl acetate (×2), washed with brine, dried (MgSO4), filtered and evaporated to give a cream solid. The solid was washed with ethyl acetate and dichloromethane (plus few drops of methanol) in an attempt to dissolve it. The suspension was heated to reflux. After filtration, a cream solid was obtained (1.6 g). The filtrate was loaded onto a silica column and after elution with ethyl acetate the crude product was obtained. Trituration with diethyl ether gave the desired compound as a pale yellow solid (3.28 g). Total yield=4.88 g (50%).
1H NMR (400.13 MHz DMSO) 2.19 (s, 3H), 4.56 (d, 2H), 6.15 (s, 1H), 6.77 (d, 1H), 8.22 (t, 1H), 8.29 (d, 1H)
MS: m/z 225 (MH+)
2-[(3-methyl1,2-oxazol-5-yl)methylamino]pyrimidin-4-ol was prepared as follows:—
(3-Methylisoxazol-5-yl)methanamine (9.3 g, 83 mmoles) and 2-methylsulfonylpyrimidin-4-ol (9.8 g, 69 mmoles) were heated together at 160° C. for 4 h. The mixture was allowed to cool then dissolved in dichloromethane and purified by chromatography (silica) eluting with 5-15% methanol in dichloromethane to give the product as a brown gum (8.88 g, 62%).
1H NMR (DMSO) δ 2.19 (s, 3H), 4.57 (s, 2H), 5.6 (d, 1H), 6.19 (s, 1H), 7.03 (bs, 1H), 7.61 (d, 1H), 11 (bs, 1H)
MS: m/z 207 (MH+)
5-cyclopentyl-2H-pyrazol-3-amine used as a starting material was prepared as follows:—
To an argon flushed reaction vessel was added 1,4-dioxane (100 ml, anhydrous) and to this was added sodium hydride (3.60 g, 60% dispersion in mineral oil, 90 mmoles). Acetonitrile (4.7 ml, 90 mmole, anhydrous) was added to the slurry and the mixture was stirred at room temperature for 30 mins. Methyl cyclopentanecarboxylate was added (9.6 g, 75 mmole) via syringe. The mixture was stirred at room temperature for 30 mins, then slowly heated to 105° C. overnight. The mixture was evaporated to dryness and the resulting solid dissolved in water (250 ml). The aqueous solution was extracted with DCM (3×75 ml). The aqueous layer was then acidified to pH 1-3 with concentrated hydrochloric acid (5-6 ml). The product was extracted into DCM (5×75 ml) and the combined organic extracts were dried over magnesium sulphate and filtered. The filtrate was evaporated at 600 mbar and 60° C. on a rotary evaporator, to avoid loss of any volatile product. The resulting oil was dissolved in ethanol (100 ml) and hydrazine hydrate (2 eq., 7.50 g, 150 mmoles) was added and the mixture was refluxed overnight. The solution was evaporated to dryness and then purified by silica column chromatography, eluting with a 0-10% MeOH in DCM gradient to give the desired compound (7.6 g, 67%)
MS: m/z 152 (MH+)
To a reaction tube was added 4-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (100 mg, 0.40 mmoles), ethanol (2 ml), and 5-cyclopentyl-2H-pyrazol-3-amine (64mg, 0.42 mmoles). The mixture was heated overnight at 80° C. The cooled mixture was filtered and washed with ethanol. The sample was dissolved in methanol, poured onto a SCX-2 column and washed with methanol. The product eluted with 2N ammonia in methanol and the solvent was evaporated to give a gum. The gum was triturated with ether, filtered, dried in a vacuum oven at 45° C. overnight to yield the title product as a white solid (80mg, 55%).
1H NMR (DMSO 400.13 MHz) 0.68 (m, 2H), 0.94 (m, 2H), 1.48-1.75 (m, 6H), 1.95 (m, 3H), 2.96 (m, 1H), 4.52 (d, 2H), 5.99 (s, 1H), 6.25 (bm, 2H), 7.15 (bs, 1H), 7.82 (d, 1H), 9.34 (s, 1H), 11.88 (s, 1H)
MS: m/z 366 (MH+)
5-cyclopentyl-2H-pyrazol-3-amine amine used as a starting material was prepared as in Example 13.
4-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared in analogous manner to (4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine in Example 13 except using 2-[(3-cyclopropyl-1,2-oxazol-5-yl)methylamino]pyrimidin-4-ol as starting material (3.17 g, 13.65 mmoles). Yield was 1.79 g (52%).
2-chloro-N-(5-cyclopentyl-2H-pyrazol-3-yl)pyrimidin-4-amine (150 mg, 0.569 mmol) was dissolved in 2-methoxy ethanol (5 ml) and [3-(oxolan-2-yl)-1,2-oxazol-5-ylmethanamine (192 mg, 1.138 mmol) and di-isopropylethylamine (148 mg, 199 μl, 1.138 mmol) were added. The mixture was heated to 160° C. for 30 mins in a microwave reactor, then to 180° C. for 20 mins and then to 200° C. for 80 mins. The solvent was evaporated under reduced pressure and the crude product was purified by reverse-phase preparative HPLC (basic) using a 25-45% gradient of acetonitrile in water containing 1% ammonium hydroxide solution. The clean fractions were combined and evaporated to give the title compound as a colourless solid (52 mg, 23% yield).
1H NMR (399.902 MHz, DMSO and d-4 AcOD) δ 1.62 (m, 6H), 1.91 (m, 5H), 2.21 (m, 1H), 2.98 (m, 1H), 3.79 (m, 2H), 4.58 (d, J =5.4 Hz, 2H), 4.87 (t, J =6.7 Hz, 1H), 6.21 (s, 1H), 6.25 (s, 1H), 7.28 (t, J=5.5 Hz, 1H), 7.83 (d, J=5.7 Hz, 1H), 9.43 (s, 1H). MS: m/z 396 (MH+)
2-chloro-N-(5-cyclopentyl-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material was prepared as follows:
2,4-Dichloropyrimidine (500 mg, 3.356 mmol) was dissolved in ethanol (10 ml) and di-isopropylethylamine (702 μl, 4.027 mmol) and 5-cyclopentyl-2H-pyrazol-3-amine (559 mg, 3.692 mmol) were added. The mixture was stirred at 40° C. for 3 days then allowed to cool to room temperature. The solution was concentrated to approximately half of the initial volume under reduced pressure, then added dropwise to water. The mixture was left to stand for 18 h and then the precipitate was collected by filtration, washed with water and dried in vacuo to yield 2-chloro-N-(5-cyclopentyl-2H-pyrazol-3-yl)pyrimidin-4-amine as a cream solid (644.2 mg, 73% yield)
1H NMR (399.902 MHz, DMSO) δ 1.65 (m, 6H), 2.02 (s, 2H), 3.04 (m, 1H), 6.08 (bs, 1H), 8.17 (s, 1H), 10.27 (s, 1H), 12.17 (s, 1H) MS: m/z 264 (MH+)
5-cyclopentyl-2H-pyrazol-3-amine amine used as a starting material was prepared as in Example 13.
[3-(oxolan-2-yl)-1,2-oxazol-5-ylmethanamine, used as a starting material was prepared in an analogous manner to that described for (3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (Example 3) by the method described in the literature (Nowak, Thorsten; Thomas, Andrew Peter. Preparation of 4-(pyrazol-3-ylamino)pyrimidines for use in the treatment of cancer. WO2005040159). Oxolane-2-carbaldehyde was used as starting material.
To a reaction tube was added 4-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (100 mg, 0.40 mmoles), ethanol (2 ml), and 5-(2-methylpropyl)-2H-pyrazol-3-amine (59mg, 0.42 mmoles). The mixture was heated overnight at 80° C. The cooled mixture was filtered and the solid was washed with ethanol. The sample was dissolved in methanol, poured onto a SCX-2 column and washed with methanol. The product eluted with 2N ammonia in methanol and the solvent was evaporated to give a gum. The gum was triturated with ether, filtered, dried in a vacuum oven at 45° C. overnight to yield the title product as a white solid (65mg, 47%).
1H NMR (DMSO 400.13 MHz) 0.69 (m, 2H), 0.87 (m, 6H), 0.95 (m, 2H), 1.85 (m, 1H), 1.93 (m, 1H), 2.39 (d, 2H), 4.51 (d, 2H), 5.99 (s, 1H), 6.2-6.35 (bs, 2H), 7.17 (bs, 1H), 7.82 (d, 1H), 9.38 (bs, 1H), 11.85 (s,1 H)
MS: m/z 354 (MH+)
4-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine material was prepared as in Example 14.
5-(2-methylpropyl)-2H-pyrazol-3-amine, used as starting material, can be prepared in an analogous method to that described for 5-propyl-1H-pyrazol-3-amine (Example 6) by the method described in the literature (Barlaam, Bernard; Pape, Andrew; Thomas, Andrew. Preparation of pyrimidine derivatives as modulators of insulin-like growth factor-1 receptor (IGF-1). WO2003048133).
Prepared in an analogous way to example 3 but starting with 2-chloro-N-[5-(3-methoxypropyl)-1H-pyrazol-3-yl]pyrimidin-4-amine (0.10 g, 0.37 mmol) and (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.084 g, 0.56 mmol) to give example 17 in table 2 (0.033 g, 26% yield).
1H NMR (300 MHz, DMSO): 1.76-1.85 (m, 2H), 2.17 (s, 3H), 2.57 (t, 2H), 3.24 (s, 3H), 3.34 (t, 2H), 4.53 (d, 2H), 6.10 (s, 1H), 6.14-6.39 (m, 2H), 7.18 (s, 1H), 7.82 (d, 1H), 9.34 (s, 1H), 11.87 (s, 1H).
MS: m/z 344 (MH+).
2-chloro-N-[5-(3-methoxypropyl)-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material, was prepared as follows:
1H NMR (300 MHz, CDCl3): 1.75-1.84 (m, 2H), 2.56 (t, 2H), 3.27 (s, 3H), 3.33 (t, 2H), 5.36 (s, 1H).
1H NMR (300 MHz, DMSO): 1.76-1.86 (m, 2H), 2.62 (t, 2H), 3.24 (s, 3H), 3.34 (t, 2H), 6.11 (s, 1H), 7.19 (s, 1H), 8.16 (d, 1H), 10.28 (s, 1H), 12.17 (s, 1H).
MS: m/z 268 (MH+).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
Prepared in an analogous way to example 17 but starting with (3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.098 g, 0.56 mmol) to give example 18 in table 2 (0.054 g, 39% yield).
1H NMR (300 MHz, DMSO): 0.67-0.72 (m, 2H), 0.93-0.99 (m, 2H), 1.76-1.85 (m, 2H), 1.89-1.99 (m, 1H), 2.57 (t, 2H), 3.24 (s, 3H), 3.34 (t, 2H), 4.50 (s, 2H), 5.99 (s, 1H), 6.13-6.39 (m, 2H), 7.15 (s, 1H), 7.82 (d, 1H), 9.34 (s, 1H), 11.88 (s, 1H).
MS: m/z 370 (MH+).
(3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as in Example 3.
Prepared in an analogous way to example 17 but starting with 5-(aminomethyl)isoxazole-3-carboxamide hydrochloride (also known as 5-(aminomethyl)-1,2-oxazole-3-carboxamide hydrochloride; 0.10 g, 0.56 mmol) to give example 19 in table 2 (0.007 g, 5% yield).
1H NMR (300 MHz, DMSO): 1.76-1.85 (m, 2H), 2.57 (t, 2H), 3.24 (s, 3H), 3.34 (t, 2H), 4.62 (d, 2H), 6.16-6.36 (m, 2H), 6.52 (s, 1H), 7.27 (s, 1H), 7.73 (s, 1H), 7.84 (d, 1H), 8.02 (s, 1H), 9.38 (s, 1H), 11. 89 (s, 1H).
MS: m/z 373 (MH+).
5-(aminomethyl)-1,2-oxazole-3-carboxamide hydrochloride, used as starting material, can be prepared as described in Example 4.
Prepared in an analogous way to example 3 but starting with 2-chloro-N-[5-(3-ethoxypropyl)-1H-pyrazol-3-yl]pyrimidin-4-amine (0.10 g, 0.35 mmol) and (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.080 g, 0.53 mmol) to give example 20 in table 2 (0.024 g, 19% yield).
1H NMR (300 MHz, DMSO): 1.11 (t, 3H), 1.75-1.84 (m, 2H), 2.17 (s, 3H), 2.57 (t, 2H), 3.35-3.45 (m, 4H), 4.53 (d, 2H), 6.10 (s, 1H), 6.15-6.41 (m, 2H), 7.18 (s, 1H), 7.82 (d, 1H), 9.34 (s, 1H), 11.87 (s, 1H).
MS: m/z 358 (MH+).
2-chloro-N-[5-(3-ethoxypropyl)-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material, was prepared as follows:
MS: m/z 170 (MH+).
1H NMR (300 MHz, DMSO): 1.12 (t, 3H), 1.76-1.85 (m, 2H), 2.62 (t, 2H), 3.35-3.45 (m, 4H), 5.88-6.33 (m, 1H), 7.19 (s, 1H), 8.16 (d, 1H), 10.27 (s, 1H), 12.16 (s, 1H).
MS: m/z 282 (MH+).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
Prepared in an analogous way to example 20 but starting with (3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.093 g, 0.53 mmol) to give example 21 in table 2 (0.032 g, 24% yield).
1H NMR (300 MHz, DMSO): 0.67-0.72 (m, 2H), 0.92-0.99 (m, 2H), 1. 11 (t, 3H), 1.75-1.84 (m, 2H), 1.90-1.99 (m, 1H), 2.57 (t, 2H), 3.35-3.44 (m, 4H), 4.51 (d, 2H), 5.99 (s, 1H), 6.07-6.49 (m, 2H), 7.15 (s, 1H), 7.82 (d, 1H), 9.33 (s, 1H), 11.87 (s, 1H).
MS: m/z 384 (MH+).
(3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as in Example 3.
Prepared in an analogous way to example 20 but starting with 5-(aminomethyl)isoxazole-3-carboxamide (also known as 5-(aminomethyl)-1,2-oxazole-3-carboxamide; 0.095 g, 0.53 mmol) to give example 22 in table 2 (0.038 g, 28% yield).
1H NMR (300 MHz, DMSO): 1.11 (t, 3H), 1.74-1.84 (m, 2H), 2.58 (t, 2H), 3.36-3.45 (m, 4H), 4.62 (d, 2H), 6.23 (s, 1H), 6.31 (s, 1H), 6.51 (s, 1H), 7.26 (s, 1H), 7.74 (s, 1H), 7.83 (d, 1H), 8.02 (s, 1H), 9.38 (s, 1H), 11.88 (s, 1H).
MS: m/z 387 (MH+).
5-(aminomethyl)-1,2-oxazole-3-carboxamide, used as starting material, can be prepared as described in Example 4.
Prepared in an analogous way to Example 3, from 2-chloro-N-[5-(3-methoxypropyl)-1H-pyrazol-3-yl]pyrimidin-4-amine (75mg, 0.28 mmol) and (3-cyclobutyl1,2-oxazol-5-yl)methanamine (95mg, 0.56 mmol) to yield the title compound (51 mg, 48%) as a white solid.
1H NMR (300.132 MHz, DMSO) 6 1.79 (t, 2H), 1.86-1.88 (m, 2H), 2.05-2.14 (m, 2H), 2.20-2.29 (m, 2H), 2.56 (t, 2H), 3.22 (s, 3H), 3.32 (t, 2H), 3.44-3.55 (m, 1H), 4.57 (s, 2H), 6.18 (s, 1H), 6.22 (s, 1H), 6.27 (s, 1H), 7.82 (d, 1H). MS: m/z 384 (MH+)
2-Chloro-N-[5-(3-methoxypropyl)-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material, can be prepared by the method described in Example 17.
(3-Cyclobutyl1,2-oxazol-5-yl)methanamine, used as starting material, can be prepared by the method described in the literature (Nowak, Thorsten; Thomas, Andrew Peter. Preparation of 4-(pyrazol-3-ylamino)pyrimidines for use in the treatment of cancer. WO2005040159). Starting from cyclobutanecarbaldehyde (14.64 g, 174 mmol) afforded (3-cyclobutylisoxazol-5-yl)methanamine as an oil (8.8 g, 27% over 3 steps). 1H NMR (399.9 MHz, CDCl3) δ1.52 (2H, s), 1.82-1.94 (1H, m), 1.96-2.07 (1H, m), 2.09-2.06 (1H, m), 2.09-2.21(2H, m), 2.23-2.35 (2H, m), 3.49-3.57 (1H, m), 3.89(2h, s), 5.98 (1H, s).MS: m/z 153 (MH+).
A mixture of 2-chloro-N-[5-[2-(4-methoxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine (0.10 g, 0.3 mmol), (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-i1,2-oxazol-5-yl)methanamine hydrochloride; 0.068 g, 0.45 mmol) and N,N-diisopropylethylamine (0. 159 ml, 0.91 mmol) in 2-methoxyethanol (3 ml) was heated at 170° C. in a Emrys Optimiser microwave for 3 hours. The mixture was concentrated in vacuo and the residue was dissolved in a mixture of dimethylformamide and acetonitrile (1 :3.8) and purified directly by preparative hplc eluting with a gradient of acetonitrile in water containing 1% ammonia. The fractions containing product were combined and evaporated to leave compound 18 in table 3 (0.039 g, 32% yield).
1H NMR (300 MHz, DMSO): 2.16 (3H, s), 2.71-2.88 (4H, m), 3.71 (3H, s), 4.53 (2H, d), 6.10 (1H, s), 6.23 (2H, s), 6.84 (2H, d), 7.14 (2H, d), 7.22 (1H, s), 7.83 (1H, d), 9.40 (1H, s), 11.93 (1H, s).
MS: m/z 406 (MH+).
2-chloro-N-[5-[2-(4-methoxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material, was prepared as follows:
1H NMR (300 MHz, DMSO): 2.62-2.81 (4H, m), 3.72 (3H, s), 4.39 (1H, s), 5.17 (1H, s), 6.83 (2H, d), 7.12 (2H, d), 11.15 (1H, s).
MS: m/z 218 (MH+).
1H NMR (300 MHz, DMSO): 2.85 (4H, s), 3.72 (3H, s), 5.75 (1H, s), 6.09 (1H, s), 6.85 (2H, d), 7.15 (2H, d), 8.16 (1H, d), 10.26 (1H, s), 12.19 (1H, s).
MS: m/z 330 (MH+).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
Prepared in an analogous way to example 24 but starting with (3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.080 g, 0.45 mmol) to give example 25 in table 3 (0.027 g, 21% yield).
1H NMR (300 MHz, DMSO): 0.65-0.73 (2H, m), 0.90-0.99 (2H, m), 1.94 (1H, ddd), 2.74-2.87 (4H, m), 3.72 (3H, s), 4.51 (2H, m), 5.99 (1H, s), 6.28 (2H, m), 6.84 (2H, d), 7.10-7.19 (3H, m), 7.82 (1H, d), 9.34 (1H, s), 11.89 (1H, s).
MS: m/z 432 (MH+).
(3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as in Example 3.
Prepared in an analogous way to example 24 but starting with 5-(aminomethyl)isoxazole-3-carboxamide trifluoroacetate (also known as 5-(aminomethyl)-1,2-oxazole-3-carboxamide trifluoroacetate; 0.1 17 g, 0.45 mmol) to give example 26 in table 3 (0.030 g, 23% yield).
1H NMR (300 MHz, DMSO): 2.77-2.86 (4H, m), 3.71 (3H, s), 4.62 (2H, d), 6.27 (2H, m), 6.52 (1H, s), 6.84 (2H, d), 7.15 (2H, s), 7.30 (1H, s), 7.74 (1H, s), 7.84 (1H, d), 8.02 (1H, s), 9.38 (1H, s), 11.92 (1H, s).
MS: m/z 435 (MH+).
5-(aminomethyl)-1,2-oxazole-3-carboxamide, used as starting material, can be prepared as described in Example 4.
A mixture of 2-chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine (0.10 g, 0.3 mmol), (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.091 g, 0.6 mmol) and N,N-diisopropylethylamine (0.212 ml, 1.2 mmol) in 2-methoxyethanol (3 ml) was heated at 200° C. in a Emrys Optimiser microwave for 2 hours. The mixture was concentrated in vacuo and the residue was dissolved in a mixture of dimethylformamide and acetonitrile (1:3.8) and purified directly by preparative hplc eluting with a gradient of acetonitrile in water containing 1% ammonia. The fractions containing product were combined and concentrated. The resultant precipitate was filtered and the residue was washed with water and then dried under vacuum to leave compound 21 in table 3 (0.041 g, 34% yield).
H NMR (300 MHz, DMSO): 2.16 (3H, s), 2.76-2.95 (4H, m), 3.73 (3H, s), 4.53 (2H, d), 6.10 (1H, s), 6.19-6.37 (2H, m), 6.72-6.85 (3H, m), 7.13-7.25 (2H, m), 7.83 (1H, s), 9.34 (1H, s), 11.90 (1H, s).
MS: m/z 406 (MH+).
2-chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material, was prepared as follows:
1H NMR (300 MHz, DMSO): 2.64-2.87 (4H, m), 3.73 (3H, s), 4.40 (1H, s), 5.19 (1H, s), 6.71-6.82 (3H, m), 7.18 (1H, t), 11.07 (1H, s).
MS: m/z 218 (MH+).
1H NMR (300 MHz, DMSO): 2.89 (4H, s), 3.73 (3H, s), 6.11 (1H, s), 6.73-6.84 (3H, m), 7.20 (2H, t), 8.16 (1H, d), 10.27 (1H, s), 12.20 (1H, s).
MS: m/z 330 (MH+).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
Prepared in an analogous way to example 27 but using (3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.080 g, 0.45 mmol). After initial purification by preparative hplc a second purification step by preparative hplc, eluting with a gradient of acetonitrile (containing 0.2% trifluroracetic acid) in water (containing 0.2% trifluroracetic acid) was applied. The fractions containing product were combined and concentrated to leave compound 22 in table 3 (0.030 g, 23% yield).
1H NMR (300 MHz, DMSO): 0.65-0.74 (2H, m), 0.95 (2H, dd), 1.94 (1H, ddd), 2.78-2.92 (4H, m), 3.73 (3H, s), 4.50 (2H, d), 5.99 (1H, s), 6.13-6.39 (2H, m), 6.72-6.84 (3H, m), 7.16 (1H, m), 7.19 (1H, t), 7.82 (1H, d), 9.34 (1H, s), 11.90 (1H, s).
MS: m/z 432 (MH+)
(3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as in Example 3.
Prepared in an analogous way to example 27 but using 5-(aminomethyl)isoxazole-3-carboxamide trifluoroacetate (also known as 5-(aminomethyl)-1,2-oxazole-3-carboxamide trifluoroacetate; 0.1 17 g, 0.45 mmol) to give example 29 in table 3 (0.026 g, 20% yield).
1H NMR (300 MHz, DMSO): 2.78-2.93 (4H, m), 3.73 (3H, s), 4.61 (2H, d), 6.13-6.42 (2H, m), 6.52 (1H, s), 6.72-6.84 (3H, m), 7.19 (1H, t), 7.22-7.30 (1H, m), 7.73 (1H, s), 7.83 (1H, d), 8.01 (1H, s), 9.37 (1H, s), 11.92 (1H, s).
MS: m/z 435 (MH+).
5-(aminomethyl)-1,2-oxazole-3-carboxamide trifluoroacetate, used as starting material, can be prepared as described in Example 4.
A mixture of 2-chloro-N-(5-phenethyl-1H-pyrazol-3-yl)pyrimidin-4-amine (0.10 g, 0.33 mmol), (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.06 g, 0.4 mmol) and N,N-diisopropylethylamine (0. 175 ml, 1.0 mmol) in 2-methoxyethanol (2 ml) was heated at 170° C. in a Emrys Optimiser microwave for 2 hours. A further portion of (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.015 g, 0.1 mmol) was added and the mixture heated at 200° C. in the microwave for 1 hour. The mixture was evaporated in vacuo and the residue was partitioned between ethyl acetate and water. The organic phase was separated and then washed with brine. The organic phase was dried over magnesium sulfate and then evaporated. The residue was dissolved in a mixture of dimethylformamide and acetonitrile (1:3.8) and purified directly by preparative hplc eluting with a gradient of acetonitrile in water (containing 1% ammonia). The fractions containing product were evaporated to leave compound 24 in table 3 (0.051 g, 41% yield).
1H NMR (300 MHz, DMSO): 2.17 (3H, s), 2.86 (4H, m), 4.53 (2H, d), 6.11 (1H, s), 6.24 (2H, s), 7.13-7.33 (6H, m), 7.83 (1H, d), 9.37 (1H, s), 11.93 (1H, s).
MS: m/z 376 (MH+).
2-chloro-N-(5-phenethyl-1H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material, was prepared as follows:
1H NMR (300 MHz, DMSO): 2.65-2.90 (4H, m), 4.33 (2H, s), 7.15-7.30 (5H, m), 11.08 (1H, s).
MS: m/z 188 (MH+).
1H NMR (300 MHz, DMSO): 2.90 (4H, m), 6.08 (1H, s), 7.16-7.32 (6H, m), 8.16 (1H, d), 10.27 (0.5H, s), 12.21 (0.5H, s).
MS: m/z 300 (MH+).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
Prepared using an analogous method to Example 3, but starting with 5-[2-(2-methoxyphenyl)ethyl]-1H-pyrazol-3-amine (78mg, 0.36 mmol) to give the title compound (51 mg, 32% yield)
1H NMR (300.132 MHz, DMSO) δ 2.17 (s, 3H), 2.84 (s, 4H), 3.78 (s, 3H), 4.69 (s, 2H), 6.18-6.44 (m, 3H), 6.84 (t, 1H), 6.95 (d, 1H), 7.09-7.12 (m, 1H), 7.15-7.21 (m, 1H), 7.87 (d, 1H). MS: m/z 406 (MH+)
5-[2-(2-methoxyphenyl)ethyl]-1H-pyrazol-3-amine, used as starting material, was prepared using an analogous method to Example 24a, but starting with methyl 3-(2-methoxyphenyl)propanoate (5 g, 25.7 mmol) to give 5-[2-(2-methoxyphenyl)ethyl]-1H-pyrazol-3-amine (3.6 g, 64%) as a golden oil.
1H NMR (300.132 MHz, CDCl3) 6 2.70-2.77 (m, 2H), 2.80-2.85 (m, 2H), 3.74 (s, 3H), 5.37 (s, 1H), 6.79 (t, 2H), 7.01 (d, 1H), 7.12 (t, 1H). MS: m/z 218 (MH+)
Methyl 3-(2-methoxyphenyl)propanoate, used as a starting material for the above intermediate, was prepared as follows:
1H NMR (300.132 MHz, CDCl3) δ 2.53 (t, 2H), 2.86 (t, 2H), 3.58 (s, 3H), 3.74 (s, 3H), 6.75-6.82 (m, 2H), 7.05-7.14 (m, 2H).
2-chloro-N-[5-[2-(4-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine (100 mg, 0.30 mmol, 1 eq) and (3-pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine. trifluoroacetic acid salt (68mg, 0.45 mmol, 1.5eq) were combined in 2-methoxyethanol (3 ml) containing diisopropylethylamine (159[l, 0.91 mmol, 3eq). The reaction was heated in the microwave at 170° C. for 1 h. The reaction was heated again at 170° C. for a further 2 h before the solvent was evaporated under reduced pressure. The crude product was dissolved in 1 ml of DMF and 3.8 ml of acetonitrile, filtered and then purified by basic reverse phase prep. eluting with a gradient of acetonitrile in water (both containing 1% ammonium hydroxide). The desired fractions were evaporated to give the title compound (0.0169 g, 12%).
1H NMR (300.132 MHz, DMSO) δ 2.73-2.87 (4H, m),3.71 (3H, s),4.68 (2H, d), 6.30 (2H, m),6.80 (1H, s), 6.82 (2H, d), 7.12 (2H, d), 7.36 (1H, s), 7.59 (1H, t), 7.85 (1H, d), 8.93 (2H, d),9.43 (1H, s), 11.90 (1H, s) MS: M/Z 470 (MH+)
2-chloro-N-[5-[2-(4-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material was prepared as follows:—
1H NMR (300.132 MHz, DMSO) δ 2.77 (2H, m), 3.29 (4H, m), 3.72 (3H, s), 6.81-6.88 (2H, m), 7.08-7.16 (2H, m) MS: M/Z 202,(MH−)
1H NMR (300.132 MHz, DMSO) δ 2.62-2.81 (4H, m), 3.72 (3H, s), 4.39 (1H, s), 5.17 (1H, s), 6.83 (2H, d), 7.12 (2H, d), 11.15 (1H, s) MS: M/Z 218,(MH+)
1H NMR (300.132 MHz, DMSO) δ2.85 (4H, s), 3.72 (3H, s), 5.75 (1H, s), 6.09 (1H, s), 6.85 (2H, d), 7.15 (2H, d), 8.16 (1H, d), 10.26 (1H, s), 12.19 (1H, s) MS: M/Z 330,(MH+)
(3-Pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine.TFA salt used as starting material was prepared as follows:—
To a solution of tert-butyl N-[(3-pyrimidin-2-yl-1,2-oxazol-5-yl)methyl]carbamate (9.27 g, 33.55 mmol) in DCM (220 ml) was added trifluoroacetic acid (24.9 ml, 335.5 mmol). The reaction mixture was stirred at room temperature overnight. The mixture was evaporated to dryness to give a clear brown oil. This was triturated with diethyl ether, resulting in a light-brown solid which was collected, washed with diethyl ether and dried in a desiccator at r.t. under high vacuum to constant weight. (3-Pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine TFA salt was obtained as a light-brown solid (9.91 g). MS: m/z 176.86 (MH+).
tert-Butyl N-[(3-pyrimidin-2-yl-1,2-oxazol-5-yl)methyl]carbamate was prepared as follows:—
(NE)-N-(pyrimidin-2-ylmethylidene)hydroxylamine (15.4 g, 125.08 mmol) was suspended and stirred in the DCM (850 ml), tert-butyl N-prop-2-ynylcarbamate (38.81 g, 250.06 mmol) was added and the mixture cooled to 10° C. under nitrogen in an ice/water bath. 13% Aq. sodium hypochlorite solution (1 19.4 ml, 250.12 mmol) was added dropwise over 10 mins with vigorous stirring, the reaction mixture temperature never rising above 15° C. It was then allowed to warm to r.t. and stirred vigorously overnight. The reaction mixture was filtered through a bed of celite and the filtrate separated. The organic phase was washed with saturated brine, dried over MgSO4 and evaporated to dryness giving a brown oil. The oil was dissolved in DCM and purified by column chromatography using EtOAc/isohexane 2:1. The appropriate fractions were combined and evaporated to yield tert-butyl N-[(3-pyrimidin-2-yl-1,2-oxazol-5-yl)methyl]carbamate (9.27 g, 13.4%). MS: m/z 277 (MH+)
(NE)-N-(pyrimidin-2-ylmethylidene)hydroxylamine was prepared as follows:—
2-(Diethoxymethyl)pyrimidine (53.46 g, 293.3 mmol) and hydroxylamine hydrochloride (24.46 g, 352.1 mmol) were dissolved in ethanol (500 ml) (containing water (50 ml)). The reaction mixture was stirred o/n at 60° C. The reaction mixture was neutralised with solid NaHCO3 to pH 6 and then evaporated to dryness a brown solid. This was extracted on a sintered funnel and washed with 1:1 MeOH/DCM until all the product had been dissolved. All extracts were combined and evaporated to dryness affording a brown solid. The crude product was purified by column chromatography eluting with a gradient of 10-30% MeOH/DCM. The desired fractions were combined and evaporated giving a brown solid. This solid was triturated with diethyl ether, collected and dried in a desiccator at room temperature under high vacuum to constant weight. (NE)-N-(Pyrimidin-2-ylmethylidene)hydroxylamine was obtained as a brown solid (30.79 g, 85.2%). MS: m/z 124 (MH+)
2-(Diethoxymethyl)pyrimidine was prepared as follows:—
2,2-Diethoxy-acetamidinehydrochloride (71.43 g, 391.08 mmol) and 3-dimethylaminoacrolein (37.51 ml, 337.13 mmol) were dissolved in dry ethanol (440 ml).
The reaction mixture was brought to reflux in an oil bath and 25% wt. sodium methoxide solution (120.26 ml, 525.92 mmol) was then added dropwise over 50 mins and the resulting suspension stirred at reflux overnight. The reaction mixture was cooled to room temperature, filtered and the filtrate evaporated to dryness giving a thick brown cloudy oil. Purified by column chromatography using 50% EtOAc in isohexane as eluant. The appropriate fractions were combined and evaporated to give the desired product (53.46 g, 87%).
Prepared in an analogous way to Example 27, but using (3-pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine trifluoroacetic acid salt (176mg, 0.61 mmol, 2 eq) and N,N-diisopropylethylamine (212 μl, 1.21 mmol, 4 eq) to give the title compound (0.0245 g, 16% yield).
1H NMR (300.132 MHz, DMSO): δ 2.77-2.92 (m, 4H), 3.72 (s, 3H), 4.68 (d, 2H), 6.27 (s, 2H), 6.70-6.86 (m, 4H), 7.17 (t, 1H), 7.35 (s, 1H), 7.59 (t, 1H), 7.86 (d, 1H), 8.93 (d, 2H), 9.42 (s, 1H), 11.93 (s, 1H). MS: m/z 470 (MH+).
2-chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material, was prepared as outlined in Example 27.
(3-Pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine.TFA salt was synthesized as outlined in Example 32.
2-Chloro-N-[5-(phenoxymethyl)-2H-pyrazol-3-yl]pyrimidin-4-amine (80 mg, 0.25 mmol, 1.0 eq) and (3-methyl1,2-oxazol-5-yl)methanamine (53mg, 0.35 mmol, 1.4 eq) and N,N-diisopropylethylamine (110 μl, 0.63 mmol, 2.5 eq) were combined in 2-methoxyethanol (4 ml) and heated in a microwave to 200° C. for 1 h. The mixture was concentrated and the residue purified by preparative HPLC (basic system, gradient 15-45% acetonitrile in water containing 1% ammonium hydroxide). Concentration of the product-containing fractions gave the title compound (13mg, 14%) as a white solid.
1H NMR (499.803 MHz, DMSO) δ 2.15 (s, 3H), 4.58 (s, 2H), 5.03 (s, 2H), 6.08 (s, 1H), 6.24-6.26 (m, 2H), 6.91 (t, 1H), 6.99 (d, 2H), 7.25 (t, 2H), 7.85 (d, 1H), 8.06 (s, 1H) MS: m/z 378 (MH+).
(3-methyl-1,2-oxazol-5-yl)methanamine was synthesized as outlined in Example 1.
2-Chloro-N-[5-(phenoxymethyl)-2H-pyrazol-3-yl]pyrimidin-4-amine used as a starting material was prepared as follows:
1H NMR (300.132 MHz, DMSO) δ 5.13 (s, 2H), 6.12 (s, 1H), 6.95-7.04 (m, 3H), 7.28-7.34 (m, 2H). MS: m/z 190 (MH+)
1H NMR (300.132 MHz, DMSO) δ 5.09 (s, 2H), 6.45 (s, 1H), 6.92-7.06 (m, 4H), 7.32 (t, 2H), 8.18 (d, 1H), 10.40 (s, 1H), 12.70 (s, 1H). MS: m/z 302 (MH+)
Prepared in an analogous way to Example 34, using (3-cyclopropylisoxazol-5-yl)methanamine (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine; 62 mg, 0.35 mmol) and 2-chloro-N-[5-(phenoxymethyl)-2H-pyrazol-3-yl]pyrimidin-4-amine (80 mg, 0.25 mmol) to give the title compound (12 mg, 12%) as a white solid.
1H NMR (499.803 MHz, DMSO) δ 0.67-0.70 (m, 2H), 0.90-0.94 (m, 2H), 1.88-1.92 (m, 1H), 4.55 (s, 2H), 5.03 (s, 2H), 5.99 (s, 1H), 6.24-6.27 (m, 2H), 6.91 (t, 1H), 6.99 (d, 2H), 7.25 (t, 2H), 7.85 (d, 1H). MS: m/z 404 (MH+).
(3-Cyclopropylisoxazol-5-yl)methanamine (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine), used as starting material, can be prepared as outlined in Example 3.
Prepared in an analogous way to Example 35, using 5-(aminomethyl)1,2-oxazole-3-carboxamide (63 mg, 0.35 mmol, 1.4 eq) and chloro-N-[5-(phenoxymethyl)-2H-pyrazol-3-yl]pyrimidin-4-amine (80 mg, 0.35 mmol, 1 eq) to give the title compound (32 mg, 32%) as a white solid.
1H NMR (499.803 MHz, DMSO) δ 4.66 (s, 2H), 5.03 (s, 2H), 6.25-6.29 (m, 2H), 6.53 (s, 1H), 6.91 (t, 1H), 6.99 (d, 2H), 7.25 (t, 2H), 7.86 (d, 1H) MS: m/z 407 (MH+).
5-(Aminomethyl)-1,2-oxazole-3-carboxamide, used as starting material, can be prepared as outlined in Example 4.
A mixture of 5-[2-(4-phenylmethoxyphenyl)ethyl]-2H-pyrazol-3-amine (114 mg, 0.39 mmol, 1.3 eq) and 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (67 mg, 0.30 mmol, 1 eq) in ethanol (10 ml) (containing a few drops of 4M HCl in dioxane) was refluxed for 18 h to yield a pale yellow solution. The solvent was evaporated under reduced pressure. The crude product was purified on acidic reverse phase prep. HPLC using a 35-45% gradient of acetonitrile in water containing 0.2% TFA. The desired fractions were poured onto a SCX-2 column which had been pre-wet with methanol. After washing several times with methanol the product was finally eluted with 10% ammonium hydroxide solution in methanol. Evaporation under reduced pressure afforded the title compound as a white solid (34.7 mg, 19% yield).
1H NMR (300.132 MHz, DMSO): 6 2.16 (s, 3H), 3.22-3.37 (m, 4H), 4.57 (d, 2H), 5.06 (s, 2H), 6.15 (s, 1H), 6.15-6.40 (m, 1H), 6.92 (d, 2H), 7.14 (d, 2H), 7.30-7.55 (m, 6H), 7.57-7.73 (m, 1H), 7.84 (d, 1H), 9.86 (s, 1H), 12.03 (s, 1H). MS: m/z 482 (MH+).
5-[2-(4-Phenylmethoxyphenyl)ethyl]-2H-pyrazol-3-amine, used as starting material was prepared in a similar way to 5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-amine in Example 27a, but using ethyl 3-(4-phenylmethoxyphenyl)propanoate as a starting material. The desired compound was obtained as a yellow solid (1.08 g, 25% yield).
MS: m/z 482 (MH+) 294.
4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was synthesized as outlined in Example 13.
A mixture of 5-[2-(3-phenylmethoxyphenyl)ethyl]-2H-pyrazol-3-amine (152 mg, 0.52 mmol, 1 eq) and 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (117 mg, 0.52 mmol, 1 eq) in ethanol (8 ml) (containing a few drops of 4M HCl in dioxane) was heated at 80° C. in a glass tube for 18 h. The precipitated product was filtered, washed with ethanol and dried. The product was suspended in water and basified by the addition of ammonium hydroxide solution. The product was extracted into ethyl acetate and the organic layer separated. The organic layer was washed with saturated sodium hydrogen carbonate, washed with brine, dried with magnesium sulphate, filtered and evaporated under reduced pressure to give the title compound as a solid. (129.7 mg, 52% yield)
1H NMR (300.132 MHz, DMSO): δ 2.16 (s, 3H), 2.81-2.90 (m, 4H), 4.53 (d, 2H), 5.06 (s, 2H), 6.09 (s, 1H), 6.28 (s, 2H), 6.80-6.86 (m, 2H), 6.90 (s, 1H), 7.20 (t, 2H), 7.28-7.46 (m, 5H), 7.82 (d, 1H), 9.34 (s, 1H), 11.91 (s, 1H). MS: m/z 482 (MH+).
5-[2-(3-Phenylmethoxyphenyl)ethyl]-2H-pyrazol-3-amine, used as starting material was prepared in a similar way to 5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-amine in Example 27, but using benzyl 3-(3-phenylmethoxyphenyl)propanoate as a starting material. The desired compound was obtained as a yellow oil (2.45 g, 40% yield).
1H NMR (300.132 MHz, DMSO): δ 2.68-2.84 (m, 4H), 4.42 (s, 2H), 5.07 (s, 2H), 5.19 (s, 1H), 6.77-6.90 (m, 3H), 7.18 (t, 1H), 7.29-7.48 (m, 5H). MS: m/z 294 (MH+).
4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was synthesized as outlined in Example 13.
Prepared using an analogous method to Example 37, but using 5-[2-(2-phenylmethoxyphenyl)ethyl]-1H-pyrazol-3-amine (105 mg, 0.36 mmol) as a starting material, to give the title compound (118 mg, 63% yield)
1H NMR (300.132 MHz, DMSO) δ 2.13 (s, 3H), 2.84-2.95 (m, 4H), 4.65 (s, 2H), 5.13 (s, 2H), 6.17-6.31 (m, 2H), 6.38 (s, 1H), 6.85 (t, 1H), 7.03 (d, 1H), 7.10-7.19 (m, 2H), 7.28-7.40 (m, 3H), 7.46 (d, 2H), 7.88 (d, 1H). MS: m/z 482 (MH+)
5-[2-(2-phenylmethoxyphenyl)ethyl]-1H-pyrazol-3-amine, used as a starting material, was prepared in a similar way to Example 34a, but using methyl 3-(2-phenylmethoxyphenyl)propanoate (3.9 g, 14.4 mmol) as a starting material to give 5-[2-(2-phenylmethoxyphenyl)ethyl]-1H-pyrazol-3-amine (1.6 g, 38%) as a brown gum. MS: m/z 294 ((M−H)−)
Methyl 3-(2-phenylmethoxyphenyl)propanoate was prepared using a method analogous to Example 31, using 3-(2-benzyloxyphenyl)propionic acid (7 g, 27.3 mmol) to give methyl 3-(2-phenylmethoxyphenyl)propanoate (6.66 g, 90%) as a colourless oil.
1H NMR (300.132 MHz, CDCl3) δ 2.65 (t, 2H), 3.01 (t, 2H), 3.64 (s, 3H), 5.08 (s, 2H), 6.86-6.90 (m, 2H), 7.13-7.18 (m, 2H), 7.28-7.43 (m, 5H).
Prepared in an analogous way to example 38, but starting with 5-[2-[3-(2-methoxyethoxy)phenyl]ethyl]-2H-pyrazol-3-amine (136 mg, 0.52 mmol, 1 eq). Isolated as a solid (124.8 mg, 53% yield).
1H NMR (300.132 MHz, DMSO): δ 2.00 (s, 3H), 2.64-2.73 (m, 4H), 3.13 (s, 3H), 3.47 (t, 2H), 3.89 (t, 2H), 4.36 (d, 2H), 5.94 (s, 1H), 6.09 (s, 2H), 6.55-6.67 (m, 3H), 7.01 (t, 2H), 7.66 (d, 1H), 9.17 (s, 1H), 11.73 (s, 1H). MS: m/z 450 (MH+).
5-[2-[3-(2-methoxyethoxy)phenyl]ethyl]-2H-pyrazol-3-amine used as starting material was prepared from 2-methoxyethyl 3-[3-(2-methoxyethoxy)phenyl]propanoate in a similar manner to 5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-amine in example 27a. Isolated as yellow oil (2.78 g, 81% yield).
1H NMR (300.132 MHz, DMSO): δ 2.68-2.84 (m, 4H), 3.31 (s, 3H), 3.65 (dd, 2H), 4.06 (dd, 2H), 4.40 (s, 2H), 5.19 (s, 1H), 6.71-6.81 (m, 3H), 7.17 (t, 1H), 11.08 (s, 1H). MS: m/z 262 (MH+).
To a stirred solution of N′-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]-N-[(3-methylisoxazol-5-yl)methyl]pyrimidine-2,4-diamine (also known as N′-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine; 100 mg, 0.25 mmol, 1 eq) in DCM (10 ml) at 0° C. under N2 was slowly added a 1M solution of boron tribromide (1.52 ml, 1.52 mmol, 5 eq). The reaction was allowed to warm to r.t. overnight. The reaction mixture was cooled in ice and methanol was slowly added (5 ml) to yield a pale yellow solution. The solution was evaporated under reduced pressure. After basifying, the product was purified on the basic reverse phase prep. HPLC using a 20-40% gradient of acetonitrile in water containing 1% ammonia in the aqueous eluent. The clean fractions were taken and evaporated under reduced pressure to low volume. The precipitate that formed was filtered, washed with water and dried in a vacuum dessicator overnight at 60° C. to afford the title compound as a pale pink solid (59 mg, 60% yield).
1H NMR (300.132 MHz, DMSO): δ 2.17 (s, 3H), 2.80 (s, 4H), 4.53 (d, 2H), 6.10 (s, 1H), 6.17-6.36 (m, 2H), 6.55-6.68 (m, 3H), 7.07 (t, 1H), 7.18 (t, 1H), 7.82 (d, 1H), 9.23 (s, 1H), 9.34 (s, 1H), 11.91 (s, 1H). MS: m/z 392 (MH+)
N′-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]-N-[(3-methylisoxazol-5-yl)methyl]pyrimidine-2,4-diamine (also known as N′-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine), used as starting material was prepared by method outlined in Example 27 (678 mg, 47% yield).
1H NMR (300.132 MHz, DMSO): δ 2.16 (s, 3H), 2.81-2.90 (m, 4H), 3.73 (s, 3H), 4.53 (d, 2H), 6.10 (s, 1H), 6.17-6.44 (m, 2H), 6.72-6.84 (m, 3H), 7.19 (t, 1H), 7.19 (s, 1H), 7.82 (d, 1H), 9.34 (s, 1H), 11.90 (s, 1H). MS: m/z 392 (MH+)
Prepared in an analogous way to example 37, but using 5-[2-(3,5-dimethoxyphenyl)ethyl]-2H-pyrazol-3-amine (124 mg, 0.42 mmol, 1.3 eq) in ethanol (5 ml). After purification (using a 25-45% gradient of acetonitrile in water containing 1% ammonium hydroxide), the fractions were evaporated to low volume. A white solid precipitated which was filtered, washed with water and dried overnight to give the title compound as a white solid (67 mg, 49% yield).
1H NMR (300.132 MHz, DMSO): δ 2.16 (s, 3H), 2.83 (s, 4H), 3.71 (s, 6H), 4.52 (d, 2H), 6.09 (s, 1H), 6.17-6.36 (m, 3H), 6.41 (m, 2H), 7.13-7.23 (m, 1H), 7.82 (d, 1H), 9.34 (s, 1H), 11.89 (s, 1H). MS: m/z 436 (MH+).
5-[2-(3,5-dimethoxy)ethyl]-2H-pyrazol-3-amine, used as starting material was prepared as follows:
1H NMR (300.132 MHz, DMSO) δ 2.64-2.82 (4H, m),3.71 (6H, s),4.07-4.72 (2H, m), 5.20 (1H, s), 6.31 (1H, t), 6.38 (2H, d). MS: m/z 248 (MH+)
To a stirred solution of N′-[5-[2-(3,5-dimethoxyphenyl)ethyl]-2H-pyrazol-3-yl]-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine (0.488 g, 1. 12 mmol) in dichloromethane (30 ml) at 0° C. under nitrogen, boron tribromide solution (1M in DCM, 5.6 ml, 5.6 mmol) was added slowly. The reaction was allowed to warm to r.t. overnight. After this time, a pale pink precipitate had formed. The reaction mixture was cooled in ice and methanol was slowly added to yield a pale yellow solution. The solution was evaporated under reduced pressure to yield a grey solid. The residue was dissolved into water and basified to pH 8 by the addition of ammonium hydroxide solution. The aqueous layer was extracted with ethyl acetate, washed with 20% aqueous ammonia, water and finally brine. It was then dried with magnesium sulphate, filtered, and evaporated under high vacuum to yield a cream solid (0.1927 g, 42%)
1H NMR (500.13 MHz, DMSO-d6) δ 2.19 (3H, s), 2.74-2.82 (4H, m), 4.59 (2H, d), 6.08-6.09 (2H, m), 6.09 (1H, s), 6.10-6.12 (2H, d), 6.14 (1H, d), 6.8 (1H, s), 7.86 (1H, d), 8.62 (2H, s), 8.90 (1H, s), 11.20 (1H, s); MS: m/z 408.53 (MH+)
N′-[5-[2-(3,5-dimethoxyphenyl)ethyl]-2H-pyrazol-3-yl]-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine, used as starting material was prepared as follows:
A mixture of 5-[2-(3,5-dimethoxyphenyl)ethyl]-2H-pyrazol-3-amine (619 mg, 2.5 mmol), 4-chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (562 mg, 2.5 mmol), and ethanol (15 ml) were stirred and heated at 80° C. for 18 hours. The precipitate was filtered and washed with ice cold ethanol and then washed with ether to give the product (0.9898 g, 91%).
5-[2-(3,5-Dimethoxyphenyl)ethyl]-2H-pyrazol-3-amine was prepared as outlined in Example 42.
4-Chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (80 mg, 0.36 mmol, 1 eq) and 5-[(3,5-dimethoxyphenoxy)methyl]-1H-pyrazol-3-amine (127 mg, 0.51 mmol, 1.4 eq) were combined in ethanol (5 ml) and heated to 80° C. for 18 hours. After this time the solution was basified using ammonium hydroxide and purifed by prep HPLC (basic system, gradient 20-40% acetonitrile in water containing 1% ammonium hydroxide). The desired fractions were combined and concentrated to give N′-[5-[(3,5-Dimethoxyphenoxy)methyl]-2H-pyrazol-3-yl]-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine (73 mg, 46%) as a white solid.
1H NMR (300.132 MHz, DMSO) δ 2.16 (s, 3H), 3.71 (s, 6H), 4.54 (s, 2H), 4.98 (s, 2H), 6.11 (t, 1H), 6.13 (s, 1H), 6.20-6.20 (m, 3H), 6.31 (s, 1H), 7.87 (d, 1H). MS m/z 438 (MH+)
5-[(3,5-Dimethoxyphenoxy)methyl]-1H-pyrazol-3-amine used as a starting material above was made in an analogous way to example 42 using methyl 2-(3,5-dimethoxyphenoxy)acetate. as a starting material (1.7 g, 30%).
1H NMR (300.132 MHz, DMSO) δ 3.70 (s, 6H), 5.08 (s, 2H), 6.13 (t, 2H), 6.18 (s, 1H), 6.19 (s, 1H). MS: m/z 250 (MH+)
3,5-Dimethoxyphenol (5 g, 32.4 mmol, 1 eq), N,N-diisopropylamine (6.78 ml, 38.9 mmol, 1.2 eq) and methyl bromoacetate (5.46 g, 35.7 mmol, 1.1 eq) were combined in DCM (100 ml) and the mixture heated to reflux (T=50° C.) for 18 hours. After this time the solution was cooled and washed with 2M HCl (3×40 ml), saturated aqueous NaHCO3 solution (3×40 ml), then brine (2×40 ml), dried (MgSO4) and concentrated to methyl 2-(3,5-dimethoxyphenoxy)acetate (5.19 g, 71%) as a colourless oil.
1H NMR (300.132 MHz, DMSO) δ 3.70 (s, 3H), 3.71 (s, 6H), 4.75 (s, 2H), 6.08-6.14 (m, 3H).
Chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine, used as starting material, was prepared as follows:—
(3-Methyl-1,2-oxazol-5-yl)methanamine (9.3 g, 83 mmol) and 2-methylsulfonylpyrimidin-4-ol (9.8 g, 69 mmol) were heated together at 160° C. for 4 h. The mixture was allowed to cool then dissolved in dichloromethane and purified by column chromatography eluting with 5-15% methanol in dichloromethane to give the desired product as a brown gum (8.88 g, 62%).
1H NMR (DMSO) δ 2.19 (s, 3H), 4.57 (s, 2H), 5.6 (d, 1H), 6.19 (s, 1H), 7.03 (bs, 1H), 7.61 (d, 1H), 11 (bs, 1H); MS: m/z 207 (MH+)
(3-methyl-1,2-oxazol-5-yl)methanamine, used as starting material, was prepared as outlined in Example 1.
A mixture of 5-[2-(2,5-dimethoxyphenyl)ethyl]-2H-pyrazol-3-amine (0.248 g, 1 mmol), 4-chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (0.225 g, 1 mmol), and ethanol (5 ml) was stirred and heated at 80° C. o/n under an inert atmosphere. A yellow precipitate formed. The suspension was allowed to cool to room temperature, filtered and washed with ice-cold ethanol (30 ml) and ether (20 ml) to give a pale yellow precipitate (0.354 g, 81%).
1H NMR (399.9 MHz, DMSO-d6) δ2.19 (3H, s), 2.82 (4H, s), 3.67 (3H, s), 3.74 (3H, s), 4.72 (2H, d), 6.28-6.38 (2H, d), 6.75 (2H, q), 6.87-6.90 (1H, m), 7.90 (1H, s), 8.88 (1H,s), 11.25 (1H, s), 12.45-12.75 (2H, d)
MS: m/z 436 (MH+)
5-[2-(2,5-Dimethoxyphenyl)ethyl]-2H-pyrazol-3-amine, used as starting material, was prepared as follows:
Sodium hydride (60%, 0.240 g, 6 mmol) was added to a stirred solution of methyl 3-(2,5-dimethoxyphenyl)propanoate (1.125 g, 5 mmol) in 1,4 dioxane (25 ml) in dry acetonitrile (0.314 ml, 6 mmol) under nitrogen. The mixture was stirred at r.t for 10 mins then heated at reflux under nitrogen for 18 h. After this time, the mixture was cooled to r.t. upon which a precipitate formed. Ethanol (2 ml) was added, followed by hydrazine monohydrochloride (0.686 g, 10 mmol). The mixture was heated to reflux for 4 h. In this time, the precipitate went into solution and a solid appeared. After filtration, the reaction mixture was concentrated in vacuo and partitioned between 2N HCl and ethyl acetate (25 ml each). The aqueous layer was basified with ammonium hydroxide solution to pH 8, extracted with ethyl acetate and dried with MgSO4. This was filtered, and the solvents were evaporated in vacuo to give an orange oil (0.690 g, 56%).
Chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine, used as starting material, was prepared as outlined in Example 44.
(3-methyl-1,2-oxazol-5-yl)methanamine, used as starting material, was prepared as outlined in Example 1.
4-Chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (80 mg, 0.36 mmol, 1 eq) and 5-[2-(3,4-dimethoxyphenyl)ethyl]-1H-pyrazol-3-amine (89 mg, 0.36 mmol, 1 eq) were combined in ethanol (5 ml) and heated to 80° C. for 24 h. The mixture was cooled to r.t. and the precipitate collected by filtration, washed with ice-cold ethanol, ether and dried under vacuum to give N′-[5-[2-(3,4-dimethoxyphenyl)ethyl]-1H-pyrazol-3-yl]-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine hydrochloride (82 mg, 48%) as an off-white solid.
1H NMR (300.132 MHz, DMSO) δ 2.18 (s, 3H), 2.83 (s, 4H), 3.71 (s, 3H), 3.72 (s, 3H), 4.68 (s, 2H), 6.20 (s, 1H), 6.26 (s, 1H), 6.38 (s, 1H), 6.69-6.72 (m, 1H), 6.80-6.84 (m, 2H), 7.87 (d, 1H). MS: m/z 436 (MH+)
Chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine, used as starting material, was prepared as outlined in Example 44.
5-[2-(3,4-dimethoxyphenyl)ethyl]-1H-pyrazol-3-amine, used as starting material, was prepared in a method analogous to that in example 42 using methyl 3-(3′,4′-dimethoxyphenyl)propanoate (5 g, 22.3 mmol) as starting material to give 5-[2-(3,4-dimethoxyphenyl)ethyl]-1H-pyrazol-3-amine (2.2 g, 40% yield) as a golden oil. MS: m/z 248 (MH+).
A mixture of 5-[2-(4-methoxy-2-methyl-phenyl)ethyl]-2H-pyrazol-3-amine (0.232 g, 1 mmol), 4-chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (0.225 g, 1 mmol), and ethanol (5 ml) was stirred and heated at 80° C. for 6 h. The yellow needle-like crystals were filtered and washed with ice-cold ethanol and then washed with ether to give the final product (0.215 g, 51%).
1H NMR (399.9 MHz, DMSO-d6) δ2.19 (3H, s), 2.25 (3H, s), 2.79 (4H, s), 3.71 (3H, s), 4.70-4.72 (2, m), 6.28 (2H, s), 6.67-6.70 (1H, m), 6.74 (1H, d), 7.05 (1H, d), 7.89-7.91 (1H, m), 8.76-8.9 (1H, s), 11.18-11.32 (1H, s), 12.39-12.50 (1H, s), 12.57-12.75 (1H, s)
MS: m/z 420.49 (MH+)
4-Chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine, used as starting material, was prepared as outlined in Example 44.
5-[2-(4-methoxy-2-methyl-phenyl)ethyl]-2H-pyrazol-3-amine, used as starting material, was prepared in a method analogous to that in example 42 using methyl 3-(4-methoxy-2-methyl-phenyl)propanoate as starting material to give 5-[2-(4-methoxy-2-methyl-phenyl)ethyl]-2H-pyrazol-3-amine as a red solid. MS: m/z 232 (MH+).
A mixture of 3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]benzonitrile (128 mg, 0.6 mmol), 4-chloro-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 135 mg, 0.6 mmol) and ethanol (5 ml) was heated at reflux for 18 h. The reaction mixture was cooled and the crystallized solid was filtered off, washed with ethanol and diethyl ether to afford the title compound as a solid (179 mg, 74.5%). 1H NMR (399.9 MHz, DMSO-d6) δ2.19 (3H, s), 2.86-3.02 (4H, m), 4.70-4.71 (2H, m), 6.29 (1H, s), 6.38 (1H, s), 7.50 (1H, t), 7.56 (1H, d), 7.66-7.70 (2H, m), 7.91 (1H, s), 8.86 (1H, s), 11.24 (1H, s), 12.42 (1H, s), 12.74 (1H, s). MS: m/z 401 (MH+).
4-Chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine, used as starting material, was prepared as outlined in Example 44.
3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]benzonitrile_used as starting material was prepared as outlined in Example 42 for 5-[2-(3,5-dimethoxy) ethyl]-2H-pyrazol-3-amine, starting from methyl-3-(3-cyanophenyl)propanoate (880 mg, 4.66 mmol) as starting material. 3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]benzonitrile was obtained as an oil (256 mg, 26%). MS: m/z 213 (MH+).
Methyl-(3-cyanophenyl)propanoate was prepared as follows: 3-(3-cyanophenyl)propanoic acid (993 mg, 4.0 mmol) in methanol (15 ml) was heated at reflux for 18 h. After evaporating under reduced pressure, the crude product was dissolved in dichloromethane, washed with saturated aqueous sodium hydrogen carbonate, brine and finally dried over magnesium sulphate. Filtration and evaporation under reduced pressure gave yield to methyl 3-(3-cyanophenyl)propanoate as an oil (1.09 g, 96%). 1H NMR (399.9 MHz, DMSO-d6) δ2.69 (2H, t), 2.94 (2H, t), 3.59 (3H, s), 7.50 (1H, t), 7.59-7.62 (1H, m), 7.66-7.68 (1H, m), 7.72-7.73 (1H, m).
Prepared in an analogous way to example 45, but starting with 5-[2-(3-fluoro-5-methyl-phenyl)ethyl]-1H-pyrazol-3-amine (143 mg, 0.52 mmol) and 4-chloro-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 117 mg, 0.52 mmol) as starting materials to afford the title compound as a white solid (85 mg, 35%). 1H NMR (499.8 MHz, DMSO-d6) δ2.21 (3H, s), 2.96 (1H, s), 2.98-2.99 (2H, m), 3.08 (2H, t), 4.72 (2H, s), 6.24 (2H, d), 6.55 (1H, d), 7.37 (2H, d), 7.42 (1H, s), 7.89 (1H, d), 10.69 (1H, s). MS: m/z 462 (MH+).
5-[2-(3-fluoro-5-methyl-phenyl)ethyl]-1H-pyrazol-3-amine used as starting material was prepared as outlined in Example 42 for 5-[2-(3,5-dimethoxy) ethyl]-2H-pyrazol-3-amine, starting from methyl 3-[3-fluoro-5-(trifluoromethyl)phenyl]propanoate (651 mg, 2.6 mmol as starting material. 5-[2-(3-fluoro-5-methyl-phenyl)ethyl]-1H-pyrazol-3-amine was obtained as a white solid (150 mg, 21%). 1H NMR (399.9 MHz, DMSO-d6) δ2.93 (2H, t), 3.05 (2H, t), 5.61 (1H, s), 7.45-7.50 (3H, m). MS: m/z 274 (MH+).
Methyl 3-[3-fluoro-5-(trifluoromethyl)phenyl]propanoate amine was prepared by reduction of methyl (E)-3-[3-fluoro-5-(trifluoromethyl)phenyl]prop-2-enoate (993 mg, 4.0 mmol) with 10% Pd/C (100 mg) in ethanol (15 ml) under a hydrogen atmosphere. After filtration through celite and evaporation methyl 3-[3-fluoro-5-(trifluoromethyl)phenyl]propanoate was obtained as an oil (650 mg, 65%). 1H NMR (399.9 MHz, DMSO-d6) δ2.73 (2H, t), 2.97 (2H, t), 3.60 (3H, s), 7.47-7.50 (3H, m)
Methyl (E)-3-[3-fluoro-5-(trifluoromethyl)phenyl]prop-2-enoate was prepared as follows:
3-fluoro-5-trifluromethylbenzaldehyde (0.999 g, 5.2 mmol) and methyl(triphenyl-phosphoranylidene)acetate (2.62 g, 7.8 mmol) in dichloromethane (25 ml) were stirred at ambient temperature for 4 h. After evaporating under reduced pressure the crude product was purified by column chromatography on silica using a gradient 2-10% of ethyl acetate in hexanes. The desired fractions were taken and evaporated to afford methyl (E)-3-[3-fluoro-5-(trifluoromethyl)phenyl]prop-2-enoate as an oil (1.08 g 84%). 1H NMR (399.9 MHz, DMSO-d6) δ3.76 (3H, s), 6.92 (1H, d), 7.68-7.74 (3H, m), 8.01-8.02 (2H, m).
2-chloro-N-(5-phenethyl-2H-pyrazol-3-yl)pyrimidin-4-amine (100 mg, 0.33 mmol, 1 eq) and 5-(aminomethyl)-1,2-oxazole-3-carboxamide trifluoroacetic acid salt (86 mg, 0.33 mmol, 1.2 eq) were combined in 2-methoxyethanol (2 ml) containing diisopropylethylamine (175 μl, 1.00 mmol, 3 eq). The reaction was heated at 170° C. in the microwave for 3 h. An additional 0.3 eq of amine (25 mg, 0.1 mmol) was added and the reaction was heated for 60 mins at 175° C. then for 60 mins at 200° C. The solvent was evaporated under reduced pressure. The residue was extracted into ethyl acetate and washed with water and brine. Dried with magnesium sulphate, filtered and evaporated. The compound was then purified by basic reverse phase prep. HPLC. The desired fractions were taken, evaporated to afford the title compound as a solid (25.8 mg, 19%)
1H NMR (300.132 MHz, DMSO) δ2.76-2.96 (4H, m), 4.61 (2H, d), 6.31 (2H, s), 6.52 (1H, s), 7.14-7.33 (6H, m), 7.73 (1H, s), 7.83 (1H, d), 8.02 (1H, s), 9.36 (1H, s), 11.93 (1H, s) MS: M/Z 405,(MH+)
2-chloro-N-(5-phenethyl-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material was prepared as outlined in Example 30a).
5-(Aminomethyl)-1,2-oxazole-3-carboxamide was synthesized as outlined in Example 4.
Prepared in an analogous way to example 38 but starting with 5-[2-[3-(trifluoromethoxy)phenyl]ethyl]-1H-pyrazol-3-amine (112 mg, 0.50 mmol, 1 eq). The title compound was isolated as a solid (88.6 mg, 39% yield).
1H NMR (300.132 MHz, DMSO): δ 2.16 (s, 3H), 2.81-3.01 (m, 4H), 4.53 (d, 2H), 6.11 (s, 1H), 6.18-6.36 (m, 2H), 7.15-7.30 (m, 4H), 7.42 (t, 1H), 7.83 (d, 1H), 9.36 (s, 1H), 11.91 (s, 1H). MS: m/z 460 (MH+).
5-[2-[3-(trifluoromethoxy)phenyl]ethyl]-1H-pyrazol-3-amine used as starting material, was prepared as outlined in Example 42 for 5-[2-(3,5-dimethoxy)ethyl]-2H-pyrazol-3-amine, but using ethyl 3-[3-(trifluoromethoxy)phenyl]propanoate to afford a brown oil (620 mg, 10% yield)
1H NMR (300.132 MHz, CDCl3): δ 2.86 (t, 2H), 2.93 (t, 2H), 5.44 (s, 1H), 7.03-7.10 (m, 3H), 7.30 (t, 2H). MS: m/z 272 (MH+).
Ethyl 3-[3-(trifluoromethoxy)phenyl]propanoate was prepared as follows:
Trans Isomer: 95%
1H NMR (300.132 MHz, CDCl3): δ 1.34 (t, 3H), 4.28 (q, 2H), 6.45 (d, 1H), 7.16-7.29 (m, 1H), 7.31-7.51 (m, 3H), 7.65 (d, 1H).
Cis Isomer: 5%
1H NMR (300.132 MHz, CDCl3): δ 1.23 (t, 3H), 4.17 (q, 2H), 6.01 (d, 1H), 6.90 (d, 1H), 7.17-7.51 (m, 4H).
(Yield 5.75 g, 99%)
1H NMR (300.132 MHz, CDCl3): δ 1.23 (t, 3H), 2.62 (t, 2H), 2.97 (t, 2H), 4.13 (q, 2H), 7.00-7.16 (m, 3H), 7.23-7.35 (m, 1H).
Prepared using an analogous method to example 46, but starting with 5-[2-(3-methylphenyl)ethyl]-1H-pyrazol-3-amine (77 mg, 0.36 mmol) to give the title compound (51 mg, 32% yield)
1H NMR (300.132 MHz, DMSO) δ 2.18 (s, 3H), 3.85 (s, 3H), 4.72 (s, 2H), 5.06 (s, 2H), 6.27 (s, 1H), 6.37 (s, 1H), 6.97-7.03 (m, 1H), 7.16-7.26 (m, 2H), 7.91 (d, 1H). MS: m/z 390 (MH+)
5-[2-(3-Methylphenyl)ethyl]-1H-pyrazol-3-amine, used as a starting material, was prepared using an analogous method to example 34a), but starting with methyl 3-(3-methylphenyl)propanoate (4 g, 22.4 mmol) to give 5-[2-(3-Methylphenyl)ethyl]-1H-pyrazol-3-amine (3.1 g, 69%) as a brown gum. MS: m/z 202 (MH+)
Methyl 3-(3-methylphenyl)propanoate was prepared using a method analogous to example 31a), using 3-(3-methylphenyl)propanoic acid (7 g, 42.6 mmol) to give methyl 3-(3-methylphenyl)propanoate (7 g, 92%) as a colourless oil.
1H NMR (300.132 MHz, CDCl3) δ 2.25 (s, 3H), 2.54 (t, 2H), 2.84 (t, 2H), 3.59 (s, 3H), 6.91-6.95 (m, 3H), 7.07-7.12 (m, 1H). MS: N/A
Prepared using an analogous method to example 46, but starting with 5-[2-(3-bromophenyl)ethyl]-1H-pyrazol-3-amine (95 mg, 0.36 mmol) to give the title compound (82 mg, 46% yield)
1H NMR (300.132 MHz, DMSO) δ 2.18 (s, 3H), 2.89 (s, 4H), 4.70 (s, 2H), 6.16-6.33 (m, 2H), 6.38 (s, 1H), 7.19-7.26 (m, 2H), 7.35-7.40 (m, 1H), 7.43 (s, 1H), 7.86 (d, 1H). MS: m/z 456 (MH+)
5-[2-(3-bromophenyl)ethyl]-1H-pyrazol-3-amine, used as a starting material, was prepared using an analogous method to example 34a), but starting with methyl 3-(3-bromophenyl)propanoate (7 g, 28.8 mmol) to give 5-[2-(3-bromophenyl)ethyl]-1H-pyrazol-3-amine (4.9 g, 60%) as a brown gum. MS: m/z 280 ((M−H)−)
Methyl 3-(3-bromophenyl)propanoate was prepared using a method analogous to example 31a), using 3-(3-bromophenyl)propanoic acid (10 g, 43.6 mmol) to give methyl 3-(3-bromophenyl)propanoate (10 g, 94%) as a colourless oil. 7.03-7.10 (m, 2H), 7.25-7.26 (m, 2H).
Prepared in an analogous way to example 38, but starting with (5-(2-benzo[1,3]dioxol-5-ylethyl)-2H-pyrazol-3-amine (128 mg, 0.55 mmol, 1 eq). The HCl salt precipitated out of the reaction mixture on cooling and was filtered and dried. The product was suspended in water and basified by the addition of ammonium hydroxide solution before extraction into ethyl acetate. The organic layer was separated, washed with saturated sodium hydrogen carbonate and then brine. Dried with magnesium sulphate, filtered and evaporated to afford the title compound as a solid. (132.1 mg, 57% yield).
1H NMR (300.132 MHz, DMSO): δ 2.17 (s, 3H), 2.76-2.84 (m, 4H), 4.53 (d, 2H), 5.96 (s, 2H), 6.10 (s, 1H), 6.26 (s, 2H), 6.68 (dd, 1H), 6.78-6.82 (m, 2H), 7.19 (s, 1H), 7.83 (d, 1H), 9.34 (s, 1H), 11.88 (s, 1H). MS: m/z 420 (MH+).
(5-(2-Benzo[1,3]dioxol-5-ylethyl)-2H-pyrazol-3-amine used as starting material was prepared in a similar manner to 5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-amine in example 27a). Product was obtained as yellow oil. (3.04 g, 44% yield).
1H NMR (300.132 MHz, DMSO): δ 2.63-2.79 (m, 4H), 4.40 (s, 2H), 5.18 (s, 1H), 5.95 (s, 2H), 6.66 (dd, 1H), 6.77-6.81 (m, 2H). MS: m/z 232 (MH+).
Prepared in an analogous way to example 38, but starting with 5-[2-(3-morpholin-4-ylphenyl)ethyl]-1H-pyrazol-3-amine (112 mg, 0.50 mmol, 1 eq). The title compound was isolated as a white solid (105.7 mg, 53% yield).
1H NMR (300.132 MHz, DMSO): δ 2.16 (s, 3H), 2.83 (s, 4H), 3.07 (t, 4H), 3.71 (t, 4H), 4.53 (d, 2H), 6.10 (s, 1H), 6.21-6.36 (m, 2H), 6.69 (d, 1H), 6.76 (dd, 1H), 6.81 (s, 1H), 7.13 (t, 1H), 7.14 (m, 1H), 7.82 (d, 1H), 9.34 (s, 1H), 11.89 (s, 1H).
MS: m/z 461 (MH+).
5-[2-(3-morpholin-4-ylphenyl)ethyl]-1H-pyrazol-3-amine (470 mg, 85% yield) used as starting material was prepared in a similar manner to 5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-amine in example 27a) using ethyl 3-(3-morpholin-4-ylphenyl)propanoate as starting material.
1H NMR (300.132 MHz, DMSO): δ 2.64-2.83 (m, 4H), 3.08 (t, 4H), 3.73 (t, 4H), 4.40 (s, 2H), 5.20 (s, 1H), 6.67 (d, 1H), 6.75 (dd, 1H), 6.79 (s, 1H), 7.12 (t, 1H), 11.06 (s, 1H). MS: m/z 273 (MH+).
Ethyl 3-(3-morpholin-4-ylphenyl)propanoate was prepared as follows:
1H NMR (300.132 MHz, DMSO): δ 3.13 (t, 4H), 3.23 (s, 3H), 3.56 (s, 3H), 3.74 (t, 4H), 6.98 (d, 1H), 7.06 (m, 2H), 7.29 (m, 1H). MS: m/z 251 (MH+).
1H NMR (300.132 MHz, DMSO): δ 3.19 (t, 4H), 3.76 (t, 4H), 7.29-7.35 (m, 2H), 7.42-7.49 (m, 2H), 9.95 (s, 1H). MS: m/z 192 (MH+).
1H NMR (300.132 MHz, DMSO): δ 1.26 (t, 3H), 3.16 (t, 4H), 3.74 (t, 4H), 4.19 (q, 2H), 6.64 (d, 1H), 7.01 (dd, 1H), 7.13 (d, 1H), 7.24-7.30 (m, 2H), 7.60 (d, 1H).
MS: m/z 262 (MH+).
1HNMR (300.132 MHz, CDCl3): δ 1.24 (t, 3H), 2.61 (t, 2H), 2.91 (t, 2H), 3.15 (t, 4H), 3.85 (t, 4H), 4.13 (q, 2H), 6.70-6.79 (m, 3H), 7.16-7.22 (m, 1H). MS: m/z 264 (MH+).
N-[(3-Cyclopropyl-1,2-oxazol-5-yl)methyl]-N′-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidine-2,4-diamine (191 mg) was dissolved in DCM (20 ml) and cooled to 0° C. under nitrogen. Boron tribromide solution was added dropwise and the reaction was allowed to warm to room temperature and stirred overnight. The reaction was quenched carefully with methanol (10 ml) and the solution was evaporated to dryness. The crude product was loaded onto a SCX-2 column, washed with methanol and then eluted with 2N ammonia in methanol to give the product as a yellow gum. Trituration with ether gave a white solid, which was then filtered and dried in a vacuum oven at 45° C. overnight (130 mg, 71%). 1H NMR (DMSO 400.13 MHz) δ 0.69 (m, 2H), 0.95 (m, 2H), 1.93 (m, 1H), 2.79 (s, 4H), 4.51 (d, 2H), 6.0 (s, 1H), 6.28 (bs, 1H), 6.57 (m, 1H), 6.65 (m, 2H), 7.05 (t, 1H), 7.15 (bs, 1H), 7.83 (d, 1H), 9.21 (s, 1H), 9.35 (bs, 1H), 11.92 (s, 1H)
MS: m/z 418 (MH+).
N-[(3-Cyclopropyl-1,2-oxazol-5-yl)methyl]-N′-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidine-2,4-diamine used as starting material was prepared as in Example 28.
A mixture of 5-[2-(3-chloro-5-fluoro-phenyl)ethyl]-2H-pyrazol-3-amine (0.096 g, 0.4 mmol), 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (0.090 g, 0.4 mmol) and ethanol (5 ml) was stirred and heated in a microwave at 120° C. for 30 mins. On cooling the product precipitated out. This was filtered, washed with ice cold ethanol (5 ml) and ether (2 ml) to give a pale yellow solid. The crude product was purified by reverse-phase prep. HPLC (basic) using a 31-51% gradient of acetonitrile in water containing 1% ammonium hydroxide solution, and a white solid was obtained (0.054 g, 32%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.17 (3H, s), 2.88 (4H, m), 4.54 (2H, s), 6.10- 6.40 (2H, d), 7.10 (1H, d), 7.20-7.30 (2H, m), 7.80 (1H, d), 9.35-9.50 (1H, s), 11.90-12.00 (1H, s) MS: m/z 428.38 (MH+)
5-[2-(3-Chloro-5-fluoro-phenyl)ethyl]-2H-pyrazol-3-amine, used as starting material was prepared as follows:—
Sodium hydride (60%, 0.288 g, 7.20 mmol) was added to a stirred solution of methyl 3-(3-chloro-5-fluoro-phenyl)propanoate (1.3 g, 6.0 mmol) in 1,4 dioxane (30 ml) and dry acetonitrile (0.377 ml, 7.20 mmol) under nitrogen. The mixture was stirred at r.t. for 10 mins and then refluxed (under nitrogen) overnight. After this time, the mixture was cooled to r.t. and ethanol (3 ml) was added, followed by hydrazine monohydrochloride (0.823 g, 12.0 mmol). The mixture was then refluxed overnight. The reaction mixture was allowed to cool to room temperature and filtered. The solution was concentrated in vacuo and then partitioned between 2N HCl and ethyl acetate (25 ml each). The aqueous layer was extracted with ethyl acetate and basified with ammonium hydroxide solution to pH 8. This was then extracted using ethyl acetate, washed with water and brine, dried (MgSO4), filtered and evaporated to dryness to give a dark orange gum. This was purified by reverse phase prep. HPLC (basic) using a 28-38% gradient of acetonitrile in water containing 1% ammonium hydroxide solution, and a white solid was obtained (0.1 15 g, 8%).
Methyl 3-(3-chloro-5-fluoro-phenyl)propanoate, used as starting material in the synthesis of 5-[2-(3-chloro-5-fluoro-phenyl)ethyl]-2H-pyrazol-3-amine was prepared as follows:—
A solution of 3-(3-chloro-5-fluorophenyl)propionic acid (1.015 g, 5 mmol) in a mixture of toluene: methanol (10 ml:5 ml) was treated dropwise at room temperature with 2M (Trimethylsilane)diazomethane (3 ml). The reaction mixture was stirred under nitrogen for 1 h and the solution was evaporated to dryness to give the crude product. The crude product was dissolved in DCM and washed with sodium bicarbonate, water, brine and dried with MgSO4. After filtration the solvent was evaporated off to give methyl 3-(3-chloro-5-fluoro-phenyl)propanoate (0.794 g product, 73%).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
Lithium aluminium hydride (72 mg, 1.88 mmol) was added to a suspension of 3-[2-[5-[[2-[(3-methyl-1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-2H-pyrazol-3-yl]ethyl]benzonitrile (301 mg, 0.75 mmol) in anhydrous tetrahydrofuran (30 ml). The reaction mixture was stirred at room temperature for 2 h. The reaction was quenched by neutralisation to pH 6-7 at 0° C. with 1M hydrochloric acid, evaporated to dryness and purified on an SCX 2 column. Product was eluted using 3.5N ammonia in methanol. After evaporation under reduced pressure the crude product was purified by reverse phase prep. HPLC (acidic) using a 5-95% gradient of acetonitrile in water containing 1% formic acid, followed by reverse phase prep HPLC (basic) using a gradient 0-95% of acetonitrile in water containing 1% ammonia The clean fractions were taken and evaporated to afford N′-[5-[2-[3-(aminomethyl)phenyl]ethyl]-1H-pyrazol-3-yl]-N-[(3-methyl-i ,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine as a white solid (23. lmg, 7.6%).
1H NMR (500.13 MHz, DMSO-d6) δ 2.17 (3H, s), 2.85 (2H, d), 2.90 (1H, d), 2.91 (1H, s), 3.83 (2H, s), 4.54 (2H, d), 6.12 (1H, s), 7.16 (1H, d), 7.21 (2H, d), 7.26 (1H, s), 7.28 (2H, t), 7.84 (1H, d). MS: m/z 405 (MH+).
3-[2-[5-[[2-[(3-Methyl-1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-2H-pyrazol-3-yl]ethyl]benzonitrile was prepared as described in Example 48.
Prepared in an analogous way to example 108, starting from of 3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]-N,N-dimethyl-benzamide (130 mg, 0.45 mmol) and 4-chloro-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 113 mg, 0.5 mmol). Purified by reverse phase prep. HPLC (acidic) using a 0-95% gradient of acetonitrile in water containing 1% formic acid. The clean fractions were taken and evaporated to afford the title compound as a white solid (60 mg, 27%).
1H NMR (500.13 MHz, DMSO-d6) δ 2.16 (3H, s), 2.86-2.92 (2H, m), 2.90 (6H, s), 2.93-2.99 (2H, m), 4.54 (2H, d), 6.03 (1H, s), 6.08 (1H, s), 6.26 (1H, d), 6.76 (1H, s), 7.17 (1H, d), 7.20 (1H, s), 7.75-7.83 (2H, m), 7.85 (1H, d), 8.89 (1H, s). MS: m/z 447 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]-N,N-dimethyl-benzamide used as starting material was prepared using an analogous procedure to that for 5-[2-(3,5-dimethoxy)ethyl]-2H-pyrazol-3-amine) in Example 42, starting from methyl 3-[3-(dimethylcarbamoyl)phenyl]propanoate (1.3 g, 6.85 mmol), sodium hydride (329 mg dispersion in mineral oil, 8.22 mmol), acetonitrile (430 μL, 8.22 mmol) and hydrazine monohydrochloride (939 mg, 13.7 mmol). The crude product was purified by normal phase chromatography on silica gel using a 50-100% gradient of ethyl acetate in hexanes. The clean fractions were taken and evaporated to afford 3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]-N,N-dimethyl-benzamide as a yellow gum (485 mg, 27%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.72-2.76 (2H, m), 2.84-2.89 (6H, m), 2.90 (2H, m), 4.40 (2H, s), 5.18 (1H, s), 7.19-7.22 (1H, m), 7.27-7.30 (1H, m), 7.32 (1H, s), 7.35 (1H, d), 11.0 (1H, s). MS: m/z 259 (MH+).
Methyl 3-[3-(dimethylcarbamoyl)phenyl]propanoate was prepared from the reduction of methyl (E)-3-[3-(dimethylcarbamoyl)phenyl]prop-2-enoate (2.335 g, 10.0 mmol) with 10% Pd/C (234 mg) in ethanol (50 ml) under a hydrogen atmosphere. Filtered through celite, evaporated to afford to afford methyl 3-[3-(dimethylcarbamoyl)phenyl]propanoate as an oil (1.35 g, 55%). 1H NMR (399.9 MHz, DMSO-d6) δ2.67 (2H, t), 2.90 (6H, t), 2.98 (2H, s), 3.59 (3H, s), 7.20-7.40 (4H, m) ). MS: m/z 236 (MH+).
Methyl (E)-3-[3-(dimethylcarbamoyl)phenyl]prop-2-enoate was prepared using an 25 analogous procedure to that for methyl (E)-3-[3-fluoro-5-(trifluoromethyl)phenyl]prop-2-enoate in Example 49, starting from 3-formyl-N,N-dimethyl-benzamide (3.015 g, 17 mmol) and methyl(triphenyl-phosphoranylidene)acetate (8.53 g, 25.5 mmol) in dichloromethane (35 ml). The crude product was purified by normal phase chromatography on silica gel using a 0-2.5% gradient of methanol in dichloromethane, followed by a silica gel column using a 50-75% gradient of ethyl acetate in hexanes. The clean fractions were taken and evaporated to afford methyl (E)-3-[3-(dimethylcarbamoyl)phenyl]prop-2-enoate as a gum (2.4 g 64%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.90-2.95 (3H, s), 2.95-3.05 (3H, s), 3.75 (3H, s), 6.70-6.75 (1H, d), 7.40-7.50 (2H, m), 7.65-7.75 (1H, d), 7.75 (1H, t), 7.80 (1H, d).
Prepared using an analogous procedure to that in Example 57, starting from 5-[2-(2,4-dimethoxypyrimidin-5-yl)ethyl]-1H-pyrazol-3-amine (100 mg, 0.40 mmol) and 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (90 mg, 0.40 mmol). Purified by reverse phase prep. HPLC (basic) using a 2.5-97.5% gradient of acetonitrile in water containing 1% ammonia. The clean fractions were taken and evaporated to affordthe title compound as a white solid (68 mg, 39%).
1H NMR (399.9 MHz, DMSO-d6) δ2.18 (3H, d), 2.76-2.79 (4H, m), 3.87 (3H, s), 3.94 (3H, s), 4.52 (2H, d), 6.10 (1H, s), 6.29 (2H, s), 7.19 (1H, s), 7.83 (1H, d), 8.03 (1H, s), 9.34 (1H, s), 11.89 (1H, s). MS: m/z 438 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[2-(2,4-dimethoxypyrimidin-5-yl)ethyl]-1H-pyrazol-3-amine used as starting material was prepared using an analogous procedure to that for 5-[2-(3,5-dimethoxy)ethyl]-2H-pyrazol-3-amine) in Example 42, starting from methyl 3-(2,4-dimethoxypyrimidin-5-yl)propanoate (611 mg, 2.7 mmol), sodium hydride (130 mg dispersion in mineral oil, 3.24 mmol), acetonitrile (430 uL, 8.22 mmol) and hydrazine monohydrochloride (370 mg, 5.4 mmol). The crude product was purified by normal phase chromatography on silica gel using a 0-20% gradient of methanol in dichloromethane. The clean fractions were taken and evaporated to afford 5-[2-(2,4-dimethoxypyrimidin-5-yl)ethyl]-1H-pyrazol-3-amine as an oil (139 mg, 19%). 1H NMR (399.9 MHz, DMSO-d6) δ2.65-2.71 (4H, m), 3.87 (3H, s), 3.93 (3H, s), 4.44 (2H, s), 5.17 (1H, s), 8.03 (1H, s), 10.91 (1H, s).
MS: m/z 250 (MH+).
Methyl 3-(2,4-dimethoxypyrimidin-5-yl)propanoate used as starting material was prepared using an analogous procedure to that for methyl 3-[3-(dimethylcarbamoyl)phenyl]propanoate in Example 59 starting from methyl (E)-3-(2,4-dimethoxypyrimidin-5-yl)prop-2-enoate (774 mg, 3.45 mmol) with 5% Pt/C (80 mg) in N,N-dimethylformamide (10 ml) under a hydrogen atmosphere. Filtered through celite, evaporated to afford to afford methyl 3-(2,4-dimethoxypyrimidin-5-yl)propanoate as an oil (611 m g, 78%). 1H NMR (399.9 MHz, DMSO-d6) δ2.55-2.59 (1H, m), 2.57-2.58 (1H, m), 2.68-2.72 (2H, m), 3.59 (3H, s), 3.87 (3H, s), 3.93 (3H, s), 8.13 (1H, s)
Methyl (E)-3-(2,4-dimethoxypyrimidin-5-yl)prop-2-enoate was prepared as follows:
A suspension (E)-3-(2,4-dimethoxypyrimidin-5-yl)prop-2-enoic acid (1.05 g, 5.0 mmol) in a mixture of methanol (5 ml) and toluene (10 ml), was treated at ambient temperature with a solution of trimethylsilyl diazomethane (2M in hexanes, 3.0 ml, 6.0 mmol). Stirred for 1 hour and evaporated to afford methyl (E)-3-(2,4-dimethoxypyrimidin-5-yl)prop-2-enoate as a solid (0.77 g, 69%). 1H NMR (399.9 MHz, DMSO-d6) δ3.73 (3H, s), 3.96 (3H, s), 3.99-4.09 (3H, m), 6.69 (1H, d), 7.55 (1H, d), 8.73 (1H, s).
To 2-chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine (250 mg, 0.76 mmoles) was added [5-(aminomethyl)-1,2-oxazol-3-yl]methanol (146 mg) followed by 2-methoxyethanol (4 ml) and diisopropylethylamine (265 ml). The reaction mixture was heated in the microwave at 200° C. for 60 mins. The solvent was evaporated under reduced pressure. The crude product was purified by flash chromatogephy using a silica column, eluting with 5-10% methanol in dichloromethane. Desired fractions were combined and evaporated to give product as a yellow foam 287 mg (90%).
1H NMR (DMSO 400.13 MHz) δ 2.85 (m, 4H), 3.72 (s, 3H), 4.44 (d, 2H), 4.56 (d, 2H), 5.36 (t, 1H), 6.21 (s, 1H), 6.29 (bs, 1H), 6.75 (m, 1H), 6.81 (m, 2H), 7.19 (t, 1H), 7.81 (d, 1H), 9.32 (bs, 1H), 11.9 (s, 1H)
MS: m/z 422 (MH+)
2-chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material was prepared as in Example 27.
[5-(aminomethyl)-1,2-oxazol-3-yl]methanol, used as starting material was prepared as follows:
tert-butyl N-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methyl]carbamate (3.36 g, 14.72 mmoles) was dissolved in dichloromethane (67 ml) and trifluoroacetic acid (5.47 ml) was added. The reaction was stirred at room temperature for 2d. The mixture was evaporated to dryness, loaded onto a SCX-2 column and washed with methanol. The product was eluted with 3.5N ammonia in methanol to give product as a white solid (after trituration with diethyl ether) (1.24 g, 66%).
tert-butyl N-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methyl]carbamate was prepared as follows:—
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate (5 g, 18.50 mmoles) was dissolved in ethanol (50 ml) and cooled to 0° C. Sodium borohydride (1.89 g, 49.95 mmoles) was added portionwise and the reaction was stirred at room temperature overnight. The mixture was quenched with aqueous sodium bicarbonate solution. The mixture was then extracted with ethyl acetate, washed with brine, dried (MgSO4) and evaporated to give the product as a colouress oil (4.22 g, 100%).
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate, used as starting material, was prepared as follows:—
Tert-butyl N-prop-2-ynylcarbamate (40.97 g, 0.26mol, 1 eq) was dissolved in anhydrous THF (150 mL) and N,N-diethylethanamine (22 mL, 0.16 mol, 1.2 eq) added. A solution of ethyl-2-chloro-2-hydroxyimino-acetate (20 g, 0. 13mol, 1 eq) in anhydrous THF (350mL) was added dropwise over 7 h. The reaction was stirred at room temperature overnight then evaporated to dryness. The residue was dissolved in DCM and washed with water, brine and dried (MgSO4). After filtration, the solution was evaporated to give the crude product as a yellow oil. This was purified by silica column chromatography, eluting with 20% -60% ether in iso-hexane to give ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate as a white solid (20.12 g, 56%).
1H NMR (CDCl3 400.13 MHz) δ 1.39-1.47 (12H, m), 4.40-4.49 (5H, m), 5.0 (1H, s), 6.58 (1H, s). MS m/z 269 (M−H).
5-[2-(5-fluoro-2-methoxy-pyridin-4-yl)ethyl]-1H-pyrazol-3-amine (60 mg, 0.254 mmol) was heated with 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (58 mg, 0.254 mmol) in ethanol (1.5 ml) at 80° C. for 24 h. The mixture was allowed to cool to room temperature and the precipitated solid was collected by filtration, washed with ethanol and dried under vacuum to afford the title compound as an off-white solid (58 mg, 50% yield).
1H NMR (399.902 MHz, DMSO) δ 2.19 (s, 3H), 2.93 (s, 4H), 3.80 (s, 3H), 4.70 (d, 2H), 6.20-6.45 (bm, 3H), 6.74 (d, 1H), 7.89 (bs, 1H), 8.06 (d, 1H), 8.78 (bs, 1H), 11.21 (bs, 1H), 12.47 (bs, 1H), 12.56 (bs, 1H). MS: m/z 425 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[2-(5-fluoro-2-methoxy-pyridin-4-yl)ethyl]-1H-pyrazol-3-amine, used as starting material was prepared as follows:
Methyl 3-(5-fluoro-2-methoxy-pyridin-4-yl)propanoate (260 mg, 1.22 mmol) and acetonitrile (78 μl, 1.46 mmol) were stirred in anhydrous 1,4-dioxane (6 ml) under nitrogen. Sodium hydride (60% dispersion on mineral oil, 59 mg, 1.46 mmol) was added and the mixture was stirred at room temperature for 10 mins, then heated at reflux for 16 h. After cooling to room temperature, ethanol (1 ml) was added followed by hydrazine monohydrochloride (168 mg, 2.44 mmol) and the mixture was heated again at reflux for 24 h. The mixture was evaporated to dryness and the residue was purified on a silica isolute column, eluting with 0-3% methanol in DCM, to afford 5-[2-(5-fluoro-2-methoxy-pyridin-4-yl)ethyl]-1H-pyrazol-3-amine as a yellow solid (128 mg, 40% yield).
1H NMR (399.902 MHz, CDCl3) δ 2.84-2.94 (m, 4H), 3.87 (s, 3H), 5.46 (s, 1H), 6.53 (d, 1H), 7.92 (d, 1H). MS: m/z 237 (MH+).
Methyl 3-(5-fluoro-2-methoxy-pyridin-4-yl)propanoate, used as starting material was prepared as follows:
10% Pd/C (25 mg) was added to a solution of methyl 3-(5-fluoro-2-methoxy-pyridin-4-yl)prop-2-enoate (315 mg, 1.49 mmol) in ethanol (25 ml) and the mixture was stirred at room temperature under a balloon of hydrogen for 1 h. The mixture was filtered, washed through with ethanol and the filtrate evaporated under vacuum to afford methyl 3-(5-fluoro-2-methoxy-pyridin-4-yl)propanoate as a colourless oil (296 mg, 93% yield).
1H NMR (399.902 MHz, CDCl3) δ 2.65 (t, 2H), 2.94 (t, 2H), 3.69 (s, 3H), 3.88 (s, 3H), 6.58 (d, 1H), 7.91 (d, 1H). MS: m/z 214 (MH+)
Methyl 3-(5-fluoro-2-methoxy-pyridin-4-yl)prop-2-enoate, used as starting material was prepared as follows:
Methyl 2-triphenylphosphoranylideneacetate (1.52 g, 4.54 mmol) was added portionwise to a stirred solution of 5-fluoro-2-methoxy-pyridine-4-carbaldehyde (470 mg, 3.03 mmol) in DCM (10 ml) under nitrogen. Stirring was continued at room temperature for 16 h. The solution was evaporated and the crude product was adsorbed onto silica, then purified on a silica isolute column, eluting with 2-4% ethyl acetate in hexane, to afford methyl 3-(5-fluoro-2-methoxy-pyridin-4-yl)prop-2-enoate as a white solid (330 mg, 52% yield).
1H NMR (399.902 MHz, DMSO) δ 3.77 (s, 3H), 3.86 (s, 3H), 6.91 (d, 1H), 7.32 (d, 1H), 7.60 (d, 1H), 8.26 (d, 1H). MS: m/z 212 (MH+)
5-Fluoro-2-methoxy-pyridine-4-carbaldehyde, used as starting material was prepared as follows:
(5-Fluoro-2-methoxy-pyridin-4-yl)methanol (1.40 g, 8.91 mmol) was stirred in DCM (50 ml). Dess-Martin periodinane (4.535 g, 10.69 mmol) in DCM (70 ml) was added slowly and stirring continued at room temperature for 1.5 h. The solution was then washed with 1M NaOH(aq) (2×75 ml), water (75 ml), brine, dried over MgSO4, filtered and evaporated to afford 5-fluoro-2-methoxy-pyridine-4-carbaldehyde as a yellow oil (0.481 g, 35% yield).
1H NMR (399.902 MHz, CDCl3) δ 3.94 (s, 3H), 7.08-7.11 (m, 1H), 8.20-8.22 (m, 1H), 10.32 (s, 1H).
(5-Fluoro-2-methoxy-pyridin-4-yl)methanol, used as starting material was prepared as follows:—
Borane-tetrahydrofuran complex (1M solution in THF, 52.6 ml, 52.6 mmol) was added slowly to a solution of 5-fluoro-2-methoxy-pyridine-4-carboxylic acid (2 g, 11.7 mmol) in THF (100 ml) under nitrogen. The reaction mixture was stirred at room temperature for 2.5 h. The solvent was then evaporated and the residue was stirred in methanol (40 ml) for 16 h. The solvent was evaporated and the residue was purified on a silica isolute column, eluting with 0-1% MeOH in DCM to afford (5-fluoro-2-methoxy-pyridin-4-yl)methanol as a white solid (1.42 g, 77% yield).
1H NMR (399.902 MHz, CDCl3) δ 3.90 (s, 3H), 4.76 (s, 2H), 6.84-6.87 (m, 1H), 7.92 (d, 1H). MS: m/z 158 (MH+)
3-[2-[5-[[2-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]ethyl]phenol (97 mg, 0.24 mmoles) was suspended in DCM (5 ml) and thionyl chloride (87 μL, 1.19 mmoles) was added. The reaction was stirred at room temperature overnight. A further amount of thionyl chloride (87 [L, 1.19 mmoles) was added and the reaction was stirred for 2 h. The mixture was evaporated to dryness and then 2M dimethylamine solution in THF (5 ml) was added. The mixture was heated at 75° C. for 3 h. The mixture was evaporated to dryness. Purification by silica column chromatography, eluting with 5-10% methanol (containing 10% 7N ammonia in methanol) in dichloromethane, gave the crude product. The crude product was purified by reverse-phase prep. HPLC (basic) using a 5-98% gradient of acetonitrile in water containing 1% ammonium hydroxide solution, and a solid was obtained (26 mg 25%).
1H NMR (DMSO 400.13 MHz) δ 2.16 (s, 6H), 2.84 (s, 4H), 3.45 (s, 2H), 4.61 (d, 2H), 6.21 (s, 1H), 6.31 (bs, 1H), 6.63 (m, 1H), 6.70 (m, 2H), 7.11 (t, 1H), 7.25 (bs, 1H), 7.38 (d, 1H), 9.40 (bs, 1H), 11.96 (bs, 1H)
MS: m/z 435 (MH+).
3-[2-[5-[[2-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]ethyl]phenol, used as starting material was prepared as follows:—
[5-[[[4-[[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]amino]pyrimidin-2-yl]amino]methyl]-1,2-oxazol-3-yl]methanol (120 mg, 0.28 mmoles) was dissolved in DCM (6 ml) and cooled to 0° C. under nitrogen. Boron tribromide solution (1M in DCM, 1.42 ml, 1.42 mmoles) was added dropwise and the reaction was allowed to warm to room temperature and stirred overnight. A further amount of boron tribromide (0.3 ml) was subsequently added. After 5 h, the reaction mixture was quenched with methanol (10 ml). The yellow solution was stirred for 1 h then evaporated to dryness. The crude product was loaded onto a SCX-2 column, washed with methanol. The product was eluted with 3.5N ammonia in methanol to give the desired crude product as a yellow foam after evaporation (97 mg, 85%). The product was used further without any purification.
MS: m/z 408 (MH+).
[5-[[[4-[[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]amino]pyrimidin-2-yl]amino]methyl]-1,2-oxazol-3-yl]methanol was prepared as in Example 61.
To 2-chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine(100 mg, 0.30 mmoles) was added 5-(aminomethyl)-N-methyl-1,2-oxazole-3-carboxamide (88 mg, 0.45 mmoles) followed by 2-methoxyethanol (3 ml) and diisopropylethylamine (159 μL). The reaction was heated in the microwave at 200° C. for 60 mins. The solvent was evaporated under reduced pressure. The crude product was purified by silica column chromatography, eluting with 5-10% methanol in dichloromethane. Desired fractions were combined and evaporated to give the product as a yellow foam. Trituration with diethyl ether and filtration gave a pale yellow solid (80 mg (60%)
1H NMR (DMSO 400.13 MHz) δ 2.64 (d, 3H), 2.75 (m, 4H), 3.64 (s, 3H), 4.52 (d, 2H), 6.21 (bs, 1H), 6.43 (s, 1H), 6.64 (m, 1H), 6.7 (m, 2H), 7.08 (t, 1H), 7.15 (s, 1H), 7.73 (d, 1H), 8.48 (d, 1H), 9.25 (s, 1H), 11.82 (s, 1H)
MS: m/z 449 (MH+).
2-chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material was prepared as in Example 27.
5-(aminomethyl)-N-methyl-1,2-oxazole-3-carboxamide, used as starting material was prepared as follows:—
tert-Butyl N-[[3-(methylcarbamoyl)-1,2-oxazol-5-yl]methyl]carbamate (928 mg, 3.63 mmol, 1 eq) was dissolved in dichloromethane (10 mL). 6M HCl in propanol (1 mL) was added and the reaction was stirred at room temperature for 6 h. The mixture was evaporated to dryness, triturated with DCM, filtered and washed with diethyl ether to give 5-(aminomethyl)-N-methyl-1,2-oxazole-3-carboxamide. HCl salt as a white solid (532 mg, 77%).
1H NMR (400.13 MHz DMSO) δ 2.78 (3H, d), 4.32 (3H, s), 6.93 (1H, s), 8.77 (4H, m). MS m/z 156 (MH+).
tert-Butyl N-[[3-(methylcarbamoyl)-1,2-oxazol-5-yl]methyl]carbamate, used as starting material was prepared as follows:—
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate (1 g, 3.7 mmol, 1 eq) was dissolved in 2M methylamine in THF (5mL) and stirred at room temperature overnight. The mixture was evaporated to dryness, triturated with diethyl ether and dried to give the product as a white solid (929 mg, 98%).
1H NMR (CDCl3 400.13 MHz) δ 1.43 (9H, s), 2.99 (3H, d), 4.45 (2H, d), 4.98 (1H, s), 6.6 (1H, s), 6.75 (1H, s). MS m/z 254 (M−H).
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate used as starting material was prepared as shown in Example 61.
5-[[[4-[[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]amino]pyrimidin-2-yl]amino]methyl]-N-methyl-1,2-oxazole-3-carboxamide (70 mg, 0.16 mmoles) was dissolved in DCM (7 ml) and cooled to 0° C. under nitrogen. Boron tribromide (0.8 ml, 0.78 mmoles) solution was added dropwise and the reaction was allowed to warm to room temperature and stirred for 3 h. The reaction mixture was quenched carefully with methanol (5 ml) and the solution was evaporated to dryness. The crude product was loaded onto a SCX-2 column, washed with methanol and eluted with 2N ammonia in methanol to give the product as a yellow gum. Trituration with ether gave a cream solid which was filtered and dried in a vacuum oven at 45° C. (52 mg (75%).
1H NMR (DMSO 500.13 MHz @373K) d 2.7 (d, 3H), 2.79 (s, 4H), 4.6 (d, 2H), 6.28 (bs, 1H), 6.51 (s, 1H), 6.55 (m, 1H), 6.62 (m, 2H), 7.04 (t, 1H), 7.28 (bs, 1H), 7.81 (d, 1H), 8.56 (d, 1H), 9.2 (s, 1H), 9.38 (bs, 1H), 11.9 (bs, 1H)
MS: m/z 435 (MH+).
5-[[[4-[[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]amino]pyrimidin-2-yl]amino]methyl]-N-methyl-1,2-oxazole-3-carboxamide used as starting material, was prepared as in Example 64.
2-chloro-N-[5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine (60 mg, 0. 17 mmol, 1 eq) was dissolved in 2-methoxyethanol (5 ml) and (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride (50 mg, 0.34 mmol, 2 eq) and N-ethyl-N-propan-2-yl-propan-2-amine (103 μl, 0.59 mmol, 3.5 eq) were added. The mixture was heated to 180° C. for 90 mins in the microwave reactor. The solvent was evaporated under reduced pressure and the residue purified by basic reverse-phase prep HPLC (gradient 25-75% MeCN in 1% aq NH3). Clean fractions were evaporated to afford N-[(3-methyl-1,2-oxazol-5-yl)methyl]-N′-[5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidine-2,4-diamine (25.4 mg, 35%) as a beige solid.
1H NMR (399.902 MHz, DMSO) δ 1.17 (d, J=6.0 Hz, 6H), 2.10 (s, 3H), 2.78 (m, 4H), 3.21 (s, 1H), 4.48 (m, 3H), 6.03 (s, 1H), 6.21 (s, 1H), 6.68 (m, 3H), 7.10 (m, 2H), 7.75 (d, J=5.8 Hz, 1H), 9.27 (s, 1H), 11.83 (s, 1H). MS: m/z=434 (MH+)
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
2-chloro-N-[5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine used a starting material was prepared as follows:—
2,4-dichloropyrimidine (177 mg, 1.2 mmol, 1 eq) was dissolved in ethanol (5 ml) and N-ethyl-N-propan-2-yl-propan-2-amine (0.25 ml, 1.4 mmol, 1.2 eq) and 5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-amine (290 mg, 1.3 mmol, 1.1 eq) were added. The mixture was stirred at 50° C. for 3 days. The reaction mixture was added slowly to water (10 ml), sonicated and left to stand overnight. The red-brown precipitate was collected by filtration, washed with water and dried in vacuo. The precipitate was dissolved in a minimum amount of methanol, water was added dropwise and the colourless precipitate was filtered and washed with water and dried in vacuo to give 2-chloro-N-[5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine (121.6 mg, 29%) as a colourless solid.
1H NMR (399.902 MHz, DMSO) δ 1.17 (d, J=6.0 Hz, 6H), 2.81 (s, 4H), 4.49 (septet, J=6.0 Hz, 1H), 6.02 (s, 1H), 6.69 (m, 4H), 7.10 (t,J=8.1 Hz, 1H), 8.09 (d, J=5.8 Hz, 1H), 10.22 (s, 1H). MS: m/z=358 (MH+).
5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-amine was prepared as follows:—
Methyl 3-(3-propan-2-yloxyphenyl)propanoate (680 mg, 3.1 mmol, 1 eq) was dissolved in 1,4-dioxane (20 ml). Sodium hydride (60% suspension) (147 mg, 3.7 mmol, 1.2 eq) and dry acetonitrile (0. 19 ml, 3.7 mmol, 1.2 eq) were added. The solution was stirred at room temperature for 10 mins and then at 100° C. overnight. The mixture was cooled to room temperature and dry ethanol (2 ml) and hydrazine hydrochloride (420 mg, 6.1 mmol, 2 eq) were added. The mixture was refluxed overnight, cooled, evaporated and then partitioned between 1M HCl and EtOAc. The aqueous layer was basified with conc. ammonia then extracted with EtOAc. The organic extracts were combined and washed with water then brine, dried and evaporated. The crude product was purified by silica column chromatography, eluting with 0.5-7% MeOH in DCM. The clean fractions were evaporated to yield 5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-amine (296 mg, 39%) as a brown oil.
1H NMR (399.902 MHz, DMSO) δ 1.18 (d, J=5.7 Hz, 6H), 2.63 (m, 2H), 2.73 (m, 2H), 4.33 (bs, 1H), 4.50 (septet, J=6.0 Hz, 1H), 5.12 (s, 1H), 6.66 (m, 3H), 7.08 (t, J=8.1 Hz, 1H), 11.03 (bs, 1H). MS: m/z=246 (MH+).
Methyl 3-(3-propan-2-yloxyphenyl)propanoate was prepared as follows:—
Methyl 3-(3-hydroxyphenyl)propanoate (1 g, 5.5 mmol, 1 eq) was dissolved in dry acetone (20 ml) and anhydrous potassium carbonate (921 mg, 6.7 mmol, 1.2 eq) and 2-iodopropane (0.67 ml, 6.7 mmol, 1.2 eq) were added. The mixture was heated to 55° C. under nitrogen for 24 h. Further potassium carbonate (844 mg, 5.6 mmol, 1 eq) and 2-iodopropane (0.4 ml, 4.0 mmol, 0.8 eq) were then added and stirring at 56° C. was continued for 24 h. The solvent was evaporated and the residue dissolved in water (25 ml). The solution was extracted with diethyl ether (3×10 ml) and the extracts were combined, dried and evaporated. The crude product was purified by silica column chromatography, eluting with 0-10% MeOH in DCM. The pure fractions were combined, evaporated and dried to give methyl 3-(3-propan-2-yloxyphenyl)propanoate (686 mg, 56%) as a yellow oil.
1H NMR (399.902 MHz, DMSO) δ 1.18 (d, J=5.9 Hz, 6H), 2.55 (t, J=7.6 Hz, 2H), 2.74 (t, J=7.6 Hz, 2H), 3.52 (s, 3H), 4.51 (septet, J=6.0 Hz, 1H), 6.67 (m, 3H), 7.09 (t, J=8.0 Hz, 1H).
Methyl 3-(3-hydroxyphenyl)propanoate was prepared as follows:—
3-(3-hydroxyphenyl)propanoic acid (3 g, 18.0 mmol, 1 eq) was dissolved in dry DMF (50 ml) and to this was added potassium hydrogen carbonate (2.17 g, 21.7 mmol, 1.2 eq). The reaction mixture was stirred at room temperature under nitrogen for 10 mins. Methyl iodide (1.24 ml, 19.9 mmol, 1.1 eq) was then added and the mixture was heated at 40° C. overnight. The solvent was evaporated and the residue dissolved in diethyl ether and washed with water followed, by ammonium chloride solution, dried and evaporated to give methyl 3-(3-hydroxyphenyl)propanoate (3.205 g, 98%) as a brown oil.
1H NMR (399.902 MHz, DMSO) δ 2.59 (t, J=7.9 Hz, 2H), 2.77 (t, J=7.7 Hz, 2H), 3.59 (s, 3H), 6.60 (m, 3H), 7.06 (m, 1H), 9.24 (s, 1H). MS: m/z=179 (M−H+)
2-chloro-N-[5-[2-[3-(cyclopropylmethoxy)phenyl]ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine (100 mg, 0.27 mmol, 1 eq) was dissolved in 2-methoxyethanol and 5-(aminomethyl)-1,2-oxazole-3-carboxamide hydrochloride (97 mg, 54 mmol, 2 eq) and N-ethyl-N-propan-2-yl-propan-2-amine (165 μl, 0.95 mmol, 3.5 eq) were added. The mixture was heated to 180° C. for 105 mins in the microwave reactor. The solvent was evaporated under reduced pressure and the residue purified on basic reverse phase prep HPLC (gradient 25-85% MeCN in 1% aq NH3). The clean fractions were evaporated to give 5-[[[4-[[5-[2-[3-(cyclopropylmethoxy)phenyl]ethyl]-1H-pyrazol-3-yl]amino]pyrimidin-2-yl]amino]methyl]-1,2-oxazole-3-carboxamide (14.8 mg, 12%) as a beige solid.
1H NMR (399.902 MHz, DMSO) δ 0.22 (m, 2H), 0.47 (m, 2H), 1.13 (m, 1H), 2.78 (m, 4H), 3.70 (d, J=7.1 Hz, 2H), 4.54 (d, J=5.8 Hz, 2H), 6.24 (s, 1H), 6.45 (s, 1H), 7.10 (t, J=8.0 Hz, 1H), 7.19 (s, 1H), 7.66 (s, 1H), 7.76 (d, J=5.7 Hz, 1H), 9.30 (s, 1H), 11.84 (s, 1H). MS: m/z=475 (MH+).
5-(Aminomethyl)-1,2-oxazole-3-carboxamide hydrochloride used a starting material was prepared as follows:—
Tert-butyl N-[(3-carbamoyl-1,2-oxazol-5-yl)methyl]carbamate (1.6 g, 6.63 mmol, 1 eq) was dissolved in dichloromethane (32 mL). 6M HCl in propanol (1.6 mL) was added and the reaction was stirred at room temperature for 6 h. The mixture was evaporated to dryness, triturated with DCM, filtered and washed with diethyl ether to give 5-(aminomethyl)-1,2-oxazole-3-carboxamide hydrochloride salt as white solid (1. 17 g, 100%).
1H NMR (400.13 MHz DMSO) δ 4.38 (2H, s), 6.40 (1H, s), 7.85 (1H, s), 8.15 (1H, s), 8.76 (3H, s)
tert-Butyl N-[(3-carbamoyl-1,2-oxazol-5-yl)methyl]carbamate used as starting material was prepared as follows:—
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate (2 g, 7.4 mmol, 1 eq) was dissolved in 3.5N ammonia in methanol (10 mL) and stirred at room temperature overnight. The mixture was evaporated to dryness, triturated with diethyl ether and dried on the filter to give product as a white solid (1.6 g, 90%).
1H NMR (CDCl3 400.13 MHz) δ 1.44 (9H, s), 4.45 (2H, d), 4.96 (1H, s), 5.58 (1H, s), 6.61 (1H, s), 6.65 (1H, s). MS m/z 240 (M−H).
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate used as starting material was prepared as follows:—
tert-butyl N-prop-2-ynylcarbamate (40.97 g, 0.26 mol, 1 eq) was dissolved in anhydrous THF (150 mL) and N,N-diethylethanamine (22 mL, 0. 16 mol, 1.2 eq) added. A solution of ethylchlorooximidoacetate (20 g, 0.13 mol, 1 eq) in anhydrous THF (350 mL) was added dropwise over 7 h. The reaction was stirred at room temperature overnight then evaporated to dryness. The residue was dissolved in DCM and washed with water, brine and dried (MgSO4). After filtration, the solution was evaporated to give the crude product as a yellow oil. This was purified by silica column chromatography, eluting with 20% -60% ether in iso-hexane to give ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate as a white solid (20.12 g, 56%).
1H NMR (CDCl3 400.13 MHz) δ 1.39-1.47 (12H, m), 4.40-4.49 (5H, m), 5.0 (1H, s), 6.58 (1H, s). MS m/z 269 (M−H).
tert-butyl N-prop-2-ynylcarbamate, used as starting material was prepared as follows:—
(2-Methylpropan-2-yl)oxycarbonyl tert-butyl carbonate (99.3 g, 455 mmol) was added portion wise over 30 mins to a stirred solution of prop-2-yn-1-amine (25 g, 455 mmol) in anhydrous diethyl ether (500 mL) at 0-10° C. The mixture was allowed to reach room temperature and stirred under an atmosphere of nitrogen for 72 h. The reaction mixture was evaporated to dryness, triturated at −10° C. with hexanes (400 ml), filtered to give a solid, washed with hexane and dried to afford of tert-butyl N-prop-2-ynylcarbamate as white crystalline solid (62.5 g, 88.5%). 1H NMR (399.9 MHz, CDCl3) 6 1.41-1.51 (9H, m), 2.22 (1H, t), 3.92 (2H, d), 4.75 (1H, s)
2-Chloro-N-[5-[2-[3-(cyclopropylmethoxy)phenyl]ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine was prepared as follows:—
5-[2-[3-(cyclopropylmethoxy)phenyl]ethyl]-1H-pyrazol-3-amine (560 mg, 2.4 mmol, 1. 1 eq) was dissolved in ethanol (10 ml) and N-ethyl-N-propan-2-yl-propan-2-amine (0.46 ml, 2.6 mmol, 1.2 eq) and 2,4-dichloropyrimidine (325 mg, 2.2 mmol, 1.0 eq) were added. The mixture was stirred at 40° C. for 3 days. The reaction mixture was, added slowly to water (30 ml), sonicated and the precipitate was collected by filtration, washed (2:1 mixture of water and MeOH) and dried in vacuo to yield 2-chloro-N-[5-[2-[3-(cyclopropylmethoxy)phenyl]ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine (380 mg, 47%) as a beige solid.
1H NMR (399.902 MHz, DMSO) δ 0.23 (m, 2H), 0.48 (m, 2H), 1.12 (m, 1H), 2.81 (m, 4H), 3.71 (d, J=7.0 Hz, 2H), 6.01 (bs, 1H), 6.69 (m, 3H), 7.10 (m, 1H), 8.09 (d, J=5.7 Hz, 1H), 10.20 (s, 1H), 12.12 (s, 1H). MS: m/z=370 (MH+).
5-[2-[3-(cyclopropylmethoxy)phenyl]ethyl]-1H-pyrazol-3-amine was prepared as follows:—
LDA (3.61 ml, 7.2 mmol, 2.0 eq) was added to dry THF (15 ml) and the solution was cooled to −78° C. Acetonitrile (377 μl, 7.2 mmol, 2.0 eq) was added dropwise and the mixture was stirred for 10 mins. Methyl 3-[3-(cyclopropylmethoxy)phenyl]propanoate (845 mg, 3.6 mmol, 1.0 eq) in THF (5 ml) was added quickly and after 10 mins the mixture was allowed to warm up to room temperature. The mixture was quenched with 1 N HCl (20 ml), extracted with diethyl ether (3×20 ml), dried and evaporated. The residue was dissolved in ethanol (20 ml), hydrazine (350 μl, 7.2 mmol, 2.0 eq) was added and the solution was refluxed for 24 h. The reaction mixture was cooled, evaporated to dryness, dissolved in water (30 ml) and extracted with diethyl ether (3×20 ml). The extracts were combined, dried and evaporated to dryness. The residue was purified by silica column chromatography, eluting with 3-8% MeOH in DCM. The desired fractions were combined and evaporated to yield 5-[2-[3-(cyclopropylmethoxy)phenyl]ethyl]-1H-pyrazol-3-amine (568 mg, 61%) as a brown oil.
1H NMR (399.902 MHz, DMSO) δ 0.24 (m, 2H), 0.49 (m, 2H), 1.13 (m, 1H), 2.64 (m, 2H), 2.73 (m, 2H), 3.71 (d, J=7.0 Hz, 2H), 4.25 (bs, 2H), 5.13 (bs, 1H), 6.67 (m, 3H), 7.09 (t, J=8.1 Hz, 1H), 11.00 (bs, 1H). MS: m/z=258 (MH+).
Methyl 3-[3-(cyclopropylmethoxy)phenyl]propanoate was prepared as follows:—
Methyl 3-(3-hydroxyphenyl)propanoate (1 g, 5.5 mmol, 1.0 eq) was dissolved in dry acetone (20 ml) and anhydrous potassium carbonate (1.54 g, 11.1 mmol, 2.0 eq), potassium iodide (185 mg 1.1 mmol, 0.2 eq) and (bromomethyl)cyclopropane (1.08 ml, 11.1 mmol, 2.0 eq) were added. The mixture was stirred at 55° C. under nitrogen for 2 days. The reaction mixture was cooled to room temperature, evaporated to dryness and the residue was dissolved in water (25 ml) and extracted with diethyl ether (3×10 ml). The extracts were combined, dried (MgSO4) and evaporated to dryness. The residue was dissolved in a small amount of DCM and purified by silica column chromatography, eluting with DCM. The pure fractions were combined and evaporated to give methyl 3-[3-(cyclopropylmethoxy)phenyl]propanoate (856 mg, 66%) as a colourless oil.
1H NMR (399.902 MHz, DMSO) δ 0.24 (m, 2H), 0.49 (m, 2H), 1.13 (m, 1H), 2.55 (t, J=7.7 Hz, 2H), 2.74 (t, J=7.6 Hz, 2H), 3.52 (s, 3H), 3.72 (d, J=7.0 Hz, 2H), 6.66 (m, 1H), 6.68 (m, 1H), 6.71 (m, 1H), 7.09 (t, J=7.8 Hz, 1H). MS: m/z=235 (MH+).
Methyl 3-(3-hydroxyphenyl)propanoate was prepared as follows:—
3-(3-hydroxyphenyl)propanoic acid (3 g, 18.0 mmol, 1 eq) was dissolved in dry DMF (50 ml), potassium hydrogen carbonate (2.17 g, 21.7 mmol, 1.2 eq) was added and the mixture was stirred at room temperature under nitrogen for 10 mins. Methyl iodide (1.24 ml, 19.9 mmol, 1.1 eq) was added and the mixture was heated at 40° C. overnight. The solvent was evaporated and the residue dissolved in diethyl ether and washed with water followed, by ammonium chloride solution, dried and evaporated to give methyl 3-(3-hydroxyphenyl)propanoate (3.205 g, 98%) as a brown oil.
1H NMR (399.902 MHz, DMSO) 6 2.59 (t, J=7.9 Hz, 2H), 2.77 (t, J=7.7 Hz, 2H), 3.59 (s, 3H), 6.60 (m, 3H), 7.06 (m, 1H), 9.24 (s, 1H). MS: m/z=179 (M−H+)
4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (72.4 mg, 0.32 mmol, 1 eq) was added to a stirred solution of 5-(2-(2,6-dimethoxypyridin-4-yl)ethyl)-1H-pyrazol-3-amine (80 mg, 0.32 mmol, 1 eq) in ethanol (5 ml) at room temperature. The resulting solution was stirred at 80° C. for 45 h. The reaction mixture was cooled and a precipitate formed. The mixture was filtered and the solid washed with ethanol to afford N′-[5-[2-(2,6-dimethoxypyridin-4-yl)ethyl]-1H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine (59.3 mg) as a white solid. The filtrate was concentrated and further product (32.0 mg) precipitated and was collected by filtration.
1H NMR (399.902 MHz, DMSO) δ 2.24 (s, 3H), 2.90 (m, 4H), 3.87 (s, 6H), 4.75 (d, J=5.7 Hz, 2H), 6.29 (s, 2H), 6.32 (s, 1H), 6.43 (s, 1H), 7.95 (s, 1H), 8.86 (s, 1H), 11.26 (s, 1H), 12.47 (s, 1H), 12.70 (s, 1H). MS: m/z=437 (MH+)
5-(2-(2,6-dimethoxypyridin-4-yl)ethyl)-1H-pyrazol-3-amine used as starting material was prepared as follows:—
Acetonitrile (0.209 mL, 4.00 mmol, 2 eq) was added dropwise to a stirred solution of lithium diisopropylamide (2.220 mL, 4.00 mmol, 2 eq) in THF (15 mL) cooled to −78° C., over a period of 1 minute under nitrogen. The resulting solution was stirred for 10 mins. A solution of methyl 3-(2,6-dimethoxypyridin-4-yl)propanoate (450 mg, 2.00 mmol, 1 eq) in THF (15 mL) was added. The resulting solution was stirred at −78° C. for 30 mins, then allowed to warm to room temperature. Ethanol (20 mL) and hydrazine hydrochloride (301 mg, 4.40 mmol, 2.2 eq) were added and the solution was refluxed for 18 h. The reaction mixture was evaporated to dryness, redissolved in Et2O (20 mL) and washed with water (3×10 mL). The organic layer was dried over MgSO4, filtered and evaporated to afford crude product. The crude product was purified by silica column chromatography, eluting with a gradient of 2-8% MeOH in DCM. Pure fractions were evaporated to dryness to afford 5-(2-(2,6-dimethoxypyridin-4-yl)ethyl)-1H-pyrazol-3-amine (385 mg, 1.55 mmol, 78%) as a colourless oil which crystallised upon standing.
1H NMR (399.902 MHz, DMSO) δ 2.74 (m, 4H), 3.82 (s, 6H), 4.41 (bs, 2H), 5.18 (bs, 1H), 6.24 (s, 2H), 11.06 (bs, 1H) MS: m/z=249 (MH+)
Methyl 3-(2,6-dimethoxypyridin-4-yl)propanoate prepared as follows:—
(E)-methyl 3-(2,6-dimethoxypyridin-4-yl)acrylate (400 mg, 1.79 mmol) and Pd/C 10% (50 mg) in ethanol (50 mL) were stirred under an atmosphere of hydrogen at room temperature for 18 h. The reaction mixture was filtered to remove the catalyst and the fitrate evaporated under reduced pressure to give methyl 3-(2,6-dimethoxypyridin-4-yl)propanoate (400 mg, 99%).
1H NMR (399.902 MHz, DMSO) δ 2.69 (t, J=7.7 Hz, 2H), 2.83 (t, J=7.5 Hz, 2H), 3.64 (s, 3H), 3.87 (s, 6H), 6.30 (s, 2H) Plus ethanol. MS: m/z=226 (MH+)
(E)-methyl 3-(2,6-dimethoxypyridin-4-yl)acrylate was prepared as follows:—
2,6-dimethoxypyridine-4-carbaldehyde (580 mg, 3.5 mmol, 1 eq) was dissolved in DCM (12 ml) under nitrogen and methyl (triphenylphosphoranylidene)acetate (1.745 g, 5.2 mmol, 1.5 eq) was added portionwise. The mixture was stirred at room temperature overnight and then evaporated to dryness. The crude product was purified by silica column chromatography, eluting with 3-10% EtOAc in isohexane. The desired fractions were combined and evaporated to give (E)-methyl 3-(2,6-dimethoxypyridin-4-yl)acrylate (464 mg, 60%) as a pale yellow solid.
1H NMR (399.902 MHz, DMSO) δ 3.68 (s, 3H), 3.80 (s, 6H), 6.65 (s, 2H), 6.76 (d, J=16.2 Hz, 1H), 7.47 (d, J=16.2 Hz, 1H). MS: m/z=224 (MH+)
2,6-dimethoxypyridine-4-carbaldehyde was prepared as follows:—
(2,6-dimethoxypyridin-4-yl)methanol (620 mg, 3.7 mmol, 1 eq) was stirred in dry DCM (30 ml) under nitrogen. Dess Martin periodinane (1.87 g, 4.4 mmol, 1.2 eq) in DCM (30 ml) was slowly added and the mixture was stirred for 30 mins. The solution was washed with NaOH (aq) followed by water, dried (MgSO4) and evaporated to give 2,6-dimethoxypyridine-4-carbaldehyde (587 mg, 96%) as a purple solid.
1H NMR (399.902 MHz, DMSO) δ 3.98 (s, 6H), 6.86 (s, 2H), 10.03 (s, 1H). MS: m/z=168 (MH+).
(2,6-Dimethoxypyridin-4-yl)methanol was prepared as follows:—
Crude 2,6-dimethoxypyridine-4-carboxylic acid (65 mol% by NMR) (1.5 g, 8.2 mmol, 1 eq) was dissolved in dry THF (100 ml) under nitrogen and BH3.THF adduct (1M in THF; 36.8 ml, 36.8 mmol, 4.5 eq) was added dropwise. The reaction was stirred at room temperature for 2.5 h. The solvent was evaporated and methanol (30 ml) was then added. The solution was stirred at room temperature for 30 mins then evaporated to dryness. The resulting oil was purified by silica column chromatography, eluting with 0-1% MeOH in DCM. Desired fractions were combined and evaporated to give (2,6-dimethoxypyridin-4-yl)methanol (536 mg, 39%) as a colourless solid.
1H NMR (399.902 MHz, DMSO) δ 3.81 (s, 6H), 4.42 (d, J=5.9 Hz, 2H), 5.29 (t, J=5.9 Hz, 1H), 6.29 (s, 2H). MS: m/z=170 (MH+).
2,6-Dimethoxypyridine-4-carboxylic acid was prepared as follows:—
2,6-Dichloropyridine-4-carboxylic acid (3 g, 15.6 mmol, 1 eq)) was dissolved in dry DMF (40 ml) and sodium methoxide (2.96 g, 54.7 mmol, 3.5 eq) added under nitrogen. The mixture was heated under reflux for 7.5 h, then cooled. A further 1.4 g sodium methoxide was added and the reaction mixture was refluxed overnight. A further 1.7 g sodium methoxide was added and the reaction mixture was refluxed for a further 4.5 h. The reaction mixture was cooled, added to an equal volume of ice-water and acidified. The precipitate was collected by filtration, washed with water to give crude 2,6-dimethoxypyridine-4-carboxylic acid (2.7 g, 98% but only 65 mol%) as a yellow solid.
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
tert-butyl N-[3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]phenyl]carbamate (100 mg, 0.3 mmol, 1 eq) was dissolved in ethanol and 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (75 mg, 0.3 mmol, 1 eq) was added. The mixture was stirred at 80° C. for 40 h. The reaction mixture was evaporated and the residue purified by basic prep. HPLC, eluting with acetonitrile in water with 1% ammonia. 10 ml HCl (4 M) in dioxane was added and the solution was stirred at room temperature for 1 h The solvent was evaporated and the residue was dissolved in dichloromethane (20 ml), washed with saturated NaHCO3 solution (20 ml), dried (MgSO4), evaporated and dried in vacuo to give N′-[5-[2-(3-aminophenyl)ethyl]-1H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine (81.6 mg, 63%) as a yellow solid.
1H NMR (399.902 MHz, DMSO) δ 2.22 (s, 3H), 2.81 (m, 4H), 4.59 (d, J=6.2 Hz, 2H), 4.99 (bs, 1H), 6.17 (s, 1H), 6.31 (bs, 1H), 6.47 (m, 3H), 6.97 (t, J=7.8 Hz, 1H), 7.28 (bs, 1H), 7.88 (d, J=5.7 Hz, 1H), 9.44 (bs, 1H), 11.97 (bs, 1H). MS: m/z=391 (MH+)
tert-butyl N-[3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]phenyl]carbamate used as starting material was prepared as follows:—
LDA (3.58 ml, 7.2 mmol, 4.0 eq) was added to THF (20 ml) and the mixture cooled to −78° C. Acetonitrile (374 μl, 7.2 mmol, 4.0 eq) was slowly added and the solution stirred for 10 mins. Methyl 3-[3-[(2-methylpropan-2-yl)oxycarbonylamino]phenyl]propanoate (500 mg, 1.8 mmol, 1.0 eq) was rapidly added. The reaction was stirred for 30 mins, then allowed to warm to room temperature. The mixture was quenched with 1 N HCl (30 ml) at 0° C., quickly extracted with diethyl ether (3×20 ml), dried over MgSO4 and evaporated. The residue was dissolved in ethanol and hydrazine monohydrate (174 μl, 3.6 mmol, 2.0 eq) was added. The solution was refluxed for 24 h. The reaction mixture was cooled, evaporated to dryness, dissolved in water and extracted with diethyl ether. The extracts were combined, dried (MgSO4), evaporated and dried in vacuo to give tert-butyl N-[3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]phenyl]carbamate (500 mg, 92%) as a yellow solid.
1H NMR (399.902 MHz, DMSO) δ 1.53 (s, 10H), 2.74 (m, 2H), 2.83 (m, 2H), 4.37 (bs, 1H), 5.26 (bs, 1H), 6.88 (d, J=7.7 Hz, 1H), 7.19 (t, J=7.8 Hz, 1H), 7.29 (d, J=7.7 Hz, 1H), 7.44 (s, 1H), 9.28 (s, 1H), 11.15 (bs, 1H). MS: m/z=303 (MH+).
Methyl 3-[3-[(2-methylpropan-2-yl)oxycarbonylamino]phenyl]propanoate was prepared as follows:—
3-[3-[(2-Methylpropan-2-yl)oxycarbonylamino]phenyl]propanoic acid (3 g, 11.3 mmol, 1.0 eq) was dissolved in dry DMF (50 ml) and potassium hydrogen carbonate (2.17 g, 13.6 mmol, 1.2 eq) was added. The mixture was stirred at room temperature under nitrogen for 10 mins. Methyl iodide (0.78 ml, 12.44 mmol, 1.1 eq) was added and the mixture was heated at 40° C. overnight. The solvent was evaporated and the residue dissolved in diethyl ether (30 ml), washed with water (20 ml), washed with saturated ammonium chloride solution (20 ml), dried (MgSO4) and evaporated to give methyl 3-[3-[(2-methylpropan-2-yl)oxycarbonylamino]phenyl]propanoate (3.08 g, 97%) as a pale yellow solid.
1H NMR (399.902 MHz, DMSO) δ 1.53 (s, 9H), 2.64 (t, J=7.6 Hz, 3H), 2.85 (t, J=7.6 Hz, 2H), 3.64 (s, 3H), 6.87 (d, J=7.5 Hz, 1H), 7.20 (t, J=7.8 Hz, 1H), 7.30 (d, J=8.4 Hz, 1H), 7.39 (s, 1H), 9.29 (s, 1H). MS: m/z=224 (MH+ minus t-butyl group).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
To 2-chloro-N-[5-[2-(3-chloro-5-methoxy-phenyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine (60 mg, 0. 16 mmol, 1 eq) was added 5-(aminomethyl)-1,2-oxazole-3-carboxamide hydrochloride (44 mg, 0.25 mmol, 1.5 eq) followed by 2-methoxyethanol (3 ml) and N-ethyl-N-propan-2-yl-propan-2-amine (87[L, 0.49 mmol, 3 eq). The reaction was heated in the microwave at 190° C. for 60 mins. The solvent was evaporated under reduced pressure and the crude product was purified by preparative HPLC using decreasingly polar mixtures of water (containing 1% ammonium hydroxide) and MeCN as eluents to give title compound as a white solid (56 mg, 76%).
1H NMR (DMSO 400.13 MHz) δ 2.87 (4H, m), 3.75 (3H, s), 4.60 (2H, d), 6.31 (1H, s), 6.52 (1H, s), 6.78 (1H, s), 6.83 (1H, s), 6.89 (1H, s), 7.34 (1H, s), 7.73 (1H, s), 7.83 (1H, s), 8.00 (1H, s), 9.36 (1H, s), 11.91 (1H, s). MS m/z 469 (MH+).
2-Chloro-N- {5-[2-(3-chloro-5-methoxyphenyl)ethyl]-1H-pyrazol-3-yl}pyrimidin-4-amine, used as starting material was prepared as follows:—
5-[2-(3-Chloro-5-methoxyphenyl)ethyl]-1H-pyrazol-3-amine (193 mg, 0.765 mmol) was stirred with N-ethyl-N-propan-2-yl-propan-2-amine (267[l, 1.53 mmol) and 2,4-dichloropyrimidine (1 14 mg, 0.765 mmol) in ethanol (5 ml) under nitrogen. The solution was heated at 50° C. for 4 days. The solution was concentrated under vacuum and water added to the residue. The mixture was then evaporated to dryness. The residue was then triturated with DCM (one drop methanol) and filtered to afford the product, 2-chloro-N- {5-[2-(3-chloro-5-methoxyphenyl)ethyl]-1H-pyrazol-3-yl}pyrimidin-4-amine, as a white solid (27 mg, 11%). The filtrate was evaporated and purified by silica column chromatography, eluting with 1-3% MeOH in DCM to afford a further crop of the product as a white solid (125 mg, 51% yield).
1H NMR (399.902 MHz, DMSO) δ 2.90 (s, 4H), 3.76 (s, 3H), 6.11 (bs, 1H), 6.78-6.81 (m, 1H), 6.84-6.87 (m, 1H), 6.89-6.92 (m, 1H), 7.21 (bs, 1H), 8.16 (d, 1H), 10.28 (s, 1H), 12.20 (s, 1H); m/z (ES+) [M+H]+=364.
5-[2-(3-Chloro-5-methoxyphenyl)ethyl]-1H-pyrazol-3-amine, used as starting material was prepared as follows:—
Methyl 3-(3-chloro-5-methoxyphenyl)propanoate (880 mg, 3.85 mmol) and acetonitrile (242 μl, 4.62 mmol) were stirred in 1,4-dioxane (16 ml) under nitrogen. Sodium hydride (111 mg, 60% dispersion on mineral oil, 2.78 mmol) was added and the mixture was stirred at room temperature for 10 mins, then refluxed under nitrogen for 18 h. The mixture was allowed to cool to room temperature, ethanol (2 ml) was then added followed by hydrazine monohydrochloride (528 mg, 7.70 mmol) and the mixture was refluxed for 22 h. The mixture was concentrated under vacuum and the residue was partitioned between ethyl acetate (10 ml) and 2M HCl(aq) (15 ml). The organic phase was then washed with sat. aq. NaHCO3, dried over MgSO4, filtered, evaporated and purified by silica column chromatography, eluting with 0-3.5% MeOH in DCM to afford 5-[2-(3-chloro-5-methoxyphenyl)ethyl]-1H-pyrazol-3-amine as a light brown gum (414 mg, 43%).
1H NMR (399.902 MHz, DMSO) δ 2.65-2.86 (m, 4H), 3.75 (s, 3H), 4.42 (bs, 2H), 5.19 (s, 1H), 6.75-6.78 (m, 1H), 6.82-6.85 (m, 1H), 6.86 (s, 1H), 11.03 (bs, 1H); m/z (ES+) [M+H]+=252.
Methyl 3-(3-chloro-5-methoxyphenyl)propanoate, used as starting material was prepared as follows:—
Platinum(IV) oxide (36 mg, 0.155 mmol) was added to a solution of methyl 3-(3-chloro-5-methoxy-phenyl)prop-2-enoate (880 mg, 3.88 mmol) in ethyl acetate (45 ml) and the mixture was stirred at room temperature under a hydrogen balloon for 20 h. The catalyst was removed by filtration, washed with ethyl acetate and the filtrate was evaporated to afford methyl 3-(3-chloro-5-methoxyphenyl)propanoate as a colourless oil (0.89 g, quant. yield).
1H NMR (399.902 MHz, CDCl3) δ 2.61 (t, 2H), 2.89 (t, 2H), 3.68 (s, 3H), 3.77 (s, 3H), 6.62-6.64 (m, 1H), 6.73-6.75 (m, 1H), 6.77-6.79 (m, 1H); m/z (ES+) [M+Na]+=251.
Methyl 3-(3-chloro-5-methoxy-phenyl)prop-2-enoate, used as starting material was prepared as follows:—
Methyl (triphenylphosphoranylidene)acetate (2.95 g, 8.79 mmol) was added portionwise to a stirred solution of 3-chloro-5-methoxybenzaldehyde (1 g, 5.86 mmol) in DCM (25 ml) under nitrogen. The reaction mixture was stirred at room temperature for 18 h. The solution was then evaporated to dryness. The residue was purified by silica column chromatography, eluting with 2-3% ethyl acetate in hexane. Product fractions were combined and evaporated to afford methyl 3-(3-chloro-5-methoxy-phenyl)prop-2-enoate as a white solid (1.13 g, 85% yield).
1H NMR (399.902 MHz, CDCl3) δ 3.81 (s, 3H), 3.82 (s, 3H), 6.41 (d, 1H), 6.91 (d, 2H), 7.10 (t, 1H), 7.57 (d, 1H).
5-(Aminomethyl)-1,2-oxazole-3-carboxamide hydrochloride used as starting material was prepared as in Example 123.
5-(2-(5-methoxypyridin-3-yl)ethyl)-1H-pyrazol-3-amine (113 mg, 0.52 mmol, 1 eq), 4-chloro-N-[[3-(chloromethyl)-1,2-oxazol-5-yl]methyl]pyrimidin-2-amine (134 mg, 0.52 mmol, 1 eq) and 4M HCl in dioxane (0.065 ml, 0.26 mmol, 0.5 eq) were dissolved in 2-propanol (3 ml) and sealed into a microwave tube. The reaction was heated to 120° C. for 30 mins in the microwave reactor and cooled to room temperature. N-Methylmethanamine (1.782 ml, 10.35 mmol, 20 eq, 33% solution in ethanol) was added and the reaction was refluxed for 30 mins. The resulting mixture was evaporated to dryness and the residue was purified by preparative HPLC using decreasingly polar mixtures of water (containing 1% ammonium hydroxide) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford N-[[3-(dimethylaminomethyl)-1,2-oxazol-5-yl]methyl]-N′-[5-[2-(5-methoxypyridin-3-yl)ethyl]-1H-pyrazol-3-yl]pyrimidine-2,4-diamine (9 mg, 3.95%) as an orange gum.
1H NMR (700.034 MHz, DMSO) δ 2.10-2.12 (6H, m), 2.82-2.93 (4H, m), 3.40 (2H, s), 3.80 (3H, s), 4.55 (2H, d), 6.13-6.18 (2H, m), 7.21-7.23 (2H, m), 7.83 (1H, d), 8.03 (1H, d), 8.10-8.12 (1H, m), 9.41 (1H, s), 11.97 (1H, s). MS. m/z 450 (MH+).
5-[2-(5-Methoxypyridin-3-yl)ethyl]-1H-pyrazol-3-amine, used as starting material was prepared as follows:—
Methyl 3-(5-methoxypyridin-3-yl)propanoate (840 mg, 4.30 mmol) and acetonitrile (270 □l, 5.16 mmol) were stirred in 1,4-dioxane (18 ml) under nitrogen. Sodium hydride (206 mg, 60% dispersion on mineral oil, 5.16 mmol) was added and the mixture was stirred at room temperature for 10 mins and then refluxed under nitrogen for 18 h. The reaction mixture was allowed to cool to room temperature. Ethanol (3 ml) was added, followed by hydrazine monohydrochloride (590, 8.61 mmol). The mixture was refluxed for a further 22 h and then left stand at room temperature for 3 days. The mixture was evaporated to dryness and the residue partitioned between water (20 ml) and ethyl acetate (15 ml). The layers were separated and the aqueous phase extracted with ethyl acetate (2×15 ml). Sat. aq. NaHCO3 and NaCl were added to the aqueous phase, which was then re-extracted with ethyl acetate (3×10 ml). The combined organic extracts were dried over MgSO4, filtered and evaporated to dryness. The crude product was purified by silica column chromatography, eluting with 0-10% MeOH in DCM to afford 5-[2-(5-methoxypyridin-3-yl)ethyl]-1H-pyrazol-3-amine as a yellow gummy oil (444 mg, 47% yield).
1H NMR (399.902 MHz, DMSO) δ 2.71-2.79 (m, 2H), 2.82-2.90 (m, 2H), 3.81 (s, 3H), 4.44 (bs, 2H), 5.19 (s, 1H), 7.20-7.23 (m, 1H), 8.03 (d, 1H), 8.11 (d, 1H), 11.08 (bs, 1H), m/z (ES+) [M+H]+=219.
Methyl 3-(5-methoxypyridin-3-yl)propanoate, used as starting material was prepared as follows:—
10% Pd/C (65 mg) was added to a solution of methyl 3-(5-methoxypyridin-3-yl)prop-2-enoate (850 mg, 4.40 mmol) in ethanol (65 ml) and the mixture was stirred at room temperature under a balloon of hydrogen for 18 h. A further portion of catalyst was added and the mixture was stirred under hydrogen for a further 24 h. The mixture was filtered, washed through with ethanol and the filtrate was evaporated under vacuum to afford methyl 3-(5-methoxypyridin-3-yl)propanoate as a colourless oil (849 mg, 99%).
1H NMR (399.902 MHz, CDCl3) δ 2.64 (t, 2H), 2.95 (t, 2H), 3.68 (s, 3H), 3.85 (s, 3H), 7.03-7.06 (m, 1H), 8.09 (d, 1H), 8.17 (d, 1H); m/z (ES+) [M+H]+=196.
Methyl 3-(5-methoxypyridin-3-yl)prop-2-enoate, used as starting material was prepared as follows:—
5-Bromo-3-methoxypyridine (1 g, 5.32 mmol) was stirred with tris(2-methylphenyl)phosphane (162 mg, 0.53 mmol), N,N-diethylethanamine (2.97 ml, 21.27 mmol) and palladium (II) acetate (120 mg, 0.53 mmol) in acetonitrile (100 ml) and the mixture was purged with nitrogen. Methyl prop-2-enoate (1.44 ml, 15.96 mmol) was added and the mixture was refluxed for 18 h. The solvent was evaporated and the residue was purified by silica column chromatography, eluting with 0-1% MeOH in DCM, to afford methyl 3-(5-methoxypyridin-3-yl)prop-2-enoate as a pale yellow solid (1.02 g, 99% yield).
1H NMR (399.902 MHz, DMSO) δ 3.69 (s, 3H), 3.81 (s, 3H), 6.80 (d, 1H), 7.63 (d, 1H), 7.71-7.74 (m, 1H), 8.25 (d, 1H), 8.40 (d, 1H); m/z (ES+) [M+H]+=194.
4-chloro-N-[[3-(chloromethyl)-1,2-oxazol-5-yl]methyl]pyrimidin-2-amine used as starting material was prepared as follows:—
To a stirred solution of 2-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methylamino]pyrimidin-4-ol (1.24 g, 5.58 mmol, 1 eq) and N-ethyl-N-propan-2-yl-propan-2-amine (2.2 mL, 12.83 mmol, 2.3 eq) in toluene (24 mL) was added phosphorous oxychloride (1.15 mL, 12.28 mmol, 2.2 eq). The reaction was heated at 80° C. for 2 h, allowed to cool to room temperature and then poured into a saturated sodium bicarbonate solution. The product was extracted with ethyl acetate (x2), washed with brine, dried (MgSO4), filtered and evaporated to give an orange gum. The crude product was dissolved in DCM and purified by silica column chromatography, eluting with 20-50% ethyl acetate in iso-hexane, to give product as a white solid (751 mg, 52%). 1H NMR (CDCl3 400.13 MHz) δ 4.55 (2H, s), 4.75 (2H, d), 5.64 (1H, s), 6.29 (1H, s), 6.67 (1H, d), 8.18 (1H, d). MS m/z 259 (MH+).
2-[[3-(Hydroxymethyl)-1,2-oxazol-5-yl]methylamino]pyrimidin-4-ol used as starting material was prepared as follows:—
[5-(aminomethyl)-1,2-oxazol-3-yl]methanol (1.35 g, 10 mmol, 1.2 eq) and 2-methylsulfonylpyrimidin-4-ol (1.24 g, 8.7 mmol, 1 eq) were heated together at 160° C. for 4 h. The mixture was allowed to cool to room temperature and suspended in methanol and filtered. The filtrate was evaporated to dryness and purified by silica column chromatography, eluting with 5-15% methanol in dichloromethane to give product as a cream solid (1.27 g, 66%).
1H NMR (DMSO 400.13 MHz) δ 4.45 (2H, d), 4.60 (2H, d), 5.39 (1H, t), 5.60 (1H, d), 6.28 (1H, s), 7.04 (1H, s), 7.6 (1H, d), 11.04 (1H, s)
2-Methylsulfonylpyrimidin-4-ol used as starting material was prepared as follows:—
2-Thiouracil (84 g, 0.66 mol, 1 eq) was dissolved in aqueous sodium hydroxide (26 g, 0.68 mol, 1.05 eq in 80 mL water). The solution was diluted with MeOH (160 mL). Iodomethane (47 mL, 0.75 mol, 1.15 eq) was added dropwise. The temperature was kept between 35-40° C. A precipitate formed and the mixture was heated at 40° C. for 1 h. The mixture was stirred at room temperature overnight, filtered and the solid was washed with water, methanol and dried at 45° C. in a vacuum oven to give 2-methylsulfonylpyrimidin-4-ol (53 g, 57%).
1H NMR (DMSO 400.13 MHz) δ 2.37 (3H, s), 5.97 (1H, d), 7.74 (1H, d)
[5-(Aminomethyl)-1,2-oxazol-3-yl]methanol used as starting material was prepared as follows:—
tert-butyl N-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methyl]carbamate (4.45 g, 19.5 mmol, 1 eq) was dissolved in dichloromethane (89 mL) and trifluoroacetic acid (7.24 mL, 97 mmol, 5 eq) was added. The reaction was stirred at room temperature for 5 h. The mixture was evaporated to dryness, dissolved in methanol and loaded onto a SCX-2 column. This was then further washed with methanol. The product was eluted with 3.5N ammonia in methanol. The desired fractions were collected and evaporated to dryness. The residue was then triturated with diethyl ether to give the product as a purple solid (1.35 g, 54%).
1H NMR (DMSO 400.13 MHz) δ 2.1 (2H, s), 3.78 (2H, s), 4.45 (2H, s), 5.39 (1H, s), 6.29 (1H, s).
tert-Butyl N-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methyl]carbamate used as starting material was prepared as follows:—
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate (5 g, 18.5 mmol, 1 eq) was dissolved in ethanol (50 mL) and cooled to 0° C. Sodium borohydride (1.89 g, 49.95 mmol, 5 eq) was added portionwise and the reaction was stirred at room temperature overnight. The mixture was quenched with aqueous sodium bicarbonate solution, extracted with ethyl acetate (x3), washed with brine, dried (MgSO4) and evaporated to give product as a colouress oil (4.45 g, >100%).
1H NMR (CDCl3 400.13 MHz) δ 1.43 (9H, s), 4.4 (2H, d), 4.72 (2H, s), 5.0 (1H, s), 6.22 (1H, s). MS m/z 173 (MH+−56).
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate used as starting material was prepared as in Example 64.
3-[2-[5-[[2-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]ethyl]phenol (97 mg, 0.24 mmol, 1 eq) was suspended in DCM (5 mL) and thionyl chloride (87 uL, 1. 19 mmol, 5 eq) was added. The reaction was stirred at room temperature overnight. 2M N-Methylmethanamine solution in THF (5 mL) was added and the mixture was heated at 75° C. for 3 h. The mixture was evaporated to dryness and purified by silica column chromatography, eluting with a gradient of 5-10% methanol (containing 10% 7N ammonia in methanol) in dichloromethane to give the crude product. The crude product was purified by preparative HPLC using decreasingly polar mixtures of water (containing 1% ammonium hydroxide) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford 3-[2-[5-[[2-[[3-(dimethylaminomethyl)-1,2-oxazol-5-yl]methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]ethyl]phenol as a white solid (26 mg, 25%).
1HNMR (DMSO 400.13 MHz) δ 2.16 (6H, s), 2.84 (4H, s), 3.45 (2H, s), 4.61 (2H, d), 6.21 (1H, s), 6.31 (1H, s), 6.63 (1H, m), 6.70 (2H, m), 7.11 (1H, t), 7.25 (1H, s), 7.38 (1H, d), 9.40 (1H, s), 11.96 (1H, s). MS m/z 435 (MH+).
3-[2-[5-[[2-[[3-(Hydroxymethyl)-1,2-oxazol-5-yl]methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]ethyl]phenol used as starting material was prepared as follows:—
[5-[[[4-[[5-[2-(3-Methoxyphenyl)ethyl]-2H-pyrazol-3-yl]amino]pyrimidin-2-yl]amino]methyl]-1,2-oxazol-3-yl]methanol (120 mg, 0.28 mmol, 1 eq) was dissolved in DCM (6 mL) and cooled to 0° C. under nitrogen. Boron tribromide (1.42 mL, 1.42 mmol, 5 eq, 1M in DCM) solution was added dropwise and the reaction was allowed to warm to room temperature and stirred overnight. The reaction was quenched with methanol (10 mL), stirred for 1 h and then evaporated to dryness. The crude product was dissolved in methanol and loaded onto a SCX-2 column. This was washed with methanol and then the product was eluted with 3.5N ammonia in methanol. After evaporation, the product was obtained as a yellow foam (97 mg, 85%).
MS m/z 408 (MH+)
[5-[[[4-[[5-[2-(3-Methoxyphenyl)ethyl]-2H-pyrazol-3-yl]amino]pyrimidin-2-yl]amino]methyl]-1,2-oxazol-3-yl]methanol used as starting material was prepared as follows:—
To 2-chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine (250 mg, 0.76 mmol, 1 eq) was added [5-(aminomethyl)-1,2-oxazol-3-yl]methanol (146 mg, 1.14 mmol, 1.5 eq) followed by 2-methoxyethanol (4 ml) and N-ethyl-N-propan-2-yl-propan-2-amine (265 μL, 1.52 mmol, 2 eq). The reaction was heated in the microwave at 200° C. for 60 mins, allowed to cool and evaporated under reduced pressure. The crude product was purified by silica column chromatography, eluting with 5-10% methanol in dichloromethane. Clean fractions were combined and evaporated to give product as a yellow foam (287 mg, 90%).
[5-(Aminomethyl)-1,2-oxazol-3-yl]methanol, used as starting material, was prepared as in Example 127.
2-Chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material, was prepared as in Example 27.
A mixture of 3-[2-(5-amino-1H-pyrazol-3-yl)ethyl]-5-methoxy-N-methylbenzamide (138 mg, 0.5 mmol, 1.0 eq), 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (113 mg, 0.5 mmol, 1.0 eq) and ethanol (2.5 ml) were stirred and heated at 80° C. overnight under an atmosphere of nitrogen. The resulting suspension was allowed to cool to room temperature and filtered to give the crude product as a white solid. This material was purified by reverse-phase preparative HPLC (basic) using a 20-40% gradient of acetonitrile in water containing 1% ammonium hydroxide solution. The clean fractions were taken and evaporated to afford the title compound as a white solid, (107 mg, 46% yield).
1H NMR (500.13 MHz, DMSO-d6, CD3CO2D) δ 2.18 (3H, s), 2.80-2.81 (3H, m), 2.88-2.93 (2H, m), 2.94-2.99 (2H, m), 3.79 (3H, s), 4.58 (2H, s), 6.08-6.10 (2H, m), 6.29 (1H, d), 6.92 (1H, t), 7.21 (1H, t), 7.31 (1H, t), 7.86 (1H, d)
MS: m/z 463 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
3-[2-(5-Amino-1H-pyrazol-3-yl)ethyl]-5-methoxy-N-methylbenzamide, used as starting material was prepared as follows:—
Lithium diisopropylamide solution (1.8M in tetrahydrofuran/heptane/ethylbenzene, 11.11 mL, 20.0 mmol, 4.0 eq) was added to anhydrous tetrahydrofuran (35 ml) at −78° C. and the mixture stirred at this temperature under an atmosphere of nitrogen. Acetonitrile (1.05 ml, 20.0 mmol, 4.0 eq) was added dropwise and the solution maintained at −78° C. for 10 mins. A solution of methyl 3-[3-methoxy-5-(methylcarbamoyl)phenyl]propanoate (1.26 g, 5.0 mmol, 1.0 eq) in tetrahydrofuran (10 mL) was added rapidly and the mixture stirred at −78° C. for 10 mins and then allowed to warm to 5° C. over 20 mins. Hydrazine hydrochloride (1.38 g, 20.0 mmol, 4.0 eq) and ethanol (35 ml) were then added and the mixture heated at 78° C. for 18 h. The mixture was evaporated, dissolved in methanol (50 ml) and applied to a SCX-2 cation exchange cartridge. The cartridge was eluted with methanol (8×50 ml) and then with methanol containing ammonia (2M anhydrous). The clean fractions were taken and evaporated to afford the title compound as a clear oil, (990 mg, 72% yield). MS: m/z 275 (MH+)
Methyl 3-[3-methoxy-5-(methylcarbamoyl)phenyl]propanoate, used as starting material was prepared as follows:—
To a mixture of methyl 3-[3-methoxy-5-(methylcarbamoyl)phenyl]prop-2-enoate (5.7 g, 23.0 mmol, 1.0 eq) in ethyl acetate (120 mL) was added 5% palladium on charcoal catalyst (750 mg) and the reaction mixture was stirred in an atmosphere of hydrogen for 18 h at room temperature. The mixture absorbed 620 mL of hydrogen. The suspension was then flushed with nitrogen, filtered and evaporated. This gave methyl 3-[3-methoxy-5-(methylcarbamoyl)phenyl]propanoate as an oil, 5.7 g.
MS: m/z 252 (MH+)
Methyl 3-[3-methoxy-5-(methylcarbamoyl)phenyl]prop-2-enoate, used as starting material was prepared as follows:
A mixture of 3-formyl-5-methoxy-N-methylbenzamide (4.9 1 g, 25.4 mmol, 1.0 eq) and methyl (triphosphoranylidene) acetate (12.74 g, 38.10 mmol, 1.5 eq) dissolved in anhydrous tetrahydrofuran (240 mL) was stirred at room temperature in an atmosphere of nitrogen for 18 h. After evaporation of the solvent, the crude product was purified by silica column chromatography, eluting with a 0-20% gradient of ethyl acetate in dichloromethane. The clean fractions were taken and evaporated to give Methyl 3-[3-methoxy-5-(methylcarbamoyl)phenyl]prop-2-enoate as a white solid, 5.7 g.
MS: m/z 250 (MH+)
3-Formyl-5-methoxy-N-methylbenzamide, used as starting material was prepared as follows:
A stirred solution of methyl 3-formyl-5-methoxybenzoate (6.22 g, 32.0 mmol, 1.0 eq) and methylamine solution (2.0M in tetrahydrofuran, 86.4 mL, 172.8 mmol, 5.4 eq) in anhydrous tetrahydrofuran (120 mL) was cooled to -50° C. under nitrogen. Trimethylaluminium solution (2.0M in toluene, 43.2 mL, 86.40 mmol, 2.7 eq) was added slowly over 10 mins and the mixture was allowed to warm slowly to room temperature and then allowed to stand for 96 h. The mixture was cooled in an ice/methanol bath and a solution of potassium sodium tartrate (20% in water, 40 mL) was added dropwise. Water (300 mL) and ethyl acetate (400 mL) were added and the mixture transferred to a separating funnel. Hydrochloric acid (2M aqueous, 300 mL) was added to give a clear solution. The layers were separated and the aqueous was extracted with more ethyl acetate. The combined ethyl acetate extracts were washed with 0.5M aqueous HCl solution, water, sodium bicarbonate solution, brine, then dried over magnesium sulphate, filtered and evaporated to give the product as a white solid, 4.9 g, (79% yield).
1H NMR (399.9 MHz, CDCl3) δ 3.03-3.04 (3H, m), 3.90 (3H, s), 6.39 (1H, s), 7.49-7.50 (1H, m), 7.62-7.63 (1H, m), 7.79 (1H, t), 9.99 (1H, s)
MS: m/z 194 (MH+)
The preparation of methyl 3-formyl-5-methoxybenzoate, used as starting material is described by Zhao, He; Thurkauf, Andrew in Synthetic Communications (2001), 31(12), 1921-1926.
5- {2-[3-(Pyrimidin-2-yloxy)phenyl]ethyl} -1H-pyrazol-3-amine (40 mg, 0.142 mmol) was heated with 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (32 mg, 0.142 mmol) in ethanol (1.5 ml) at 80° C. for 18 h. The mixture was allowed to cool to room temperature and the precipitated product was collected by filtration and washed with a little ethanol, then dried under vacuum to afford the title compound as a pale yellow solid (29 mg, 40% yield).
1H NMR (399.902 MHz, DMSO) δ 2.17 (s, 3H), 2.86-2.98 (m, 4H), 4.70 (d, 2H), 6.28 (bs, 2H), 6.38 (bs, 1H), 7.00-7.05 (m, 1H), 7.05-7.08 (m, 1H), 7.13 (d, 1H), 7.26 (t, 1H), 7.35 (t, 1H), 7.89 (bd, 1H), 8.64 (d, 2H), 8.78 (bs, 1H), 11.22 (bs, 1H), 12.42 (bs, 1H), 12.56 (bs, 1H)
MS: m/z 470 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-{2-[3-(Pyrimidin-2-yloxy)phenyl]ethyl}-1H-pyrazol-3-amine, used as starting material, was prepared as follows:—
Dry acetonitrile (138 μl, 2.63 mmol) was added dropwise to a stirred solution of LDA (1.46 ml, 1.8M solution in THF, 2.63 mmol) in THF (4 ml) at −78° C. under nitrogen and the mixture was stirred at −78° C. for 10 mins. A solution of methyl 3-(3-pyrimidin-2-yloxyphenyl)propanoate (340 mg, 1.32 mmol) in THF (6 ml) was added rapidly and stirring was continued at −78° C. for 20 mins, before the reaction mixture was allowed to warm to room temperature. The mixture was poured into aq. NH4Cl (40 ml) and the aqueous phase was extracted with ether (3×20 ml). The combined extracts were dried over MgSO4, filtered and evaporated. The residue was dissolved in ethanol (8 ml), hydrazine monohydrate (128 μl, 2.63 mmol) was added and the mixture was refluxed for 18 h. The mixture was allowed to cool and evaporated to dryness. The residue was partitioned between DCM (15 ml) and water (20 ml), the layers were separated and the aqueous extracted with a further portion of DCM (15 ml). The combined DCM extracts were washed with brine, dried over MgSO4, filtered and evaporated. The crude product was purified by silica column chromatography, eluting with 0-5% MeOH in DCM, to afford the product, 5-[2-(3-pyrimidin-2-yloxyphenyl)ethyl]-1H-pyrazol-3-amine, as a colourless gum (40 mg, 11% yield).
1H NMR (399.902 MHz, CDCl3) δ 2.69-2.92 (m, 4H), 4.31 (bs, 2H), 5.22 (bs, 1H), 6.98-7.03 (m, 1H), 7.05-7.07 (m, 1H), 7.12 (d, 1H), 7.27 (t, 1H), 7.34 (t, 1H), 8.65 (d, 2H), 11.09 (bs, 1H), MS: m/z 282 (MH+)
Methyl 3-(3-pyrimidin-2-yloxyphenyl)propanoate, used as starting material, was prepared as follows:—
10% Pd/C (100 mg) was added to a solution of methyl 3-(3-pyrimidin-2-yloxyphenyl)prop-2-enoate (0.96 g, 3.75 mmol) in ethanol (100 ml) and the mixture was stirred at room temperature under a balloon of hydrogen for 18 h. The solution was filtered and the filtrate was evaporated to dryness under vacuum. The residue was purified by silica column chromatography, eluting with 15-45% ethyl acetate in hexane, to afford the product, methyl 3-[3-(pyrimidin-2-yloxy)phenyl]propanoate, as a white solid (540 mg, 56% yield).
1H NMR (399.902 MHz, CDCl3) δ 2.66 (t, 2H), 2.89 (t, 2H), 3.59 (s, 3H), 7.00-7.05 (m, 1H), 7.05-7.08 (m, 1H), 7.10-7.14 (m, 1H), 7.27 (t, 1H), 7.35 (t, 1H), 8.65 (d, 2H); MS: m/z 259 (MH+)
Methyl 3-(3-pyrimidin-2-yloxyphenyl)prop-2-enoate, used as starting material, was prepared as follows:—
Methyl (triphenylphosphoranylidene)acetate (2.25 g, 6.74 mmol) was added portionwise to a stirred suspension of 3-(pyrimidin-2-yloxy)benzaldehyde (900 mg, 4.50 mmol) in DCM (20 ml) under nitrogen. The reaction mixture was stirred at room temperature for 18 h. The solution was then concentrated under vacuum, adsorbed onto silica and purified by silica column chromatography, eluting with 15-30% ethyl acetate in hexane to afford the product, methyl 3-(3-pyrimidin-2-yloxyphenyl)prop-2-enoate, as a white solid (0.97 g, 84% yield).
1H NMR (399.902 MHz, CDCl3) δ 3.80 (s, 3H), 6.43 (d, 1H), 7.06 (t, 1H), 7.21-7.25 (m, 1H), 7.36-7.38 (m, 1H), 7.39-7.46 (m, 2H), 7.69 (d, 1H), 8.57 (d, 2H); MS: m/z 257 (MH+)
3-(Pyrimidin-2-yloxy)benzaldehyde, used as starting material, was prepared as follows:—
(3-Pyrimidin-2-yloxyphenyl)methanol (1 g, 4.95 mmol) was suspended in DCM (40 ml) and stirred under nitrogen. Dess-Martin periodinane (2.52 g, 5.93 mmol) in DCM (40 ml) was added slowly and the mixture was stirred at room temperature for a further 30 min. The mixture was washed with 1N NaOH(aq) (2×35 ml), water/brine (30 ml), dried over MgSO4, filtered and evaporated to afford the product, 3-(pyrimidin-2-yloxy)benzaldehyde, as a white solid (1.17 g, quant. yield).
1H NMR (399.902 MHz, CDCl3) δ 7.37 (t, 1H), 7.61-7.67 (m, 1H), 7.74 (t, 1H), 7.77-7.80 (m, 1H), 7.88 (d, 1H), 8.73 (d, 2H), 10.08 (s, 1H); MS: m/z 201 (MH+)
N′-[5-[2-(6-methoxypyridin-2-yl)ethyl]-1H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine hydrochloride (85 mg, 0.226 mmol) was stirred in ethanol (15 ml) and conc. aqueous HCl (1.5 ml) at 80° C. for 2 days. The mixture was allowed to cool and poured into ice-water, then allowed to warm to room temperature over 1 h. The precipitated product was collected by filtration, washed with water and dried under vacuum to afford the title compound as a cream solid (70 mg, 67%).
1H NMR (399.902 MHz, DMSO) δ 2.19 (3H, s), 2.71-2.83 (2H, m), 2.86-2.95 (2H, m), 4.70 (2H, d), 5.98 (1H, d), 6.16 (1H, d), 6.22-6.45 (3H, bm), 7.29-7.37 (1H, m), 7.87 (1H, bs), 8.74 (1H, bs), 11.22 (1H, bs), 11.60 (1H, bs), 12.46 (1H, bs); MS: m/z 393 (MH+)
N′-[5-[2-(6-methoxypyridin-2-yl)ethyl]-1H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine hydrochloride, used as starting material, was prepared as follows:—
5-[2-(6-Methoxypyridin-2-yl)ethyl]-1H-pyrazol-3-amine (80 mg, 0.367 mmol) was heated with 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (83 mg, 0.367 mmol) in ethanol (2 ml) in a microwave reactor at 120° C. for 1 h. The precipitated solid was collected by filtration, washed with ethanol and dried under vacuum to afford N′-[5-[2-(6-methoxypyridin-2-yl)ethyl]-1H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4hydrochloride as an off-white solid (106 mg, 65%).
1H NMR (399.902 MHz, DMSO) δ 2.19 (s, 3H), 2.92-3.06 (m, 4H), 3.84 (s, 3H), 4.70 (d, 2H), 6.19-6.46 (bm, 3H), 6.63 (d, 1H), 6.82 (d, 1H), 7.60 (t, 1H), 7.89 (bs, 1H), 8.78 (bs, 1H), 11.20 (bs, 1H), 12.44 (bs, 1H), 12.56 (bs, 1H); MS: m/z 407 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[2-(6-Methoxypyridin-2-yl)ethyl]-1H-pyrazol-3-amine, used as starting material, was prepared as follows:—
Dry acetonitrile (268 μl, 5.122 mmol) was added dropwise to a stirred solution of LDA (1.46 ml, 1.8M solution in THF, 5.122 mmol) in THF (20 ml) at −78° C. (under nitrogen) and the mixture was stirred at −78° C. for 10 mins. Methyl 3-(6-methoxypyridin-2-yl)propanoate (500 mg, 2.561 mmol) was added rapidly and the reaction mixture was stirred at −78° C. for 20 mins, then allowed to warm to room temperature. Ethanol (20 ml) was added followed by hydrazine monohydrochloride (439 mg, 6.403 mmol) and the solution was refluxed for 18 h. The solvent was evaporated under vacuum, the residue was purified by silica column chromatography, eluting with 0-4% MeOH in DCM. Fractions containing product were evaporated to afford 5-[2-(6-methoxypyridin-2-yl)ethyl]-1H-pyrazol-3-amine as a yellow gum (450 mg, 80% yield).
1H NMR (399.902 MHz, DMSO) δ 2.77-2.97 (m, 4H), 3.85 (s, 3H), 4.30 (bs, 2H), 5.18 (bs, 1H), 6.62 (d, 1H), 6.83 (d, 1H), 7.59 (t, 1H), 11.10 (bs, 1H); MS: m/z (MH+) 219.
Methyl 3-(6-methoxypyridin-2-yl)propanoate, used as starting material, was prepared as follows:—
10% Pd/C (140 mg) was added to a solution of methyl 3-(6-methoxypyridin-2-yl)prop-2-enoate (1.43 g, 7.40 mmol) in ethanol (150 ml) and the mixture was stirred at room temperature under a balloon of hydrogen for 18 h. The catalyst was removed by filtration and washed with ethanol. The filtrate was evaporated under vacuum to give the product, methyl 3-(6-methoxypyridin-2-yl)propanoate, as a colourless oil (1.45 g, quant. yield).
1H NMR (399.902 MHz, DMSO) δ 2.73 (t, 2H), 2.96 (t, 2H), 3.60 (s, 3H), 3.82 (s, 3H), 6.62 (d, 1H), 6.85 (d, 1H), 7.60 (t, 1H); MS: m/z (MH+) 196.
Methyl 3-(6-methoxypyridin-2-yl)prop-2-enoate, used as starting material, was prepared as follows:—
2-Bromo-6-methoxypyridine (2 g, 10.64 mmol) was added to a mixture of bis(tri-tbutylphosphine)palladium(0) (327 mg, 0.64 mmol) and cesium carbonate (3.82 g, 11.70 mmol) in dioxane (20 ml). The reaction mixture was stirred under nitrogen. Methyl acrylate (1.92 ml, 21.27 mmol) was added and the mixture was heated at 90° C. for 18 h. The reaction mixture was allowed to cool to room temperature, diluted with ether, filtered and washed through with ether. The filtrate was evaporated to dryness and purified by silica column chromatogrpahy, eluting with 0-5% ethyl acetate in hexane) to afford methyl 3-(6-methoxypyridin-2-yl)prop-2-enoate as a white solid (1.81 g, 88% yield).
1H NMR (399.902 MHz, DMSO) δ 3.76 (s, 3H), 3.91 (s, 3H), 6.88 (d, 1H), 6.90 (d, 1H), 7.31 (d, 1H), 7.62 (d, 1H), 7.77 (t, 1H); MS: m/z 194 (MH+).
5-[2-(5-Fluoro-2-methoxy-pyridin-4-yl)ethyl]-1H-pyrazol-3-amine (65 mg, 0.275 mmol) was heated with 4-chloro-N-[[3-(chloromethyl)-1,2-oxazol-5-yl]methyl]pyrimidin-2-amine (72 mg, 0.275 mmol) in ethanol (2 ml) at 80° C. for 18 h. The mixture was allowed to cool and the precipitated solid was collected by filtration and washed with ethanol. The solid was then stirred again in ethanol (2 ml) and N-methylmethanamine (2M solution in ethanol, 1 ml) was added. The mixture was heated at 80° C. for 30 min. The solution was allowed to cool and evaporated to dryness and then diluted with water (8 ml). The aqueous phase was extracted with ethyl acetate (3×8 ml), dried over MgSO4, filtered and evaporated to afford N-[[3-(dimethylaminomethyl)-1,2-oxazol-5-yl]methyl]-N′-[5-[2-(5-fluoro-2-methoxy-pyridin-4-yl)ethyl]-1H-pyrazol-3-yl]pyrimidine-2,4-diamine as an off-white glassy solid (40 mg, 32% yield).
1H NMR (399.902 MHz, DMSO) δ 2.17 (s, 6H), 2.87-3.04 (m, 4H), 3.45 (s, 2H), 3.85 (s, 3H), 4.61 (d, 2H), 6.22 (s, 1H), 6.14-6.40 (bs, 2H), 6.81 (d, 1H), 7.29 (bs, 1H), 7.90 (d, 1H), 8.10 (s, 1H), 9.45 (bs, 1H), 12.01 (bs, 1H); m/z (ES+) [M+H]+=468.
5-[2-(5-Fluoro-2-methoxy-pyridin-4-yl)ethyl]-1H-pyrazol-3-amine, used as starting material was prepared as follows:—
3-Amino-5-hydroxypyrazole (0.56 g, 5.65 mmol) and triphenylphosphine (1.78 g, 6.78 mmol) were stirred in DCM (16 ml) under nitrogen and the reaction mixture was cooled in an ice-bath. Diisopropylazodicarboxylate (1.34 ml, 6.78 mmol) was added dropwise over a period of 10 min. The reaction mixture was then stirred in the ice-bath for 1 h. (5-Fluoro-2-methoxy-pyridin-4-yl)methanol (1.07 g, 6.78 mmol) in THF (15 ml) was added slowly over 5-10 min. The reaction mixture was stirred and allowed to warm to room temperature over 1 h. This was then stirred for a further 18 h. The mixture was filtered and washed through with DCM (10 ml). The filtrate was extracted with 2M HCl(aq) (3×8 ml) and the combined extracts were basified with 6N NaOH(aq). The basified aqueous phase was extracted with DCM (3×20 ml). The combined extracts were filtered, dried over MgSO4, filtered and evaporated. The crude product was purified by silica column chromatography, eluting with 0-3% MeOH in DCM, to afford 5-[(5-fluoro-2-methoxy-pyridin-4-yl)methoxy]-1H-pyrazol-3-amine as a white solid (354 mg, 26% yield).
1H NMR (399.902 MHz, DMSO) δ 3.75 (s, 3H), 4.70 (s, 1H), 4.91 (s, 2H), 5.06 (s, 2H), 6.76 (d, 1H), 8.04 (d, 1H), 10.37 (s, 1H); m/z (ES+) [M+H]+=239.
(5-Fluoro-2-methoxy-pyridin-4-yl)methanol, used as starting material, was prepared as follows:—
Borane-tetrahydrofuran complex (1M solution in THF, 52.6 ml, 52.6 mmol) was added slowly to a solution of 5-fluoro-2-methoxy-pyridine-4-carboxylic acid (2 g, 11.7 mmol) in THF (100 ml) under nitrogen. The reaction mixture was stirred at room temperature for 2.5 h. The solvent was evaporated and the residue was stirred in methanol (40 ml) for 18 h. The solvent was evaporated and the crude product was purified by silica column chromatography, eluting with 0-1% MeOH in DCM. Pure product fractions were combined and evaporated to afford (5-fluoro-2-methoxypyridin-4-yl)methanol as a white solid (1.42 g, 77%).
1H NMR (399.902 MHz, CDCl3) δ 3.90 (s, 3H), 4.76 (s, 2H), 6.84-6.87 (m, 1H), 7.92 (d, 1H); m/z (ES+) [M+H]+=158.
4-Chloro-N-[[3-(chloromethyl)-1,2-oxazol-5-yl]methyl]pyrimidin-2-amine, used as a starting material, was prepared as follows:—
2-[[3-(Hydroxymethyl)-1,2-oxazol-5-yl]methylamino]pyrimidin-4-ol (1.24 g, 5.58 mmol, 1 eq) and N-ethyl-N-propan-2-yl-propan-2-amine (2.2 mL, 12.83 mmol, 2.3 eq) were stirred in toluene (24 mL) and phosphorous oxychloride (1.15 mL, 12.28 mmol, 2.2 eq) was added dropwise. The reaction was heated at 80° C. for 2 h, then allowed to cool and poured into saturated sodium bicarbonate solution. The product was extracted with ethyl acetate (×2), washed with brine, dried (MgSO4), filtered and evaporated to give an orange gum. The crude product was dissolved in DCM and purified by silica column chromatography, eluting with 20-50% ethyl acetate in iso-hexane to give the product as a white solid (75 lmg, 52%).
1H NMR (CDCl3 400.13 MHz) δ 4.55 (2H, s), 4.75 (2H, d), 5.64 (1H, s), 6.29 (1H, s), 6.67 (1H, d), 8.18 (1H, d). MS m/z 259 (MH+).
2-[[3-(Hydroxymethyl)-1,2-oxazol-5-yl]methylamino]pyrimidin-4-ol was prepared as follows:—
[5-(Aminomethyl)-1,2-oxazol-3-yl]methanol (1.35 g, 10 mmol, 1.2 eq) and 2-methylsulfonylpyrimidin-4-ol (1.24 g, 8.7 mmol, 1 eq) were heated together at 160° C. for 4 h. The mixture was allowed to cool, then suspended in methanol and filtered. The filtrate was evaporated to dryness and purified by silica column chromatography, eluting with 5-15% methanol in dichloromethane to give product as a cream solid (1.27 g, 66%).
1H NMR (DMSO 400.13 MHz) δ 4.45 (2H, d), 4.60 (2H, d), 5.39 (1H, t), 5.60 (1H, d), 6.28 (1H, s), 7.04 (1H, s), 7.6 (1H, d), 11.04 (1H, s)
2-Methylsulfanylpyrimidin-4-ol was prepared as follows:—
2-Thiouracil (84 g, 0.66 mol, 1 eq) was dissolved in aqueous sodium hydroxide (26 g, 0.68 mol, 1.05 eq in 80 mL water). The solution was diluted with MeOH (160 mL). Iodomethane (47 mL, 0.75 mol, 1.15 eq) was added dropwise with ice bath cooling to keep temp between 35-40° C. A precipitate formed and the mixture was heated at 40° C. for 1 h. The mixture was stirred at room temperature overnight, filtered and the solid washed with water, methanol and dried (vacuum oven at 45° C.) to give 2-methylsulfanylpyrimidin-4-ol (53 g, 57%).
1H NMR (DMSO 400.13 MHz) δ 2.37 (3H, s), 5.97 (1H, d), 7.74 (1H, d)
[5-(Aminomethyl)-1,2-oxazol-3-yl]methanol was prepared as follows:—
tert-Butyl N-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methyl]carbamate (4.45 g, 19.5 mmol, 1 eq) was dissolved in dichloromethane (89 mL) and trifluoroacetic acid (7.24 mL, 97 mmol, 5 eq) was added. The reaction was stirred at room temperature for 5 h. The mixture was evaporated to dryness, dissolved in methanol and loaded onto a SCX-2 column. After washing with methanol, the product was eluted with 3.5N ammonia in methanol. After trituration with diethyl ether, the product was obtained as a purple solid (1.35 g, 54%) after.
1H NMR (DMSO 400.13 MHz) δ 2.1 (2H, s), 3.78 (2H, s), 4.45 (2H, s), 5.39 (1H, s), 6.29 (1H, s).
tert-Butyl N-[[3-(hydroxymethyl)-1,2-oxazol-5-yl]methyl]carbamate was prepared as follows:—
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate (5 g, 18.5 mmol, 1 eq) was dissolved in ethanol (50 mL) and cooled to 0° C. Sodium borohydride (1.89 g, 49.95 mmol, 5 eq) was added portionwise and the reaction was stirred at room temperature overnight. The mixture was quenched with aqueous sodium bicarbonate solution, extracted with ethyl acetate (×3), washed with brine, dried (MgSO4) and evaporated to give product as a colouress oil (4.45 g, >100%).
1H NMR (CDCl3 400.13 MHz) δ 1.43 (9H, s), 4.4 (2H, d), 4.72 (2H, s), 5.0 (1H, s), 6.22 (1H, s). MS m/z 173 (MH+−56).
Ethyl 5-[[(2-methylpropan-2-yl)oxycarbonylamino]methyl]-1,2-oxazole-3-carboxylate was prepared as shown in Example 61.
5-[2-(5-Methoxypyridin-3-yl)ethyl]-1H-pyrazol-3-amine (102 mg, 0.467 mmol) and 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (106 mg, 0.467 mmol) were heated with HCl (37 [2l, 4M solution in dioxane, 0.148 mmol) in ethanol (1 ml) in a microwave reactor at 120° C. for 30 min. The solution was allowed to stand at 5° C. for 24 h and the precipitated solid was collected by filtration. The solid were combined with the filtrate, evaporated to dryness and purified by preparative HPLC using decreasingly polar mixtures of water (containing 0.1% NH3) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford N′-[5-[2-(5-methoxypyridin-3-yl)ethyl]-1H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine as a brown glassy solid (15 mg, 8% yield).
1H NMR (399.902 MHz, DMSO) δ 2.22 (3H, s), 2.87-3.02 (4H, m), 3.85 (3H, s), 4.58 (2H, d), 6.01-6.44 (2H, bs), 6.15 (1H, s), 7.19-7.28 (1H, bd), 7.29 (1H, s), 7.88 (1H, d), 8.09 (1H, d), 8.17 (1H, d), 9.40 (1H, bs), 11.96 (1H, bs); m/z (ES+) [M+H]+=407.
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[2-(5-Methoxypyridin-3-yl)ethyl]-1H-pyrazol-3-amine, used as starting material, was prepared as described for Example 127.
A mixture of N-{3-[2-(3-amino-1H-pyrazol-5-yl)ethyl]-5-methoxyphenyl}acetamide (138 mg, 0.5 mmol, 1.0 eq), 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (113 mg, 0.5 mmol, 1.0 eq), and ethanol (2.5 ml) was stirred and heated at 85° C. for 4 h under an atmosphere of nitrogen. The resulting suspension was allowed to cool to room temperature and then filtered to give N-[3-methoxy-5-[2-[5-[[2-[(3-methyl-1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]ethyl]phenyl]acetamide as a white solid, (142 mg, 61% yield).
1H NMR (500.13 MHz, DMSO-d6, CD3CO2D ) δ 2.03 (3H, s), 2.20 (3H, s), 2.85-2.90 (4H, m), 3.72 (3H, s), 4.66 (2H, s), 6.17 (2H, s), 6.45 (1H, d), 6.50 (1H, t), 7.04 (1H, s), 7.08 (1H, s), 7.86 (1H, d)
MS: m/z 463 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
N-{3-[2-(3-amino-1H-pyrazol-5-yl)ethyl]-5-methoxyphenyl}acetamide, used as starting material was prepared as follows:—
Lithium diisopropylamide solution (1.8M in tetrahydrofuran/heptane/ethylbenzene, 17.8 mL, 32.0 mmol, 4.0 eq) was added to anhydrous tetrahydrofuran (52 ml) at −78° C. and the mixture stirred at this temperature under an atmosphere of nitrogen. Acetonitrile (1.7 ml, 32.0 mmol, 4.0 eq) was added dropwise and the solution maintained at −78° C. for 5 mins. A solution of methyl 3-(3-acetamido-5-methoxyphenyl)propanoate (2.02 g, 8.0 mmol, 1.0 eq) in tetrahydrofuran (20 mL) was added rapidly and the mixture stirred at −78° C. for 5 mins and then allowed to warm to 5° C. over 30 mins. Hydrazine hydrochloride (2.20 g, 32.0 mmol, 4.0 eq) and ethanol (56 ml) were then added and the mixture heated at 68° C. for 4 h. The mixture was evaporated, water (100 mL) was added and the mixture acidified with hydrochloric acid (2.0M, 50 ml) and then extracted with ethyl acetate (2×100 ml). The aqueous layer was basified with concentrated sodium hydroxide solution and then extracted with ethyl acetate. The organic layer was separated, washed with brine, dried over magnesium sulphate and evaporated to give a foam. The crude product was purified by silica column chromatography, eluting with a 3-10% gradient of methanol containing ammonia (2.0M) in dichloromethane. The clean fractions were taken and evaporated to afford the desired compound as a clear gum, 417 mg (19%).
MS: m/z 275 (MH+)
Methyl 3-(3-acetamido-5-methoxyphenyl)propanoate, used as starting material was prepared as follows:
A mixture of methyl 3-(3-amino-5-methoxyphenyl)propanoate (2.0 g, 9.55 mmol, 1.0 eq) and acetic anhydride (2.71 mL, 28.65 mmol, 3.0 eq) was heated at 120° C. for 20 mins. Water (20 ml) was added and the mixture was heated for a further 20 mins. After cooling, the mixture was partitioned between ethyl acetate and aq. sodium bicarbonate solution. The organic layer was washed with brine, dried over magnesium sulphate and evaporated to give the desired compound as an oil, (2.4 g, 100% yield).
MS: m/z 252 (MH+)
Methyl 3-(3-amino-5-methoxyphenyl)propanoate, used as starting material was prepared as follows:
A mixture of methyl 3-{3-[(tert-butoxycarbonyl)amino]-5-methoxyphenyl}propanoate (3.05 g, 9.85 mmol, 1.0 eq) and trifluoroacetic acid (15.2 mL, 197 mmol, 20.0 eq) was stirred at room temperature overnight. The trifluoroacetic acid was evaporated and the residue partitioned between ethyl acetate (150 ml) and aq. sodium bicarbonate solution (100 ml). The ethyl acetate extracts were combined and washed with brine, dried over magnesium sulphate and evaporated to give the desired compound as a clear oil, (2.0 g, 97% yield).
1H NMR (399.9 MHz, CDCl3) δ 2.57-2.61 (2H, m), 2.80-2.84 (2H, m), 3.29 (2H, s), 3.67 (3H, s), 3.74 (3H, s), 6.09 (1H, t), 6.14 (1H, q), 6.17 (1H, t)
MS: m/z 210 (MH+)
Methyl 3-{3-[(tert-butoxycarbonyl)amino]-5-methoxyphenyl}propanoate, used as starting material was prepared as follows:—
A mixture of methyl 3-[3-methoxy-5-[(2-methylpropan-2-yl)oxycarbonylamino]phenyl]prop-2-enoate (3.26 g, 10.6 mmol, 1.0 eq) dissolved in ethyl acetate (100 mL) and 5% palladium on charcoal catalyst (750 mg) was stirred at room temperature under an atmosphere of hydrogen for 2 h. The mixture absorbed 320 mL of hydrogen. The suspension was then flushed with nitrogen, filtered and evaporated. This gave methyl 3- {3-[(tert-butoxycarbonyl)amino]-5-methoxyphenyl}propanoate as an oil, (3.16 g, 96% yield).
MS: m/z 310 (MH+)
Methyl 3-[3-methoxy-5-[(2-methylpropan-2-yl)oxycarbonylamino]phenyl]prop-2-enoate, used as starting material was prepared as follows:
A mixture of tert-butyl (3-formyl-5-methoxyphenyl)carbamate (4.78 g, 19.0 mmol, 1.0 eq) and methyl (triphosphoranylidene) acetate (6.99 g, 20.9 mmol, 1. eq) dissolved in anhydrous tetrahydrofuran (200 mL) was stirred at room temperature under an atmosphere of nitrogen for 48 h. After evaporation of the solvent, the crude product was purified by silica column chromatography, eluting with dichloromethane. The clean fractions were taken and evaporated to give methyl 3-[3-methoxy-5-[(2-methylpropan-2-yl)oxycarbonylamino]phenyl]prop-2-enoate as a white solid, (3.35 g, 57%).
1H NMR (399.9 MHz, CDCl3) δ 1.52 (9H, s), 3.80 (3H, s), 3.81 (3H, s), 6.40 (1H, d), 6.51 (1H, s), 6.73 (1H, t), 7.08 (2H, s), 7.59 (1H, d)
MS: m/z 308 (MH+)
tert-Butyl (3-formyl-5-methoxyphenyl)carbamate, used as starting material was prepared as follows:—
A suspension of tert-butyl [3-(hydroxymethyl)-5-methoxyphenyl]carbamate (5.32 g, 21.0 mmol, 1.0 eq) and manganese (IV) dioxide (activated 5um, 7.3 g, 84 mmol, 4.0 eq) in ethyl acetate (230 mL) was stirred for 18 h at room temperature under nitrogen. The reaction mixture was then refluxed for 2 h. The mixture was filtered and evaporated to give tert-butyl (3-formyl-5-methoxyphenyl)carbamate as a white solid, (5.0 g, 95% yield).
MS: m/z 252 (MH+)
tert-Butyl [3-(hydroxymethyl)-5-methoxyphenyl]carbamate, used as starting material was prepared as follows:—
Sodium borohydride (4.77 g, 126.0 mmol, 6.0 eq) was added to a stirred solution of methyl 3-[(tert-butoxycarbonyl)amino]-5-methoxybenzoate (5.91 g; 21. 0 mmol, 1.0 eq) in methanol (51 mL) and tetrahydrofuran (50 mL) at room temperature. The mixture was stirred for 30 mins and then allowed to stand for 72 h. A further amount of sodium borohydride (4.77 g, 126 mmol, 6.0 eq) was added. The mixture was stirred for 18 h. The resulting solution was neutralised by the addition of hydrochloric acid (0.5M aqueous) and then extracted with ethyl acetate (400 mL). The ethyl acetate extract was washed with water, brine, dried over magnesium sulphate, filtered and then evaporated to give crude tert-butyl [3-(hydroxymethyl)-5-methoxyphenyl]carbamate as a clear gum, (6.0 g, 113%). This material was used without further purification.
MS: m/z 254 (MH+)
Methyl 3-[(tert-butoxycarbonyl)amino]-5-methoxybenzoate, used as starting material was prepared as follows:—
3-Methoxy-5-(methoxycarbonyl)benzoic acid (6.3 1 g, 30.0 mmol, 1.0 eq) was dissolved in warm tert-butanol (50 mL). N,N-diethylethanamine (4.19 mL, 30.0 mmol, 1.0 eq) was added followed by diphenyl phosphoryl azide (6.47 mL, 30.0 mmol, 1.0 eq) and the mixture was refluxed for 3.5 hours. The solvent was evaporated and the residue partitioned between ethyl acetate (400 mL) and water (200 mL). The organic layer was separated, washed with brine, dried over magnesium sulphate and evaporated to give the crude product. The crude product was purified by silica column chromatography, eluting with a 1-5% gradient of ethyl acetate in dichloromethane. The clean fractions were taken and evaporated to give methyl 3-[(tert-butoxycarbonyl)amino]-5-methoxybenzoate as a white solid, (6.60 g, 78%).
1H NMR (399.9 MHz, CDCl3) δ1.52 (9H, s), 3.83 (3H, s), 3.90 (3H, s), 6.60 (1H, s), 7.24-7.25 (1H, m), 7.37 (1H, s), 7.49-7.50 (1H, m)
The preparation of 3-methoxy-5-(methoxycarbonyl)benzoic acid, used as starting material is described by Zhao, He; Thurkauf, Andrew in Synthetic Communications (2001), 31(12), 1921-1926.
2-Chloro-N-[5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine (60 mg, 0. 17 mmol, 1.0 eq)) was dissolved in 2-methoxyethanol (4 ml) and 5-(aminomethyl)-1,2-oxazole-3-carboxamide (60 mg, 0.34 mmol, 2.0 eq) and N-ethyl-N-propan-2-yl-propan-2-amine (117 μl, 0.59 mmol, 3.5 eq) were added. The mixture was heated to 180° C. for a total of 90 mins in the microwave reactor. The solvent was evaporated under reduced pressure and the crude product purified by reverse-phase prep. HPLC (basic) using a gradient of 29-49% acetonitrile in water containing 1% ammonium hydroxide solution. The clean fractions were taken and evaporated to afford as a beige solid. (39 mg, 50% yield).
1H NMR (399.902 MHz, DMSO) δ 1.16 (d, J=6.1 Hz, 6H), 2.78 (m, 4H), 4.48 (m, 1H), 4.54 (d, J=5.6 Hz, 2H), 6.24 (s, 1H), 6.45 (s, 1H), 6.69 (m, 3H), 7.09 (t, J=7.8 Hz, 1H), 7.21 (s, 1H), 7.66 (s, 1H), 7.77 (d, J=5.4 Hz, 1H), 7.94 (s, 1H), 9.33 (s, 1H), 11.86 (s, 1H). MS: m/z=463 (MH+)
2-chloro-N-[5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material, was prepared as follows:—
2,4-Dichloropyrimidine (177 mg, 1. 18 mmol, 1.0 eq) was dissolved in ethanol (5 ml) and N-ethyl-N-propan-2-yl-propan-2-amine (0.25 ml, 1.42 mmol, 1.2 eq) and 5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-amine (290 mg, 1.30 mmol, 1.1 eq) were added. The mixture was stirred at 50° C. for 3 days. The reaction mixture was added slowly to water (10 ml), sonicated and the precipitate collected by filtration, washed with water and dried in vacuo to give 2-chloro-N-[5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine (122 mg, 29%) as a white solid.
1H NMR (399.902 MHz, DMSO) δ 1.17 (d, J=6.0 Hz, 6H), 2.81 (s, 4H), 4.49 (septet, J=6.0 Hz, 1H), 6.02 (s, 1H), 6.69 (m, 4H), 7.10 (t,J=8.1 Hz, 1H), 8.09 (d, J=5.8 Hz, 1H), 10.22 (s, 1H). MS: m/z=358 (MH+)
5-[2-(3-Propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-amine was prepared as follows:—
Methyl 3-(3-propan-2-yloxyphenyl)propanoate (680 mg, 3.06 mmol, 1.0 eq) was dissolved in 1,4-dioxan (20 ml) under nitrogen and sodium hydride 60% suspension (147 mg, 3.67 mmol, 1.2 eq) and dry acetonitrile (0.19 ml, 3.67 mmol, 1.2 eq) were added. The solution was stirred at room temperature for 10 mins and then heated to 100° C. for 18 h. The mixture was then cooled to room temperature and ethanol (2 ml) and hydrazine hydrochloride (420 mg, 6.12 mmol, 2.0 eq) were added. The mixture was heated to 100° C. for 18 h. The solvent was evaporated and the residue partitioned between 1M HCl and ethyl acetate. The aqueous layer was basified with concentrated ammonia solution and extracted with ethyl acetate. The organic extracts were washed with water then brine, dried over MgSO4 and evaporated. The residue was purified by silica column chromatography, eluting with a gradient of 0.5-7% methanol in DCM. The clean fractions were evaporated to give 5-[2-(3-propan-2-yloxyphenyl)ethyl]-1H-pyrazol-3-amine (296 mg, 39%) as a brown oil.
1H NMR (399.902 MHz, DMSO) δ 1.18 (d, J=5.7 Hz, 6H), 2.63 (m, 2H), 2.73 (m, 2H), 4.33 (bs, 1H), 4.50 (septet, J=6.0 Hz, 1H), 5.12 (s, 1H), 6.66 (m, 3H), 7.08 (t, J=8.1 Hz, 1H), 11.03 (bs, 1H). MS: m/z=246 (MH+)
Methyl 3-(3-propan-2-yloxyphenyl)propanoate was prepared as follows:—
Methyl 3-(3-hydroxyphenyl)propanoate (1.0 g, 5.55 mmol, 1.0 eq) was dissolved in dry acetone (20 ml) and anhydrous potassium carbonate (921 mg, 6.66 mmol, 1.2 eq) and 2-iodopropane (0.67 ml, 6.66 mmol, 1.2 eq) were added. The mixture was refluxed at 55° C. under nitrogen for 24 h. A further equivalent of potassium carbonate (844 mg, 5.55 mmol, 1.0 eq) and 2-iodopropane (0.4 ml, 5.55 mmol, 1.0 eq) were then added and stirring at 55° C. was continued for 24 h. The solvent was then evaporated and the residue dissolved in water (25 ml). The solution was extracted with diethyl ether (3×10 ml) and the extracts were combined, dried and evaporated. The crude product was purified by silica column chromatography, eluting with 0-10% MeOH in DCM. The product-containing fractions were combined, evaporated and dried to give methyl 3-(3-propan-2-yloxyphenyl)propanoate (686 mg, 56%) as a pale yellow oil.
1H NMR (399.902 MHz, DMSO) δ 1.18 (d, J=5.9 Hz, 6H), 2.55 (t, J=7.6 Hz, 2H), 2.74 (t, J=7.6 Hz, 2H), 3.52 (s, 3H), 4.51 (septet, J=6.0 Hz, 1H), 6.67 (m, 3H), 7.09 (t, J=8.0 Hz, 1H).
Methyl 3-(3-hydroxyphenyl)propanoate was prepared as follows:—
3-(3-Hydroxyphenyl)propanoic acid (3.0 g, 18.1 mmol, 1.0 eq) was dissolved in dry DMF (50 ml), potassium hydrogen carbonate (2.17 g, 21.7 mmol, 1.2 eq) was added and the mixture was stirred at room temperature under nitrogen for 10 mins. Methyl iodide (1.24 ml, 19.9 mmol, 1.1 eq) was then added and the mixture was heated at 40° C. overnight. The solvent was evaporated and the residue dissolved in diethyl ether (50 ml), washed with water (20 ml) then ammonium chloride solution (20 ml), dried over MgSO4 and evaporated to give methyl 3-(3-hydroxyphenyl)propanoate (3.21 g, 98%) as a brown oil.
1H NMR (399.902 MHz, DMSO) δ 2.59 (t, J=7.9 Hz, 2H), 2.77 (t, J=7.7 Hz, 2H), 3.59 (s, 3H), 6.60 (m, 3H), 7.06 (m, 1H), 9.24 (s, 1H). MS: m/z=179 M−(H+) [ES−]
5-(Aminomethyl)-1,2-oxazole-3-carboxamide was prepared as in Example 123.
3-[2-(5-Amino-1H-pyrazol-3-yl)ethyl]-N-methyl-benzamide (98 mg, 0.6 mmol) and 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (90 mg, 0.4 mmol) in ethanol (3 ml) were heated at 180° C. in a microwave reactor for 30 mins. The reaction mixture was cooled and concentrated. The crude product was purified by reverse phase prep. HPLC (basic) using a 15-40% gradient of acetonitrile in water containing 1% ammonia. The clean fractions were taken and evaporated to afford the title compound as a white solid (59 mg, 34%).
1H NMR (500.13 MHz, DMSO-d6) δ 2.19 (3H, s), 2.78-2.82 (3H, m), 2.89-2.92 (2H, m), 2.94-3.01 (2H, m), 4.59 (2H, d), 6.11 (2H, s), 6.27 (1H, s), 7.35 (2H, q), 7.64 (1H, s), 7.65 (1H, d), 7.73 (1H, s), 7.87 (1H, d), 7.94 (1H, s), 8.80 (1H, s), 11.69 (1H, s)
MS m/z: 433 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
3-[2-(5-amino-1H-pyrazol-3-yl)ethyl]-N-methyl-benzamide, used as starting material was prepared as follows:—
To a stirred suspension of 3-[2-(5-amino-1H-pyrazol-3-yl)ethyl]benzoic acid (1.620 g, 7.0 mmol) and 2M N-methylmethanamine in THF (5.25 mL, 10.5 mmol) in dry DMF (50 mL), dry N-ethyl-N-propan-2-yl-propan-2-amine (4.63 mL, 4 eq, 28.0 mmol) was added. O-(7-Azabenzotriazol-1-Y1)-N,N,N′,N′-Tetramethyluronium Hexafluoro-Phosphate (2.93 g, 7.7 mmol) was then added and the mixture left to stir for 18 h. The reaction mixture was evaporated to dryness, dissolved in ethyl acetate and then partitioned between water (30 ml) and ethyl acetate (30 ml). The aqueous layer was washed with ethyl acetate (3×30 ml). The organic layers were combined, washed sequentially with brine (1×30 ml), 0.5N citric acid (1×30 ml) and NaHCO3 solution (1×30 ml) and evaporated to dryness to afford crude 3-[2-(5-amino-1H-pyrazol-3-yl)ethyl]-N-methyl-benzamide as an orange gum (1.3594 g). The crude product was purified by silica column chromatography, eluting with a gradient of 0-10% MeOH in DCM. Pure fractions were evaporated to dryness to afford pure 3-[2-(5-amino-1H-pyrazol-3-yl)ethyl]-N-methyl-benzamide (0.330 g, 28%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.74-2.79 (2H, m), 2.76-2.78 (3H, m), 2.89 (2H, d), 3.20-3.45 (2H, s), 5.21 (1H, s), 7.35-7.36 (2H, m), 7.63-7.66 (1H, m), 7.72 (1H, s), 8.36-8.37 (1H, m)
MS: m/z 245.41 (MH+)
3-[2-(5-Amino-1H-pyrazol-3-yl)ethyl]benzoic acid used as starting material, was prepared as follows:—
A suspension of 3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]benzonitrile (4.000 g, 19.0 mmol) in an aqueous solution of sodium hydroxide (1OM, 40 ml) was heated at 95-100° C. for 5 h. The reaction mixture was cooled to 5-10° C. in an ice/water bath and acidified to pH3 by the dropwise addition of conc. HCl (approx. 50 ml). The resultant cream solid was removed by filtration, washed with water and then dried in a vacuum oven over the weekend to leave pure 3-[2-(5-amino-1H-pyrazol-3-yl)ethyl]benzoic acid (4.4208 g, 101% yield).
1H NMR (399.9 MHz, DMSO-d6) δ2.79 (2H, d), 2.95 (2H, d), 5.29 (1H, s), 7.41 (1H, t), 7.48 (1H, d), 7.77 (1H, s), 7.79 (1H, s), 7.82 (1H, d)
MS: m/z 232.39 (MH+)
3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]benzonitrile, used as starting material, was prepared as follows:—
Sodium hydride (60%, 3.0 g, 75.6 mmol) was added to a stirred solution of methyl 3-(3-cyanophenyl)propanoate (1 1.9 g, 63.0 mmol) in dry 1,4 dioxane (350 ml) and dry acetonitrile (3.95 ml, 75.6 mmol) under nitrogen to give a cloudy grey mixture. This was stirred at room temperature for 10 mins and then refluxed under nitrogen overnight to give a dark orange solution. The reaction mixture was cooled and ethanol (25 ml) was added followed by hydrazine monohydrochloride (8.635 g, 126 mmol). The reaction mixture was refluxed overnight. The reaction mixture was cooled, filtered, and evaporated to dryness to afford crude 3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]benzonitrile (16 g). The crude product was purified by silica column chromatography, eluting isocratically with 8% MeOH in DCM. Pure fractions were evaporated to dryness to afford 3-[2-(5-amino-2H-pyrazol-3-yl)ethyl]benzonitrile as an orange gum, (5.1 g, 38%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.73-2.76 (2H, m), 2.88-2.92 (2H, m), 4.07-4.08 (1H, m), 4.50 (2H, s), 5.17 (1H, s), 7.47-7.51 (1H, m), 7.55-7.58 (1H, m), 7.64-7.66 (2H, m)
MS: m/z 213.41 (MH+)
Methyl 3-(3-cyanophenyl)propanoate, used as starting material, was prepared as follows:—
To a solution of methyl (E)-3-(3-cyanophenyl)prop-2-enoate (12.36 g, 66.00 mmol) dissolved in DMF (250 ml), was added platinum catalyst (1.24 g) and the reaction mixture was stirred under hydrogen overnight. The mixture was filtered through celite, washed with DMF, then evaporated to dryness to give a grey-brown liquid. The solid was dissolved in DCM (150 ml) and washed sequentially with water (3×80 ml) and brine (1×80 ml), then dried with MgSO4, and evaporated to dryness to afford methyl 3-(3-cyanophenyl)propanoate as a brown liquid (11.949 g, 96%).
1H NMR (399.9 MHz, DMSO-d6) δ2.69 (2H, t), 2.90-2.94 (2H, m), 3.59 (3H, s), 7.50 (1H, t), 7.60-7.62 (1H, m), 7.66-7.69 (1H, m), 7.73 (1H, d)
Methyl (E)-3-(3-cyanophenyl)prop-2-enoate, used as starting material, was prepared as follows:—
Methyl (triphenyphosphoranylidene)acetate (38.12 g, 114 mmol) was added to a mixture of 3-cyanobenzaldehyde (9.97 g, 76 mmol) in DCM (150 ml) and the reaction mixture was stirred for 6 h at room temperature. The reaction mixture was evaporated to dryness to afford crude methyl (E)-3-(3-cyanophenyl)prop-2-enoate. The crude product was purified by silica column chromatography, eluting isocratically with 50% ethyl acetate in isohexanes. Pure fractions were evaporated to dryness to afford pure methyl (E)-3-(3-cyanophenyl)prop-2-enoate (12.36 g, 87%).
1H NMR (399.9 MHz, DMSO-d6) δ 3.76 (3H, s), 6.84 (1H, s), 7.64 (1H, t), 7.68 (1H, s), 7.87-7.89 (1H, m), 8.06-8.09 (1H, m), 8.27 (1H, t)
3-[2-(5-Amino-1H-pyrazol-3-yl)ethyl]-N,5-dimethyl-benzamide (142 mg, 0.6 mmol) and 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (135 mg, 0.25 mmol) in ethanol (4 ml) were heated at 180° C. in a microwave reactor for 30 mins. The reaction mixture was cooled and the suspension was filtered. The crude product was washed with cold ethanol (5 ml) and diethyl ether (3×10 ml). The residue was air-dried to give N,3-dimethyl-5-[2-[5-[[2-[(3-methyl-1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]ethyl]benzamide as a cream solid (133 mg, 49.6%). 1H NMR (399.9 MHz, DMSO-d6) δ 2.19 (3H, s), 2.33 (3H, s), 2.77 (3H, d), 2.90 (4H, s), 4.70-4.71 (2H, m), 6.28 (2H, s), 6.38 (1H, s), 7.20 (1H, s), 7.49-7.52 (2H, m), 7.89 (1H, s), 8.33-8.34 (1H, m), 8.79 (1H, s), 11.23 (1H, s), 12.45 (1H, s). MS m/z: 447 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
3-[2-(5-Amino-1H-pyrazol-3-yl)ethyl]-N,5-dimethyl-benzamide, used as starting material, was prepared as follows:—
Anhydrous acetonitrile (653 μl, 12.5 mmol) was added to anhydrous THF (50 ml), containing a solution of 1.8 M lithium diisopropylamide (in THF; 6.97 ml) at −78° C. The solution was stirred at −78° C. for 10 mins. A solution of methyl 3-[3-methyl-5-(methylcarbamoyl)phenyl]propanoate (1.475 g, 6.25 mmol) in anhydrous THF (10 ml) was added rapidly and the reaction mixture stirred at −78° C. for 30 mins. The reaction mixture was stirred at 20° C. for 1 h. Two additional equivalents of the acetonitrile anion were added (prepared at −78° C.) and the mixture stirred for 1 h. The reaction mixture was quenched with 1N HCl solution and extracted with diethyl ether (3×40 ml). The extracts were dried (MgSO4), filtered and evaporated. The residue was dissolved in ethanol (25 ml) and refluxed with hydrazine monohydrate (1 ml) for 18 h. The reaction mixture was cooled and evaporated to dryness. The residue was dissolved and partitioned between water and DCM (20 ml:40 ml). The aqueous layer was extracted with DCM (4×25 ml). The extracts were washed with saturated brine solution (25 ml), filtered and evaporated to give 3-[2-(5-amino-1H-pyrazol-3-yl)ethyl]-N,5-dimethyl-benzamide, as a yellow foam (0.685 g, 42%). 1H NMR (399.9 MHz, DMSO-d6) δ 2.32 (3H, s), 2.69-2.79 (2H, m), 2.80 (3H, d), 2.83-2.90 (2H, m), 5.20 (1H, s), 7.19 (1H, s), 7.48 92H, d), 8.31 (1H, s). MS m/z: 259 (MH+).
Methyl 3-[3-methyl-5-(methylcarbamoyl)phenyl]propanoate, used as starting material, was prepared as follows:—
Methyl (E)-3-[3-methyl-5-(methylcarbamoyl)phenyl]prop-2-enoate (3.27 g, 14 mmol) was dissolved in a mixture of ethanol (50 ml) and DMF (10 ml). To this was added 10% Pd/C (300 mg) and the reaction mixture was stirred under a hydrogen atmosphere overnight. The reaction mixture was filtered through celite and evaporated to afford to give methyl 3-[3-methyl-5-(methylcarbamoyl)phenyl]propanoate as an oil 2.78 g, ( 84.5%). 1H NMR (399.9 MHz, DMSO-d6) δ 2.32 (3H, s), 2.65 (2H, t), 2.77 (3H, d), 2.85 (2H, d), 3.60 (3H, s), 7.19-7.19 (1H, m), 7.48 (2H, s), 8.31 (1H, d). MS m/z: 258 (M+Na+).
Methyl (E)-3-[3-methyl-5-(methylcarbamoyl)phenyl]prop-2-enoate was prepared as follows:
Methyl(triphenyl-phosphoranylidene)acetate (10.02 g, 30 mmol) was added under nitrogen to a stirred solution of 3-formyl-N,5-dimethyl-benzamide (3.55 g, 20 mmol) in dry DCM (50 ml) at 0° C. The reaction mixture was stirred at 20° C. for 18 h. The solvent was evaporated and the crude product was purified by silica column chromatography, eluting with a 25-50% gradient of ethyl acetate in hexanes. The pure fractions were combined and evaporated to give methyl (E)-3-[3-methyl-5-(methylcarbamoyl)phenyl]prop-2-enoate a white solid (3.25 g, 70%). 1H NMR (399.9 MHz, DMSO-d6) 6 2.38 (3H, s), 2.76-2.86 (3H, m), 3.70-3.80 (3H, m), 6.69 (2H, d), 7.61-7.71 (3H, m), 7.96 (1H, s), 8.38-8.47 (1H, m). MS m/z: 234 (MH+).
3-formyl-N,5-dimethyl-benzamide used as starting material was prepared using an analogous method to that outlined in Example 139 for tert-Butyl (3-formyl-5-methoxyphenyl)carbamate except using 3-(hydroxymethyl)-N,5-dimethyl-benzamide (3.59 g, 20 mmol) and manganese (IV) dioxide (activated 5 um, 6.960 mol), to give 3-formyl-N,5-dimethyl-benzamide as a white solid (3.54 g, 100%). 1H NMR (399.9 MHz, DMSO-d6) δ 2.46 (3H, s), 2.81-2.82 (3H, m), 7.86 (1H, d), 7.98 (1H, t), 8.17 (1H, s), 8.60-8.61 (1H, m), 10.04 (1H, s).
3-(hydroxymethyl)-N,5-dimethyl-benzamide was prepared from:—
A solution of trimethylaluminium (2M in toluene, 25 ml, 12.5 mmol) was added dropwise at −50° C. to a stirred solution of methyl 3-(hydroxymethyl)-5-methyl-benzoate (3.5 g, 20 mmol) and methylamine (2.0M solution in THF, 50 ml, 100 mmol) in dry THF (100 ml). The reaction mixture was stirred for 15 mins at −50° C., then at 20° C. for 18 h. The reaction was cooled to −50° C. and quenched with saturated potassium sodium tartrate solution and stirred for 1 h. The reaction mixture was extracted with ethyl acetate (2×50 ml) and washed with saturated brine solution (25 ml). The extracts were dried (MgSO4), filtered and evaporated. The crude product was purified by silica column chromatography, eluting with a gradient of 0-5% methanol in dichloromethane. The pure fractions were combined and evaporated to dryness to give 3-(hydroxymethyl)-N,5-dimethyl-benzamide as an oil (3.7 g, ˜100%). 1H NMR (399.9 MHz, DMSO-d6) δ2.35 (3H, s), 2.78 (3H, d), 4.52 (2H, d), 5.22 (1H, t), 7.27-7.28 (1H, m), 7.52 (1H, s), 7.60 (1H, s), 8.34 (1H, d). MS m/z: 180 (MH+)
Methyl 3-(hydroxymethyl)-5-methyl-benzoate was prepared as follows:
A solution of borane-DMS complex (2M in THF, 30 ml, 60 mmol) was added dropwise at 0° C. to a stirred solution of 3-methoxycarbonyl-5-methylbenzoic acid (9.72 g, 50 mmol) in anhydrous THF (50 ml), under nitrogen. The reaction mixture was stirred at 20° C. for 30 mins and then heated at 60° C. for 18 h. The reaction mixture was cooled and quenched with a mixture of 1:2 water/glacial acetic acid (7.2 ml). The reaction mixture was concentrated and partitioned between ethyl acetate (50 ml) and potassium carbonate solution (2M, 25 ml). The organic phase was washed with hydrochloric acid (1M, 25 ml), saturated sodium bicarbonate and saturated brine solution. The organic extracts were dried over magnesium sulphate, filtered and evaporated to give methyl 3-(hydroxymethyl)-5-methyl-benzoate as a clear oil, (8.16 g, 91%). 1H NMR (399.9 MHz, DMSO-d6) δ2.37 (3H, s), 3.86 (3H, s), 4.54 (2H, d), 5.28 (1H, t), 7.40-7.41 (1H, m), 7.66 (1H, d), 7.75 (1H, d)
6-[2-(5-amino-1H-pyrazol-3- yl)ethyl]-4-methoxy-N-methyl-pyridine-2-carboxamide (138 mg, 0.5 mmol) and 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (103 mg, 0.5 mmol) in ethanol (4 ml) were heated at 120° C. in a microwave reactor for 1 h. The reaction mixture was cooled and filtered to give the crude product. The crude product was washed with cold methanol (10 ml) and diethyl ether (2×10 ml) and air-dried. The crude product was purified by reverse phase prep. HPLC (Basic) using a 20-40% gradient of acetonitrile in water containing 1% ammonia. The clean fractions were taken and evaporated to afford the title compound as a white solid (69 mg, 30%).
1H NMR (500.13 MHz, DMSO-d6) δ 2.19 (3H, s), 2.87 (3H, d), 3.00-3.05 (2H, m), 3.06-3.11 (2H, m), 3.89 (3H, s), 4.58 (2H, d), 6.07 (1H, s), 6.12 (1H, s), 6.30 (1H, s), 6.70 (1H, s), 6.97 (1H, d), 7.40 (1H, d), 7.87 (1H, d), 8.27 (1H, s), 8.85 (1H, s), 11.70 (1H, s). MS m/z: 464 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
6-[2-(5-amino-1H-pyrazol-3-yl)ethyl]-4-methoxy-N-methyl-pyridine-2-carboxamide used as starting material was prepared following the procedure for 3-[2-(5-amino-1H-pyrazol-3-yl)ethyl]-N,5-dimethyl-benzamide in Example 142, but starting from methyl 3-[4-methoxy-6-(methylcarbamoyl)pyridin-2-yl]propanoate (581 mg, 2.3 mmol), acetonitrile ( 481 ul, 9.2 mmol), 1.8 M LDA in THF (5 ml, 9.2 mmol) and hydrazine hydrochloride (631 mg, 9.20 mmol). The crude product was purified by silica column chromatography, eluting with a gradient of 0-10% methanol in dichloromethane. Pure fractions were combined and evaporated to give 6-[2-(5-amino-1H-pyrazol-3-yl)ethyl]-4-methoxy-N-methyl-pyridine-2-carboxamide as a gum (454 mg, 71%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.84 (3H, d), 2.89-2.94 (2H, m), 2.99-3.03 (2h, m), 3.87 (3H, s), 5.17 (1H, m), 6.99 (1H, d), 7.37 (1H, m), 8.42 (1H, s), 8.55 (1H, d). MS m/z: 276 (MH+).
Methyl 3-[4-methoxy-6-(methylcarbamoyl)pyridin-2-yl]propanoate was prepared following the procedure for methyl 3-[3-methyl-5-(methylcarbamoyl)phenyl]propanoate in Example 142, but starting from methyl (E)-3-[4-methoxy-6-(methylcarbamoyl)pyridin-2-yl]prop-2-enoate (676 mg, 2.7 mmol) to afford methyl 3-[4-methoxy-6-(methylcarbamoyl)pyridin-2-yl]propanoate as an oil (595 mg, 87%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.84 (3H, d), 2.88 (2H, d), 3.03 (2H, t), 3.62 (3H, s), 3.88 (3H, s), 7.05 (1H, d), 7.38 (1H, d), 8.51-8.52 (1H, m).
Methyl (E)-3-[4-methoxy-6-(methylcarbamoyl)pyridin-2-yl]prop-2-enoate used as starting material was prepared following the procedure for methyl-5-(methylcarbamoyl)phenyl]prop-2-enoate in Example 142, but starting from 6-formyl-4-methoxy-N-methyl-pyridine-2-carboxamide (1.27 g, 6.5 mmol) and methyl(triphenyl-phosphoranylidene)acetate (3.26 g, 9.75 mmol). The crude product was purified by silica column chromatography, eluting with a gradient of 25-40% ethyl acetate in hexanes. Pure fractions were combined and evaporated to give methyl (E)-3-[4-methoxy-6-(methylcarbamoyl)pyridin-2-yl]prop-2-enoate as a white solid (680 mg, 42%). 1H NMR (399.9 MHz, DMSO-d6) δ 2.85-2.89 (3H, m), 3.78 (3H, s), 3.93 (3H, s), 7.34-7.38 (1H, m), 7.49-7.53 (2H, m), 7.67 (1H, s), 8.92 (1H, d). MS m/z: 251 (MH+).
6-formyl-4-methoxy-N-methyl-pyridine-2-carboxamide used as starting material was prepared using an analogous method to that used for tert-butyl (3-formyl-5-methoxyphenyl)carbamate in Example 139,, but starting from 6-(hydroxymethyl)-4-methoxy-N-methyl-pyridine-2-carboxamide (1.34 g, 6.80 mmol) and manganese (IV) dioxide (activated 5 um, 2.37 g, 27.2 mmol). The crude product was purified by silica column chromatography, eluting with a gradient of 2-5% methanol in dichloromethane. Pure fractions were combined and evaporated to give to give the title compound as a white solid (1.27 g, 96%). 1H NMR (399.9 MHz, DMSO-d6) δ 2.84-2.88 (3H, m), 2.90 (1H, s), 4.00 (3H, s), 7.57 (1H, d), 7.75 (1H, d), 8.80 (1H, s), 10.00 (1H, d). MS m/z: 195 (MH+).
6-(Hydroxymethyl)-4-methoxy-N-methyl-pyridine-2-carboxamide used as starting material was prepared following the procedure for 3-(hydroxymethyl)-N,5-dimethyl-benzamide in Example 142, but starting from methyl 6-(hydroxymethyl)-4-methoxy-pyridine-2-carboxylate (1.5 g, 7.6 mmol), trimethylaluminium (2M in toluene, 19 ml, 9.5 mmol) and methylamine (2.0M solution in THF, 19 ml, 38 mmol). The crude product was purified by silica column chromatography, eluting with a gradient of 0-5% methanol in dichloromethane. Pure fractions were combined and evaporated to give to give the title compound as a white solid (1.36 g, 91%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.82-2.83 (3H, m), 3.90 (3H, s), 4.59 (2H, d), 5.41-5.48 (1H, m), 7.14 (1H, d), 7.40 (1H, d), 8.67-8.69 (1H, m). MS m/z: 197 (MH+)
Methyl 6-(hydroxymethyl)-4-methoxy-pyridine-2-carboxylate used as starting material, was prepared following the procedure described by Atsushi Kittaka, Yuichi Sugano, Masami Otsuka and Masaji Ohno, Tetrahedron, Vol 44, No 10, p 2821 (1988)—example 4, Man-designed bleomycins. synthesis of dioxygen activating molecules and a DNA cleaving molecule based on bleomycin-Fe(II)-02 complex.
To a stirred degassed solution of 5-bromo-N′-(5-isopropoxy-1H-pyrazol-3-yl)-N-[(3-methylisoxazol-5-yl)methyl]pyrimidine-2,4-diamine (also known as 5-bromo-N-[(3-methyl-1,2-oxazol-5-yl)methyl]-N′-(5-propan-2-yloxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine; 0.12 g, 0.29 mmol) in ethanol (15 ml) was added 10% palladium on carbon (12 mg). The mixture was stirred at room temperature for 24 hours under an atmosphere of hydrogen. The mixture was filtered through Celite and the residue washed with ethanol and then with a mixture of dichloromethane/dimethylformamide and finally with methanolic ammonia solution. The filtrate was evaporated and the residue dissolved in methanol and then purified using an Isolute SCX-3 column eluting with methanolic ammonia solution. Fractions containing product were combined and evaporated to leave example 66 in table 4 (0.045 g, 46% yield).
1H NMR (300 MHz, DMSO): 1.27 (6H, d), 2.20 (3H, s), 4.52-4.71 (3H, m), 5.21 (1H, s), 6.02 (1H, d), 6.17 (1H, s), 7.71 (1H, s), 7.91 (1H, d), 9.98 (1H, s), 11.81 (1H, s).
MS: m/z 330 (MH+).
5-bromo-N′-(5-isopropoxy-1H-pyrazol-3-yl)-N-[(3-methylisoxazol-5-yl)methyl]pyrimidine-2,4-diamine (also known as 5-bromo-N-[(3-methyl-1,2-oxazol-5-yl)methyl]-N′-(5-propan-2-yloxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine), used as starting material, was prepared as follows:
MS: m/z 332 (MH+).
MS: m/z 408 (MH+).
5-isopropoxy-1H-pyrazol-3-amine, used as starting material, can be prepared according to the literature (Sato, Tadahisa; Mizukawa, Hiroki; Kawagishi, Toshio. Preparation of 3-alkoxy-5-amino-1H-pyrazoles as intermediates for photographic magenta couplers JP01013072).
To a stirred degassed solution of 5-bromo-N-[(3-cyclopropylisoxazol-5-yl)methyl]-N′-(5-isopropoxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine (also known as 5-bromo-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]-N′-(5-propan-2-yloxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine; 0.152 g, 0.37 mmol) in ethanol (15 ml) was added 10% palladium on carbon (15 mg). The mixture was stirred at room temperature for 24 hours under an atmosphere of hydrogen. The mixture was filtered through Celite and the residue washed with ethanol and then with methanolic ammonia solution. The filtrate was evaporated and the residue dissolved in methanol and purified using an Isolute SCX-3 column eluting with methanolic ammonia solution. Fractions containing product were combined and evaporated to leave a residue. The solid was then purified again by preparative hplc using a gradient of acetonitrile in water containing 1% ammonia solution. The fractions containing product were combined and then evaporated to leave example 67 in table 4 (0.041 g, 31% yield).
1H NMR (300 MHz, DMSO): 0.69-0.74 (2H, m), 0.94-1.00 (2H, m), 1.27 (6H, d), 1.90-2.01 (1H, m), 4.49-4.71 (3H, m), 5.28 (1H, s), 5.96-6.10 (2H, m), 7.68 (1H, s), 7.93 (1H, s), 10.00 (1H, s), 11.92 (1H, s).
MS: m/z 356 (MH+).
5-bromo-N-[(3-cyclopropylisoxazol-5-yl)methyl]-N′-(5-isopropoxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine (also known as 5-bromo-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]-N′-(5-propan-2-yloxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine), used as starting material, was prepared as follows:
1H NMR (300 MHz, DMSO): 0.77 (2H, m), 1.05 (2H, m), 1.32 (6H, d), 2.01 (1H, m), 4.59 (2H, s), 4.71 (1H, m), 5.69 (1H, s), 6.12 (1H, s), 8.02 (1H, s), 8.17 (1H, s), 9.40 (1H, bs), 11.82 (1H, bs).
MS: m/z 436 (MH+).
(3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as in Example 3.
A mixture of 4-chloro-6-methyl-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-6-methyl-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 0.20 g, 0.84 mmol) and 5-isopropoxy-1H-pyrazol-3-amine (0.178 g, 1.26 mmol) in anhydrous 1-methylpyrrolidinone (2 mL) and 4M hydrogen chloride solution in dioxane (0.42 mL) was heated at 110° C. for 4 hours. The mixture was left to stand at room temperature overnight and was then diluted with saturated sodium bicarbonate solution and extracted with ethyl acetate (×2). The organic extracts were washed with brine, dried over magnesium sulfate, filtered and then evaporated to leave an orange oil. The oil was purified by chromatography on silica eluting with a mixture of 2-4% methanol in dichloromethane. Fractions containing product were combined and then evaporated to leave a solid which was triturated with diethyl ether to leave example 68 in table 4 (0.039 g, 12% yield).
1H NMR (500 MHz, DMSO at 373K): 1.28 (d, 6H), 2.15 (s, 3H), 2.19 (s, 3H), 4.58 (d, 2H), 4.64 (bs, 1H), 5.25 (bs, 1H), 5.41 (bs, 1H), 6.12 (s, 1H), 7.2 (bs, 1H), 9.33 (bs, 1H), 11.39 (bs, 1H).
MS: m/z 344 (MH+).
4-chloro-6-methyl-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-6-methyl-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine), used as starting material, was prepared as follows:
1H NMR (400 MHz, DMSO): 2.02 (s, 3H), 2.2 (s, 3H), 4.56 (s, 2H), 5.5 (s, 1H), 6.19 (s, 1H), 6.94 (bs, 1H), 10.8 (bs, 1H).
1H NMR (400 MHz, DMSO): 2.19 (s, 3H), 2.27 (s, 3H), 4.55 (d, 2H), 6.15 (s, 1H), 6.68 (s, 1H), 8.09 (t, 1H).
MS: m/z 239 (MH+).
5-Isopropoxy-1H-pyrazol-3-amine was synthesized as outlined in Example 66.
A mixture of 2-chloro-N-(5-isopropoxy- I H-pyrazol-3-yl)-6-methyl-pyrimidin-4-amine (0.214 g, 0.80 mmol), (3-cyclopropylisoxazol-5-yl)methanamine hydrochloride (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.168 g, 0.96 mmol) and di-iso-propylethylamine (0.18 ml, 1.04 mmol) in 1-butanol (5 ml) was heated at 120° C. for 2 days. The mixture was diluted with ethyl acetate and washed with water, brine, dried over magnesium sulfate and then evaporated to leave an orange gum. The gum was purified by chromatography on silica eluting with a mixture of 0-5% methanol in dichloromethane. Fractions containing product were combined and evaporated to leave a solid which was triturated with diethyl ether to give example 69 in table 4 (0.118 g, 40% yield).
1H NMR (500 MHz, DMSO 373K): 0.73 (m, 2H), 0.95 (m, 2H), 1.29 (d, 6H), 1.92 (m, 1H), 2.15 (s, 3H), 4.56 (d, 2H), 4.6 (s, 1H), 5.33 (bs, 1H), 5.96 (bs, 1H), 6.02 (s, 1H), 7.08 (bs, 1H), 9.2 (bs, 1H), 11.39 (bs, 1H).
MS: m/z 370 (MH+).
2-chloro-N-(5-isopropoxy-1H-pyrazol-3-yl)-6-methyl-pyrimidin-4-amine, used as starting material, was prepared as follows:
1H NMR (400 MHz, DMSO): 1.28 (d, 6H), 2.29 (s, 3H), 4.52 (bs, 1H), 5.6 (bs, 1H), 6.5-7.5 (bs, 1H), 10.08 (bs, 1H), 11.9 (bs, 1H).
MS: m/z 268 (MH+).
(3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as in Example 3.
6-chloro-N′-(5-isopropoxy-1H-pyrazol-3-yl)-N-[(3-methylisoxazol-5-yl)methyl]pyrimidine-2,4-diamine (also known as 6-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]-N′-(5-propan-2-yloxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine; 0.140 g, 0.38 mmol) was dissolved in methanol (3 ml) and sodium methoxide (0. 104 g, 1.92 mmol) was added. The mixture was heated at 140° C. for 1 hour in a Emrys Optimiser microwave. The reaction was diluted with saturated ammonium chloride solution and then extracted with ethyl acetate (×2). The organic extracts were washed with water and then with brine, dried over magnesium sulfate, filtered and then evaporated to leave a yellow oil. The oil was purified by chromatography on silica eluting with a mixture of 0-5% methanol in dichloromethane. Fractions containing product were combined and evaporated to leave a solid which was triturated with diethyl ether to give example 70 in table 4 (0.045 g, 32% yield).
1H NMR (500 MHz, DMSO 373K): 1.28 (d, 6H), 2.19 (s, 3H), 3.78 (s, 3H), 4.57 (d, 2H), 4.6 (bs, 1H), 5.21 (bs, 1H), 5.39 (bs, 1H), 6.12 (s, 1H), 7.35 (bs, 1H), 9.23 (bs, 1H), 11.35 (bs, 1H).
MS: m/z 360 (MH+).
6-chloro-N′-(5-isopropoxy-1H-pyrazol-3-yl)-N-[(3-methylisoxazol-5-yl)methyl]pyrimidine-2,4-diamine (also known as 6-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]-N′-(5-propan-2-yloxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine), used as starting material, was prepared as follows:
1HNMR(400 MHz, DMSO 373K): 1.31 (d, 6H), 4.5 (bs, 1H), 5.62 (s, 1H), 7.19 (bs, 1H), 10.16 (bs, 1H), 11.72 (bs, 1H).
MS: m/z 288 (MH+).
1H NMR (500 MHz, DMSO 373K): 1.26 (d, 6H), 2.18 (s, 3H), 4.55 (m, 3H), 5.47 (bs, 1H), 6.1-6.25 (m, 2H), 7.55 (bs, 1H), 9.5 (bs, 1H), 11.45 (bs, 1H). MS: m/z 364 (MH+).
Prepared in an analogous way to example 70 but starting with 6-chloro-N-[(3-cyclopropylisoxazol-5-yl)methyl]-N′-(5-isopropoxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine (also known as 6-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]-N′-(5-propan-2-yloxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine; 0.14 g, 0.35 mmol) to give example 71 in table 4 (0.067 g, 49% yield).
1H NMR (500 MHz, DMSO 373K): 0.72 (m, 2H), 0.95 (m, 2H), 1.28 (d, 6H), 1.94 (m, 1H), 3.77 (s, 1H), 4.55 (d, 2H), 4.62 (bs, 1H), 5.21 (bs, 1H), 5.39 (bs, 1H), 6.04 (s, 1H), 7.33 (bs, 1H), 9.34 (bs, 1H), 11.34 (bs, 1H).
MS: m/z 386 (MH+).
6-chloro-N-[(3-cyclopropylisoxazol-5-yl)methyl]-N′-(5-isopropoxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine (also known as 6-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]-N′-(5-propan-2-yloxy-1H-pyrazol-3-yl)pyrimidine-2,4-diamine), used as starting material, was prepared as follows:
1H NMR (500 MHz, DMSO 373K): 0.72 (m, 2H), 0.95 (m, 2H), 1.29 (d, 6H), 1.94 (m, 1H), 4.55 (m, 3H), 5.4 (bs, 1H), 6.04-6.2 (m, 2H), 7.5 (bs, 1H), 9.6 (bs, 1H), 11.42 (bs, 1H).
MS: m/z 390 (MH+).
(3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as in Example 3.
A mixture of N-(5-benzyloxy-1H-pyrazol-3-yl)-2-chloro-pyrimidin-4-amine (0.045 g, 0.15 mmol), (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.045 g, 0.3 mmol) and di-iso-propylethylamine (0.078 ml, 0.45 mmol) in 2-methoxyethanol (2 ml) was heated at 160° C. for 1 hour in an Emrys Optimiser microwave. The mixture was evaporated and the residue purified by preparative hplc eluting with a gradient of acetonitrile in water both containing 1% formic acid to give example 72 in table 4 as the formate salt (0.008 g, 13% yield).
MS: m/z 378 (MH+).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
N-(5-benzyloxy-1H-pyrazol-3-yl)-2-chloro-pyrimidin-4-amine, used as starting material, was prepared a s follows:
MS: m/z 302 (MH+).
5-benzyloxy-1H-pyrazol-3-amine, used as starting material, was obtained as follows:
1H NMR (300 MHz, CDCl3): 5.05 (s, 1H), 5.12 (s, 2H), 7.25-7.45 (m, 5H).
MS: m/z 190 (MH+).
Prepared in an analogous way to example 72 by reacting 2-chloro-N-[5-[(3,5-dimethoxyphenyl)methoxy]-1H-pyrazol-3-yl]pyrimidin-4-amine (0.052, 0.144 mmol) with (3-methylisoxazol-5-yl)methanamine hydrochloride (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 0.043 g, 0.29 mmol). After the reaction was complete the mixture was purified by preparative hplc eluting with a gradient of 25-45% acetonitrile in water containing 1% ammonia. The fractions containing product were combined and evaporated to leave example 73 in table 4 (0.022 g, 35% yield).
1H NMR (300 MHz, DMSO): 2.18 (s, 3H), 3.73 (s, 6H), 4.58 (d, J=5.6 Hz, 2H), 5.07 (s, 2H), 5.30 (s, 1H), 6.02 (d, J=5.5 Hz, 1H), 6.17 (s, 1H), 6.43 (t, J=2.0 Hz, 1H), 6.59 (d, J=2.0 Hz, 2H), 7.69 (s, 1H), 7.92 (d, J=5.5 Hz, 1H), 10.00 (s, 1H), 11.90 (s, 1H).
MS: m/z 438 (MH+). (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
2-chloro-N-[5-[(3,5-dimethoxyphenyl)methoxy]-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material, was prepared as follows:
MS: m/z 360 (MH+).
5-[(3,5-dimethoxyphenyl)methoxy]-1H-pyrazol-3-amine, used as starting material, was prepared as follows:
1H NMR (300 MHz, DMSO): 3.74 (s, 6H), 5.17 (s, 2H), 5.26 (s, 1H), 6.48 (s, 1H), 6.59 (s, 2H).
MS: m/z 250 (MH+).
Prepared in an analogous way to example 38, but starting with 5-[(3-ethylphenyl)methoxy]-2H-pyrazol-3-amine (153.5 mg, 0.71 mmol, 1 eq) and using a 35-55% gradient of acetonitrile in water containing 1% ammonia to purify. The title compound was obtained as a solid (47.7 mg, 17% yield).
1H NMR (300.132 MHz, DMSO): δ 1.19 (t, 3H), 2.19 (s, 3H), 2.62 (q, 2H), 4.58 (d, 2H), 5.10 (s, 2H), 5.29 (s, 1H), 6.02 (s, 1H), 6.17 (s, 1H), 7.13-7.31 (m, 4H), 7.69 (s, 1H), 7.91 (d, 1H), 10.00 (s, 1H), 11.91 (s, 1H). MS: m/z 406 (MH+).
5-[(3-ethylphenyl)methoxy]-2H-pyrazol-3-amine, used as starting material was prepared as follows:
1H NMR (300.132 MHz, DMSO): δ 1.18 (t, 3H), 2.60 (q, 2H), 4.47 (d, 2H), 5.09 (t, 1H), 7.05-7.16 (m, 3H), 7.23 (t, 1H).
2-Chloro-N-[5-(2-methoxy-1-methylethoxy)-1H-pyrazol-3-yl]pyrimidin-4-amine (55 mg, 0.194 mmol) and [(3-methylisoxazol-5-yl)methyl]amine. HCl (also known as (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride; 58 mg, 0.388 mmol) were heated with DIPEA (102ul, 0.582 mmol) in 2-methoxyethanol (2 ml) in a microwave reactor at 160° C. for an initial period of 30 min, then for a further 20 min. The solution was evaporated to dryness and the residue was purified by reverse phase acidic prep hplc, using a gradient of 5-50% MeCN in H2O+0.2% TFA. The product fractions were neutralised with aqueous NaHCO3, concentrated under vacuum to remove organic solvents and extracted with ethyl acetate (3×15 ml). The combined extracts were dried over MgSO4, filtered and evaporated. The gummy residue was triturated with a mixture of ether and hexane to crystallize the product, the solvent was evaporated and the product was dried under vacuum to afford the title compound as a white solid (30 mg, 43% yield).
1H NMR (300.132 MHz, DMSO) δ 1.24 (d, 3H), 2.19 (s, 3H), 3.30 (s, 3H—obscured by water peak), 3.36-3.54 (m, 2H), 4.58 (d, 2H), 4.62-4.76 (m, 1H), 5.23 (bs, 1H), 6.04 (bs, 1H), 6.16 (s, 1H), 7.67 (bs, 1H), 7.90 (d, 1H), 9.97 (bs, 1H), 11.86 (bs, 1H); MS: m/z 360 (MH+)
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
2-Chloro-N-[5-(2-methoxy-1-methylethoxy)-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material was prepared as follows:
The reaction mixture was filtered to remove some undissolved solid and washed through with dichloromethane. The filtrate was extracted with 2M HCl (aq) (2×10 ml) and the combined extracts were washed with dichloromethane (10 ml). The aqueous phase was basified with solid NaHCO3, and re-extracted with dichloromethane (3×10 ml). The basic aqueous phase was then evaporated to dryness and washed with ethyl acetate, filtered to remove inorganics and washed through with ethyl acetate. The solid filtered from the aqueous phase was re-dissolved in aqueous Na2CO3, then re-extracted with ethyl acetate; the pH of the aqueous was then adjusted to pH7-8 and re-extracted with ethyl acetate. The ethyl acetate extracts and washes were combined, dried over MgSO4, filtered and evaporated to give the product, 5-(2-methoxy-1-methylethoxy)-1H-pyrazole-3-amine, as an orange/brown oil (0.60 g, 35%).
1H NMR (300.132 MHz, DMSO) δ 1.18 (d, 3H), 3.26 (s, 3H), 3.31-3.48 (m, 2H), 4.52-4.64 (m, 1H), 4.67 (s, 1H), 4.86 (bs, 2H), 10.34 (bs, 1H); MS: m/z 172 (MH+).
MS: m/z 282 (M−H).
2-Chloro-N-[5-(2-methoxy-1-methylethoxy)-1H-pyrazol-3-yl]pyrimidin-4-amine (55 mg, 0.194 mmol) and 1-(3-cyclopropylisoxazol-5-yl)methanamine.HCl (also known as (3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride; 51 mg, 0.291 mmol) were heated with DIPEA (102 ul, 0.582 mmol) in 2-methoxyethanol (2 ml) in a microwave reactor at 160° C. for and initial period of 40 min, then for a further 1 h. The solvent was removed under vacuum and the residue was purified by reverse phase basic prep hplc, using a gradient of 20-40% MeCN in H2O+1% NH4OH (aq). The combined product fractions were evaporated to give a gum, which was then triturated with ether and hexane to crystallize the product. The solvent was evaporated and the solid dried under vacuum to afford the title compound as a white solid (27 mg, 36%).
1H NMR (300.132 MHz, DMSO) δ 0.64-0.77 (m, 2H), 0.91-1.03 (m, 2H), 1.24 (d, 3H), 1.89-2.02 (m, 1H), 3.30 (s, 3H - obscured by water peak), 3.38-3.55 (m, 2H), 4.56 (d, 2H), 4.64-4.77 (m, 1H), 5.22 (bs, 1H), 6.02 (d, 1H), 6.06 (s, 1H), 7.65 (bs, 1H), 7.91 (d, 1H), 9.98 (bs, 1H), 11.87 (bs, 1H); MS: m/z 386 (MH+).
2-Chloro-N-[5-(2-methoxy-1-methylethoxy)-1H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material was prepared as per example 75a).
3-Cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride was synthesized as outlined in Example 3.
To a solution of 2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (0.741 g, 2.92 mmol,1.00 eq) in 2-methoxy ethanol (15 ml) in a microwave tube was added the ethyl 5-(aminomethyl)1,2-oxazole-3-carboxylate.TFA salt (1.005 g, 3.52 mmol, 1.2 eq) followed by DIPEA (1.27 ml, 7.30 mmol, 2.5 eq. The mixture was then heated to 200° for 45 mins in the microwave. The solvent was removed under vacuum and the residue was dissolved in dichloromethane and washed with water followed by brine. The organic layer was then dried over MgSO4 and reduced under vacuum to give 0.939 g brown gum. The residue was purified by column chromatography, eluting with isohexane/ethyl acetate (50/50). The appropriate fractions were collected and reduced under vacuum to give the title compound as a yellow solid (311 mg, 28% yield).
1H NMR (500.133 MHz, d4 acetic acid): δ 1.25-1.32 (9H, m), 4.35 (2H, q), 4.55-4.60 (1H, m), 4.70 (2H, s), 5.38 (1H, s), 6.13 (1H, d), 6.59 (1H, s), 7.88 (1H, d); MS: m/z 388 (MH+).
2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material, was prepared as follows:
2,4-Dichloropyrimidine (10.051 g, 67.0 mmol .1 eq) and 3-isopropoxy-1H-pyrazol-5-amine (10.0 g, 70.0 mmol, 1.05 eq) were mixed together in ethanol (100 ml) and stirred at 60° C. under nitrogen atmosphere for 5 days. The reaction mixture was reduced in vacuo and the residue was dissolved in ethyl acetate (200 ml) and washed with water twice (200 ml) followed by brine (100 ml). The ethyl acetate layer was dried over MgSO4 and filtered, reduced under vacuum to leave a crude, pale yellow oil, yield 17.1 g. Purification by flash column chromatography using silica, eluting with a mixture of dichloromethane 95% and methanol 5% to dichloromethane 90% and methanol 10%, gave yield to an oily solid (13.7 g). The oily solid was dissolved in hot diethyl ether (100 ml). Upon standing a white solid crystallised out which was filtered, washed with ether (10 ml) and dried to give a white crystalline solid, which was an impurity. The filtrate was reduced in vacuo and then dissolved in a mixture of 50% hot methanol in diethyl ether. Again a solid slowly crystallised out which was filtered off, washed with a mixture of 50% methanol in diethyl ether (100 ml), and dried to give the title compound as a white solid (5.003 g, 29% yield).
1H NMR (500.133 MHz, d4 acetic acid) δ 1.31 (6H, d), 4.47-4.54 (1H, m), 5.61 (1H, s), 6.97 (1H, d), 8.10 (1H, d); MS: m/z 254 (MH+).
5-(Aminomethyl)1,2-oxazole-3-carboxylate, used as starting material can be prepared by the method described in the literature (Barlaam, Bernard; Pape, Andrew; Thomas, Andrew. Preparation of pyrimidine derivatives as modulators of insulin-like growth factor-1 receptor (IGF-1). WO2003048133).
To a stirred degassed solution of 5-[[[5-bromo-4-[(5-propan-2-yloxy-2H-pyrazol-3-yl)amino]pyrimidin-2-yl]amino]methyl]-1,2-oxazole-3-carboxamide (140 mg, 0.32 mmol) in ethanol (15 mL) was added Pd/C catalyst (14 mg). Hydrogen gas was introduced by balloon and the mixture was stirred at room temperature for 30 h. The reaction mixture was then filtered and washed with ethanol followed by methanolic ammonia. The filtrate was then evaporated in vacuo and put onto a SCX column and the free base washed off with methanolic ammonia solution. This solution then evaporated in vacuo to give the title compound as an off-white solid (110 mg, 99%).
1H NMR (300.132 MHz, DMSO) 8 1.26 (6H, d), 4.67 (3H, s), 5.22 (1H, s), 6.04 (1H, d), 6.56 (1H, s), 7.75 (1H, s), 7.91 (1H, d), 8.04 (1H, s), 9.98 (1H, s), 11.8 (1H, s); MS: m/z 359.5 (MH+).
5-[[[5-bromo-4-[(5-propan-2-yloxy-2H-pyrazol-3-yl)amino]pyrimidin-2-yl]amino]methyl]-1,2-oxazole-3-carboxamide used as starting material was prepared as follows:—
5-bromo-2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (0.30 g, 0.90 mmol), 5-(aminomethyl)1,2-oxazole-3-carboxamide TFA salt (0.299 g, 1.17 mmol), DIPEA (628[L, 3.6 mmol) and 2-methoxyethanol (4 mL) were added and reacted in a microwave at 200° for 30 mins. The mixture was evaporated in vacuo and purified by flash column chromatography. The appropriate fractions were collected and evaporated in vacuo to give a pale yellow solid (0.166 g, 42%).
1H NMR (300.132 MHz, DMSO) δ 1.32 (6H, d), 4.65-4.75 (3H, m), 5.70 (1H, s), 6.63 (1H, bs), 7.81 (1H, s), 8.10 (2H, bs), 8.18 (1H, s), 9.43 (1H, bs),11.80 (1H, bs); MS: m/z 439 (MH+).
5-bromo-2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine used as starting material was prepared as follows:—
To a solution of 3-isopropoxy-1 H-pyrazol-5-amine (also known as 5-isopropoxy-1H-pyrazol-3-amine; 2.005 g, 14.2 mmol), in dry THF (60 ml) under nitrogen was added triethylamine (2.37 mL, 17 mmol). This mixture was cooled to 0° C. and a solution of 2,4-dichloro-5-bromopyrimidine (3.23 g, 14.2 mmol) in dry THF (30 ml) was added dropwise. The mixture was then allowed to stir at room temp for 18 h. After this time the mixture was evaporated in vacuo to give a yellow solid, which was crystallised with ethyl acetate, filtered and dried under high vaccuum to give pale yellow solid. The solid was washed thoroughly with water and filtered off. Product was left to dry overnight (1.645 g, 35%) MS: m/z 332 (MH+).
5-Isopropoxy-1H-pyrazol-3-amine was synthesized as outlined in Example 66.
5-(Aminomethyl)1,2-oxazole-3-carboxamide, used as starting material was prepared in an analogous method to that described for (3-pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine in Example 32, except using 2-oxoacetamide as starting material.
To a test tube was added ethyl 5-[[[4-[(5-propan-2-yloxy-2H-pyrazol-3-yl)amino]pyrimidin-2-yl]amino]methyl]1,2-oxazole-3-carboxylate (100 mg, 0.26 mmol) followed by the 2M methylamine in methanol (4.00 ml). The mixture was shaken for 3 hours at room temperature for 3 hours. After this time the mixture was concentrated to give a yellow gum. This gum was dissolved in DMF (4 ml) and purified by basic prep HPLC using a gradient of 15-35% MeCN in H2O+1% NH4OH. The appropriate fractions were collected and concentrated to give the title compound as a white solid (57 mg 59% yield).
1H NMR (500.133 MHz, DMSO): δ 1.27 (6H, d), 2.78 (3H, s), 4.68 (3H, m), 5.28 (1H, s), 6.08 (1H, s), 6.51 (1H, s), 7.34 (1H, s), 7.88 (1H, d), 8.15 (1H, s), 9.43 (1H, s), 11.41 (1H, s);
MS: m/z 373 (MH+)
5-[[[4-[(5-Propan-2-yloxy-2H-pyrazol-3-yl)amino]pyrimidin-2-yl]amino]methyl]1,2-oxazole-3-carboxylate was synthesized as outlined in Example 77.
To a test tube was added ethyl 5-[[[4-[(5-propan-2-yloxy-2H-pyrazol-3-yl)amino]pyrimidin-2-yl]amino]methyl]1,2-oxazole-3-carboxylate (62 mg, 0.16 mmol) followed by dimethylamine in 33% absolute ethanol (4 mL). The mixture was shaken and heated to 75° C. for 3 h. After this time the mixture was reduced under vacuum to give a yellow gum. This gum was dissolved in DMF (4 ml) and purified by basic prep. HPLC using a gradient of 15-35% MeCN in H2O+1% NH4OH. The appropriate fractions were collected and reduced under vacuum to give the title compound as a white solid (13 mg 21% yield).
1H NMR (300.132 MHz, DMSO): δ 1.27 (6H, d), 2.99 (3H, s), 3.05 (3H, s), 4.68 (3H, d), 5.28 (1H, s), 6.05 (1H, s), 6.48 (1H, s), 7.73 (1H, s), 7.91 (1H, d), 10.09 (1H, s), 11.85 (1H, s)
MS: m/z 387 (MH+)
5-[[[4-[(5-Propan-2-yloxy-2H-pyrazol-3-yl)amino]pyrimidin-2-yl]amino]methyl]1,2-oxazole-3-carboxylate was synthesized as outlined in Example 77.
To a solution of 2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (100 mg, 0.39 mmol, 1 eq) in 2-methoxy ethanol (3 ml)in a microwave tube was added (3-pyrimidin-5-yl1,2-oxazol-5-yl)methanamine.TFA salt (117 mg, 0.40 mmol, 1.02 eq). The mixture was then heated to 200° C. for 30 mins in the microwave (Smith Synthesiser). The solvent was removed in vacuo. The residue was dissolved in methanol and put onto a 5 g Isolute SCX-3 column. The compound was then washed off with methanolic ammonia and reduced under vacuum to give a brown gum. The gum was dissolved in 4 ml DMF and purified by basic prep HPLC using a gradient 15-30% MeCN in H2O+1% NH4OH. The appropriate fractions were collected and reduced under vacuum to give the title compound as an off-white solid (50 mg, 33% yield).
1H NMR (500.133 MHz, DMSO): δ 1.27 (6H, d), 4.60-4.75 (3H, m), 5.40 (1H, bs), 6.16 (1H, bs), 6.97 (1H, s), 7.48 (1H, bs), 7.96 (1H, s), 9.17 (2H, s), 9.24 (1H, s), 9.49 (1H, bs), 11.45 (1H, bs); MS: m/z 394 (MH+).
2-Chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material was prepared as in Example 77.
(3-Pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine.TFA salt was synthesized as outlined in Example 32.
To a solution of 2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (0.1 g, 0.39 mmol) in 2-methoxy ethanol (3 mL) in a microwave tube was added (3-pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine.TFA salt (0.137 g, 0.47 mmol). The mixture was then heated to 200° for 30 mins in the microwave. After this time the solvent was removed in vacuo. The residue was dissolved in methanol and purified by chromatography using a SCX-3 column. The compound was washed off with methanolic ammonia to give a brown tar, which was subsequently purified by flash column chromatography, eluting with DCM/MeOH (95%/5%). The desired fractions were collected and reduced in vacuo to give a brown gum. The gum was dissolved in 4 ml DMF and purified by basic prep. HPLC using a gradient 15-35% MeCN in H2O+1% NH4OH. The appropriate fractions were collected and reduced in vacuo to give the title product (0.034 g, 22%).
1H NMR (300.132 MHz, DMSO) δ 1.26 (6H, d), 4.57-4.77 (3H, m), 5.23 (1H, s), 6.06 (1H, s), 6.84 (1H, s), 7.61 (1H, t), 7.79 (1H, s), 7.92 (1H, d), 8.96 (2H, d), 9.94 (1H, s), 11.87 (1H, s); MS: m/z 394 (MH+).
2-Chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material was prepared as in Example 77.
(3-pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine.TFA salt used as starting material was prepared as outlined in Example 81.
To a solution of 2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (100 mg, 0.39 mmol, 1 eq) in 2-methoxy ethanol (3 ml)in a microwave tube was added [3-(oxolan-3-yl)1,2-oxazol-5-yl]methanamine (150 mg, 0.89 mmol, 2.3 eq). The mixture was then heated to 200° C. for 45 mins in the microwave (Smith Synthesiser). The solvent was removed in vacuo. The residue was dissolved in methanol and put onto a 5 g Isolute SCX-3 column. The compound was then washed off with methanolic ammonia and reduced under vacuum to give a gum. The gum was dissolved in 4 mL DMF and purified by basic prep HPLC using a gradient 20-40% MeCN in H2O+1% NH4OH. The appropriate fractions were collected and reduced under vacuum to give the title compound as a pale orange solid (42 mg, 28% yield).
1H NMR (300.132 MHz, DMSO): 8 1.27 (6H, d), 1.93-2.01 (1H, m), 2.22-2.31 (1H, m), 3.35-4.01 (5H, m), 4.51-4.73 (3H, m), 5.19 (1H, s), 6.04 (1H, s), 6.29 (1H, s), 7.70 (1H, s), 7.93 (1H, s), 9.97 (1H, s), 11.87 (1H, s); MS: m/z 386 (MH+).
2-Chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material was prepared as in Example 77.
[3-(Oxolan-3-yl)1,2-oxazol-5-yl]methanamine, used as starting material was prepared in an analogous method to that described for (3-pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine in Example 32, except using oxolane-3-carbaldehyde as starting material. Final yield was 86%.
To a solution of 2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (100 mg, 0.39 mmol, 1 eq) in 2-methoxy ethanol (3 ml)in a microwave tube was added [3-(oxolan-2-yl)1,2-oxazol-5-yl]methanamine (150 mg, 0.89 mmol, 2.3 eq). The mixture was then heated to 200° C. for 45 mins in the microwave (Smith Synthesiser). The solvent was removed in vacuo. The residue was dissolved in methanol and put onto a 5 g Isolute SCX-3 column. The compound was washed off with methanolic ammonia and reduced under vacuum to give a gum. The gum was dissolved in 4 mL DMF and purified by basic prep. HPLC using a gradient 20-40% MeCN in H2O+1% NH4OH. The appropriate fractions were collected and reduced under vacuum to give the title compound as an off-white solid (18 mg, 12% yield).
1H NMR (500.133 MHz, d4 acetic acid): δ 1.27 (6H, d), 1.90-1.93 (3H, m), 2.15-2.23 (1H, m), 3.72-3.78 (1H, m), 3.80-3.86 (1H, m), 4.52-4.57 (1H, m), 4.61 (2H, s), 4.84-4.88 (1H, m), 5.42 (1H, s), 6.14 (1H, d), 6.21 (1H, s), 7.86 (1H, d); MS: m/z 386 (MH+).
2-Chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material was prepared as in Example 77.
[3-(Oxolan-2-yl)1,2-oxazol-5-yl]methanamine, used as starting material was prepared in an analogous method to that described for (3-pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine in Example 32, except using oxolane-2-carbaldehyde as starting material.
To a solution of 2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (100 mg, 0.39 mmol, 1 eq) in 2-methoxy ethanol (3 ml)in a microwave tube was added [3-(oxan-4-yl)1,2-oxazol-5-yl]methanamine ( (11 3 mg, 0.62 mmol, 1.6 eq). The mixture was then heated to 200° C. for 45 mins in the microwave (Smith Synthesiser). The solvent was removed in vacuo. The residue was dissolved in methanol and put onto a 5 g Isolute SCX-3 column. The compound was then washed off with methanolic ammonia and reduced under vacuo to give a gum. The gum was dissolved in 4 ml DMF and purified by basic prep HPLC using a gradient 20-40% MeCN in H2O+1% NH4O H. The appropriate fractions were collected and reduced under vacuum to give the title compound as a pale cream solid (35 mg, 22% yield).
1H NMR (500.133 MHz, d4 acetic acid): δ 1.27 (6H, d), 1.62-1.71 (2H, m), 1.77-1.83 (2H, m), 2.88-2.97 (1H, m), 3.39-3.46 (2H, m), 3.84-3.89 (2H, m), 4.55-4.62 (3H, m), 5.39 (1H, s), 6.11 (1H, d), 6.21 (1H, s), 7.88 (1H, d); MS: m/z 400 (MH+).
2-Chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material was prepared as in Example 77.
[3-(Oxan-4-yl)1,2-oxazol-5-yl]methanamine, used as starting material was prepared in an analogous method to that described for (3-pyrimidin-2-yl-1,2-oxazol-5-yl)methanamine in Example 32, except using oxane-4-carbaldehyde as starting material.
A mixture of 3-ethoxy-5-aminopyrazole (also known as 5-ethoxypyrazol-3-amine; 0.21 g, 1.65 mmol) and 4-chloro-2-(5-aminomethyl-3-methylisoxazole)pyrimidine (also known as 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 0.371 g, 1.65 mmol) in ethanol (5 mL) was heated at 80° C. overnight. The mixture was allowed to cool, diluted with ethanol and then filtered. The filtered solid was dissolved in a mixture of acetonitrile, dimethylformaide and aqueous ammonia solution and purified by reverse phase preparative chromatography eluting with a gradient of acetonitrile in water (containing 1% ammonia). Fractions containing product were combined and concentrated in vacuo. The resultant precipitate was collected by filtration and dried under vacuum at room temperature to yiled the title compound (0.118 g, 23% yield).
1H NMR (300 MHz, DMSO+acetic acid): δ 7.89 (d, 1H), 6.15 (s, 1H), 6.06 (d, 1H), 5.32 (br s, 1H), 4.57 (s, 2H), 4.08 (q, 2H), 2.18 (s, 3H), 1.29 (t, 3H).
MS: m/z 316 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
3-Ethoxy-5-aminopyrazole (also known as 5-ethoxypyrazol-3-amine) has been described in the literature: Kawagishi, Toshio; Sato, Tadahisa. Preparation of 3-alkoxy-5-aminopyrazoles as materials for photographic couplers and drugs. JP63250368.
Prepared in an analogous way to example 11 but starting with 5-[(3-morpholin-4-ylphenyl)methoxy]-1H-pyrazol-3-amine (182 mg, 0.66 mmol, 1 eq) and using a 25-45% gradient of acetonitrile in water containing 1% ammonia to purify. The title compound was obtained as a solid (28.4 mg, 9.3% yield).
1H NMR (300.132 MHz, DMSO): δ 2.19 (s, 3H), 3.11 (t, 4H), 3.74 (t, 4H), 4.58 (d, 2H), 5.07 (s, 2H), 5.33 (s, 1H), 6.05 (d, 1H), 6.16 (s, 1H), 6.89 (m, 2H), 7.00 (s, 1H), 7.23 (t, 1H), 7.66 (s, 1H), 7.91 (d, 1H), 9.96 (s, 1H), 11.92 (s, 1H). MS: m/z 463 (MH+).
5-[(3-morpholin-4-ylphenyl)methoxy]-1H-pyrazol-3-amine used as starting material was prepared in a similar manner to 5-[(3-ethylphenyl)methoxy]-2H-pyrazol-3-amine in Example 74a) and taken on crude to the next step.
Prepared in an analogous way to example 38, but starting with 5-[(3-methylsulfonyloxyphenyl)methoxy]-2H-pyrazol-3-amine (80 mg, 0.28 mmol, 1 eq) and using a 15-35% gradient of acetonitrile in water containing 1% ammonia to purify. The title compound was obtained as a solid (37.5 mg, 29% yield).
1H NMR (300.132 MHz, DMSO): δ 2.19 (s, 3H), 3.39 (s, 3H), 4.58 (d, 2H), 5.20 (s, 2H), 5.32 (s, 1H), 6.03 (d, 1H), 6.17 (s, 1H), 7.26-7.58 (m, 2H), 7.71 (s, 1H), 7.92 (d, 1H), 10.03 (s, 1H), 11.95 (s, 1H). MS: m/z 472 (MH+).
5-[(3-methylsulfonyloxyphenyl)methoxy]-2H-pyrazol-3-amine, used as starting material was prepared from (3-methylsulfonyloxyphenyl)methanol in an analogous way to 5-[(3-ethylphenyl)methoxy]-2H-pyrazol-3-amine in Example 74a). Isolated as a clear film (80 mg, 9% yield) MS: m/z 284 (MH+).
3-[[5-[[2-[(3-Methyl 1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]oxymethyl]benzoic acid (70 mg, 0.17 mmol, 1 eq), diphenylphosphoryl azide (40 μl, 0.18 mmol, 1.1 eq) and diisopropylethylamine (23 μl, 0.18 mmol, 1.1 eq) were dissolved in t-butanol (3 ml) and heated to 150° C. for 20 minutes. After this time the mixture was concentrated and the residue purified by basic prep HPLC. The product containing fraction was concentrated to give the title compound (14 mg, 17%) as a white solid.
1H NMR (300.132 MHz, DMSO) δ 1.48 (s, 9H), 2.19 (s, 3H), 4.58 (d, 2H), 5.06 (s, 2H), 5.29 (s, 1H), 6.02 (d, 1H), 6.17 (s, 1H), 7.02 (d, 1H), 7.21-7.26 (m, 1H), 7.34 (d, 1H), 7.59 (s, 1H), 7.69 (s, 1H), 7.91 (d, 1H), 9.34 (s, 1H), 10.00 (s, 1H), 11.91 (s, 1H). MS: m/z 493
(MH+)
3-[[5-[[2-[(3-Methyl 1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]oxymethyl]benzoic acid was prepared as outlined in Example 98.
To a stirred solution of 3-[[5-[[2-[(3-Methyl1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]oxymethyl]benzoic acid (60 mg, 0.14 mmol, 1 eq) in DMF (4 ml) was added HATU (60 mg, 0.16 mmol, 1.1 eq) followed by morpholine (25 mg, 0.29 mmol, 2 eq). The reaction was stirred for 24 hours at room temperature, then concentrated and the residue partitioned between water (10 ml) and ethyl acetate (10 ml). The organic layer, in each case, was separated and washed with water (2×10 ml), sat NaHCO3 (2×10 ml), brine (2×10 ml) and dried over anhydrous Na2SO4. The solution was concentrated to yield the title compound (22 mg, 32%) as a white solid.
1H NMR (300.132 MHz, DMSO) δ 2.24 (s, 3H), 3.61-3.68 (m, 8H), 4.63 (d, 2H), 5.25 (s, 2H), 5.36 (s, 1H), 6.08 (d, 1H), 6.22 (s, 1H), 7.40 (d, 1H), 7.49-7.59 (m, 3H), 7.75 (s, 1H), 7.97 (d, 1H), 10.07 (s, 1H), 11.98 (s, 1H). MS: m/z 491 (MH+)
3-[[5-[[2-[(3-Methyl 1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]oxymethyl]benzoic acid was prepared as outlined in Example 98.
Prepared using a method analogous to example 90, using methylamine hydrochloride (20 g, 0.29 mmol, 2 eq) and diisopropylethylamine (50μl, 0.29 eq, 2 eq) as starting materials to yield the title compound (45 mg, 74%) as a white solid.
1H NMR (300.132 MHz, DMSO) δ 2.24 (s, 3H), 2.84 (d, 3H), 4.63 (d, 2H), 5.24 (s, 2H), 5.36 (s, 1H), 6.08 (d, 1H), 6.22 (s, 1H), 7.49-7.54 (m, 1H), 7.63 (d, 1H), 7.76 (d, 1H), 7.83 (d, 1H), 7.96 (s, 2H), 8.49 (d, 1H), 10.06 (s, 1H), 11.98 (s, 1H). MS: m/z 435 (MH+)
Prepared using an analogous method to example 46, but starting with 3-[(5-amino-2H-pyrazol-3-yl)oxymethyl]benzonitrile (77 mg, 0.36 mmol) to give the title compound (27 mg, 17% yield)
1H NMR (300.132 MHz, DMSO) δ 2.19 (s, 3H), 4.71 (s, 2H), 5.19 (s, 2H), 6.25 (s, 1H), 6.38 (s, 1H), 7.61 (t, 1H), 7.75-7.93 (m, 4H). MS: m/z 403 (MH+)
3-[(5-Amino-2H-pyrazol-3-yl)oxymethyl]benzonitrile, used as starting material, was prepared as follows:
Prepared using an analogous method to example 46, but starting with 5-[(3-chlorophenyl)methoxy]-1H-pyrazol-3-amine (80 mg, 0.36 mmol) to give the title compound (42 mg, 26% yield)
1H NMR (300.132 MHz, DMSO) δ 2.19 (s, 3H), 4.71 (s, 2H), 5.14 (s, 2H), 6.26 (s, 1H), 6.37 (s, 1H), 7.37-7.42 (m, 4H), 7.49 (s, 1H), 7.92 (d, 1H). MS: m/z 412 (MH+)
5-[(3-chlorophenyl)methoxy]-1H-pyrazol-3-amine, used as a starting material, was prepared using an analogous method to example 92a, but starting with (3-chlorophenyl)methanol (3.75 g, 26.2 mmol) to give 5-[(3-chlororophenyl)methoxy]-1H-pyrazol-3-amine (179 mg, 4%) as a white solid. 1H NMR (300.132 MHz, DMSO) δ 4.75 (s, 1H), 4.94 (s, 2H), 5.06 (s, 2H), 7.32-7.41 (m, 3H), 7.44 (s, 1H), 10.43 (s, 1H). MS: m/z 224 (MH+)
Prepared using an analogous method to to example 46, but starting with 5-[(3-fluorophenyl)methoxy]-1H-pyrazol-3-amine (74 mg, 0.36 mmol) to give the title compound (73 mg, 47% yield)
1H NMR (300.132 MHz, DMSO) δ 2.19 (s, 3H), 4.71 (s, 2H), 5.14 (s, 2H), 6.26 (s, 1H), 6.38 (s, 1H), 7.12-7.19 (m, 1H), 7.22-7.28 (m, 2H), 7.40-7.47 (m, 1H), 7.91 (d, 1H). MS: m/z 396 (MH+)
5-[(3-fluorophenyl)methoxy]-1H-pyrazol-3-amine, used as a starting material, was prepared using an analogous method to example 92a), but starting with (3-fluorophenyl)methanol (3.3 g, 26.2 mmol) to give 5-[(3-fluorophenyl)methoxy]-1H-pyrazol-3-amine (428 mg, 10%) as a white solid. 1H NMR (300.132 MHz, DMSO) δ 4.76 (s, 1H), 4.93 (s, 2H), 5.06 (s, 2H), 7.09-7.15 (m, 1H), 7.18-7.24 (m, 2H), 7.37-7.44 (m, 1H), 10.41 (s, 1H). MS: m/z 208 (MH+)
Prepared using an analogous method to example 46, but starting with 5-[[3-(trifluoromethyl)phenyl]methoxy]-1H-pyrazol-3-amine (92 mg, 0.36 mmol) to give the title compound (29 mg, 17% yield)
1H NMR (300.132 MHz, DMSO) δ 2.18 (s, 3H), 4.70 (s, 2H), 5.22 (s, 2H), 6.25 (s, 1H), 6.37 (s, 1H), 7.61-7.75 (m, 3H), 7.78 (s, 1H), 7.90 (d, 1H). MS: m/z 446 (MH+)
5-[[3-(trifluoromethyl)phenyl]methoxy]-1H-pyrazol-3-amine, used as a starting material, was prepared using an analogous method to example 92a, but starting with [3-(trifluoromethyl)phenyl]methanol (4.63 g, 26.2 mmol) to give 5-[[3-(trifluoromethyl)phenyl]methoxy]-1H-pyrazol-3-amine (121 mg, 2.4%) as an off-white solid.
MS: m/z 258 (MH+)
Prepared using an analogous method to example 46, but starting with 5-[[4-(trifluoromethyl)phenyl]methoxy]-1H-pyrazol-3-amine (77 mg, 0.36 mmol) to give the title compound (58 mg, 38% yield)
1H NMR (300.132 MHz, DMSO) δ 2.18 (s, 3H), 4.71 (s, 2H), 5.24 (s, 2H), 6.25 (s, 1H), 6.37 (s, 1H), 7.64 (d, 2H), 7.75 (d, 2H), 7.91 (d, 1H). MS: m/z 445 (MH+)
5-[[4-(trifluoromethyl)phenyl]methoxy]-1H-pyrazol-3-amine, used as a starting material, was prepared using an analogous method to example 92a, but starting with [4-(trifluoromethyl)phenyl]methanol (4.27 g, 24.2 mmol) to give 5-[[4-(trifluoromethyl)phenyl]methoxy]-1H-pyrazol-3-amine (177 mg, 3.4%) as a white solid.
1H NMR (399.902 MHz, DMSO) δ 4.77 (s, 1H), 4.95 (s, 2H), 5.16 (s, 2H), 7.61 (d, 2H), 7.73 (d, 2H), 10.42 (s, 1H). MS: m/z 258 (MH+)
Prepared using an analogous method to example 46, but starting with methyl 3-[(5-amino-1H-pyrazol-3-yl)oxymethyl]benzoate (500 mg, 2.02 mmol) to give the title compound (320 mg, 44% yield).
1H NMR (300.132 MHz, DMSO) δ 2.18 (s, 3H), 3.86 (s, 3H), 4.70 (s, 2H), 5.20 (s, 2H), 6.25 (s, 1H), 6.37 (s, 1H), 7.52-7.57 (m, 1H), 7.70 (d, 1H), 7.89-7.94 (m, 2H), 8.03 (s, 1H). MS: m/z 436 (MH+)
Methyl 3-[(5-amino-1H-pyrazol-3-yl)oxymethyl]benzoate, used as a starting material, was prepared using an analogous method to example 92a, but starting with methyl 3-(hydroxymethyl)benzoate (4.5 g, 27.1 mmol) to give Methyl 3-[(5-amino-1H-pyrazol-3-yl)oxymethyl]benzoate (602 mg, 9%) as a brown gum.
1H NMR (300.132 MHz, DMSO) δ 3.86 (s, 3H), 4.77 (s, 1H), 4.93 (s, 2H), 5.12 (s, 2H), 7.49-7.54 (m, 1H), 7.67 (d, 1H), 7.89 (d, 1H), 7.99 (s, 1H), 10.42 (s, 1H) MS: m/z 248 (MH+)
Methyl 3-(hydroxymethyl)benzoate was prepared as follows:
mono-Methylisophthalate (8 g, 44.4 mmol, 1 eq) was dissolved in tetrahydrofuran (250 ml) at room temperature. 1.0M Borane-THF solution (222 ml, 222 mmol, 5 eq) was added slowly and the solution stirred for 24 hours at RT. After this time, methanol (30 ml) was slowly added and the reaction stirred at RT for 1 hour after which it was concentrated. The residue was partitioned between ethyl acetate (50 ml) and 10% aq ammonium hydroxide solution and the organic layer separated. The aqueous layer was washed with ethyl acetate (2×50 ml) and the organic layers combined, washed with 10% aq ammonium hydroxide solution (2×50 ml), 2M hydrochloric acid (2×50 ml), water (2×50 ml), brine (2×50 ml) and dried over anhydrous sodium sulphate. The solution was concentrated to give methyl 3-(hydroxymethyl)benzoate as a colourless oil (6.2 g, 84%).
1H NMR (400.132 MHz, DMSO) δ 3.86 (s, 3H), 4.58 (d, 2H), 5.33 (t, 1H), 7.45-7.49 (m, 1H), 7.59 (d, 1H), 7.84 (d, 1H), 7.96 (s, 1H). MS: N/A
3-[[5-[[2-[(3-Methyl1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]oxymethyl]benzoate hydrochloride (30 mg, 0.063 mmol, 1 eq) was dissolved in 2M sodium hydroxide solution (2 ml) with one drop of methanol added. The mixture was heated to 120° C. for 20 mins. After this time, the reaction was cooled to approx 10° C. and neutralised with 2M hydrochloric acid. The precipitate was filtered and washed with cold water, then dried to give 3-[[5-[[2-[(3-methyl1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]oxymethyl]benzoic acid as a white solid (14 mg, 52%)
1H NMR (300.132 MHz, DMSO) d 2.17 (s, 3H), 4.57 (s, 2H), 5.21 (s, 2H), 5.38 (s, 1H), 6.15 (s, 1H), 7.47-7.52 (m, 1H), 7.67 (d, 1H), 7.87-7.91 (m, 2H), 8.01 (s, 1H)
3-[[5-[[2-[(3-Methyl 1,2-oxazol-5-yl)methylamino]pyrimidin-4-yl]amino]-1H-pyrazol-3-yl]oxymethyl]benzoate was prepared as outlined in Example 97.
A mixture of 5-[(4-ethoxy-3-methoxy-phenyl)methoxy]-1H-pyrazol-3-amine (87 mg, 0.33 mmol), 4-chloro-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 75 mg, 0.33 mmol) and ethanol (3 ml) was heated at 80° C. for 24 h. After evaporating under reduced pressure, the crude product was purified by column chromatography on silica in ammonia/methanol/DCM (2:8:90). Fractions containing product were combined and evaporated to yield an off white solid that required additional purification by reverse phase prep. HPLC (acidic) using a 25-45% gradient of acetonitrile in water containing 0.1% trifluoroacetic acid. The clean fractions were taken and evaporated to afford the title compound as a white solid (11 mg, 7%). 1H NMR (399.9 MHz, DMSO-d6) δ1.29 (3H, t), 2.18 (3H, s), 3.36 (2H, s), 3.72 (3H, s), 3.94 (2H, q), 4.64-4.66 (2H, m), 6.17 (1H, s), 6.43 (2H, s), 6.77-6.79 (1H, m), 6.93-6.94 (1H, m), 7.42 (1H, s), 7.48 (1H, d), 8.08 (1H, d), 9.56 (1H, s); MS: m/z 452 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[(4-ethoxy-3-methoxy-phenyl)methoxy]-1H-pyrazol-3-amine used as starting material was prepared using an analogous procedure to 82a), starting from 3-methoxy-4-ethoxybenzylalcohol (4.74 g, 26 mmol) as starting material. 5-[(4-Ethoxy-3-methoxy-phenyl)methoxy]-1H-pyrazol-3-amine was obtained as a solid (90 mg, 1.3%); MS: m/z 264 (MH+).
Prepared using an analogous method to example 46, but starting with 5-[(4-fluoro-3-methoxy-phenyl)methoxy]-N-methyl-1H-pyrazol-3-amine (85 mg, 0.36 mmol) to give the title compound (55 mg, 33% yield)
1H NMR (300.132 MHz, DMSO) δ 2.18 (s, 3H), 3.85 (s, 3H), 4.72 (s, 2H), 5.06 (s, 2H), 6.27 (s, 1H), 6.37 (s, 1H), 6.97-7.03 (m, 1H), 7.16-7.26 (m, 2H), 7.91 (d, 1H). MS: m/z 426 (MH+)
5-[(4-Fluoro-3-methoxy-phenyl)methoxy]-N-methyl-1H-pyrazol-3-amine, used as a starting material, was prepared using an analogous method to example 92a, but starting with methyl (4-fluoro-3-methoxy-phenyl)methanol (3.79 g, 24.2 mmol) to give 5-[(4-Fluoro-3-methoxy-phenyl)methoxy]-N-methyl-1H-pyrazol-3-amine (258 mg, 5.4%) as a white solid.
1H NMR (300.132 MHz, DMSO) δ 4.75 (s, 1H), 4.91 (s, 2H), 4.99 (s, 2H), 6.93-6.98 (m, 1H), 7.15 (d, 1H), 7.19 (d, 1H), 10.41 (s, 1H). MS: m/z 238 (MH+)
A mixture of 5-(2-phenoxyethoxy)-2H-pyrazol-3-amine (0.483 g, 2.20 mmol), 4-chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (0.495 g, 2.20 mmol) and ethanol (10 ml) was stirred and heated at 80° C. for 18 h. The mixture was filtered and the precipitate washed with ice cold ethanol and then washed with ether to give product (0.355 g, 40% yield).
1H NMR (399.9 MHz, DMSO-d6) δ 2.20 (3H, s), 4.30 (2H, t), 4.37 (2H, s), 4.76 (2H, s), 5.9 (1H, s), 6.22-6.43 (2H, d), 6.39 (1H, s), 6.95-6.99 (3H, m), 7.29-7.34 (2H, m), 7.94 (1H, d), 8.80-8.95 (1H, s), 11.2-11.4 (1H, s), 12.5-13.2 (1H, s); MS: m/z 408 (MH+)
5-(2-phenoxyethoxy)-2H-pyrazol-3-amine, used as starting material was prepared as follows:
A mixture of 2-cyanoacetohydrazide (2.34 g, 24.12 mmol), 4-methylbenzenesulfonic acid (9.18 g, 48.24 mmol), 2-phenoxyethanol (10.00 g, 72.37 mmol) and toluene (15 ml) was stirred under reflux (Dean and Stark conditions) for 5 hours. Ethyl acetate (20 ml) was added and stirred, and the mixture allowed to cool. After cooling, the mixture was filtered and the obtained sulfonate of 5-(2-phenoxyethoxy)-2H-pyrazol-3-amine was neutralised with 10% aqueous sodium hydroxide solution. The precipitated 5-(2-phenoxyethoxy)-2H-pyrazol-3-amine was then filtered, washed with ethyl acetate and brine, and dried with magnesium sulphate to give the final product (1215 mg, 23%).
A mixture of 2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (254 mg, 1.00 mmol), (3-cyclobutyl-1,2-oxazol-5-yl)methanamine (153 mg, 1.00 mmol) and ethanol (3 ml) was heated at 150° C. in the microwave for 30 mins. After cooling, the crystalline solid was filtered off, washed with cold ethanol and the crude product was purified by reverse phase prep. HPLC (basic) using a 31-51% gradient of acetonitrile in water containing 1% ammonium hydroxide. The desired fractions were collected and evaporated to afford the title compound as a white solid (78 mg, 22%). 1H NMR (399.9 MHz, DMSO-d6) δ 1.28 (6H, d), 1.83-1.92 (1H, m), 1.95-2.04 (1H, m), 2.12-2.19 (1H, m), 2.24-2.32 (1H, m), 3.50-3.58 (1H, m), 4.60 (2H, d), 7.71 (1H, s), 7.92 (2H, d), 9.99 (1H, m), 11.89 (1H, m),
MS: m/z 370 (MH+).
2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material was prepared as in Example 77.
(3-cyclobutyl-1,2-oxazol-5-yl)methanamine, used as starting material was prepared as in Example 23.
To a reaction tube was added 4-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (100 mg, 0.40 mmoles), ethanol (2 ml), and 5-phenylmethoxy-2H-pyrazol-3-amine (80 mg, 0.42 mmoles). The mixture was heated overnight at 80° C. The cooled mixture was filtered and the solid was washed with ethanol. The solid was suspended in water and to this was added a few drops of conc. ammonia and the resulting solid was filtered off. The resulting gum was combined with the aqueous filtrate and the mixture was diluted with methanol to dissolve any solid. The mixture was poured onto a SCX-2 column and washed with methanol. The product was eluted with 2N ammonia in methanol to give crude product as a yellow gum. The crude product was purified by reverse phase prep. HPLC (basic) using a 10-95% gradient of acetonitrile in water containing 1% ammonium hydroxide. The product was obtained as a solid (15 mg, 9%).
1H NMR (DMSO 400.13 MHz) δ 0.71 (m, 2H), 0.95 (m, 2H), 1.94 (m, 1H), 4.55 (d, 2H), 5.13 (s, 2H), 5.28 (bs, 1H), 6.01 (d, 1H), 6.05 (s, 1H), 7.3-7.45 (m, 5H), 7.56 (bs, 1H), 7.92 (d, 1H), 9.97 (bs, 1H), 11.9 (bs, 1H)
MS: m/z 404 (MH+).
4-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine, used as starting material was prepared as in Example 19.
5-Phenylmethoxy-2H-pyrazol-3-amine (also named as 5-benzyloxy-1H-pyrazol-3-amine), used as starting material was prepared as in Example 72.
2-chloro-N-[5-[(3-methoxy-5-methyl-phenyl)methoxy]-2H-pyrazol-3-yl]pyrimidin-4-amine (73 mg, 0.2 mmol), (3-methyl-1,2-oxazol-5-yl)methanamine. hydrochloride (38 mg, 0.25 mmol) and N-ethyl-N-propan-2-yl-propan-2-amine (112 uL, 0.63 mmol) in ethanol (4 ml) were heated at 180° C. in a microwave reactor for 45 mins. The reaction mixture was cooled and the solution concentrated. The crude product was purified by reverse-phase prep. HPLC (basic) using a 35-55% gradient of acetonitrile in water containing 1% ammonium hydroxide solution. The clean fractions were taken and evaporated to afford the title compound as a gum. (8 mg, 9% yield). H NMR (500.13 MHz, DMSO-d6) δ 2.17 (3H, m), 2.27 (3H, s), 3.72 (3H, s) 4.50-4.59 (2H, m), 5.03, (2H, s), 5.30 (1H, s), 5.99 (1H, s), 6.13 (1H, s), 6.68 (1H, s), 6.75 (1H, s), 6.80 (1H, s), 7.67 (1H, s), 7.89 (1H, d), 10.08 (1H, s), 11.95 (1H, s). MS: m/z 422 (MH+).
(3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride, used as starting material, was prepared as outlined in Example 1.
2-chloro-N-[5-[(3-methoxy-5-methyl-phenyl)methoxy]-2H-pyrazol-3-yl]pyrimidin-4-amine used as starting material was prepared as follows:
5-[(3-methoxy-5-methyl-phenyl)methoxy]-2H-pyrazol-3-amine mono hydrochloride (256 mg, 0.95 mmol), 2,4-dichloropyrimidine (170 mg, 1. 14 mmol) and N-ethyl-N-propan-2-yl-propan-2-amine (423 μL, 2.38 mmol) in ethanol (15 ml) were heated at 80° C. for 144 h. The reaction mixture was cooled and the solution concentrated. The crude product was purified by normal phase chromatography on silica, using a 0-5% gradient of methanol in DCM. The clean fractions were taken and evaporated to afford the title compound as a oil. (75 mg, 23% yield). MS: m/z346(MH+).
5-[(3-methoxy-5-methyl-phenyl)methoxy]-2H-pyrazol-3-amine mono hydrochloride used as starting material was prepared as follows:
To a stirred solution of triphenylphosphine (4.095 g, 15.6 mmol) in DCM (20 ml) was added 5-amino-2H-pyrazol-3-ol (1.43 g, 14.4 mmol) and the suspension stirred for 1 h at room temperature and then cooled to 5-10° C. Propan-2-yl (NZ)-N-propan-2-yloxycarbonyliminocarbamate (3.08 ml, 15.6 mmol) was added over 30 mins and the mixture allowed to warm to room temperature and stirred for 1 hr. A solution of (3-methoxy-5-methyl-phenyl)methanol (1.83 g, 12 mmol) in DCM (10 ml) was added and the mixture stirred for 24 h. The mixture was filtered and the organic layer extracted with 2M HCl (3×100 ml). The aqueous layer was extracted with DCM (2×20 ml). Upon standing, a solid crystallised out from the DCM liquors. This was filtered off to give 5-[(3-methoxy-5-methyl-phenyl)methoxy]-1H-pyrazol-3-amine mono hydrochloride as a white solid (259 mg, 18.2%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.30 (3H, s), 3.70-3.75 (3H, m), 5.19 (2H, s), 5.28 (1H, s), 6.78 (1H, s), 6.83 (2H, t), 7.54-7.58 (1H, m), 7.62-7.66 (1H, m). MS: m/z 233 (MH+).
(3-methoxy-5-methyl-phenyl)methanol used as starting material was prepared as follows:—
1M solution of Lithium aluminium hydride in tetrahydrofuran (22.4 ml, 22.4 mmol) was added over 10 mins at −4° C. under nitrogen to a stirred solution of methyl 3-methoxy-5-methyl-benzoate (2.525 g, 14 mmol) in anhydrous tetrahydrofuran (25 ml). The reaction mixture was stirred at room temperature for 4 h. The reaction mixture was cooled to 0° C. and quenched with 5N hydrochloric acid and adjusted to pH7. The reaction mixture was evaporated to dryness and the residue partitioned between ether and water (50 ml each). This was extracted with diethyl ether (3×40 ml), washed with saturated brine solution, dried (MgSO4), filtered and evaporated to give (3-methoxy-5-methyl-phenyl)methanol as an oil (1.864 g, 87.6%). 1H NMR (399.9 MHz, DMSO-d6) δ 2.27 (3H, d), 3.73 (3H, s), 4.44 (2H, d), 5.10 (1H, t), 6.62 (1H, s), 6.69-6.71 (2H, m). MS: m/z 175 (M+Na)+
Methyl 3-methoxy-5-methyl-benzoate used as starting material was prepared as follows:
A solution of methyl 3-hydroxy-5-methyl-benzoate (4.16 g, 25 mmol) in anhydrous N,N dimethylformamide (20 ml) was added drop wise at 20° C. to a stirred suspension of sodium hydride (60% dispersion in mineral oil, 1.51 g, 37.5 mmol). The reaction mixture was stirred for 20 mins at 20° C. and iodomethane (2.36 ml, 37.5 mmol) was added in one portion. The suspension stirred for 18 h. The reaction mixture was quenched by pouring onto a mixture of ice and water (50 g and 100 ml). The product was extracted with ethyl acetate (4×25 ml) and the extracts were washed with water and saturated brine solution. The organic layers were dried (MgSO4), filtered and evaporated to give crude methyl 3-methoxy-5-methyl-benzoate as a oil (4.93 g, >100%).
1H NMR (399.9 MHz, DMSO-d6) δ 2.35 (3H, d), 3.80 (3H, s), 3.85 (3H, s), 7.05-7.06 (1h, m), 7.25-7.27 (1H, m), 7.38-7.39 (1H, m)
3-hydroxy-5-methyl-benzoate used as starting material was prepared by the method described in the literature (Fred A. Turner and James E Gearien - Journal of Organic Chemistry 1959, Volume 24, p 1952- Synthesis of Reserpine Analogs).
(5-Fluoro-2-methoxy-pyridin-4-yl)methoxy]-1H-pyrazol-3-amine (130 mg, 0.546 mmol) was heated with 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (1 24 mg, 0.546 mmol) in ethanol (8 ml) in a microwave reactor at 120° C. for 1.5 h. The reaction mixture was allowed to stand at 5° C. for 2 days. The precipitated solid was collected by filtration, washed with ethanol and dried under vacuum. The crude solid was purified by preparative HPLC using decreasingly polar mixtures of water (containing 1% NH3) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford N′-[5-[(5-fluoro-2-methoxy-pyridin-4-yl)methoxy]-1H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine as a white solid (45 mg, 18% yield).
1H NMR (399.902 MHz, DMSO) δ 2.19 (3H, s), 3.83 (3H, s), 4.58 (2H, d), 5.25 (2H, s), 5.35 (1H, bs), 6.03 (1H, d), 6.17 (1H, s), 6.89 (1H, d), 7.69 (1H, bs), 7.93 (1H, d), 8.15 (1H, s), 10.05 (1H, bs), 11.98 (1H, bs); m/z (ES+) [M+H]+=427.
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[(5-Fluoro-2-methoxy-pyridin-4-yl)methoxy]-1H-pyrazol-3-amine, used as starting material, was prepared as follows:—
3-Amino-5-hydroxypyrazole (0.56 g, 5.65 mmol) and triphenylphosphine (1.78 g, 6.78 mmol) were stirred in DCM (I6 ml) under nitrogen and the reaction mixture was cooled in an ice-bath. Diisopropylazodicarboxylate (1.34 ml, 6.78 mmol) was added dropwise over a period of 10 min. The reaction mixture was then stirred in the ice-bath for 1 h. (5-Fluoro-2-methoxy-pyridin-4-yl)methanol (1.07 g, 6.78 mmol) in THF (15 ml) was added slowly over 5-10 min. The reaction mixture was stirred and allowed to warm to room temperature over 1 h. This was then stirred for a further 18 h. The mixture was filtered and washed through with DCM (10 ml). The filtrate was extracted with 2M HCl(aq) (3×8 ml) and the combined extracts were basified with 6N NaOH(aq). The basified aqueous phase was extracted with DCM (3×20 ml). The combined extracts were filtered, dried over MgSO4, filtered and evaporated. The crude product was purified by silica column chromatography, eluting with 0-3% MeOH in DCM, to afford 5-[(5-fluoro-2-methoxy-pyridin-4-yl)methoxy]-1H-pyrazol-3-amine as a white solid (354 mg, 26% yield).
1H NMR (399.902 MHz, DMSO) δ 3.75 (s, 3H), 4.70 (s, 1H), 4.91 (s, 2H), 5.06 (s, 2H), 6.76 (d, 1H), 8.04 (d, 1H), 10.37 (s, 1H); m/z (ES+) [M+H]+=239.
(5-Fluoro-2-methoxy-pyridin-4-yl)methanol, used as starting material, was prepared as follows:—
Borane-tetrahydrofuran complex (IM solution in THF, 52.6 ml, 52.6 mmol) was added slowly to a solution of 5-fluoro-2-methoxy-pyridine-4-carboxylic acid (2 g, 11.7 mmol) in THF (100 ml) under nitrogen. The reaction mixture was stirred at room temperature for 2.5 h. The solvent was evaporated and the residue was stirred in methanol (40 ml) for 18 h. The solvent was evaporated and the crude product was purified by silica column chromatography, eluting with 0-1% MeOH in DCM. Pure product fractions were combined and evaporated to afford (5-fluoro-2-methoxypyridin-4-yl)methanol as a white solid (1.42 g, 77%).
1H NMR (399.902 MHz, CDCl3) δ 3.90 (s, 3H), 4.76 (s, 2H), 6.84-6.87 (m, 1H), 7.92 (d, 1H); m/z (ES+) [M+H]+=158.
A solution of 5-((4-methoxypyridin-2-yl)methoxy)-1H-pyrazol-3-amine (50 mg, 0.23 mmol) and 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (51.0 mg, 0.23 mmol) in ethanol (1.5 ml) was stirred at 80° C. for 3 days. The solution was cooled to room temperature and allowed to stand overnight. A small amount of crystallised solid was removed by filtration and the filtrate was evaporated to dryness. The crude product from the filtrate was purified by preparative HPLC using decreasingly polar mixtures of water (containing 0.1% TFA) and MeCN as eluents, then further purified by preparative HPLC using decreasingly polar mixtures of water (containing 1% NH3) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford N′-[5-[(4-methoxypyridin-2-yl)methoxy]-1H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine (25 mg, 27%) as a white solid.
1H NMR (399.902 MHz, DMSO) δ 2.24 (3H, s), 3.89 (3H, s), 4.64 (2H, d), 5.21 (2H, s), 5.39 (1H, bs), 6.08 (1H, d), 6.22 (1H, s), 6.94-6.99 (1H, m), 7.07 (1H, d), 7.76 (1H, bs), 7.97 (1H, d), 8.42 (1H, d), 10.10 (1H, bs), 12.01 (1H, bs); m/z (ES+) [M+H]+=409
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-((4-Methoxypyridin-2-yl)methoxy)-1H-pyrazol-3-amine, used as starting material, was prepared as follows:—
3-Amino-5-hydroxypyrazole (1 g, 10.09 mmol) and triphenylphosphine (3.18 g, 12.22 mmol) were stirred in DCM (25 ml) under nitrogen and the reaction mixture was cooled in an ice-bath. Diisopropylazodicarboxylate (2.38 ml, 12.11 mmol) was added dropwise over a period of 10 min. The reaction mixture was then stirred in the ice-bath for 1 h. (4-Methoxypyridin-2-yl)methanol (1.495 g, 12.11 mmol) in DCM (10 ml) was added over 5 min. The reaction mixture was then stirred at room temperature for 18 h. The mixture was filtered and washed through with DCM (10 ml). The filtrate was extracted with 2M HCl(aq) (3×8 ml) and the combined extracts were basified with 6N NaOH(,q). The basified aqueous phase was then extracted with DCM (3×20 ml). The combined DCM extracts from the basic phase were dried over MgSO4, filtered, evaporated and purified by silica column chromatography, eluting with 0-7% MeOH in DCM. Product fractions were combined and evaporated to afford the product, 5-((4-methoxypyridin-2-yl)methoxy)-1H-pyrazol-3-amine, as a yellow gum (220 mg, 67% purity), used for subsequent reaction without further purification.
1H NMR (399.902 MHz, DMSO) δ 3.83 (3H, s), 4.79 (1H, s), 4.96 (2H, s), 5.05 (2H, s), 6.87-6.92 (1H, m), 6.97 (1H, d), 8.35 (1H, d), 10.41 (1H, s); m/z (ES+) [M+H]+=221.
2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (100 mg, 0.39 mmol), (3-propan-2-yl-1,2-oxazol-5-yl)methanamine (83 mg, 0.59 mmol) and N-ethyl-N-propan-2-yl-propan-2-amine (0.171 ml, 0.99 mmol) were dissolved in 2-methoxyethanol (2 ml) and sealed into a microwave tube. The reaction was heated to 160° C. for 1 h then 200° C. for 2 h in the microwave reactor and cooled to room temperature. The crude product was purified by ion exchange chromatography, using an SCX column. The crude product was eluted from the column using 7M NH3/MeOH and then was purified by preparative HPLC (Waters XBridge Prep C18 OBD column, 5μ silica, 19 mm diameter, 100 mm length), using decreasingly polar mixtures of water (containing 1% NH3) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford the title compound (13.00 mg, 9.23%) as a yellow solid.
1H NMR (400.13 MHz, DMSO-d6) δ 1.20 (6H, d), 1.27 (6H, d), 2.93-2.99 (1H, m), 4.59 (2H, d), 4.66 (1H, q), 5.20 (1H, s), 6.02 (1H, d), 6.25 (1H, s), 7.68 (1H, s), 7.92 (1H, d), 9.97 (1H, s), 11.88 (1H, s) MS m/z 358 (MH+).
2-Chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material, was prepared as in Example 77.
(3-Propan-2-yl-1,2-oxazol-5-yl)methanamine, used as starting material, was prepared in an analogous manner to that outlined for 3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride in Example 3, except using 2-methylpropanal as starting material.
N-Ethyl-N-propan-2-yl-propan-2-amine (0.388 mL, 2.23 mmol), [3-(3-methyloxetan-3-yl)-1,2-oxazol-5-yl]methanamine (250 mg, 1.49 mmol) and 2-chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (189 mg, 0.74 mmol) were dissolved in 2-methoxy ethanol (4 mL) and sealed into a microwave tube. The reaction was heated to 180° C. for 4 h in the microwave reactor and cooled to room temperature. The crude product was purified by preparative HPLC using decreasingly polar mixtures of water (containing 1% NH3) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford the title compound (7.00 mg, 2.444%) as a white solid.
1H NMR (399.9 MHz, DMSO-d6) δ1.25 (6H, d), 1.61 (3H, s), 4.49 (2H, d), 4.63 (2H, d), 4.65 (1H, m), 4.74 (2H, d), 5.23 (1H, s), 6.00 (1H, d), 6.49 (1H, s), 7.68 (1H, s), 7.94 (1H, d), 9.98 (1H, s), 11.75 (1H, s) MS: m/z 386 (MH+)
[3-(3-methyloxetan-3-yl)-1,2-oxazol-5-yl]methanamine, used as starting material, was prepared in an analogous manner to that outlined for 3-cyclopropyl-1,2-oxazol-5-yl)methanamine hydrochloride in Example 3, except using (NE)-N-[(3-methyloxetan-3-yl)methylidene]hydroxylamine as starting material.
2-Chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material, was prepared as in Example 77.
2-Chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine (100 mg, 0.39 mmol, 1 eq), [3-(1-methylcyclopropyl)-1,2-oxazol-5-yl]methanamine (120 mg, 0. 79 mmol, 2 eq) and N-ethyl-N-propan-2-yl-propan-2-amine A (0.103 ml, 0.59 mmol, 1.5 eq) were dissolved in 2-methoxyethanol (1.5 ml) and sealed into a microwave tube. The reaction was heated to 200° C. for 75 mins in the microwave reactor, before being cooled to room temperature. The crude product solution was purified by reverse-phase prep. HPLC (basic) using a 31-51% gradient of acetonitrile in water containing 1% ammonium hydroxide solution. The clean fractions were taken and evaporated to afford the title compound as a cream-coloured solid. (31.0 mg, 21.29% yield)
1H NMR (399.902 MHz, DMSO) δ 0.82 (2H, m), 0.91 (2H, m), 1.28 (6H, d), 1.37 (3H, s), 4.56 (2H, d), 4.67 (1H, bs), 5.21 (1H, bs), 6.03 (1H, bs), 6.08 (1H, bs), 7.66 (1H, bs), 7.91 (1H, bs), 9.98 (1H, bs), 11.78 (1H, bd).
MS: m/z 370 (MH+)
[3-(1-methylcyclopropyl)-1,2-oxazol-5-yl]methanamine, used as starting material, was prepared as follows:—
A stirred solution of 1-methylcyclopropanecarbaldehyde oxime (3.90 g, 39.34 mmol, 1 eq) and tert-butyl prop-2-ynylcarbamate (13.43 g, 86.55 mmol, 2.2 eq) in dichloromethane (70 ml) was cooled to <5° C. (ice bath) under nitrogen. Aqueous sodium hypochlorite solution (13% active chlorine) (37.6 ml, 165.43 mmol, 4.2 eq) was added over a period of 2 h to the stirred solution, keeping the temperature below <10° C. (under nitrogen). The resulting mixture was then stirred under nitrogen, for 64 h, before being diluted with dichloromethane (160 ml) and water (160 ml), and being separated. The organic layer was washed with saturated brine (107 ml×2), dried with magnesium sulphate, filtered, and evaporated under reduced pressure to afford a pale yellow oil (15.22 g), which was dissolved in methanol (25 ml). 5N aqueous hydrochloric acid (26.0 ml, 129.82 mmol, 3.3 eq), and water (8 ml) were added, and the resulting solution was stirred at 50° C. for 3 h, before being allowed to cool to room temperature overnight. The methanol was then removed by evaporation under reduced pressure and the remaining aqueous solution was washed with dichloromethane (52 ml×3), before being adjusted to pH12 with 40% w/w aqueous sodium hydroxide solution, and extracted into dichloromethane (105 ml×4). The dichloromethane extracts were then washed with saturated brine (157 ml×2), dried with magnesium sulphate and filtered, before being evaporated under reduced pressure to give [3-(1-methylcyclopropyl)-1,2-oxazol-5-yl]methanamine as a brown oil (2.91 g, 48.6% yield).
1H NMR (399.902 MHz, DMSO) δ 0.83 (2H, m), 0.91 (2H, m), 1.38 (3H, s), 1.99 (2H, bs), 3.73 (2H, s), 6.07 (1H, s).
MS: m/z 153 (MH+)
2-Chloro-N-(5-propan-2-yloxy-2H-pyrazol-3-yl)pyrimidin-4-amine, used as starting material, was prepared as in Example 77.
4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (0.225 g, 1.00 mmol) and 3-methoxy-1H-pyrazol-5-amine (0. 113 g, 1 mmol) in ethanol were sealed into a microwave tube. The reaction was heated to 100° C. for 2 h in the microwave reactor and cooled to room temperature. The reaction mixture was evaporated to dryness. The crude product was purified by preparative HPLC (Waters XBridge Prep C18 OBD column, 5μ silica, 19 mm diameter, 100 mm length), using decreasingly polar mixtures of water (containing 1% TFA) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford the title compound (0.065 g, 21.57%) as a yellow solid.
1HNMR (399.9 MHz, DMSO-d6) δ 2.19 (3H, d), 3.89 (3H, s), 4.73 (2H, d), 5.60-5.81 (1H, bs), 6.29-6.45 (2H, 2bs), 7.92 (1H, d), 8.85 (1H, bs), 11.10 (1H, bs)
MS: m/z 302 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
4-chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (100mg, 0.45 mmol, 1 eq) and the 5-amino-3-(2-thienyl)pyrazole (0.47 mmol, 1.05 eq) were combined in ethanol (5 ml) and heated to 80° C. for 24 h. After this time the precipitate was filtered and washed with cold ethanol (20 ml). The solid was taken up into water (8 ml) and basified to pH9 using ammonium hydroxide solution, added dropwise. The resultant solid was filtered and washed with cold water (20 ml), then dried under vacuum to yield the title compound (71 mg, 45%) as a white solid.
1H NMR (500.133 MHz, DMSO) δ 2.17 (s, 3H), 4.59 (s, 2H), 6.11 (s, 1H), 6.27 (s, 2H), 6.54 (s, 1H), 6.70 (s, 1H), 7.63 (s, 1H), 7.89 (d, 1H). MS: m/z 354 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
Made using the method in example 104 from 4-chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (100 mg, 0.45 mmol, 1 eq) and 5-(2-furyl)-1H-pyrazol-3-amine (70 mg, 0.47 mmol, 1.05 eq) to give the title compound (1 19 mg, 78%) as a white solid.
MS: m/z 337 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
A mixture of 5-[2-(3-phenyl-1,2,4-oxadiazol-5-yl)ethyl]-2H-pyrazol-3-amine (77 mg, 0.30 mmol, 1 eq) and 4-chloro-N-[(3-methyl1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (67 mg. 0.30 mmol, 1 eq) in ethanol (5 ml) containing a few drops of 4M HCl in dioxane was heated at reflux for 18 hours before allowing to cool. The precipitated solid was filtered, washed with cold ethanol then dried. The solid was suspended in water and basified by the addition of 2M sodium hydroxide. The solid was then filtered, washed with water then 50% ether/hexane and dried overnight in the vacuum dessicator at 60° C.
1H NMR (300.132 MHz, DMSO): δ 2.17 (s, 3H), 3.12 (t, 2H), 3.36 (t, 2H), 4.52 (d, 2H), 6.11 (s, 1H), 6.11-6.46 (m, 2H), 7.19 (s, 1H), 7.53-7.63 (m, 3H), 7.83 (d, 1H), 7.98-8.03 (m, 2H), 9.38 (s, 1H), 12.04 (s, 1H). MS: m/z 444 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[2-(3-phenyl-1,2,4-oxadiazol-5-yl)ethyl]-2H-pyrazol-3-amine, used as starting material, was prepared from methyl 3-(3-phenyl-1,2,4-oxadiazol-5-yl)propanoate in a similar manner example 24a). An orange solid was obtained (336 mg, 13% yield).
1H NMR (300.132 MHz, DMSO) δ 2.98 (t, 2H), 3.27 (t, 2H), 4.26-4.78 (m, 1H), 5.19 (s, 1H), 7.53-7.60 (m, 3H), 7.97-8.05 (m, 3H), 11.15 (s, 2H). MS: m/z 256 (MH+).
A mixture of 2-chloro-N-[5-[2-(2-furyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine (100 mg, 0.35 mmol, 1 eq), (3-methyl-1,2-oxazol-5-yl)methanamine hydrochloride (62 mg, 0.42 mmol, 1.5 eq) and diisopropylethylamine (159[l, 0.91 mmol, 3 eq) in methoxyethanol (3 ml) was heated in the microwave at 190° C. for 240 mins before evaporating solvent under reduced pressure. The crude product was purified on the acidic reverse phase hplc using a 20-40% gradient of acetonitrile in water containing 0.2% TFA. The clean fractions were taken and loaded onto a SCX-3 column pre-wet with methanol. After washing through three times with methanol the product was finally eluted with 10% ammonia solution in methanol. After evaporation to low volume a white solid was obtained. (68.7 mg, 48% yield)
1H NMR (300.132 MHz, DMSO): δ 2.17 (s, 3H), 2.80-2.99 (m, 4H), 4.54 (d, 2H), 6.11 (d, 2H), 6.22-6.33 (m, 2H), 6.34 (dd, 1H), 7.23 (s, 1H), 7.51 (d, 1H), 7.82 (d, 1H), 9.41 (s, 1H), 11.95 (s, 1H). MS: m/z 366 (MH+).
(3-Methyl-1,2-oxazol-5-yl)methanamine was synthesized as outlined in Example 1.
2-chloro-N-[5-[2-(2-furyl)ethyl]-2H-pyrazol-3-yl]pyrimidin-4-amine, used as starting material was prepared from 4-[2-(2-furyl)ethyl]-1H-pyrazol-3-amine in a similar way to the synthesis of 2-chloro-N-[5-[2-(3-methoxyphenyl)ethyl]-1H-pyrazol-3-yl]pyrimidin-4-amine used in example 27b). (2.26 g, 78% yield, beige solid)
1H NMR (300.132 MHz, DMSO): δ 2.87-2.99 (m, 4H), 6.03-6.21 (m, 2H), 6.35 (dd, 1H), 6.91-7.44 (m, 1H), 7.52 (m, 1H), 8.16 (d, 1H), 10.27 (s, 1H), 12.23 (s, 1H). MS: m/z 289 (MH+).
4-[2-(2-furyl)ethyl]-1H-pyrazol-3-amine (2.19 g, 31% over 2steps) was prepared in an analogous manner to example 24a) starting from ethyl 3-(2-furyl)propanoate.
1H NMR (300.132 MHz, DMSO): δ 2.70-2.88 (m, 4H), 4.43 (s, 1H), 5.18 (s, 1H), 6.09 (d, 1H), 6.34 (t, 1H), 7.50 (s, 1H), 11.10 (s, 1H).
Prepared in an analogous way to example 11 but starting with 5-[2-(2-furyl)ethyl]-2H-pyrazol-3-amine (1 12 mg, 0.50 mmol, 1 eq). The title compound was isolated as a solid by the method used in example. (95 mg, 52% yield).
1H NMR (300.132 MHz, DMSO): δ2.17 (s, 3H), 2.81-2.98 (m, 4H), 4.53 (d, 2H), 6.11 (s, 1H), 6.12 (d, 1H), 6.24-6.30 (m, 2H), 6.34 (dd, 1H), 7.18 (s, 1H), 7.51 (dd, 1H), 7.83 (d, 1H), 9.35 (s, 1H), 11.94 (s, 1H). MS: m/z 366 (MH+).
4-[2-(2-furyl)ethyl]-2H-pyrazol-3-amine, used as starting material was prepared as follows:
1H NMR (300.132 MHz, CDCl3): δ 1.25 (t, 3H), 2.64 (t, 2H), 2.97 (t, 2H), 4.15 (q, 2H), 6.02 (td, 1H), 6.27 (dd, 1H), 7.30 (dd, 1H).
5-[2-(2-furyl)ethyl]-2H-pyrazol-3-amine (2.09 g, 72% over 2steps) was then prepared in an analogous manner to that previously shown starting from ethyl-3-(2-furyl)propanoate.
1H NMR (300.132 MHz, DMSO): δ 2.69-2.90 (m, 4H), 4.45 (s, 2H), 5.18 (s, 1H), 6.09 (dd, 1H), 6.34 (dd, 1H), 7.50 (dd, 1H), 11.10 (s, 1H). MS: m/z 178 (MH+).
A mixture of 5-(3-furylmethoxy)-1H-pyrazol-3-amine (117 mg, 0.65 mmol), 4-chloro-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 147 mg, 0.65 mmol) and ethanol (5 ml) was heated at 100° C. in the microwave for 15 mins. After cooling, the crystalline solid was filtered off, washed with ethanol and diethyl ether to afford the title compound as a white solid (42 mg, 19%). 1H NMR (399.9 MHz, DMSO-d6) δ2.20 (3H, s), 4.75 (2H, d), 4.98 (2H, s), 5.96 (1H, s), 6.49 (1H, s), 6.57 (1H, d), 7.68 (1H, s), 7.78 (1H, s), 7.94 (1H, d), 8.82 (1H, s); MS: m/z 368 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-(3-furylmethoxy)-1H-pyrazol-3-amine, used as starting material was prepared as follows:
A mixture of triphenylphosphine (6.82 g, 26 mmol), 3-amino-5-hydroxypyrazole (1.49 g, ml 5 mmol) in dichloromethane (40 ml) was treated portion wise at 0° C. with DTAD (5.99 g, 26 mmol). Stirred for 15 mins at 0° C. and a solution of 3-furanmethanol (1.915 g, 19.5 mmol) in dichloromethane (20 ml) was added at 0° C. Stirred at ambient temperature for 18 h. After filtration, the organic layer was extracted with 2N HCl solution (2×20 ml). The aqueous layer was neutralised with 40% sodium hydroxide to pH 8, extracted with diethyl ether (3×25 ml), washed with water and then brine and finally dried over magnesium sulphate. After evaporating under reduced pressure, the crude product was purified by reverse phase prep. HPLC (acidic) using a 2-40% gradient of acetonitrile in water containing 0.1% trifluoroacetic acid. The desired fractions were taken and evaporated to afford 5-(3-furylmethoxy)-1H-pyrazol-3-amine as a purple solid (121 mg, 3.5%). 1H NMR (500.13 MHz, DMSO-d6) δ5.09 (2H, s), 5.22 (1H, s), 6.58-6.58 (1H, m), 7.70 (1H, t), 7.83 (1H, s). MS: m/z 180 (MH+).
Prepared in an analogous way to example 107, but starting with 5-[2-(oxolan-3-yl)ethyl]-1H-pyrazol-3-amine (112 mg, 0.50 mmol, 1 eq). The HCl salt precipitated out of the reaction mixture on cooling and was filtered and dried. The product was suspended in water and basified by the addition of ammonium hydroxide solution before extraction into ethyl acetate. The organic layer was separated, washed again with ammonium hydroxide solution and then brine. Dried with magnesium sulphate, filtered and evaporated to afford the title compound as a solid. (84 mg, 45% yield).
1H NMR (300.132 MHz, DMSO): δ 1.47 (dq, 1H), 1.64 (q, 2H), 1.93-2.17 (m, 2H), 2.17 (s, 3H), 2.49-2.56 (m, 2H), 3.18-3.38 (m, 1H), 3.61 (qd, 1H), 3.69-3.76 (m, 1H), 3.78 (t, 1H), 4.53 (d, 2H), 6.10 (s, 1H), 6.16-6.37 (m, 2H), 7.19 (s, 1H), 7.82 (d, 1H), 9.35 (s, 1H), 11.87 (s, 1H). MS: m/z 370 (MH+).
5-[2-(oxolan-3-yl)ethyl]-1H-pyrazol-3-amine used as starting material was prepared as follows:
1H NMR (300.132 MHz, DMSO): δ 1.24 (t, 3H), 4.16 (q, 2H), 6.36 (d, 1H), 6.96 (d, 1H), 7.56 (d, 1H), 7.73 (dd, 1H), 8.10 (d, 1H). MS: m/z 167 (MH+).
Prepared in an analogous way to example 107, but starting with 5-[2-(3-furyl)ethyl]-1H-pyrazol-3-amine (112 mg, 0.50 mmol, 1 eq). The title compound was isolated as a solid (105.7 mg, 58% yield).
1H NMR (300.132 MHz, DMSO): δ 2.17 (s, 3H), 2.66-2.83 (m, 4H), 4.53 (d, 2H), 6.10 (s, 1H), 6.22-6.34 (m, 2H), 6.38 (s, 1H), 7.18 (s, 1H), 7.44 (s, 1H), 7.55 (t, 1H), 7.83 (d, 1H), 9.35 (s, 1H), 11.91 (s, 1H). MS: m/z 366 (MH+).
5-[2-(3-furyl)ethyl]-1H-pyrazol-3-amine used as starting material was prepared in an analogous manner to example 24a), from ethyl 3-(3-furyl)propanoate. Isolated as an orange solid (3.94 g, 59% yield).
1H NMR (300.132 MHz, CDCl3): δ 2.70-2.83 (m, 4H), 5.47 (s, 1H), 6.24 (d, 1H), 7.21 (s, 1H), 7.35 (t, 1H). MS: m/z 178 (MH+).
Ethyl 3-(3-furyl)propanoate was obtained as a clear oil. (6.33 g, 47% yield)
1H NMR (300.132 MHz, CDCl3): δ 1.25 (t, 3H), 2.55 (t, 2H), 2.76 (t, 2H), 4.14 (q, 2H), 6.27 (s, 1H), 7.24 (td, 1H), 7.34 (t, 1H).
Prepared in an analogous manner to example 107, but starting with (3-cyclopropyl1,2-oxazol-5-yl)methanamine hydrochloride (73 mg, 0.42 mmol, 1.5 eq). Purified on the acidic reverse phase hplc using a 25-45% gradient of acetonitrile in water containing 0.2% TFA to give the title compound (15.6 mg, 11% yield)
1H NMR (300.132 MHz, DMSO): δ 0.69 (m, 2H), 0.96 (m, 2H), 1.95 (ddd, 1H), 2.82-2.97 (m, 4H), 4.56 (d, 2H), 6.06 (s, 1H), 6.11 (d, 1H), 6.15-6.40 (m, 3H), 7.51 (s, 1H), 7.74 (s, 1H), 7.85 (d, 1H), 10.05 (s, 1H), 12.13 (s, 1H). MS: m/z 392 (MH+).
(3-Cyclopropyl1,2-oxazol-5-yl)methanamine hydrochloride was synthesized as outlined in Example 3.
Prepared in an analogous manner to example 107, but starting with 5-(aminomethyl)-1,2-oxazole-3-carboxamide trifluoroacetic acid salt (84 mg, 0.33 mmol, 1 eq). Purified on the acidic reverse phase hplc using a 15-35% gradient of acetonitrile in water containing 0.2% TFA to give the title compound (8.3 mg, 6% yield)
1H NMR (300.132 MHz, DMSO): δ 2.82-2.97 (m, 4H), 4.66 (d, 2H), 6.11 (d, 1H), 6.15-6.42 (m, 3H), 6.57 (s, 1H), 7.00 (s, 1H), 7.50 (d, 1H), 7.74 (s, 1H), 7.86 (d, 1H), 8.03 (s, 1H), 9.85 (s, 1H), 12.08 (s, 1H). MS: m/z 395 (MH+).
5-(Aminomethyl)-1,2-oxazole-3-carboxamide, used as starting material, can be prepared as outlined in Example 4.
Prepared in an analogous manner to example 107, but starting with (3-pyrimidin-2-yl1,2-oxazol-5-yl)methanamine trifluoroacetic acid salt (122 mg, 0.42 mmol, 1.2 eq). Purified on the acidic reverse phase hplc using a 20-40% gradient of acetonitrile in water containing 0.2% TFA. The cleaner fractions were trapped onto a 5 g scx-3 column then the column was washed with methanol before the product was eluted with 10% ammonium hydroxide solution in methanol. Evaporation under reduced pressure yielded slightly purer material. This was re-purified on the basic reverse phase prep hplc using a 25-45% gradient. After evaporation this afforded the title compound (8.3 mg, 6% yield)
1H NMR (300.132 MHz, DMSO): δ 2.82-2.97 (m, 4H), 4.66 (d, 2H), 6.11 (d, 1H), 6.15-6.42 (m, 3H), 6.57 (s, 1H), 7.00 (s, 1H), 7.50 (d, 1H), 7.74 (s, 1H), 7.86 (d, 1H), 8.03 (s, 1H), 9.85 (s, 1H), 12.08 (s, 1H). MS: m/z 395 (MH+).
(3-Pyrimidin-2-yl1,2-oxazol-5-yl)methanamine, used as starting material, can be prepared as outlined in Example 32.
Prepared using an analogous method to example 46, but starting with 5-(oxan-4-yl)-1H-pyrazol-3-amine (60 mg, 0.36 mmol) to give the title compound (61 mg, 43% yield)
1H NMR (300.132 MHz, DMSO) δ 1.52-1.65 (m, 2H), 1.78 (d, 2H), 2.18 (s, 3H), 2.81-2.91 (m, 1H), 3.36-3.45 (m, 2H), 3.86-3.91 (m, 2H), 4.72 (s, 2H), 6.27 (s, 1H), 6.31 (bs, 1H), 6.39 (bs, 1H), 7.88 (d, 1H). MS: m/z 356 (MH+)
5-(oxan-4-yl)-1H-pyrazol-3-amine, used as starting material, was prepared using an analogous method to example 24a), but starting with methyl oxane-4-carboxylate (10 g, 69.4 mmol) to give 5-(oxan-4-yl)-1H-pyrazol-3-amine (1.87 g, 16%) as a white solid.
1H NMR (300.132 MHz, CDCl3) δ 1.56-1.82 (m, 4H), 2.64-2.81 (m, 1H), 3.33-3.47 (m, 2H), 3.88-3.99 (m, 2H), 5.38 (s, 1H). MS: m/z 168 (MH+)
Prepared in an analogous way to example 38, but starting with 5-(2-pyridin-3-ylethyl)-2H-pyrazol-3-amine (158.5 mg, 0.84 mmol, 1 eq) and using a 15-35% gradient of acetonitrile in water containing 1% ammonia to purify. The title compound was obtained as a solid (48.7 mg, 15.4% yield).
1H NMR (300.132 MHz, DMSO): δ 2.17 (s, 3H), 2.81-2.98 (m, 4H), 4.53 (d, 2H), 6.11 (s, 1H), 6.22 (s, 2H), 7.24 (s, 1H), 7.30 (dd, 1H), 7.63 (d, 1H), 7.83 (d, 1H), 8.40 (dd, 1H), 8.44 (d, 1H), 9.39 (s, 1H), 11.94 (s, 1H). MS: m/z 377 (MH+).
5-(2-pyridin-3-ylethyl)-2H-pyrazol-3-amine used as starting material was prepared as follows:
1H NMR (400.132 MHz, DMSO): δ 2.74 (t, 2H), 2.87 (t, 2H), 4.43 (s, 2H), 5.17 (s, 1H), 7.29 (ddd, 1H), 7.61 (dddd, 1H), 8.39 (dd, 1H), 8.42 (d, 1H), 11.08 (s, 1H). MS: m/z 189 (MH+).
A mixture of 5-(2-pyridin-4-ylethyl)-2H-pyrazol-3-amine (95 mg, 0.5 mmol, 1.0 eq), 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (113 mg, 0.5 mmol, 1.0 eq), and ethanol (2.5 ml) were stirred and heated at 80° C. overnight under an atmosphere of nitrogen. The solution was allowed to cool to room temperature and then evaporated to dryness. The crude product was purified by chromatography on silica column using a 0-10% gradient of methanol containing ammonia (2.0M) in dichloromethane. The clean fractions were taken and evaporated to a yellow solid. This solid was triturated with dichloromethane to afford the title compound as a yellow solid, (95 mg, 50% yield).
1H NMR (499.8 MHz, DMSO) δ 2.19 (3H, s), 2.90-2.99 (4H, m), 4.58 (2H, d), 6.07 (1H, s), 6.11 (1H, s), 6.28 (1H, d), 6.86 (1H, s), 7.23 (2H, d), 7.87 (1H, d), 8.45 (2H, d), 8.98 (1H, s).
MS: m/z 377 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-(2-pyridin-4-ylethyl)-2H-pyrazol-3-amine, used as starting material was prepared as follows:
Acetonitrile (0.151 ml, 2.84 mmol, 1.2 eq) was added to a slurry of sodium hydride (114 mg dispersion in mineral oil, 2.84 mmol, 1.2 eq) in anhydrous dioxan (8 ml) and the mixture stirred at room temperature under an atmosphere of nitrogen. Methyl 3-pyridin-4-ylpropanoate (532 mg, 2.37 mmol, 1 eq) was then added and the reaction was refluxed overnight for 18 h. The mixture was cooled to room temperature and ethanol (1 ml) added followed by hydrazine hydrochloride (325 mg, 4.74 mmol, 2.0 eq). The mixture was stirred and heated to reflux and then stirred at this temperature for 1 hour.
After cooling and quenching with a small amount of water the solvent was evaporated under reduced pressure. The residue was dissolved in 2M HCl (25 ml). The acidic solution was then extracted with ethyl acetate (50 ml). The aqueous layer was separated and the ethyl acetate layer was washed with 2M HCl (10 ml). The combined aqueous fraction was basified to pH 9 using concentrated aqueous ammonia. The product was extracted using ethyl acetate (3×50 ml). The aqueous was further basified with 4M NaOH solution and saturated with salt and extracted using ethyl acetate (3×50 ml). Finally it was extracted with 1-BuOH (100 ml). The extracts were evaporated to dryness. The residues were dissolved in dichloromethane containing 10% methanol, filtered to remove inorganics and evaporated to afford the crude product as a golden oil. The crude product was purified by column chromatography using a 0-10% gradient of methanol containing ammonia (2.0M) in dichloromethane. The clean fractions were taken and evaporated to afford the title compound as a clear gum, (209 mg, 47% yield).
MS: m/z 189 (MH+)
Methyl 3-pyridin-4-ylpropanoate was prepared as outlined in EP 0 539 977.
The mixture of 5-[2-(4-methylthiophen-2-yl)ethyl]-2H-pyrazol-3-amine (0.104 g, 1 mmol), 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (0.113 g, 1 mmol), and ethanol (3 ml) were heated in a microwave at 100° C. for 15 mins. The crude product was purified by reverse-phase prep. HPLC (basic) using a 30-40% gradient of acetonitrile in water containing 1% ammonium hydroxide solution, and a thin film of final product was obtained (0.002 g, 1%). MS: m/z 396.29 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[2-(4-Methylthiophen-2-yl)ethyl]-2H-pyrazol-3-amine, used as starting material, was prepared as follows:
Sodium hydride (60%, 0.236 g, 5.88 mmol) was added to a stirred solution of methyl 3-(4-methylthiophen-2-yl)propanoate (0.903 g, 4.90 mmol) in 1,4 dioxane (25 ml) and dry acetonitrile (0.308 ml, 5.88 mmol) under nitrogen. The mixture was stirred at r.t. for 10 mins and then refluxed under nitrogen o/n. The mixture was cooled to r.t. and ethanol (2 ml) was added, followed by hydrazine monohydrochloride (0.672 g, 9.8 mmol). The mixture was refluxed for 7 h and then left to stir at room temperature for 2d. The reaction mixture was filtered, concentrated in vacuo and partitioned between 2N HCl and ethyl acetate (25 ml each). The aqueous layer was extracted with ethyl acetate, basified with ammonium hydroxide solution to pH 8, extracted with ethyl acetate (2×), washed with water and brine, dried (MgSO4), filtered and evaporated to dryness to give yellow needle-like crystals (223 mg, 22%).
Methyl 3-(4-methylthiophen-2-yl)propanoate, used as starting material was prepared as follows:—
Methyl (E)-3-(4-methylthiophen-2-yl)prop-2-enoate (1.095 g) was hydrogenated under a hydrogen balloon with 10% Pd/C and hydrogen in ethanol (20 ml) overnight. Filtration through celite and evaporation to dryness gave an oil (0.914 g, 82.7%).
Methyl (E)-3-(4-methylthiophen-2-yl)prop-2-enoate used as starting material was prepared as follows:
4-Methyl-thiophene-2-carboxaldehyde (1.01 g, 8 mmol), methyl(triphenyl-phosphoranylidene)acetate (4.01 g, 12 mmol) and dichloromethane (25 ml) were mixed together at r.t. and stirred for 4 h. The reaction mixture was evaporated to dryness and purified by column chromatography on silica, eluting with ethyl acetate/isohexane (2:98 increasing to 10:90). The desired fractions were vaporated to dryness to give a gum (1.095 g, 75.5%).
Prepared in an analogous procedure to that in Example 57, starting from 5-[2-(2,5-dimethylpyrazol-3-yl)ethyl]-1H-pyrazol-3-amine (124 mg, 0.60 mmol) and 4-chloro-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 135 mg, 0.60 mmol) in ethanol (5 ml). The crystalline solid was filtered off and washed with cold ethanol and diethyl ether to afford the title compound as a white solid (104 mg, 44%).
1H NMR (399.9 MHz, DMSO-d6) δ1. 2.07 (3H, s), 2.19 (3H, s), 2.88 (4H, s), 3.63 (3H, s), 4.72 (2H, d), 5.82 (1H, s), 6.28 (1H, s), 6.39 (1H, s), 7.91 (1H, s), 8.87 (1H, s), 11.25 (1H, s), 12.49 (1H, s), 12.74 (1H, s). MS: m/z 394 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[2-(2,5-dimethylpyrazol-3-yl)ethyl]-1H-pyrazol-3-amine used as starting material was prepared using the procedure for 5-[2-(3,5-dimethoxy)ethyl]-2H-pyrazol-3-amine) in Example 42, starting from methyl 3-(2,5-dimethylpyrazol-3-yl)propanoate (645 mg, 3.54 mmol), Sodium hydride (171 mg dispersion in mineral oil, 4.26 mmol), acetonitrile (223 uL, 4.26 mmol) and hydrazine monohydrochloride (486 mg, 7.08 mmol). The crude product was purified by normal phase chromatography on silica gel using a 5-10% gradient of methanol in dichloromethane. The clean fractions were taken and evaporated to afford 5-[2-(2,5-dimethylpyrazol-3-yl)ethyl]-1H-pyrazol-3-amine as an oil (270 mg, 37%). MS: m/z 206 (MH+).
3-(2,5-dimethylpyrazol-3-yl)propanoate used as starting material was prepared using the procedure as for methyl 3-[3-(dimethylcarbamoyl)phenyl]propanoate in Example 59, starting from methyl (E)-3-(2,5-dimethylpyrazol-3-yl)prop-2-enoate (612 mg, 3.45 mmol) with 10% Pd/C (60 mg) in ethanol (15 ml) under a hydrogen atmosphere. Filtered through 10 celite, evaporated to afford 3-(2,5-dimethylpyrazol-3-yl)propanoate as an oil (648m g, >100%) 1H NMR (399.9 MHz, DMSO-d6) δ2.06 (3H, s), 2.64 (2H, t), 2.80 (2H, d), 3.62 (3H, s), 3.64 (3H, s), 5.79 (1H, s).
Methyl (E)-3-(1-methylimidazol-4-yl)prop-2-enoate was prepared using the procedure as for methyl (E)-3-[3-fluoro-5-(trifluoromethyl)phenyl]prop-2-enoate in Example 49, starting from 1,3-dimethyl-1H-pyrazole-5-carbaldehyde (786 mg, 6.33 mmol) and methyl(triphenyl-phosphoranylidene)acetate (3.17 g, 9.49 mmol) in dichloromethane (25 ml). The crude product was purified by normal phase chromatography on silica gel using a 0-2.5% gradient of methanol in dichloromethane, followed by chromatography on a silica gel column using 25% ethyl acetate in hexanes. The clean fractions were taken and evaporated to afford methyl (E)-3-(1-methylimidazol-4-yl)prop-2-enoate as an oil (614 mg, 54%). 1H NMR (399.9 MHz, DMSO-d6) δ2.14 (3H, s), 3.73 (3H, s), 3.85 (3H, s), 6.49 (1H, d), 6.64 (1H, s), 7.54-7.58 (1H, m).
Prepared in an analogous procedure to that used in Example 57, starting from 5-[2-(1-methylimidazol-4-yl)ethyl]-1H-pyrazol-3-amine (115 mg, 0.60 mmol) and 4-chloro-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 135 mg, 0.60 mmol). Purified by reverse phase prep. HPLC (basic) using a 18-35% gradient of acetonitrile in water containing 1% ammonia. The clean fractions were taken and evaporated to afford the title compound as a white solid (41 mg, 18%). 1H NMR (399.9 MHz, DMSO-d6) 62.18 (3H, s), 2.63-2.87 (4H, m), 3.60 (3H, s), 4.54 (2H, d), 6.12 (1H, s), 6.19-6.44 (2H, m), 6.85 (1H, s), 7.20 (1H, s), 7.51 (1H, s), 7.83 (1H, d), 9.38 (1H, s), 11.96 (1H, s). MS: m/z 380 (MH+).
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[2-(1-methylimidazol-4-yl)ethyl]-1H-pyrazol-3-amine used as starting material was prepared using an analogous procedure to that for 5-[2-(3,5-dimethoxy)ethyl]-2H-pyrazol-3-amine) in Example 42, starting from methyl 3-(1-methylimidazol-4-yl)propanoate (732 mg, 4.35 mmol), Sodium hydride (209 mg dispersion in mineral oil, 5.22 mmol), acetonitrile (273 uL, 5.22 mmol) and hydrazine monohydrochloride (597 mg, 8.7 mmol). The crude product was purified by normal phase chromatography on silica gel using a 5-10% gradient of methanol in dichloromethane. The clean fractions were taken and evaporated to afford 5-[2-(1-methylimidazol-4-yl)ethyl]-1H-pyrazol-3-amine as an oil (198 mg, 24%). MS: m/z 192 (MH+).
3-(1-methylimidazol-4-yl)propanoate used as starting material was prepared using the procedure described in Example 59 for methyl 3-[3-(dimethylcarbamoyl)phenyl]propanoate, starting from methyl (E)-3-(1-methylimidazol-4-yl)prop-2-enoate (760 mg, 4.57 mmol) with 10% Pd/C (80 mg) in ethanol (15 ml) under a hydrogen atmosphere. Filtered through celite, evaporated to afford 3-(1-methylimidazol-4-yl)propanoate as an oil (743m g, 97%). 1H NMR (399.9 MHz, DMSO-d6) δ2.58-2.60 (2H, m), 2.68-2.72 (2H, m), 3.57 (3H, s), 3.62 (3H, s), 6.82 (1H, d), 7.43 (1H, d).
Methyl (E)-3-(1-methylimidazol-4-yl)prop-2-enoate was prepared using the procedure for Methyl (E)-3-[3-fluoro-5-(trifluoromethyl)phenyl]prop-2-enoate in Example 49, starting from 1-methylimidazole-4-carbaldehyde (1.03 g, 9.35 mmol) and methyl(triphenyl-phosphoranylidene)acetate (4.69 g, 14.03 mmol) in dichloromethane (25 ml). The crude product was purified by normal phase chromatography on silica gel using a 0-2.5% gradient of methanol in dichloromethane, followed by chromatography on a silica gel column using ethyl acetate. The clean fractions were taken and evaporated to afford methyl (E)-3-(1-methylimidazol-4-yl)prop-2-enoate as a solid (760 mg, 49%). 1H NMR (399.9 MHz, DMSO-d6) 63.67 (3H, s), 3.69 (3H, s), 6.33 (1H, d), 7.51 (1H, d), 7.57 (1H, s), 7.69 (1H, s).
To a reaction tube was added 4-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (100 mg, 0.40 mmoles), ethanol (2 ml), and 5-(2-furyl)-2H-pyrazol-3-amine (63 mg, 0.42 mmoles). The mixture was heated overnight at 80° C. The cooled mixture was filtered and the solid was washed with ethanol. The sample was dissolved in methanol, poured onto a SCX-2 column and washed with methanol. The product eluted with 2N ammonia in methanol and the solvent was evaporated to give a gum. The gum was triturated with ether, filtered, dried in a vacuum oven at 45° C. overnight to yield the title product as a white solid (62 mg, 43%).
1H NMR (DMSO 400.13MHz d4AcOH at 373K) 0.69 (m, 2H), 0.92 (m, 2H), 1.89 (m, 1H), 4.56 (s, 2H), 5.98 (s, 1H), 6.25 (d, 1H), 6.45 (s, 1H), 6.52 (m, 1H), 6.69 (d, 1H), 7.59 (d, 1H), 7.87 (d, 1H)
MS: m/z 364 (MH+).
4-chloro-N-[(3-cyclopropyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as in Example 14.
A mixture of 5-(2-{5-[(dimethylamino)methyl]-2-furyl}ethyl)-1H-pyrazol-3-amine (118 mg, 0.5 mmol, 1.0 eq), 4-chloro-N-[(3-methylisoxazol-5-yl)methyl]pyrimidin-2-amine (also known as 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine; 113 mg, 0.5 mmol, 1.0 eq), hydrogen chloride (2.0M solution in diethyl ether, 0.25 mL, 0.5 mmol, 1.0 eq) and ethanol (2.5 ml) were stirred and heated at 80° C. for 45 mins under an atmosphere of nitrogen. The solution was allowed to cool to room temperature and then evaporated to dryness. The crude product was purified by chromatography on a silica column using a 0-10% gradient of methanol containing ammonia (2.0M) in dichloromethane. The clean fractions were taken and evaporated to a white solid, 108 mg. This material was further purified by reverse-phase prep. HPLC (basic) using a 22-32% gradient of acetonitrile in water containing 1% ammonium hydroxide solution. The clean fractions were taken and evaporated to afford the title compound as a solid. (16 mg, 8% yield)
1H NMR (499.8 MHz, DMSO-d6, CD3CO2D) δ 2.19 (3H, s), 2.22 (6H, s), 2.87-2.90 (2H, m), 2.91-2.96 (2H, m), 3.46 (2H, s), 4.58 (2H, s), 6.03 (1H, d), 6.09 (2H, d), 6.14 (1H, d), 6.29 (1H, d), 7.86 (1H, d). MS: m/z 423 (MH+)
4-Chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-(2- {5-[(dimethylamino)methyl]-2-furyl} ethyl)-1H-pyrazol-3-amine, used as starting material was prepared as follows:
Acetonitrile (0.258 ml, 4.88 mmol, 1.2 eq) was added to a slurry of sodium hydride (196 mg dispersion in mineral oil, 4.88 mmol, 1.2 eq) in anhydrous dioxan (15 ml) and the mixture stirred at room temperature under an atmosphere of nitrogen for 5 mins. Ethyl 3-{5-[(dimethylamino)methyl]-2-furyl}propanoate (917 mg, 4.07 mmol, 1.0 eq) was then added and the reaction was refluxed overnight for 18 h. The mixture was cooled to room temperature and ethanol (1.9 ml) was added, followed by hydrazine hydrochloride (558 mg, 8.14 mmol, 2.0 eq). The mixture was refluxed for 1 h. After cooling the solvent was evaporated under reduced pressure. The residue was dissolved in dichloromethane containing 10% methanol (50 mL) and the insoluble impurities were filtered off. The filtrate was evaporated to give the crude product as a golden oil, 1.07 g. This material was purified by silica column chromatography eluting with a 0-10% gradient of methanol (containing ammonia at 2M) in dichloromethane. Pure product fractions were combined and evaporated to give a clear oil. (520 mg, 55% yield)
1H NMR (399.9 MHz, DMSO-d6) δ2.16 (6H, s), 2.70-2.74 (2H, m), 2.81-2.85 (2H, m), 3.40 (2H, s), 5.20 (1H, s), 6.03 (1H, d), 6.15 (1H, d). MS: m/z 235 (MH+)
Ethyl 3- {5-[(dimethylamino)methyl]-2-furyl}propanoate, used as starting material was prepared as follows:
A mixture of ethyl 3-(2-furanyl)propionate (12.1lg, 72.0 mmol, 1.0 eq), dimethylammonium chloride (6.76 g, 82.8 mmol, 1.15 eq), 37% aqueous formaldehyde (6.43 g, 79.2 mmol, 1.1 eq) in acetic acid (75 mL) was stirred at room temperature until a solution formed. The solution was allowed to stand for 44 h. The mixture was evaporated to an oil. This was suspended in water and extracted with ethyl acetate (2×250 mL). The aqueous layer (containing the product) was basified to pH11 with 4M sodium hydroxide solution and then extracted into ethyl acetate (2×250 mL). These combined extracts were washed with brine, dried over magnesium sulphate and evaporated to give the crude product as a dark brown oil, 6.5 g. This material was purified by silica column chromatography eluting with a 0-10% gradient of methanol (containing ammonia at 2M) in dichloromethane. Fractions containing the product were combined and evaporated to give a light brown oil. (3.44 g) This material was repurified by silica column chromatography eluting with a 0-5% gradient of methanol (containing ammonia at 2M) in dichloromethane. Fractions containing the product were combined and evaporated to give a light brown oil. (1.36 g, 8% yield)
1H NMR (399.9 MHz, CDCl3) δ 1.24 (3H, t), 2.29 (6H, s), 2.62-2.65 (2H, m), 2.95 (2H, t), 3.47 (2H, s), 4.11-4.15 (2H, m), 5.95 (1H, d), 6.11 (1H, d). MS: m/z 226 (MH+)
5-(2-(5-methoxythiophen-2-yl)ethyl)-1H-pyrazol-3-amine (100 mg, 0.45 mmol, 1 eq) was added to 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (101 mg, 0.45 mmol, 1 eq) in ethanol (3 ml). The resulting solution was stirred at 80° C. for 24 h. The resulting mixture was evaporated to dryness and the residue was purified by preparative HPLC using decreasingly polar mixtures of water (containing 1% ammonium hydroxide) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford N′-[5-[2-(5-methoxythiophen-2-yl)ethyl]-1 H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine (60.0 mg, 32.6%) as a white solid.
1H NMR (400.13 MHz, DMSO-d6) δ 2.16 (3H, s), 2.81 (2H, m), 2.95 (2H, t), 3.78 (3.78 (3H, s), 4.52 (2H, d), 6.07 (1H, d), 6.10 (1H, s), 6.45-6.46 (1H, m), 7.23 (1H, s), 7.82 (1H, d), 9.40 (1H, s), 11.94 (1H, s). MS m/z 412 (MH+).
4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-(2-(5-Methoxythiophen-2-yl)ethyl)-1H-pyrazol-3-amine, used as starting material, was prepared as follows:—
Acetonitrile (1. 174 ml, 22.47 mmol, 1. 8 eq) was added dropwise to lithium diisopropylamide (1 1.24 ml, 22.47 mmol, 1.8 eq 1M in THF) in THF (80 ml) at −78° C. over a period of 5 mins under nitrogen. The resulting solution was stirred at −78° C. for 10 mins. Methyl 3-(5-methoxythiophen-2-yl)propanoate (2.5 g, 12.48 mmol, 1 eq) was added dropwise and the reaction was stirred for 30 mins before being allowed to warm to 22° C. The reaction mixture was diluted with ethanol (80 ml) and hydrazine monohydrochloride (1.539 g, 22.47 mmol, 1.8 eq) was added. The reaction was heated at 70° C. until formation of pyrazole was complete. The resulting mixture was evaporated to dryness, suspended in DCM and filtered. The filtrate was purified by silica column chromatography, eluting with a gradient of 0-10% MeOH in EtOAc. Pure fractions were evaporated to dryness to afford 5-(2-(5-methoxythiophen-2-yl)ethyl)-1H-pyrazol-3-amine (875 mg, 31.4%)
1H NMR (399.902 MHz, DMSO) δ 2.69 (2H, t), 2.89 (2H, t), 3.80 (3H, s), 4.51 (2H, s), 5.22 (1H, s), 6.07 (1H, d), 6.44 (1H, d), 11.18 (1H, s). MS m/z 224 (MH+).
Methyl 3-(5-methoxythiophen-2-yl)propanoate, used as starting material, was prepared as follows:—
(E)-Methyl 3-(5-methoxythiophen-2-yl)prop-2-enoate (4 g, 2.52 mmol, 1 eq) and Palladium, (5% on Carbon 50% wet) (0.8 g, 0.16 mmol, 0.01 eq) in EtOH (100 mL) were stirred under an atmosphere of hydrogen at 3 bar and 25° C. for 15 h. The reaction mixture was filtered through celite and the solvent evaporated to give crude product as a yellow oil (2.58 g, 63%). 1H NMR (400.13 MHz, DMSO-d6) δ 2.59 (2H, t), 2.86-2.88 (2H, m), 3.59 (3H, t), 3.79 (3H, s), 6.06-6.07 (1H, m), 6.45-6.46 (1H, m). MS m/z 201 (MH+).
(E)- Methyl 3-(5-methoxythiophen-2-yl)prop-2-enoate, used as starting material, was prepared as follows:—
To 5-methoxythiophene-2-carbaldehyde (5.69 g, 40 mmol, 1 eq) in DCM (150 mL) was added methyl (triphenylphosphorylidene) acetate (20. 1 g, 60 mmol, 1.5 eq) portionwise. The reaction was stirred at room temperature overnight and then evaporated to dryness and purified by silica column chromatography, eluting with 2-5% ethyl acetate in isohexane to give product as a yellow solid (5.24 g, 66%).
1H NMR (400.13 MHz CDCl3) δ 3.75 (3H, s), 3.92 (3H, s), 5.93 (1H, d), 6.14 (1H, d), 6.63 (1H, d), 7.63 (1H, d). MS m/z 199 (MH+).
5-Methoxythiophene-2-carbaldehyde, used as starting material, was prepared as follows:—
A solution of n-butyllithium (35.5 mL, 56.93 mmol, 1.3 eq 1.6M in hexanes) was added to a solution of 2-methoxythiophene (5 g, 43.79 mmol, 1 eq) in ethoxyethane (100 mL) at 0° C. under nitrogen. The reaction was stirred for 15 mins and then DMF (4.41 ml, 56.93 mmol, 1.3 eq) was added dropwise. The temperature was allowed to rise to 25° C. over 15 mins. The mixture was heated at 35° C. for 1 h and then allowed to cool to room temperature and poured into water. The mixture was extracted with diethyl ether (×3), the organics were washed with brine, dried (MgSO4) and evaporated to give crude product as a yellow liquid (7.2 g, >100%).
1H NMR (400.13 MHz CDCl3) δ 3.99 (1H, s), 6.34 (1H, d), 7.51 (1H, d), 9.67 (1H, s).
5-[2-(2-methoxy-1,3-thiazol-5-yl)ethyl]-1H-pyrazol-3-amine (100 mg, 0.45 mmol, 1 eq) was added to 4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine (100 mg, 0.45 mmol, 1 eq) in ethanol (3 ml). The resulting solution was stirred at 80° C. for 18 h. The resulting mixture was evaporated to dryness and the residue was purified by preparative HPLC using decreasingly polar mixtures of water (containing 0.1% TFA) and MeCN as eluents. The crude product was converted to free base by preparative HPLC using decreasingly polar mixtures of water (containing 1% ammonium hydroxide) and MeCN as eluents. Fractions containing the desired compound were evaporated to dryness to afford N′-[5-[2-(2-methoxy-1,3-thiazol-5-yl)ethyl]-1H-pyrazol-3-yl]-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidine-2,4-diamine (47.0 mg, 25.6%) as a white solid.
1H NMR (400.13 MHz, DMSO-d6) δ 2.17 (3H, s), 2.83 (2H, t), 2.99 (2H, t), 3.95 (3H, s), 4.53 (2H, d), 6.10 (1H, s), 6.29 (1H, s), 6.90 (1H, s), 7.18 (1H, s), 7.83 (1H, s), 9.36 (1H, s), 11.92 (1H, s). MS m/z 413 (MH+).
4-chloro-N-[(3-methyl-1,2-oxazol-5-yl)methyl]pyrimidin-2-amine was prepared as outlined in Example 13.
5-[2-(2-methoxy-1,3-thiazol-5-yl)ethyl]-1H-pyrazol-3-amine, used as starting material, was prepared as follows:—
Acetonitrile (0.29 ml, 5.5 mmol, 2 eq) was added dropwise to a solution of lithium diisopropylamide (1.8 M in THF, 3.05 ml, 5.5 mmol, 2 eq) in THF (20 ml) at −78° C. under a nitrogen atmosphere. After stirring at -78° C. for 10 mins, methyl 3-(2-methoxy-1,3-thiazol-5-yl)propanoate (553 mg, 2.75 mmol, 1 eq) in THF (5 ml) was added dropwise. The reaction was stirred at −78° C. for 20 mins and then warmed to room temperature. Ethanol (20 ml) was added followed by hydrazine monohydrochloride (471 mg, 6.87 mmol, 2.5 eq) and the reaction was refluxed overnight. After cooling to room temperature, the volatiles were removed under reduced pressure and the residue purified by silica column chromatography eluting with 0-10% methanol in dichloromethane to afford the title compound as a pale yellow solid (401 mg, 65% yield). 1H NMR (399.902 MHz, CDCl3) δ 2.83 (2H, t), 2.96 (2H, t), 4.03 (3H, s), 5.46 (1H, s), 6.80 (1H, s). MS: m/z 225 (MH+).
Methyl 3-(2-methoxy-1,3-thiazol-5-yl)propanoate, used as starting material, was prepared as follows:—
Methyl (E)-3-(2-methoxy-1,3-thiazol-5-yl)prop-2-enoate (650 mg, 3.26 mmol, 1 eq) and 5% Pd on barium sulfate (1.63 g, 3.26 mmol) in ethanol (10 mL) were stirred under an atmosphere of hydrogen at 1 atmosphere and 25° C. for 18 h. The reaction mixture was filtered through Celite. The filtrate was evaporated under reduced pressure to afford the title compound as a pale yellow liquid (563 mg, 86% yield). 1H NMR (399.902 MHz, CDCl3) δ2.61 (2H, t), 2.99 (2H, t), 3.70 (3H, s), 4.02 (3H, s), 6.83 (1H, s). MS: m/z 202 (MH+).
Methyl (E)-3-(2-methoxy-1,3-thiazol-5-yl)prop-2-enoate, used as starting material, was prepared as follows:—
Methyl (E)-3-(2-chloro-1,3-thiazol-5-yl)prop-2-enoate (400 mg, 1.96 mmol, 1 eq), sodium methoxide (319 mg, 5.89 mmol, 3 eq) and dry methanol (12 ml) were added into a microwave vial. The reaction mixture was heated to 120° C. in a microwave reactor for 15 mins. The procedure was repeated on exactly the same scale under exactly the same conditions and the reactions combined for work-up. The combined reactions were evaporated, the residue taken up in water (50 ml), neutralized with 2 N HCl (aq.), extracted with EtOAc (2×50 ml) and the combined organic phases dried over sodium sulfate. After filtering, the solvent was evaporated under reduced pressure to afford the title compound as a pale yellow solid (655 mg, 84% yield). 1H NMR (399.902 MHz, DMSO) 6 4.09 (3H, s), 6.05 (1H, d), 7.68 (1H, s), 7.76 (1H, d). MS: m/z 200 (MH+)
Methyl (E)-3-(2-chloro-1,3-thiazol-5-yl)prop-2-enoate, used as starting material, was prepared as follows:—
Methyl 2-triphenylphosphoranylideneacetate (3.4 g, 10. 16 mmol, 1.5 eq) was added portionwise to a stirred solution of 2-chloro-1,3-thiazole-5-carbaldehyde (1 g, 6.78 mmol, 1 eq) in DCM (20 ml) at ambient temperature and the reaction was allowed to stir overnight. The volatiles were removed under reduced pressure and the residue purified by silica column chromatography to afford the title compound as a colourless solid (1 1 53 g, 84% yield).
1H NMR (399.902 MHz, DMSO) δ 3.74 (3H, s), 6.42 (1H, d), 7.83 (1H, d), 8.11 (1H, s)
To determine inhibition of FGFR activity, kinase assays were conducted using ELISA (Enzyme-Linked Immunosorbent Assay) technology.
Kinase activity assays were performed in 384-well polypropylene plates (Matrix, 4311) with a total volume of 40 μl in each well. Each well was coated with 2 μg of polyEAY substrate (Sigma, P3899) at 4° C. overnight. The plates were then washed once with 100 μl PBS and once with 100 μl 50 mM HEPES (pH 7.4) prior to the addition of the kinase assay reagents. Each kinase reaction contained 0.1 ng His6-tagged FGFR kinase domain (FGFR kinase domain (amino acids 458-765, C488A, C584S) N-terminally fused to a His6-tag and TEV cleavage site encoded by the following sequence; [MHHHHHHEFKGSTSLYKKAGSSENLYFQGA]. The final alanine denotes the start of the FGFR protein sequence. The resultant protein was expressed and purified based on Mohammadi et al, Cell Vol 86, 577-587 (1996)), 50 mM HEPES (pH 7.4), 0.1 mM Na3VO4, 0.1 mM DTT, 0.05% (v/v) Triton X100, 20 mM MgCl2, 160 μM ATP. Various concentrations of test compounds were each added in 5% (v/v) DMSO to yield a final assay DMSO concentration of 1.25% (v/v). The kinase reactions were incubated at room temperature for 45 minutes and stopped by washing the plate three times with 100 μl PBS plus 0.05% Tween. 40 μl of a one in 10000 dilution of 4G10-HRP antibody (Upstate Biotechnology, UBI 16-105) made up in 0.5% (w/v) BSA/PBS was then added to each well and the plates incubated at room temperature for one hour. Following this, the plates were then washed repeatedly with 100 μl PBS plus 0.05% Tween to remove all traces of the antibody solution. 40 μl of 50 μg/ml 3,3′,5,5′-Tetramethylbenzidine (Sigma, T2885), 0.05M phosphate-citrate buffer, containing 0.03% sodium perborate was added to each well and the plates incubated at room temperature for twelve minutes. The colour reaction was stopped by the addition of 20 μl 2M H2SO4 and the plates read at 450 nm on a Spectrafluor Plus (Tecan). The mean data values for each test compound concentration, untreated control wells and 100% inhibition control wells were used to determine the test compounds IC50 value. IC50 value is the concentration of test compound that inhibits 50% of FGFR kinase activity.
To determine inhibition of FGFR activity, kinase assays were conducted using Caliper technology.
Kinase activity assays were performed in Greiner 384-well low volume plates, with a total reaction volume of 12ul per well. Final concentration of FGFR1 active kinase in each reaction well was 7.2 nM. The substrate for each assay was a custom peptide with fluorescent tag (13 amino acids in length) the sequence of which was specific for FGFR1 kinase.
Compounds were serially diluted in 5% (v/v) DMSO, before being added to assay plates. The Enzyme (at 7.2 nM [final]) and Substrate (at 3.6 uM [final]) were added separately to the compound plates, in reaction buffer [comprising: 50mM MOPS—pH 6.5, 0.004% Triton, 2.4 mM DTT, 12 mM MgCl2, 408 uM ATP]resulting in a final DMSO concentration in the reaction mix of 0.8%.
Assay plates were incubated at room temperature for 1.5 h, before the reaction was stopped with the addition of buffer [comprising: 100 mM HEPES—pH7.5, 0.033% Brij-35, 0.22% Caliper Coating Reagent #3, 88mM EDTA, 5% DMSO]. Stopped assay plates were then read using the Caliper LabChip® LC3000 (which uses microfludics to measure a shift in mobility between fluorescent labelled peptide and the FGFR1 kinase—phosphorylated form of this peptide).
The mean data values for each compound concentration, untreated control wells and 100% inhibition control wells were used to determine the IC50 for each test compound. The IC50 is the concentration of compound, which inhibits FGFR1 kinase activity by 50% in the context of this assay.
The following compounds were tested in this assay and exhibited an IC50 of:—
These and other assays were used to evaluate the ability of a test compound to inhibit growth factor stimulated cellular signalling in mammalian cell lines. This was achieved by measuring the amount of receptor tyrosine kinase regulated Erk phosphorylation within a cell following compound treatment.
NIH 3T3 (ECACC, 93061524) cells were routinely passaged in DMEM (Gibco BRL, 41966) plus 10% foetal calf serum (FCS), 1% L-glutamine (Gibco BRL, 25030) to a confluence not greater than 80%. To undertake the assay, NIH 3T3's were seeded at 1×104 cells/well in DMEM plus 10% foetal calf serum, 1% L-glutamine in 96 well plates (Costar, 3904) and incubated at 37° C. (+5% CO2) in a humidified incubator. Once the cells had fully adhered (typically following 4-5 hours incubation) the media was removed from each well and the cells gently washed with 100μl warm serum free media. 90μl of serum free DMEM plus 1% L-glutamine was then added to each well and the plates were returned to a humidified 37° C. (+5% CO2) incubator. The following day, the plates were dosed with 10[l compound (diluted from 10 mM stock in DMSO using serum free DMEM) and the plates were returned to a humidified 37° C. (+5% CO2) incubator for one hour. NIH 3T3 cells were then stimulated with a final concentration of 3 ng/ml bFGF (Sigma, F029 1) for 20 minutes at 37° C. Following stimulation the cells were fixed by adding formaldehyde (4% v/v final concentration) and incubating at room temperature for 20 minutes. The fixative solution was then removed and the wells were washed twice with 100μl phosphate buffered saline (PBS/A) before permeabilising the cells by the addition of 50 μl/well 0.1% triton/PBS/A for 10 minutes at room temperature. The permeabilisation solution was then removed and the cells washed twice more with 100 μl/well PBS/A before the addition of 50 μl/well anti-phospho p44/42 (Cell Signalling Technology, 9106), diluted 1/500 with PBS/A plus 10% FCS. The anti-phospho p44/42 antibody recognises Erk phosphorylated at threonine 202 and tyrosine 204. Following incubation at room temperature for 2 hours, the antibody solution was removed and the wells were washed twice with 100 μl/well PBS/A. 50 μl/well 1/250 goat anti-mouse alexa fluor 488 secondary antibody (Molecular Probes, A11001) and 1/10000 Hoescht (Molecular Probes, H-3570) diluted with PBS/A plus 10% FCS was added and the plate incubated in the dark at room temperature for one hour. Finally, the plates were washed three times with 100 μl/well PBS/A, leaving the final wash in the wells before sealing the plates. The plates were read at 350 nm and 488 nm using an Arrayscan (Cellomics). The mean average intensity fluorescence values for each test compound concentration, untreated control wells and 100% inhibition control wells were used to determine the test compounds IC50 value. IC50 value is the concentration of test compound that inhibits 50% of Erk phosphorylation.
The following compounds were tested in this assay and exhibited an IC50 of:—
For example, Example 33 was measured to have an IC50 of 518 nM
This assay is designed to detect inhibitors of transiently expressed FGFR1 phosphorylation by antibody staining of fixed cells detected using ArrayScan technology.
Cos-1 cells were routinely passaged in DMEM (Gibco BRL, 41966) plus 3% foetal calf serum (FCS), 1% L-glutamine (Gibco BRL, 25030) to a confluence of 80%. To undertake the assay, Cos-1 cells were harvested at 90-95% confluence for cell transfection. For each 96-well plate, 24 ul Lipofectamine 2000 was added to 809 ul OptiMEM and incubated at room temperature for 5 minutes. For each 96 well plate, 20 ug 3′ FLAG tagged FGFR1/pcDNA3.1 (In-house clone15, MSD 4793) was diluted with OptiMEM to a total volume of 833 ul. Equal volumes of DNA and Lipofectamine 2000 were combined (DNA: Lipid=1:1.2 ratio) and incubated at room temperature for 20 minutes.
The harvested Cos-1 cells are counted using a coulter counter and diluted further with 1% FCS/DMEM to 2.5×105 cells/ml. For each 96-well, 8.33 ml cells were required. The complexed transfection solution was added to the cell solution and the cells were seeded at 2.5×105 cells/well in DMEM plus 1% foetal calf serum, 1% L-glutamine in 96 well plates (Costar, 3904) and incubated at 37° C. (+5% CO2) in a humidified incubator overnight (24 hrs). The following day, the plates were dosed with 25 μl compound (diluted from 10 mM stock in DMSO using serum free DMEM) and the plates were returned to a humidified 37° C. (+5% CO2) incubator for one hour. Media was removed from the wells using vacuum aspiration; cells were fixed by adding 50μl of 100% methanol to each well and incubated at room temperature for 20 minutes. The fixative solution was then removed and the wells were washed once with 200 μl phosphate buffered saline (PBS/A) before permeabilising the cells by the addition of 50 ul/well 0.1% triton/PBS/A for 20 minutes at room temperature. The permeabilisation solution was then removed and the cells washed once more with 200 ul/well PBS/A before the addition of 40μl 1/1000 primary antibody solution (Cell Signalling Technologies #CS3476; mouse anti-phospho FGFR1 diluted in PBS/A with 10% FCS+0.1% Tween20) to each well.
Following incubation at room temperature for 1 hour, the antibody solution was removed and the wells were washed once with 200 ul/well PBS/A. Then 40 μl 1/500 secondary antibody (A11005; goat anti-mouse 594) solution and 1/10000 Hoechst (diluted together in PBS/A with 10% FCS+0.1% Tween 20) were added and the plate incubated in the dark at room temperature for one hour. Finally, the plates were washed once with 200[l/well PBS/A, leaving the final wash in the wells before sealing the plates. The plates were read on an Arrayscan (Cellomics). The Channel 2 (594 nm) values obtained from undosed (max) and reference compound (min) wells within a plate are used to set boundaries for 0% and 100% compound inhibition. Compound data was normalized against these values to determine the dilution range of a test compound that gives 50% inhibition of phosphorylated FGFR1.
The following compounds were tested in this assay and exhibited an IC50 of:—
This assay is designed to detect inhibitors of transiently expressed FGFR1 phosphorylation by antibody staining of fixed cells detected using ArrayScan technology.
Cos-1 cells were routinely passaged in DMEM (Gibco BRL, 41966) plus 3% foetal calf serum (FCS), 1% L-glutamine (Gibco BRL, 25030) to a confluence of 80%. To undertake the assay, Cos-1 cells were harvested at 90-95% confluence for cell transfection. For each 96-well plate, 24μl Lipofectamine 2000 was added to 809 ul OptiMEM and incubated at room temperature for 5 minutes. For each 96 well plate, 20 ug 3° FLAG tagged FGFR1/pcDNA3.1 (In-house clone15, MSD 4793) was diluted with OptiMEM to a total volume of 833 μl. Equal volumes of DNA and Lipofectamine 2000 were combined (DNA: Lipid=1:1.2 ratio) and incubated at room temperature for 20 minutes.
The harvested Cos-1 cells are counted using a coulter counter and diluted further with 1% FCS/DMEM to 2.5×105 cells/ml. For each 96-well, 8.33 ml cells were required. The complexed transfection solution was added to the cell solution and the cells were seeded at 2.5×105 cells/well in DMEM plus 1% foetal calf serum, 1% L-glutamine in 96 well plates (Costar, 3904) and incubated at 37° C. (+5% CO2) in a humidified incubator overnight (24 hrs). The following day, compounds from dry weight samples were dissolved in 100% DMSO to give 10 mM concentration. 40μl of the compound was dispensed into the wells of each quadrant across the 384 Labcyte plate (inclusive of a positive control (100% DMSO), a negative control (10 μM) and a reference compound (250 nM)). The 384 Labcyte plate was then transferred to the Hydra to dilute the compounds 1:100 into the remaining wells of the quadrant. 70 μl of media was aspirated from the assay plate using the Quadra before the plate was transferred onto the ECHO 550. The 384 Labcyte compound plate was also transferred onto the ECHO 550. Compound transfer to the assay plate on the ECHO 550 was at concentration ranges 1)10 μM, 2) 3 μM, 3) 1 μM, 4) 0.3 μM, 5) 0.1 μM, 6) 0.01.
The plates were gently tapped to mix compound in with the cell media and left to incubate at 37° C. with 5% CO2 for 1 hour.
Media was removed from the wells using vacuum aspiration; cells were fixed by adding 50 μl of 100% methanol to each well and incubated at room temperature for 20 minutes. The fixative solution was then removed and the wells were washed once with 200 μl phosphate buffered saline (PBS/A) before permeabilising the cells by the addition of 50 ul/well 0.1% triton/PBS/A for 20 minutes at room temperature. The permeabilisation solution was then removed and the cells washed once more with 200μl/well PBS/A before the addition of 40 μl 1/1000 primary antibody solution (Cell Signalling Technologies #CS3476; mouse anti-phospho FGFR1 diluted in PBS/A with 10% FCS+0.1% Tween20) to each well.
Following incubation at room temperature for 1 hour, the antibody solution was removed and the wells were washed once with 200 ul/well PBS/A. Then 40 μl 1/500 secondary antibody (A11005; goat anti-mouse 594) solution and 1/10000 Hoechst (diluted together in PBS/A with 10% FCS+0.1% Tween 20) were added and the plate incubated in the dark at room temperature for one hour. Finally, the plates were washed once with 200 μl/well PBS/A, leaving the final wash in the wells before sealing the plates. The plates were read on an Arrayscan (Cellomics). The Channel 2 (594 nm) values obtained from undosed (max) and reference compound (min) wells within a plate are used to set boundaries for 0% and 100% compound inhibition. Compound data was normalized against these values to determine the dilution range of a test compound that gives 50% inhibition of phosphorylated FGFR1.
The following compounds were tested in this assay and exhibited an IC50 of:—
This immunofluorescence end point cell assay measures the ability of a test compound to reduce the measured levels of IGF1R phosphorylation after IGF1 stimulation in R+ cells. R− cells were derived by transfection of R− mouse fibroblast cells with human IGF1R. R+ cells were routinely cultured in DMEM growth medium (Gibco BRL, 41966) containing 2 mM L-Glutamine (Invitrogen Code no. 25030-024) and 10% (v/v) foetal bovine serum (FBS)) in a 5% CO2 air incubator at 37° C.
To undertake the assay, the R+ cells were seeded at 5×103 cells/well in DMEM plus 1% foetal calf serum, 1% L-glutamine in 96-well black Packard View plates (PerkinElmer 6005182) and incubated at 37° C. (+5% CO2) in a humidified incubator. The following day, the plates were dosed with 10μl of 10× concentrated compound (diluted from 10 mM stock in DMSO and DMEM without serum) and the plates were e returned to a humidified 37° C. (+5% CO2) incubator for 30 minutes. Cells were tested in duplicates in a suitable dose range to accurately measure the compound IC50.
Following the compound treatment, the R+ cells were stimulated with a final concentration of 30 nM IGF1 (Gropep 1M001) for 20 minutes at 37° C. The IGF1 was dissolved according to the manufacture's instructions to a 26 μM stock solution and diluted in DMEM without serum. Following stimulation, the cells were fixed by adding formaldehyde (4% v/v final concentration) and incubated at room temperature for 20 minutes. The fixative solution was removed and the wells were washed twice with 100 μl phosphate buffered saline containing 0.05% Tween20 (PBS-Tween 20) before permeabilisation of the cells by the addition of 50 μl/well 0.05% Triton in PBS for 10 minutes at room temperature. The permeabilisation solution was removed and the cells were washed twice with 100μl/well PBS-Tween 20 before addition of 50 μl blocking solution containing 2% BSA (Sigma. A-78888)+2% goat serum (DAKO X0907 ) in PBS. Plates were incubated for 1 hour at room temperature. The blocking solution was aspirated from the wells and 50 μl rabbit dual phospho specific anti-phospho IGF1R/IR (BioSource 44-804) 1/350 diluted in blocking solution was added to the wells. Additionally, in-house antibodies raised against phospho TGF1R were also used at a suitable titre determined for each batch.
Following incubation at room temperature for 1 hour, the antibody solution was removed and the wells washed twice with 100 μl/well PBS-Tween 20. 50 μl/well Alexa Fluor conjugated anti rabbit (Invitrogen/Molecular Probes-A11008) was added to the wells in a dilution of 1/1000 in blocking solution. The plates were incubated at room temperature for one hour. Finally, the plates were washed three times with 100 μl/well PBS-Tween. After addition of 100 μl/well PBS the plates were sealed with a black seal.
The Green Fluorescent phospho IGF1R -associated signal in each well was measured using an Acumen Explorer HTS Reader (TTP Labtech Ltd., Cambridge). Phospho IGF1R-associated fluorescence emission can be detected at 530 nm following excitation at 488 nm. The instrument is a laser-scanning fluorescence microplate cytometer, which samples the well at regular intervals and uses threshold algorithms to identify all fluorescent intensities above the solution background without the need to generate and analyse an image. These fluorescent objects can be quantified and provide a measure of the phospho IGF1R levels in cells. Fluorescence dose response data obtained with each compound was exported into a suitable software package (such as Origin) to perform curve fitting analysis. Phospho-IGF1R levels in response to compound treatment versus stimulated and unstimulated controls were expressed as an IC50 value. This was determined by calculation of the concentration of compound that was required to give a 50% reduction of the maximum phospho-IGF1R signal.
Conclusion: Although the compounds tested show some inhibition of IGFR in cells, the compounds show reduced potency against IGFR than the much higher levels of potency against FGFR as demonstrated in the enzyme assay results. Reduced inhibition of IGFR is desirable to ameliorate potential effects upon insulin or growth factor production.
The inhibitory potential (IC50) of test compounds against 5 human cytochrome P450 (CYP) isoforms (IA2, 2C9, 2C19, 3A4 and 2D6) was assessed using an automated fluorescent end point in vitro assay modified from Crespi (Crespi and Stresser, 2000). Microsomal subcellular fractions prepared from Yeast cell lines expressing each human CYP isoform were used as an enzyme source in this assay. The activity of the 5 major human CYPs was determined from the biotransformation of a number of coumarin substrates to fluorescent metabolites, in the presence of NADPH. Inhibition of these CYPs resulted in a decrease in the amount of fluorescent metabolite formed. Comparison of the fluorescence observed in the presence of varying concentrations of test compound with that seen in its absence allowed an IC50 value to be calculated. Initial experiments were performed to optimise the kinetic parameters of the assay and these have been listed in Table 1. Stock solutions of each CYP, with its respective substrate, were prepared in phosphate buffer pH7.4 (see Table 1) and 178 μl was added to the well of a black solid, flat bottom, 300 μl 96 well microtitre plate (Coming Costar). Test compounds were serially diluted in DMSO/acetonitrile and added (2 μl) to the reaction to give final concentrations of 0.1, 0.3, 1, 3 and 10 μM. After pre-incubating at 37° C. for 5 min the reactions were started with addition of NADPH (20 μl, concentration shown in Table 1). The final solvent content in each incubation was <=2% (1% from the test compound and a maximum of 1% from the substrate). The appropriate solvent controls and substrate blanks were included in each experiment to assess control activity and identify any inherent fluorescence due to the test compounds. In addition, known inhibitors of each CYP were included as positive controls (see Table 3 for inhibitor concentrations and expected IC50 ranges). The reactions were stopped at defined timepoints (see Table 1) by quenching with 100 μl of solvent (acetonitrile:0.5M Tris buffer 80:20 v/v). The plates were read on a fluorimeter (Spectrafluor Plus) at the appropriate excitation and emission wavelengths (listed in Table 2) and the percent activity, corrected for control, was plotted against the test compound concentration. The IC50 (the concentration of test compound required to cause 50% inhibition of metabolic activity) for each CYP was then determined from the slope of these plots.
Crespi C L, Stresser, D M., Fluorometric screening for metabolism-based drug-drug interactions. J Pharmacol Toxicol Methods. 2000, 44 (1): 325-31.
Compounds described in Examples 1 and 9 were tested against compounds known IGFR inhibitors (as described in WO03/048133).
Comparative Example (a) is 5-bromo-N-[(3-methylisoxazol-5-yl)methyl]-N′-(5-methyl-2H-pyrazol-3-yl)pyrimidine-2,4-diamine (WO03/048133, Example 1)
Comparitive Example (b) is 5-chloro-N-[(3-methylisoxazol-5-yl)methyl]-N′-(5-methyl-2H-pyrazol-3-yl)pyrimidine-2,4-diamine (WO03/048133, Example 2)
Comparative Example (c) is 5-bromo-N′-(5-cyclopropyl-2H-pyrazol-3-yl)-N-[(3-methylisoxazol-5-yl)methyl]pyrimidine-2,4-diamine (WO03/048133, Example 3)
Comparative Example (d) is 5-bromo-N-[(3-methylisoxazol-5-yl)methyl]-N′-(5-propyl-2H-pyrazol-3-yl)pyrimidine-2,4-diamine (WO03/048133, Example 47)
Conclusion: Compounds of the present invention (Example 1 and 9) while showing good FGFR inhibition, also show decreased Cytochrome P450 inhibition when compared to known IGF inhibitors. Low inhibition of Cytochrome P450 is desirable to ameliorate potential drug:drug interactions.
This application claims the benefit under 35 U.S.C. §119(e) of Application No U.S. 60/818259 filed on 30th June 2006 and Application No U.S. 60/908428 filed on 28th Mar. 2007. The present invention relates to pyrimidine derivatives, a process for their preparation, pharmaceutical compositions containing them, a process for preparing the pharmaceutical compositions, and their use in therapy.
| Number | Date | Country | |
|---|---|---|---|
| 60908428 | Mar 2007 | US | |
| 60818259 | Jun 2006 | US |
