Claims
- 1. An isolated and purified peptide comprising the GD domain.
- 2. An isolated and purified peptide having an amino acid sequence selected from the group consisting of
GDDINRRYDSEFQ, PSSTMGQVGRQLAIIGDDINRRYDSEFQ, QVGRQLAIIGDDINRRYDSEFQTMLQHLQPT, LSECLKRIGDELDSN, LKRIGDELD, QDASTKKLSECLKRIGDELDSNMELQ, LALRLACIGDEMDVS, IGDEM, CMEGSDALALRLACIGDEMDVSLRAPRL, VGRQLAIIGDDINRR, ps and functional equivalents thereof.
- 3. A mutant of a protein selected from the group consisting of Bak, Bax and Bip1a, characterized in that it comprises the GD domain and exhibits Rat-1 cell killing activity substantially equivalent to that of wild-type Bak.
- 4. A mutant of a protein selected from the group consisting of Bak, Bax and Bip1a, characterized in that it comprises the GD domain and exhibits Bcl-xL binding substantially equivalent to that of wild-type Bak.
- 5. An isolated and purified nucleotide sequence encoding a GD domain peptide.
- 6. An isolated and purified nucleotide sequence encoding the peptide of claim 2, wherein said nucleotide sequence is as shown in FIG. 8.
- 7. An isolated recombinant DNA molecule consisting essentially of a nucleotide sequence that encodes a GD domain peptide.
- 8. A vector consisting essentially of a recombinant DNA molecule encoding a GD domain peptide.
- 9. A vector comprising a recombinant DNA molecule encoding a GD domain peptide, wherein said vector expresses an antisense RNA of said recombinant molecule.
- 10. A host cell transformed with the vector of any one of claims 8 or 9.
- 11. The host cell of claim 10, wherein said host cell is a mammalian cell.
- 12. A method for producing isolated GD domain peptide, comprising:
(a) constructing the vector of claim 8;(b) transforming a suitable host cell with said vector of step (a); (c) culturing said host cell under conditions which allow the expression of said GD domain peptide by said host cell; and (d) isolating said GD domain peptide expressed by said host cell of step (c); wherein isolated GD domain peptide is produced.
- 13. The method according to claim 12, wherein said host cell is a mammalian cell.
- 14. An antibody raised against a GD domain peptide.
- 15. The antibody of claim 14, wherein said antibody is selected from the group consisting of a polyclonal antibody and a monoclonal antibody.
- 16. The antibody of claim 15, wherein said antibody is detectably labeled.
- 17. The antibody of claim 16, wherein said detectable label is selected from the group consisting of: a radio label, an enzyme label, a co-factor label, a fluorescent label, a paramagnetic label, a chemiluminescent label, and a metal label.
- 18. A detectably labeled nucleotide probe, comprising a first nucleotide sequence which is substantially complementary to a second nucleotide sequence that encodes the GD domain peptide.
- 19. A pharmaceutical composition comprising a GD domain peptide and a pharmaceutically acceptable carrier.
- 20. A method of identifying an agent capable of modulating GD domain mediated heterodimerization, comprising:
carrying out a heterodimerization assay which includes a first and a second protein or polypeptide comprising the GD domain, wherein said first and second protein or polypeptide are different, and an agent; determining whether said agent inhibits or augments heterodimerization of said first protein or polypeptide to said second protein or polypeptide; wherein if inhibition or augmentation of heterodimerization is determined, it indicates that said agent is capable of modulating GD domain mediated heterodimerization.
- 21. The method of claim 20, wherein said first and said second protein or polypeptide is selected from the group consisting of Bak, Bcl-xL, Bax and Bip1a.
- 22. A method of identifying an agent capable of modulating GD domain mediated homodimerization, comprising:
carrying out a homodimerization assay which includes a first and a second protein or polypeptide comprising the GD domain, wherein said first and second protein or polypeptide are the same, and an agent; determining whether said agent inhibits or augments homodimerization of said first protein or polypeptide to said second protein or polypeptide; wherein if inhibition or augmentation of homodimerization is determined, it indicates that said agent is capable of modulating GD domain mediated homodimerization.
- 23. The method of claim 22, wherein said first and second protein or polypeptide is selected from the group consisting of Bak, Bcl-xL, Bax and Bip1a.
- 24. An agent identified by the method of any of claims 20-23.
- 25. Use of an antibody against a GD domain peptide to screen a cDNA expression library for clones comprising DNA inserts encoding immunocrossreactive proteins.
- 26. An agent comprising a Bcl-2/Bcl-xL mimetic.
- 27. A peptide comprising the GD domain selected from the group consisting of QVG, PEM and derivatives of either of them.
CROSS-REFERENCE TO RELATED APPLICATIONS
[0001] This application is a continuation-in-part of U.S. patent application Ser. No. 08/908,597 filed Aug. 8, 1997, now U.S. Pat. No. 5,863,795, which is a divisional application of U.S. Ser. No. 08/440,391, filed May 12, 1995, now U.S. Pat, No. 5,656,725.
Divisions (1)
|
Number |
Date |
Country |
| Parent |
08440391 |
May 1995 |
US |
| Child |
08908597 |
Aug 1997 |
US |
Continuations (1)
|
Number |
Date |
Country |
| Parent |
09236385 |
Jan 1999 |
US |
| Child |
09828870 |
Apr 2001 |
US |
Continuation in Parts (1)
|
Number |
Date |
Country |
| Parent |
08908597 |
Aug 1997 |
US |
| Child |
09236385 |
Jan 1999 |
US |