Novel polypeptides and nucleic acids encoding same

Information

  • Patent Application
  • 20030087815
  • Publication Number
    20030087815
  • Date Filed
    February 06, 2001
    25 years ago
  • Date Published
    May 08, 2003
    23 years ago
Abstract
The present invention provides novel isolated NOVX polynucleotides and polypeptides encoded by the NOVX polynucleotides. Also provided are the antibodies that immunospecifically bind to a NOVX polypeptide or any derivative, variant, mutant or fragment of the NOVX polypeptide, polynucleotide or antibody. The invention additionally provides methods in which the NOVX polypeptide, polynucleotide and antibody are utilized in the detection and treatment of a broad range of pathological states, as well as to other uses.
Description


TECHNICAL FIELD OF THE INVENTION

[0002] The invention generally relates to nucleic acids and polypeptides encoded therefrom.



BACKGROUND OF THE INVENTION

[0003] Within the animal kingdom, odor detection is a universal tool used for social interaction, predation, and reproduction. Chemosensitivity in vertebrates is modulated by bipolar sensory neurons located in the olfactory epithelium, which extend a single, highly arborized dendrite into the mucosa while projecting axons to relay neurons within the olfactory bulb. The many ciliae on the neurons bear odorant (or olfactory) receptors (ORs), which cause depolarization and formation of action potentials upon contact with specific odorants. ORs may also function as axonal guidance molecules, a necessary function as the sensory neurons are normally renewed continuously through adulthood by underlying populations of basal cells.


[0004] The mammalian olfactory system is able to distinguish several thousand odorant molecules. Odorant receptors are believed to be encoded by an extremely large subfamily of G protein-coupled receptors. These receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are likely to underlie the recognition and G-protein-mediated transduction of odorant signals and possibly other chemosensing responses as well. The genes encoding these receptors are devoid of introns within their coding regions. Schurmans and co-workers cloned a member of this family of genes, OLFR1, from a genomic library by cross-hybridization with a gene fragment obtained by PCR. See Schurmans et al., Cytogenet. Cell Genet., 1993, 63(3):200. By isotopic in situ hybridization, they mapped the gene to 17p13-p12 with a peak at band 17p13. A minor peak was detected on chromosome 3, with a maximum in the region 3q13-q21. After MspI digestion, a restriction fragment length polymorphism (RFLP) was demonstrated. Using this in a study of 3 CEPH pedigrees, they demonstrated linkage with D17S126 at 17pter-p12; maximum lod=3.6 at theta=0.0. Used as a probe on Southern blots under moderately stringent conditions, the cDNA hybridized to at least 3 closely related genes. Ben-Arie and colleagues cloned 16 human OLFR genes, all from 17p13.3. See Ben-Arie et al., Hum. Mol. Genet., 1994, 3(2):229. The intronless coding regions are mapped to a 350-kb contiguous cluster, with an average intergenic separation of 15 kb. The OLFR genes in the cluster belong to 4 different gene subfamilies, displaying as much sequence variability as any randomly selected group of OLFRs. This suggested that the cluster may be one of several copies of an ancestral OLFR gene repertoire whose existence may have predated the divergence of mammals. Localization to 17p13.3 was performed by fluorescence in situ hybridization as well as by somatic cell hybrid mapping.


[0005] Previously, OR genes cloned in different species were from disparate locations in the respective genomes. The human OR genes, on the other hand, lack introns and may be segregated into four different gene subfamilies, displaying great sequence variability. These genes are primarily expressed in olfactory epithelium, but may be found in other chemoresponsive cells and tissues as well.


[0006] Blache and co-workers used polymerase chain reaction (PCR) to clone an intronless cDNA encoding a new member (named OL2) of the G protein-coupled receptor superfamily. See Blache et al., Biochem. Biophys. Res. Commun., 1998, 242(3):669. The coding region of the rat OL2 receptor gene predicts a seven transmembrane domain receptor of 315 amino acids. OL2 has 46.4 percent amino acid identity with OL1, an olfactory receptor expressed in the developing rat heart, and slightly lower percent identities with several other olfactory receptors. PCR analysis reveals that the transcript is present mainly in the rat spleen and in a mouse insulin-secreting cell line (MIN6). No correlation was found between the tissue distribution of OL2 and that of the olfaction-related GTP-binding protein Golf alpha subunit. These findings suggest a role for this new hypothetical G-protein coupled receptor and for its still unknown ligand in the spleen and in the insulin-secreting beta cells.


[0007] Olfactory loss may be induced by trauma or by neoplastic growths in the olfactory neuroepithelium. There is currently no treatment available that effectively restores olfaction in the case of sensorineural olfactory losses. See Harrison's Principles of Internal Medicine 14th Ed., Fauci, A S et al. (eds.), McGraw-Hill, New York, 1998, 173. There thus remains a need for effective treatment to restore olfaction in pathologies related to neural olfactory loss.



SUMMARY OF THE INVENTION

[0008] The invention is based, in part, upon the discovery of novel polynucleotide sequences encoding novel polypeptides.


[0009] Accordingly, in one aspect, the invention provides an isolated nucleic acid molecule that includes the sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, 26 or a fragment, homolog, analog or derivative thereof. The nucleic acid can include, e.g., a nucleic acid sequence encoding a polypeptide at least 85% identical to a polypeptide that includes the amino acid sequences of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, 27. The nucleic acid can be, e.g, a genomic DNA fragment, or a cDNA molecule.


[0010] Also included in the invention is a vector containing one or more of the nucleic acids described herein, and a cell containing the vectors or nucleic acids described herein.


[0011] The invention is also directed to host cells transformed with a vector comprising any of the nucleic acid molecules described above.


[0012] In another aspect, the invention includes a pharmaceutical composition that includes a NOVX nucleic acid and a pharmaceutically acceptable carrier or diluent.


[0013] In a further aspect, the invention includes a substantially purified NOVX polypeptide, e.g., any of the NOVX polypeptides encoded by an NOVX nucleic acid, and fragments, homologs, analogs, and derivatives thereof. The invention also includes a pharmaceutical composition that includes an NOVX polypeptide and a pharmaceutically acceptable carrier or diluent.


[0014] In still a further aspect, the invention provides an antibody that binds specifically to an NOVX polypeptide. The antibody can be, e.g., a monoclonal or polyclonal antibody, and fragments, homologs, analogs, and derivatives thereof. The invention also includes a pharmaceutical composition including NOVX antibody and a pharmaceutically acceptable carrier or diluent. The invention is also directed to isolated antibodies that bind to an epitope on a polypeptide encoded by any of the nucleic acid molecules described above.


[0015] The invention also includes kits comprising any of the pharmaceutical compositions described above.


[0016] The invention further provides a method for producing an NOVX polypeptide by providing a cell containing an NOVX nucleic acid, e.g., a vector that includes an NOVX nucleic acid, and culturing the cell under conditions sufficient to express the NOVX polypeptide encoded by the nucleic acid. The expressed NOVX polypeptide is then recovered from the cell. Preferably, the cell produces little or no endogenous NOVX polypeptide. The cell can be, e.g., a prokaryotic cell or eukaryotic cell.


[0017] The invention is also directed to methods of identifying an NOVX polypeptide or nucleic acid in a sample by contacting the sample with a compound that specifically binds to the polypeptide or nucleic acid, and detecting complex formation, if present.


[0018] The invention further provides methods of identifying a compound that modulates the activity of an NOVX polypeptide by contacting an NOVX polypeptide with a compound and determining whether the NOVX polypeptide activity is modified.


[0019] The invention is also directed to compounds that modulate NOVX polypeptide activity identified by contacting an NOVX polypeptide with the compound and determining whether the compound modifies activity of the NOVX polypeptide, binds to the NOVX polypeptide, or binds to a nucleic acid molecule encoding an NOVX polypeptide.


[0020] In another aspect, the invention provides a method of determining the presence of or predisposition of an NOVX-associated disorder in a subject. The method includes providing a sample from the subject and measuring the amount of NOVX polypeptide in the subject sample. The amount of NOVX polypeptide in the subject sample is then compared to the amount of NOVX polypeptide in a control sample. An alteration in the amount of NOVX polypeptide in the subject protein sample relative to the amount of NOVX polypeptide in the control protein sample indicates the subject has a tissue proliferation-associated condition. A control sample is preferably taken from a matched individual, i.e., an individual of similar age, sex, or other general condition but who is not suspected of having a tissue proliferation-associated condition. Alternatively, the control sample may be taken from the subject at a time when the subject is not suspected of having a tissue proliferation-associated disorder. In some embodiments, the NOVX is detected using an NOVX antibody.


[0021] In a further aspect, the invention provides a method of determining the presence of or predisposition of an NOVX-associated disorder in a subject. The method includes providing a nucleic acid sample, e.g., RNA or DNA, or both, from the subject and measuring the amount of the NOVX nucleic acid in the subject nucleic acid sample. The amount of NOVX nucleic acid sample in the subject nucleic acid is then compared to the amount of an NOVX nucleic acid in a control sample. An alteration in the amount of NOVX nucleic acid in the sample relative to the amount of NOVX in the control sample indicates the subject has a NOVX-associated disorder.


[0022] In a still further aspect, the invention provides a method of treating or preventing or delaying an NOVX-associated disorder. The method includes administering to a subject in which such treatment or prevention or delay is desired an NOVX nucleic acid, an NOVX polypeptide, or an NOVX antibody in an amount sufficient to treat, prevent, or delay a NOVX-associated disorder in the subject.


[0023] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In the case of conflict, the present specification, including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting.


[0024] Other features and advantages of the invention will be apparent from the following detailed description and claims.



DETAILED DESCRIPTION OF THE INVENTION

[0025] Olfactory receptors (ORs) are the largest family of G-protein-coupled receptors (GPCRs) and belong to the first family (Class A) of GPCRs, along with catecholamine receptors and opsins. The OR family contains over 1,000 members that traverse the phylogenetic spectrum from C. elegans to mammals. ORs most likely emerged from prototypic GPCRs several times independently, extending the structural diversity necessary both within and between species in order to differentiate the multitude of ligands. Individual olfactory sensory neurons are predicted to express a single, or at most a few, ORs. All ORs are believed to contain seven α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. The pocket of OR ligand binding is expected to be between the second and sixth transmembrane domains of the proteins. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%, and genes greater than 80% identical to one another at the amino acid level are considered to belong to the same subfamily.


[0026] Since the first ORs were cloned in 1991, outstanding progress has been made into their mechanisms of action and potential dysregulation during disease and disorder. It is understood that some human diseases result from rare mutations within GPCRs. Drug discovery avenues could be used to produce highly specific compounds on the basis of minute structural differences of OR subtypes, which are now being appreciated with in vivo manipulation of OR levels in transgenic and knock-out animals. Furthermore, due to the intracellular homogeneity and ligand specificity of ORs, renewal of specific odorant-sensing neurons lost in disease or disorder is possible by the introduction of individual ORs into basal cells. Additionally, new therapeutic strategies may be elucidated by further study of so-called orphan receptors, whose ligand(s) remain to be discovered.


[0027] OR proteins bind odorant ligands and transmit a G-protein-mediated intracellular signal, resulting in generation of an action potential. The accumulation of DNA sequences of hundreds of OR genes provides an opportunity to predict features related to their structure, function and evolutionary diversification. See Pilpel Y, et.al., Essays Biochem 1998;33:93-104. The OR repertoire has evolved a variable ligand-binding site that ascertains recognition of multiple odorants, coupled to constant regions that mediate the cAMP-mediated signal transduction. The cellular second messenger underlies the responses to diverse odorants through the direct gating of olfactory-specific cation channels. This situation necessitates a mechanism of cellular exclusion, whereby each sensory neuron expresses only one receptor type, which in turn influences axonal projections. A ‘synaptic image’ of the OR repertoire thus encodes the detected odorant in the central nervous system.


[0028] The ability to distinguish different odors depends on a large number of different odorant receptors (ORs). ORs are expressed by nasal olfactory sensory neurons, and each neuron expresses only 1 allele of a single OR gene. In the nose, different sets of ORs are expressed in distinct spatial zones. Neurons that express the same OR gene are located in the same zone; however, in that zone they are randomly interspersed with neurons expressing other ORs. When the cell chooses an OR gene for expression, it may be restricted to a specific zonal gene set, but it may select from that set by a stochastic mechanism. Proposed models of OR gene choice fall into 2 classes: locus-dependent and locus-independent. Locus-dependent models posit that OR genes are clustered in the genome, perhaps with members of different zonal gene sets clustered at distinct loci. In contrast, locus-independent models do not require that OR genes be clustered.


[0029] OR genes have been mapped to 11 different regions on 7 chromosomes. These loci lie within paralogous chromosomal regions that appear to have arisen by duplications of large chromosomal domains followed by extensive gene duplication and divergence. Studies have shown that OR genes expressed in the same zone map to numerous loci; moreover, a single locus can contain genes expressed in different zones. These findings raised the possibility that OR gene choice is locus-independent or involved consecutive stochastic choices.


[0030] Issel-Tarver and Rine (1996) characterized 4 members of the canine olfactory receptor gene family. The 4 subfamilies comprised genes expressed exclusively in olfactory epithelium. Analysis of large DNA fragments using Southern blots of pulsed field gels indicated that subfamily members were clustered together, and that two of the subfamilies were closely linked in the dog genome. Analysis of the four olfactory receptor gene subfamilies in 26 breeds of dog provided evidence that the number of genes per subfamily was stable in spite of differential selection on the basis of olfactory acuity in scent hounds, sight hounds, and toy breeds.


[0031] Issel-Tarver and Rine (1997) performed a comparative study of four subfamilies of olfactory receptor genes first identified in the dog to assess changes in the gene family during mammalian evolution, and to begin linking the dog genetic map to that of humans. These four families were designated by them OLF1, OLF2, OLF3, and OLF4 in the canine genome. The subfamilies represented by these four genes range in size from 2 to 20 genes. They are all expressed in canine olfactory epithelium but were not detectably expressed in canine lung, liver, ovary, spleen, testis, or tongue. The OLF1 and OLF2 subfamilies are tightly linked in the dog genome and also in the human genome. The smallest family is represented by the canine OLF1 gene. Using dog gene probes individually to hybridize to Southern blots of genomic DNA from 24 somatic cell hybrid lines. They showed that the human homologous OLF1 subfamily maps to human chromosome 11. The human gene with the strongest similarity to the canine OLF2 gene also mapped to chromosome 11. Both members of the human subfamily that hybridized to canine OLF3 were located on chromosome 7. It was difficult to determine to which chromosome or chromosomes the human genes that hybridized to the canine OLF4 probe mapped. This subfamily is large in mouse and hamster as well as human, so the rodent background largely obscured the human cross-hybridizing bands. It was possible, however, to discern some human-specific bands in blots corresponding to human chromosome 19. They refined the mapping of the human OLF1 homolog by hybridization to YACs that map to 11 q11. In dogs, the OLF1 and OLF2 subfamilies are within 45 kb of one another (Issel-Tarver and Rine (1996)).


[0032] Issel-Tarver and Rine (1997) demonstrated that in the human OLF1 and OLF2 homologs are likewise closely linked. By studying YACs, Issel-Tarver and Rine (1997) found that the human OLF3 homolog maps to 7q35. A chromosome 19-specific cosmid library was screened by hybridization with the canine OLF4 gene probe, and clones that hybridized strongly to the probe even at high stringency were localized to 19p13.1 and 19p13.2. These clones accounted, however, for a small fraction of the homologous human bands.


[0033] Rouquier et al. (1998) demonstrated that members of the olfactory receptor gene family are distributed on all but a few human chromosomes. Through fluorescence in situ hybridization analysis, they showed that OR sequences reside at more than 25 locations in the human genome. Their distribution was biased for terminal bands of chromosome arms. Flow-sorted chromosomes were used to isolate 87 OR sequences derived from 16 chromosomes. Their sequence relationships indicated the inter- and intrachromosomal duplications responsible for OR family expansion. Rouquier et al. (1998) determined that the human genome has accumulated a striking number of dysfunctional copies: 72% of these sequences were found to be pseudogenes. ORF-containing sequences predominate on chromosomes 7, 16, and 17.


[0034] Trask et al. (1998) characterized a subtelomeric DNA duplication that provided insight into the variability, complexity, and evolutionary history of that unusual region of the human genome, the telomere. Using a DNA segment cloned from chromosome 19, they demonstrated that the blocks of DNA sequence shared by different chromosomes can be very large and highly similar. Three chromosomes appeared to have contained the sequence before humans migrated around the world. In contrast to its multicopy distribution in humans, this subtelomeric block maps predominantly to a single locus in chimpanzee and gorilla, that site being nonorthologous to any of the locations in the human genome. Three new members of the olfactory receptor (OR) gene family were found to be duplicated within this large segment of DNA, which was found to be present at 3q, 15q, and 19p in each of 45 unrelated humans sampled from various populations. From its sequence, one of the OR genes in this duplicated block appeared to be potentially functional. The findings raised the possibility that functional diversity in the OR family is generated in part through duplications and interchromosomal rearrangements of the DNA near human telomeres.


[0035] Mombaerts (1999) reviewed the molecular biology of the odorant receptor (OR) genes in vertebrates. Buck and Axel (1991) discovered this large family of genes encoding putative odorant receptor genes. Zhao et al. (1998) provided functional proof that one OR gene encodes a receptor for odorants. The isolation of OR genes from the rat by Buck and Axel (1991) was based on three assumptions. First, ORs are likely G protein-coupled receptors, which characteristically are 7-transmembrane proteins. Second, ORs are likely members of a multigene family of considerable size, because an immense number of chemicals with vastly different structures can be detected and discriminated by the vertebrate olfactory system. Third, ORs are likely expressed selectively in olfactory sensory neurons. Ben-Arie et al. (1994) focused attention on a cluster of human OR genes on 17p, to which the first human OR gene, OR1D2, had been mapped by Schurmans et al. (1993). According to Mombaerts (1999), the sequences of more than 150 human OR clones had been reported.


[0036] The human OR genes differ markedly from their counterparts in other species by their high frequency of pseudogenes, except the testicular OR genes. Research showed that individual olfactory sensory neurons express a small subset of the OR repertoire. In rat and mouse, axons of neurons expressing the same OR converge onto defined glomeruli in the olfactory bulb.


[0037] OR proteins bind odorant ligands and transmit a G-protein-mediated intracellular signal, resulting in generation of an action potential. The accumulation of DNA sequences of hundreds of OR genes provides an opportunity to predict features related to their structure, function and evolutionary diversification. The OR repertoire has evolved a variable ligand-binding site that ascertains recognition of multiple odorants, coupled to constant regions that mediate the cAMP-mediated signal transduction. The cellular second messenger underlies the responses to diverse odorants through the direct gating of olfactory-specific cation channels. This situation necessitates a mechanism of cellular exclusion, whereby each sensory neuron expresses only one receptor type, which in turn influences axonal projections. A ‘synaptic image’ of the OR repertoire thus encodes the detected odorant in the central nervous system. See Pilpel et al., Curr Opin Neurobiol 1999 August;9(4):419-26 (PMID: 10488444, UI: 99418068).


[0038] The odorant-induced Ca(2+) increase inside the cilia of vertebrate olfactory sensory neurons controls both excitation and adaptation. The increase in the internal concentration of Ca(2+) in the cilia has recently been visualized directly and has been attributed to Ca(2+) entry through cAMP-gated channels. These recent results have made it possible to further characterize Ca(2+)'s activities in olfactory neurons. Ca(2+) exerts its excitatory role by directly activating Cl(−) channels. Given the unusually high concentration of ciliary Cl(−), Ca(2+)'s activation of Cl(−) channels causes an efflux of Cl(−) from the cilia, contributing high-gain and low-noise amplification to the olfactory neuron depolarization. Moreover, in combination with calmodulin, Ca(2+) mediates odorant adaptation by desensitizing cAMP-gated channels. The restoration of the Ca(2+) concentration to basal levels occurs via a Na(+)/Ca(2+) exchanger, which extrudes Ca(2+) from the olfactory cilia. See Menini, Cell Mol Biol (Noisy-le-grand) 1999 May;45(3):285-91 (PMID: 10448159, UI: 99379989).


[0039] The olfactory epithelium is unique in the mammalian nervous system as it is a site of continual neurogenesis. Constant turnover of primary sensory neurons in the periphery results in continuous remodeling of neuronal circuits and synapses in the olfactory bulb throughout life. Most of the specific mechanisms and factors that control and modulate this process are not known. Recent studies suggest that growth factors, and their receptors, may play a crucial role in the development and continuous regeneration of olfactory neurons, i.e. particularly in neuronal proliferation, neurite outgrowth, fasciculation and synapse formation of the olfactory system. The potential role of the following factors and their receptors in different species are reviewed: Nerve growth factor (NGF); insulin-like growth factors (IGFs); fibroblast growth factors (FGFs); epidermal growth factor (EGF); transforming growth factor alpha (TGF alpha); amphiregulin (AR) and transforming growth factors beta (TGFs beta). See Plendl et al., Biochemistry (Mosc) 2000 July;65(7):824-33 (PMID: 10385999, UI: 99313777).


[0040] An important recent advance in the understanding of odor adaptation has come from the discovery that complex mechanisms of odor adaptation already take place at the earliest stage of the olfactory system, in the olfactory cilia. At least two rapid forms and one persistent form of odor adaptation coexist in vertebrate olfactory receptor neurons. These three different adaptation phenomena can be dissected on the basis of their different onset and recovery time courses and their pharmacological properties, indicating that they are controlled, at least in part, by separate molecular mechanisms. Evidence is provided for the involvement of distinct molecular steps in these forms of odor adaptation, including Ca(2+) entry through cyclic nucleotide-gated (CNG) channels, Ca(2+)-dependent CNG channel modulation, Ca(2+)/calmodulin kinase II-dependent attenuation of adenylyl cyclase, and the activity of the carbon monoxide/cyclic GMP second messenger system. Identification of these molecular steps may help to elucidate how the olfactory system extracts temporal and intensity information and to which extent odor perception is influenced by the different mechanisms underlying adaptation. See Zufall et al., Comp Biochem Physiol A Mol Integr Physiol 2000 May;126(1):17-32 (PMID: 10944513).


[0041] Since the discovery of odorant-activated adenylate cyclase in the olfactory receptor cilia, research into the olfactory perception of vertebrates has rapidly expanded. Recent studies have shown how the odor discrimination starts at the receptor level: each of 700-1000 types of the olfactory neurons in the neural olfactory epithelium contains a single type of odor receptor protein. Although the receptors have relatively low specific affinities for odorants, excitation of different types of receptors forms an excitation pattern specific to each odorant in the glomerular layer of the olfactory bulb. It was demonstrated that adenosine 3′,5′-cyclic monophosphate (cAMP) is very likely the sole second messenger for olfactory transduction. It was also demonstrated that the affinity of the cyclic nucleotide-gated channel for cAMP regulated by Ca(2+)/calmodulin is solely responsible for the adaptation of the cell. However, many other regulatory components were found in the transduction cascade. Regulated by Ca(2+) and/or the protein-phosphorylation, many of them may serve for the adaptation of the cell, probably on a longer time scale. It may be important to consider the resensitization as a part of this adaptation, as well as to collect kinetic data of each reaction to gain further insight into the olfactory mechanism. See Nakamura, J Soc Biol 1999;193(1):35-40 (PMID: 10908849, UI: 20371128).


[0042] The olfactory epithelium (OE) of the mammal is uniquely suited as a model system for studying how neurogenesis and cell death interact to regulate neuron number during development and regeneration. To identify factors regulating neurogenesis and neuronal death in the OE, and to determine the mechanisms by which these factors act, investigators studied OE using two major experimental paradigms: tissue culture of OE; and ablation of the olfactory bulb or severing the olfactory nerve in adult animals, procedures that induce cell death and a subsequent surge of neurogenesis in the OE in vivo. These studies characterized the cellular stages in the olfactory receptor neuron (ORN) lineage, leading to the realization that at least three distinct stages of proliferating neuronal precursor cells are employed in generating ORNs. The identification of a number of factors that act to regulate proliferation and survival of ORNs and their precursors suggests that these multiple developmental stages may serve as control points at which cell number is regulated by extrinsic factors. In vivo surgical studies, which have shown that all cell types in the neuronal lineage of the OE undergo apoptotic cell death, support this idea. These studies, and the possible coregulation of neuronal birth and apoptosis in the OE, are discussed. See Calof et al., Ciba Found Symp 1996;196:188-205; discussion; 205-10 (PMID: 8727984, UI: 96284837)


[0043] To identify factors regulating neurogenesis and neuronal death in mammals and to determine the mechanisms by which these factors act, researchers studied mouse olfactory epithelium using two different experimental paradigms: tissue culture of olfactory epithelium purified from mouse embryos; and ablation of the olfactory bulb in adult mice, a procedure that induces olfactory receptor neuron (ORN) death and neurogenesis in vivo. Studies of olfactory epithelium cultures have allowed the characterization of the cellular stages in olfactory neurogenesis and to identify factors regulating proliferation and differentiation of precursor cells in the ORN lineage. Studies of adult olfactory epithelium determined that all cell types in this lineage-proliferating neuronal precursors, immature ORNs and mature ORNs-undergo cell death following olfactory bulb ablation and that this death has characteristics of programmed cell death or apoptosis. In vitro studies have confirmed that neuronal cells of the olfactory epithelium undergo apoptotic death and have permitted identification of several polypeptide growth factors that promote survival of a fraction of ORNs. Using this information, researchers have begun to explore whether these factors, as well as genes known to play crucial roles in cell death in other systems, function to regulate apoptosis and neuronal regeneration in the adult olfactory epithelium following lesion-induced ORN death. PMID: 8866135, UI: 97019661


[0044] The present invention provides novel nucleotides and polypeptides encoded thereby. Included in the invention are the novel nucleic acid sequences and their polypeptides. The sequences are collectively referred to as “NOVX nucleic acids” or “NOVX polynucleotides” and the corresponding encoded polypeptides are referred to as “NOVX polypeptides” or “NOVX proteins.” Unless indicated otherwise, “NOVX” is meant to refer to any of the novel sequences disclosed herein. Table 1 provides a summary of the NOVX nucleic acids and their encoded polypeptides. Example 1 provides a description of how the novel nucleic acids were identified.
1TABLE 1Sequences and Corresponding SEQ ID NumbersSEQ ID NONOVXInternal(nucleicSEQ ID NOAssignmentIdentificationacid)(polypeptide)Homology1AL135841_B12OR GPCR2AL135841_B34OR GPCR3ba521115_2000085Same as 4OR GPCR04_da14AL135841_A67OR GPCR5AC0170103_A89OR GPCR6AC0170103A_da11011OR GPCR7AL135784_B1213OR GPCR8AL135784_A1415OR GPCR9AC135784B1617OR GPCR10AC020679_B1819OR GPCR11AC020679_A2021OR GPCR12ba113a10_da42223OR GPCR13CG53935-022425OR GPCR14AL135841_da12627OR GPCR


[0045] Where OR GPCR is an odorant receptor of the G-protein coupled-receptor family.


[0046] NOVX nucleic acids and their encoded polypeptides are useful in a variety of applications and contexts. The various NOVX nucleic acids and polypeptides according to the invention are useful as novel members of the protein families according to the presence of domains and sequence relatedness to previously described proteins. Additionally, NOVX nucleic acids and polypeptides can also be used to identify proteins that are members of the family to which the NOVX polypeptides belong.


[0047] For example, NOV1-14 are homologous to members of the odorant receptor (OR) family of the human G-protein coupled receptor (GPCR) superfamily of proteins, as shown in Table 52. Thus, the NOV1-14 nucleic acids and polypeptides, antibodies and related compounds according to the invention will be useful in therapeutic and diagnostic applications in disorders of olfactory loss, e.g., trauma, HIV illness, neoplastic growth and neurological disorders e.g. Parkinson's disease and Alzheimer's disease.


[0048] The NOVX nucleic acids and polypeptides can also be used to screen for molecules, which inhibit or enhance NOVX activity or function. Specifically, the nucleic acids and polypeptides according to the invention may be used as targets for the identification of small molecules that modulate or inhibit, e.g., neurogenesis, cell differentiation, cell motility, cell proliferation and angiogenesis.


[0049] Additional utilities for the NOVX nucleic acids and polypeptides according to the invention are disclosed herein.


[0050] NOV1


[0051] A NOV1 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV1 nucleic acid and its encoded polypeptide includes the sequences shown in Table 2. The disclosed nucleic acid (SEQ ID NO:1) is 1,050 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 59-61 and ends with a TAA stop codon at nucleotides 995-997. The representative ORF encodes a 312 amino acid polypeptide (SEQ ID NO:2). Putative untranslated regions upstream and downstream of the coding sequence are underlined in SEQ ID NO: 1.
2TABLE 2CCCTGTACCCTCTCTCCTTCCATCCCAGCTGTGGACCATCTCTTCAGAACTCTGCAGC(SEQ ID NO. 1)ATGGAGCCGCTCAACAGAACAGAGGTGTCCGAGTTCTTTCTGAAAGGATTTTCTGGCTACCCAGCCCTGGAGCATCTGCTCTTCCCTCTGTGCTCAGCCATGTACCTGGTGACCCTCCTGGGGAACACAGCCATCATGGCGGTGAGCGTGCTAGATATCCACCTGCACACGCCCGTGTACTTCTTCCTGGGCAACCTCTCTACCCTGGACATCTGCTACACGCCCACCTTTGTGCCTCTGATGCTGGTCCACCTCCTGTCATCCCGGAAGACCATCTCCTTTGCTGTCTGTGCCATCCAGATGTGTCTGAGCCTGTCCACGGGCTCCACGGAGTGCCTGCTACTGGCCATCACGGCCTATGACCGCTACCTGGCCATCTGCCAGCCACTCAGGTACCACGTGCTCATGAGCCACCGGCTCTGCGTGCTGCTGATGGGAGCTGCCTGGGTCCTCTGCCTCCTCAAGTCGGTGACTGAGATGGTCATCTCCATGAGGCTGCCCTTCTGTGGCCACCACGTGGTCAGTCACTTCACCTGCAAGATCCTGGCAGTGCTGAAGCTGGCATGCGGCAACACGTCGGTCAGCGAAGACTTCCTGCTGGCGGGCTCCATCCTGCTGCTGCCTGTACCCCTGGCATTCATCTGCCTGTCCTACTTGCTCATCCTGGCCACCATCCTGAGGGTGCCCTCGGCCGCCAGGTGCTGCAAAGCCTTCTCCACCTGCTTGGCACACCTGGCTGTAGTGCTGCTTTTCTACGGCACCATCATCTTCATGTACTTGAAGCCCAAGAGTAAGGAAGCCCACATCTCTGATGAGGTCTTCACAGTCCTCTATGCCATGGTCACGACCATGCTGAACCCCACCATCTACAGCCTGAGGAACAAGGAGGTGAAGGAGGCCGCCAGGAAGGTGTGGGGCAGGAGTCGGGCCTCCAGGTGAGGGAGGGCGGGGCTCTGTACAGACGCAGGTCTCAGGTTAGTAGCTGAGGCCATMEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVLDIHLHTPNY(SEQ ID NO. 2)FFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITAYDRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRILPFCGHHVVSHFTCKILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSAARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVFTVLYAMVTTMLNPTIYSLRNKEVKVEAARKVWGRSRASR


[0052] The NOV1 nucleic acid sequence has homology (85% identity) with the mouse olfactory receptor gene cluster OR17 and OR6 (OLF) (GenBank Accession No.: AJ251155), as shown in Table 3. Also, the NOV1 polypeptide has homology (82% identity) to the mouse olfactory receptor 71 (OLF) (GenBank Accession No.: NP062359), as is shown in Table 4.


[0053] Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413.


[0054] OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV1 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of monkey (SEQ ID NO. 30) (GenBank Accession No.: AAF40368), mouse (SEQ ID NO. 31) (GenBank Accession No.: CAB55597), rat (SEQ ID NO. 32) (GenBank Accession No.: S29711), and human (SEQ ID NO. 33) (GenBank Accession No.: CAB96728), as shown in Table 5.
3TABLE 3NOV1:99tgaaaggattttctggctacccagccctggagcatctgctcttccctctgtgctcagcca158(SEQ ID No. 1)|||| ||||||||||||||||| ||||| ||||  || ||||| ||||||||||||| ||OLF:6102tgaagggattttctggctacccggccctcgagcggctactctttcctctgtgctcagtca6161(SEQ ID No. 28)NOV1:159tgtacctggtgaccctcctggggaacacagccatcatggcggtgagcgtgctagatatcc218||||||||||||| || |||||||||||||||||| ||||||||||| || | |||  ||OLF:6162tgtacctggtgactctgctggggaacacagccatcgtggcggtgagcatgttggatgccc6221NOV1:219acctgcacacgcccgtgtacttcttcctgggcaacctctctaccctggacatctgctaca278||||||||||||| ||||||| |||||||| ||||| || |   |||||||||||||||OLF:6222gcctgcacacgcccatgtactttttcctgggtaacctttccattttggacatctgctaca6281NOV1:279cgcccacctttgtgcctctgatgctggtccacctcctgtcatcccggaagaccatctcct338|  | || ||||| || ||||||||||||||||||||||| |||||||||||||||||||OLF:6282catctacttttgtacccctgatgctggtccacctcctgtcgtcccggaagaccatctcct6341NOV1:339ttgctgtctgtgccatccagatgtgtctgagcctgtccacgggctccacggagtgcctgc398|| | | ||||||| ||||||||||||||||||| |||||||||||||| ||||||||||OLF:6342ttacgggctgtgccgtccagatgtgtctgagcctctccacgggctccaccgagtgcctgc6401NOV1:399tactggccatcacggcctatgaccgctacctggccatctgccagccactcaggtaccacg458|  ||||| ||| |||||||||||||||| ||||||| ||||||||||||||||||| ||OLF:6402tgttggccgtcatggcctatgaccgctacttggccatttgccagccactcaggtaccccg6461NOV1:459tgctcatgagccaccggctctgcgtgctgctgatgggagctgcctgggtcctctgcctcc518|||||||||||||| |||||||| || |||||   |||||  ||||||| ||||||||| OLF:6462tgctcatgagccacaggctctgcctgatgctggcaggagcctcctgggtgctctgcctct6521NOV1:519tcaagtcggtgactgagatggtcatctccatgaggctgcccttctgtggccaccacgtgg578||||||| ||| | |||| ||||||| ||||||||||||||||||| |||||||||||| OLE:6522tcaagtcagtggcagagacggtcatcgccatgaggctgcccttctgcggccaccacgtga6581NOV1:579tcagtcacttcacctgcaagatcctggcagtgctgaagctggcatgcggcaacacgtcgg638|||| |||||||||||  |||||||||| |||||||||||| | || ||  |||| || |OLF:6582tcagacacttcacctgtgagatcctggctgtgctgaagctgacctgtggtgacacctcag6641NOV1:639tcagcgaagacttcctgctggcgggctccatcctgctgctgcctgtacccctggcattca698||||||| | ||||||||||| |||  ||||||| ||| ||||| |||||||| |  |||OLE:6642tcagcgatgccttcctgctggtgggggccatcctcctgttgcctatacccctgaccctca6701NOV1:699tctgcctgtcctacttgctcatcctggccaccatcctgagggtgccctcggccgccaggt758|||||||||||||| |||| ||||||||||||||||||||||||||||| ||| || || OLE:6702tctgcctgtcctacatgctgatcctggccaccatcctgagqgtgccctcagccaccgggc6761NOV1:759gctgcaaagccttctccacctgcttggcacacctggctgtagtgctgcttttctacggca818|| ||||||||||||||||||||| ||||||||||||||| || |||||||||||  |||OLE:6762gcagcaaagccttctccacctgctcggcacacctggctgttgtcctgcttttctatagca6821NOV1:819ccatcatcttcatgtacttgaagcccaagagtaaggaagcccacatctctgatgaggtct878| ||||||||||||||| |||| |||||||| ||||||||||  ||||| ||  ||||||OLE:6822ctatcatcttcatgtacatgaaacccaagagcaaggaagcccggatctcagaccaggtct6881NOV1:879tcacagtcctctatgccatggtcacgaccatgctgaaccccaccatctacagcctgagga938| ||||||||||| ||  |||| ||  |||||||||||||||  ||||||||||||||||OLE:6882ttacagtcctctacgctgtggtgacccccatgctgaaccccattatctacagcctgagga6941NOV1:939acaaggaggtgaaggaggccgccaggaaggtgtggggcaggagtcgggcctccaggtgag998|||||||||||||||| || |||||||| |  |||||||| ||  ||||||  |||||||OLE:6942acaaggaggtgaaggaagcggccaggaaagcttggggcagcagatgggcctgtaggtgag7001NOV1:999ggagggcggggctctg1014||||||| ||||||||OLE:7002ggagggcagggctctg7017


[0055]

4









TABLE 4










NOV1:
1
MEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVLDIHLHTPVY
60
(SEQ ID No. 2)




MEP NRT VSEF LKGFSGYPALE LLFPLCS MYLVTLLGNTAI+AVS+LD  LHTP+Y


OLF:
1
MEPSNRTAVSEFVLKGFSGYPALERLLFPLCSVMYLVTLLGNTAIVAVSMLDARLHTPMY
60
(SEQ ID No. 29)





NOV1:
61
FFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITAY
120




FFLGNLS LDICYT TFVPLMLVHLLSSRKTISF  CA+QMCLSLSTGSTECLLLA+ AY


OLF:
61
FFLGNLSILDICYTSTFVPLMLVHLLSSRKTISFTGCAVQMCLSLSTGSTECLLLAVMAY
120





NOV1:
121
DRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGHHVVSHFTCK
180




DRYLAICQPLRY VLMSHRLC++L GA+WVLCL KSV E VI+MRLPFCGHHV+ HFTC+


OLF:
121
DRYLAICQPLRYPVLMSHRLCLMLAGASWVLCLFKSVAETVIAMRLPFCGHHVTRHFTCE
180





NOV1:
181
ILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSAARCCKAFST
240




ILAVLKL CG+TSVS+ FLL G+ILLLP+PL  ICLSY+LILATILRVPSA    KAFST


OLF:
181
ILAVLKLTCGDTSVSDAFLLVGAILLLPIPLTLICLSYMLILATILRVPSATGRSKAFST
240





NOV1:
241
CLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVFTVLYAMVTTMLNPTIYSLRNKEVKEA
300




C AHLAVVLLFY TIIFMY+KPKSKEA ISD+VFTVLYA+VT MLNP IYSLRNKEVKEA


OLF:
241
CSAHLAVVLLFYSTIIFMYMKPKSKEARISDQVFTVLYAVVTPMLNPIIYSLRNKEVKEA
300





NOV1:
301
ARKVWGRSRASR
312




ARK WG   A R


OLF:
301
ARKAWGSRWACR
312






Where “+” denotes similarity.








[0056]

5







TABLE 5










macaca_OLF
 ------------------------------------------------------------
(SEQ ID No. 30)


NOV1
 MEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVLDIHLHTPVY
(SEQ ID No. 2)


Mouse_OLF
 MEPSNRTAVSEFVLKGFSGYPALERLLFPLCSVMYLVTLLGNTAIVAVSMLDARLHTPMY
(SEQ ID No. 31)


Rat_OLF
 ------------LLLGLSGYPKTEILYFVIVLVMYLVIHTGNGVLIIASIFDSHLHTPMY
(SEQ ID No. 32)


Human_OLF
 ---------MGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMY
(SEQ ID No. 33)





macaca_OLF
 ------------------------------------------------------------


NOV1
FFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITAY


Mouse_OLF
 FFLGNLSILDICYTSTFVPLMLVHLLSSRKTISFTGCAVQMCLSLSTGSTECLLLAVMAY


Rat_OLF
 FFLGNLSFLDTCYTTSSVPSTLVSLISKKRNISFSGCTVQMFVGFAMGSTECLLLGMMAF


Human OLF
 FFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAF





macaca_OLF
 ---PAICQPLRYRVLMNHRLCVLLVGAAWVLCLLKSVTETVIAMRLPFCGHEVVSHFTCE


NOV1
 DRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGHHVVSHFTCK


Mouse_OLF
 DRYLAICQPLRYPVLMSHRLCLMLAGASWVLCLFKSVAETVIAMRLPFCGHHVIRHFTCE


Rat_OLF
 DRYVAICNPLRYSVIMSKEVYVSMASASWFSGGINSVVQTSLAMRLPFCGNNVINHFTCE


Human OLF
 DRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCE



     ***:**** *:*.:   : : .::*      **..  ::::*****.:*: ****:





macaca_OLF
 ILAVLKLTCGNTSVSEVFLLVGSILLLPVPLAFICLSYLLILATILRVPSAAGCRKAFST


NOV1
 ILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSAARCCKAFST


Mouse_OLF
 ILAVLKLTCGDTSVSDAFLLVGAILLLPIPLTLICLSYMLILATILRVPSATGRSKAFST


Rat_OLF
 VLAVLKLACADISLNIVTMVISNMAFLVLPLLLIFFSYVLILYTILRMNSASGRRKAFST


Human_OLF
 ILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVPST



 :******:*.:* :.   :    : :* :*: :* :**::*: ****: **    *.***





macaca_OLF
 CSAHLAVVLLFYSTIIFTYMKPKSKE------AHISDEVFTVLYAMVTPML---------


NOV1.
 CLAHLAVVLLFYGTIIFMYLKPKSKE------AHISDEVFTVLYAMVTTMLNPTIYSLRN


Mouse_OLF
 CSAHLAVVLLFYSTITFMYMKPKSKE------ARISDQVFTVLYAVVTPMLNPIIYSLRN


Rat_OLF
 CSAHLTVVVIFYGTTFSMYAKPKSQDLTGKDKFQTSDKITSLFYGVVTPMLNPIIYSLRN


Human_OLF
 CSAHLTVVIVFYGTIFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRN



 * ***:**::**.*::  * ****::         **:::.::*.:**.**         





macaca_OLF
 ------------------


NOV1
 KEVKEAARKVWGRSRASR


Mouse_OLF
 KEVKEAARKAWGSRWACR


Rat_OLF
 KDVKAAVKYILKQKYIP-


Human_OLF
 KDVKAAVRRLLRPKGFTQ






Consensus key



*—single, fully conserved residue


:—conservation of strong groups


.—conservation of weak groups - no consensus







[0057] Because the OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade, NOV1 can be used to detect nasal epithelial neuronal tissue.


[0058] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV1 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0059] NOV2


[0060] A NOV2 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. The NOV1 nucleic acid sequence (SEQ ID No.: 1) was further analyzed by exon linking and the resulting sequence was identified as NOV2. A NOV2 nucleic acid and its encoded polypeptide includes the sequences shown in Table 6. The disclosed nucleic acid (SEQ ID NO:3) is 1,050 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 59-61 and ends with a TGA stop codon at nucleotides 995-997. The representative ORF encodes a 312 amino acid polypeptide (SEQ ID NO:4). Putative untranslated regions upstream and downstream of the coding sequence are underlined in SEQ ID NO: 3.
6TABLE 6CCCTGTACCCTCTCTCCTTCCATCCCAGCTGTGGACCATCTCTTCAGAACTCTGCAGC(SEQ ID NO. 3)ATGGAGCCGCTCAACAGAACAGAGGTGTCCGAGTTCTTTCTGAAAGGATTTTCTGGCTACCCAGCCCTGGAGCATCTGCTCTTCCCTCTGTGCTCAGCCATGTACCTGGTGACCCTCCTGGGGAACACAGCCATCATGGCGGTGAGCGTGCTAGATATCCACCTGCACACGCCCGTGTACTTCTTCCTGGGCAACCTCTCTACCCTGGACATCTGCTACACGCCCACCTTTGTGCCTCTGATGCTGGTCCACCTCCTGTCATCCCGGAAGACCATCTCCTTTGCTGTCTGTGCCATCCAGATGTGTCTGAGCCTGTCCACGGGCTCCACGGAGTGCCTGCTACTGGCCATCACGGCCTATGACCGCTACCTGGCCATCTGCCAGCCACTCAGGTACCACGTGCTCATGAGCCACCGGCTCTGCGTGCTGCTGATGGGAGCTGCCTGGGTCCTCTGCCTCCTCAAGTCGGTGACTGAGATGGTCATCTCCATGAGGCTGCCCTTCTGTGGCCACCACGTGGTCAGTCACTTCACCTGCAAGATCCTGGCAGTGCTGAAGCTGGCATGCGGCAACACGTCGGTCAGCGAAGACTTCCTGCTGGCGGGCTCCATCCTGCTGCTGCCTGTACCCCTGGCATTCATCTGCCTGTCCTACTTGCTCATCCTGGCCACCATCCTGAGGGTGCCCTCGGCCGCCAGGTGCTGCAAAGCCTTCTCCACCTGCTTGGCACACCTGGCTGTAGTGCTGCTTTTCTACGGCACCATCATCTTCATGTACTTGAAGCCCAAGAGTAAGGAAGCCCACATCTCTGATGAGGTCTTCACAGTCCTCTATGCCATGGTCACGACCATGCTGAACCCCACCATCTACAGCCTGAGGAACAAGGAGGTGAAGGAGGCCGCCAGGAAGGTGTGGGGCAGGAGTCGGGCCTCCAGGTGAGGGAGGGCGGGGCTCTGTACAGACGCAGGTCTCAGGTTAGTAGCTGAGGCCATMEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVLDIHLHTPVY(SEQ ID NO. 4)FFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITAYDRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGHHVVSHFTCKILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSAARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVFTVLYAMVTTMLNPTLYSLRNKEVKEAARKVWGRSRASR


[0061] The target sequence previously identified, Accession Number AL135841 was subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding seuqnce, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such suitable sequences were then employed as the forward and reverse primers in a PCR amplification based on a wide range of cDNA libraries. The resulting amplicon was gel purified, clone, and sequenced to high redundancy to provide the sequence reported as NOV2.


[0062] The NOV2 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0063] The NOV2 nucleic acid sequence has homology (86% identity) with the mouse olfactory receptor gene cluster, OR17 and OR6 (OLF) (GenBank Accession No.: AJ251155), as shown in Table 7. Additionally, the NOV2 polypeptide has a high degree of homology (approximately 82% identity) to the mouse olfactory receptor 71 (OLF) (GenBank Accession No.: NP062359), as shown in Table 8. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413.


[0064] OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, along with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV2 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of monkey (SEQ ID NO. 30) (GenBank Accession No.: AAF40368), mouse (SEQ ID NO. 31) (GenBank Accession No.: CAB55597), rat (SEQ ID NO. 32) (GenBank Accession No.: S29711), and human (SEQ ID NO. 33) (GenBank Accession No.: CAB96728), as shown in Table 9.
7TABLE 7NOV2:99tgaaaggattttctggctacccagccctggagcatctgctcttccctctgtgctcagcca158(SEQ ID No. 3)|||| ||||||||||||||||| ||||| ||||  || ||||| ||||||||||||| ||OLF:6102tgaagggattttctggctacccggccctcgagcggctactctttcctctgtgctcagtca6161(SEQ ID No. 28)NOV2:159tgtacctggtgaccctcctggggaacacagccatcatggcggtgagcgtgctagatatcc218||||||||||||| || |||||||||||||||||| ||||||||||| || | |||  ||OLF:6162tgtacctggtgactctgctggggaacacagccatcgtggcggtgagcatgttggatgccc6221NOV2:219acctgcacacgcccgtgtacttcttcctgggcaacctctctaccctggacatctgctaca278 ||||||||||||| ||||||| |||||||| ||||| || |   |||||||||||||||OLF:6222gcctgcacacgcccatgtactttttcctgggtaacctttccattttggacatctgctaca6281NOV2:279cgcccacctttgtgcctctgatgctggtccacctcctgtcatcccggaagaccatctcct338|  | || ||||| || ||||||||||||||||||||||| |||||||||||||||||||OLF:6282catctacttttgtacccctgatgctggtccacctcctgtcgtcccggaagaccatctcct6341NOV2:339ttgctgtctgtgccatccagatgtgtctgagcctgtccacgggctccacggagtgcctgc398|| | | ||||||| ||||||||||||||||||| |||||||||||||| ||||||||||OLF:6342ttacgggctgtgccgtccagatgtgtctgagcctctccacgggctccaccgagtgcctgc6401NOV2:399tactggccatcacggcctatgaccgctacctggccatctgccagccactcaggtaccacg458|  ||||| ||| ||||||||||||||| |||||||| ||||||||||||||||||| ||OLF:6402tgttggccgtcatggcctatgaccgctacttggccatttgccagccactcaggtaccccg6461NOV2:459tgctcatgagccaccggctctgcgtgctgctgatgggagctgcctgggtcctctgcctcc518 |||||||||||||| |||||||| || |||||   |||||  ||||||| |||||||||OLF:6462tgctcatgagccacaggctctgcctgatgctggcaggagcctcctgggtgctctgcctct6521NOV2:519tcaagtcggtgactgagatggtcatctccatgaggctgcccttctgtggccaccacgtgg578 ||||||| ||| | |||| ||||||| ||||||||||||||||||| ||||||||||||OLF:6522tcaagtcagtggcagagacggtcatcgccatgaggctgcccttctgcggccaccacgtga6581NOV2:579tcagtcacttcacctgcaagatcctggcagtgctgaagctggcatgcggcaacacgtcgg638|||| ||||||||||| |||||||||| |||||||||||| | || ||  |||| ||  |OLF:6582tcagacacttcacctgtgagatcctggctgtgctgaagctgacctgtggtgacacctcag6641NOV2:639tcagcgaagacttcctgctggcgggctccatcctgctgctgcctgtacccctggcattca698||||||| | ||||||||||| |||  ||||||| ||| ||||| |||||||| |  |||OLF:6642tcagcgatgccttcctgctggtgggggccatcctcctgttgcctatacccctgaccctca6701NOV2:699tctgcctgtcctacttgctcatcctggccaccatcctgagggtgccctcggccgccaggt758|||||||||||||| |||| ||||||||||||||||||||||||||||| ||| || ||OLF:6702tctgcctgtcctacatgctgatcctggccaccatcctgagggtgccctcagccaccgggc6761NOV2:59gctgcaaagccttctccacctgcttggcacacctggctgtagtgctgcttttctacggca818|| ||||||||||||||||||||| ||||||||||||||| || |||||||||||  |||OLF:6762gcagcaaagccttctccacctgctcggcacacctggctgttgtcctgcttttctatagca6821NOV2:819ccatcatcttcatgtacttgaagcccaagagtaaggaagcccacatctctgatgaggtct878| ||||||||||||||| |||| |||||||| ||||||||||  ||||| ||  ||||||OLF:6822ctatcatcttcatgtacatgaaacccaagagcaaggaagcccggatctcagaccaqgtct6881NOV2:879tcacagtcctctatgccatggtcacgaccatgctgaaccccaccatctacagcctgagga938| ||||||||||| ||  |||| ||  |||||||||||||||  ||||||||||||||||OLF:6882ttacagtcctctacgctgtggtgacccccatgctgaaccccattatctacagcctgagga6941NOV2:939acaaggaggtgaaggaggccgccaggaaggtgtggggcaggagtcgggcctccaggtgag998|||||||||||||||| || |||||||| |  |||||||| ||  ||||||  |||||||OLF:6942acaaggaggtgaaggaagcggccaggaaagcttggggcagcagatgggcctgtaggtgag7001NOV2:999ggagggcggggctctg1014||||||| ||||||||OLF:7002ggagggcagggctctg7017


[0065]

8









TABLE 8










NOV2:
1
MEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSANYLVTLLGNTAIMAVSVLDTHLHTPVY
60
(SEQ ID No. 4)




MEP NRT VSEF LKGFSGYPALE LLFPLCS MYLVTLLGNTAI+AVS+LD  LHTP+Y


OLF:
1
MEPSNRTAVSEFVLKGFSGYPALERLLFPLCSVMYLVTLLGNTAIVAVSMLDARLHTPMY
60
(SEQ ID No. 29)





NOV2:
61
FFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITAY
120




FFLGNLS LDICYT TFVPLMLVHLLSSRKTISF  CA+QMCLSLSTGSTECLLLA+AY


OLF:
61
FFLGNLSILDICYTSTFVPLMLVELLSSRKTISFTGCAVQMCLSLSTGSTECLLVMAY
120





NOV2:
121
DRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGEHVVSHFTCK
180




DRYLAICQPLRY VLMSHRLC++L GA+WVLCL KSV E VI+MRLPFCGHHV+ HFTC+


OLF:
121
DRYLAICQPLRYPVLMSHRLCLMLAGASWVLCLFKSVAETVIAMRLPFCGHHVIRHFTCE
180





NOV2:
181
ILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSAAPCCKAFST
240




ILAVLKL CG+TSVS+ FLL G+ILLLP+PL  ICLSY+LILATILRVPSA    KAFST


OLF:
181
ILAVLKLTCGDTSVSDAFLLVGAILLLPIPLTLICLSYMLILATILRVPSATGRSKAFST
240





NOV2:
241
CLAELAVVLLFYGTIIFMYLKPKSKEAHISDEVFTVLYANVTTMLNPTIYSLRNKEVKEA
300




C AHLAVVLLFY TIIFMY+KPKSKEA ISD+VFTVLYA+VT MLNP IYSLRNKEVKEA


OLF:
241
CSAHLAVVLLFYSTIIFMYMKPKSKEARISDQVFTVLYAVVTPMLNPIIYSLRNKEVKEA
300





NOV2:
301
ARKVWGRSRASR
312




ARK WG   A R


OLF:
301
ARKAWGSRWACR
312






Where “+” denotes similarity








[0066]

9







TABLE 9










NOV2
MEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVLDIHLHTPVY
(SEQ ID No. 4)


macaca_OLF
------------------------------------------------------------
(SEQ ID No. 30)


Mouse_OLF
MEPSNRTAVSEFVLKGFSGYPALERLLFPLCSVMYLVTLLGNTAIVAVSMLDARLHTPMY
(SEQ ID No. 31)


Rat OLF
------------LLLGLSGYPKTEILYFVIVLVMYLVIHTGNGVLIIASIFDSHLHTPMY
(SEQ ID No. 32)


Human_OLF
---------MGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMY
(SEQ ID No. 33)





NOV2
FFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITAY


macaca OLF
------------------------------------------------------------


Mouse OLF
FFLGNLSILDICYTSTFVPLMLVHLLSSRKTISFTGCAVQMCLSLSTGSTECLLLAVMAY


Rat_OLF
FFLGNLSFLDICYTTSSVPSTLVSLISKKRNISFSGCTVQMFVGFAMGSTECLLLGMMAF


Human OLF
FFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAF





NOV2
DRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGHHVVSHFTCK


macaca_OLF
---PAICQPLRYRVLERLCVLLVGAAWVLCLLKSVTETVIRLPFCGHHVVSHFTCE


Mouse_OLF
DRYLAICQPLRYPVTMSFRLCLMLAGASWVLCLFKSVAETVIAMRLPFCGHHVIRHFTCE


Rat_OLF
DRYVAICNPLRYSVIMSKEVYVSMASASWFSGGINSVVQTSLAMRLPFCGNNVINNFTCE


Human OLF
DRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCE



    ***:**** *:*.:   : : .::*      **..  ::::*****.:*: ****:





NOV2
ILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSAARCCKAFST


macaca_OLF
ILAVLKLTCGNTSVSEVFLLVGSILLLPVPLAFICLSYLLILATILRVPSAAGCRKAFST


Mouse_OLF
ILAVLKLTCGDTSVSDAFLLVGAILLLPIPLTLICLSYMLILATILRVPSATGRSKAFST


Rat_OLF
VLAVLKLACADISLNIVTMVISNMAFLVLPLLLIFFSYVLILYTILRMNSASGRRKAFST


Human OLF
ILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFST



:******:*.: *:.   :    : :* :*: :* :**::*: ****: **    *.***





NOV2
CLAHLAVVLLFYGTIIFMYLKPKSKE------AHISDEVFTVLYAMVTTMLNPTIYSLRN


macaca_OLF
CSAHLAVVLLFYSTIIFTYMKPKSKE------AHISDEVFTVLYANVTPML---------


Mouse_OLF
CSAHLAVVLLFYSTIIFMYMKPKSKE------ARISDQVFTVLYAVVTPMLNPIIYSLRN


Rat_OLF
CSAHLTVVVIFYGTIFSMYAKPKSQDLTGKDKFQTSDKIISLFYGVVTPMLNPIIYSLRN


Human_OLF
CSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRN



* ***:**::**.*::  * ****::         **:::.::*.:**.**





NOV2
KEVKEAARKVWGRSRASR


macaca_OLF
------------------


Mouse_OLF
KEVKEAARKAWGSRWACR


Rat_OLF
KDVKAAVKYILKQKYIP-


Human_OLF
KDVKAAVRRLLRPKGFTQ






Consensus key




*—single, fully conserved residue




:—conservation of strong groups




.—conservation of weak groups - no consensus








[0067] The OR family of the GPCR superfamily is involved in the initial steps of the olfactory signal transduction cascade. Therefore, the NOV2 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0068] Based on this relatedness to other known members of the OR family of the GPCR superfamily, NOV2 can be used to provide new diagnostic and/or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Moreover, nucleic acids, polypeptides, antibodies, and other compositions of the present invention are also useful in the treatment of a variety of diseases and pathologies, including but not limited to, those involving neurogenesis, cancer, and wound healing.


[0069] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV2. PSORT analysis predicts that NOV2 is localized to the plasma membrane. Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 47 and 48. Additionally, the following possible SNPs were identified:


[0070] 82: T->G(11)


[0071] 125218920(i), phred 40


[0072] 125218923(i), phred 42


[0073] 125219376(i), phred 40


[0074] 125219632(i), phred 33


[0075] 125219739(i), phred 33


[0076] 125586244(i), phred 29


[0077] 125586186(i), phred 34


[0078] 125586110(i), phred 35


[0079] 126544369(i), phred 45


[0080] 125588716(i), phred 33


[0081] 125219986(i), phred 37


[0082] 91: C->T(11)


[0083] 125218920(i), phred 37


[0084] 125218923(i), phred 33


[0085] 125219376(i), phred 37


[0086] 125219632(i), phred 22


[0087] 125219739(i), phred 37


[0088] 125586244(i), phred 32


[0089] 125586186(i), phred 25


[0090] 125586110(i), phred 37


[0091] 126544369(i), phred 37


[0092] 125588716(i), phred 33


[0093] 125219986(i), phred 37


[0094] 150: C->G(10)


[0095] 125218920(i), phred 45


[0096] 125218923(i), phred 51


[0097] 125219376(i), phred 38


[0098] 125219632(i), phred 41


[0099] 125219739(i), phred 51


[0100] 125586244(i), phred 40


[0101] 125586186(i), phred 45


[0102] 125586110(i), phred 45


[0103] 126544369(i), phred 40


[0104] 125588716(i), phred 45


[0105] 157: G->A(2)


[0106] 125219739(i), phred 45


[0107] 125586186(i), phred 45


[0108] 246: G->C(10)


[0109] 125218920(i), phred 40


[0110] 125218923(i), phred 45


[0111] 125219376(i), phred 42


[0112] 125219632(i), phred 21


[0113] 125219739(i), phred 45


[0114] 125586244(i), phred 38


[0115] 125586186(i), phred 32


[0116] 125586110(i), phred 36


[0117] 126544369(i), phred 45


[0118] 125588716(i), phred 45


[0119] 296: G->A(10)


[0120] 125218920(i), phred 39


[0121] 125218923(i), phred 36


[0122] 125219376(i), phred 36


[0123] 125219632(i), phred 36


[0124] 125219739(i), phred 49


[0125] 125586244(i), phred 36


[0126] 125586186(i), phred 36


[0127] 125586110(i), phred 39


[0128] 126544369(i), phred 36


[0129] 125588716(i), phred 36


[0130] 406: A->G(2)


[0131] 125586198(i), phred 38


[0132] 125219755(i), phred 29


[0133] 450: C->T(8)


[0134] 125218920(i), phred 27


[0135] 125218923(i), phred 24


[0136] 125219376(i), phred 22


[0137] 125219739(i), phred 29


[0138] 125586244(i), phred 30


[0139] 125586186(i), phred 19


[0140] 126544369(i), phred 28


[0141] 125530948(i), phred 27


[0142] 562: A->G(5)


[0143] 125531346(i), phred 29


[0144] 125530963(i), phred 29


[0145] 125531302(i), phred 49


[0146] 125530948(i), phred 31


[0147] 125531257(i), phred 24


[0148] 662: C->T(6)


[0149] 125531346(i), phred 36


[0150] 125530963(i), phred 41


[0151] 125531302(i), phred 37


[0152] 125530948(i), phred 40


[0153] 125531257(i), phred 40


[0154] 126652213(i), phred 37


[0155] 664: A->G(6)


[0156] 125531346(i), phred 45


[0157] 125530963(i), phred 41


[0158] 125531302(i), phred 45


[0159] 125530948(i), phred 45


[0160] 125531257(i), phred 44


[0161] 126652213(i), phred 45


[0162] 667: A->T(6)


[0163] 125531346(i), phred 37


[0164] 125530963(i), phred 45


[0165] 125531302(i), phred 45


[0166] 125530948(i), phred 40


[0167] 125531257(i), phred 45


[0168] 126652213(i), phred 45


[0169] 671: A->G(7)


[0170] 125531283(i), phred 38


[0171] 126652328(i), phred 45


[0172] 126652243(i), phred 37


[0173] 125531218(i), phred 45


[0174] 125531233(i), phred 51


[0175] 125531199(i), phred 45


[0176] 125531268(i), phred 39


[0177] 679: G->A(6)


[0178] 125531346(i), phred 45


[0179] 125530963(i), phred 45


[0180] 125531302(i), phred 45


[0181] 125530948(i), phred 45


[0182] 125531257(i), phred 45


[0183] 126652213(i), phred 37


[0184] 776: C->T(6)


[0185] 125531346(i), phred 41


[0186] 125531302(i), phred 41


[0187] 125530948(i), phred 45


[0188] 126652243(i), phred 36


[0189] 125531257(i), phred 45


[0190] 126652213(i), phred 45


[0191] 820: C->A(4)


[0192] 125531346(i), phred 37


[0193] 125530948(i), phred 40


[0194] 125531257(i), phred 41


[0195] 126652213(i), phred 45


[0196] NOV3


[0197] A NOV3 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV3 nucleic acid and its encoded polypeptide includes the sequences shown in Table 10. The disclosed nucleic acid (SEQ ID NO.: 5) is 1,050 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 59-61 and ends with a TAA stop codon at nucleotides 995-997. The representative ORF encodes a 312 amino acid polypeptide similar in sequence to SEQ ID NO.: 4. Putative untranslated regions upstream and downstream of the coding sequence are underlined in SEQ ID NO: 5.
10TABLE 10    CCCTGTACCCTCTCTCCTTCCATCCCAGCTGTGGACCATCTCTTCAGAACTCTG(SEQ ID NO.: 5)CAGCATGGAGCCGCTCAACAGAACAGAGGTGTCCGAGTTCTTTCTGAAAGGATTTTCTGGCTACCCAGCCCTGGAGCATCTGCTCTTCCCTCTGTGCTCAGCCATGTACCTGGTGACCCTCCTGGGGAACACAGCCATCATGGCGGTGAGCGTGCTAGATATCCACCTGCACACGCCCGTGTACTTCTTCCTGGGCAACCTCTCTACCCTGGACATCTGCTACACGCCCACCTTTGTGCCTCTGATGCTGGTCCACCTCCTGTCATCCCGGAAGACCATCTCCTTTGCTGTCTGTGCCATCCAGATGTGTCTGAGCCTGTCCACGGGCTCCACGGAGTGCCTGCTACTGGCCATCACGGCCTATGACCGCTACCTGGCCATCTGCCAGCCACTCAGGTACCACGTGCTCATGAGCCACCGGCTCTGCGTGCTGCTGATGGGAGCTGCCTGGGTCCTCTGCCTCCTCAAGTCGGTGACTGAGATGGTCATCTCCATGAGGCTGCCCTTCTGTGGCCACCACGTGGTCAGTCACTTCACCTGCAAGATCCTGGCAGTGCTGAAGCTGGCATGCGGCAACACGTCGGTCAGCGAAGACTTCCTGCTGGCGGGCTCCATCCTGCTGCTGCCTGTACCCCTGGCATTCATCTGCCTGTCCTACTTGCTCATCCTGGCCACCATCCTGAGGGTGCCCTCGGCCGCCAGGTGCTGCAAAGCCTTCTCCACCTGCTTGGCACACCTGGCTGTAGTGCTGCTTTTCTACGGCACCATCATCTTCATGTACTTGAAGCCCAAGAGTAAGGAAGCCCACATCTCTGATGAGGTCTTCACAGTCCTCTATGCCATGGTCACGACCATGCTGAACCCCACCATCTACAGCCTGAGGAACAAGGAGGTGAAGGAGGCCGCCAGGAAGGTGTGGGGCAGGAGTCGGGCCTCCAGGTGAGGGAGGGCGGGGCTCTGTACAGACGCAGGTCTCAGGTTAGTAGCTGAGGCCATMEPLNRTEVSEFFLKGFSGYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVLDIHLHTPVY(SEQ ID NO.: 4)FFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTECLLLAITADRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGHHVVSHFTCKILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSAARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKEAHISDEVFTVLYAMVTTMLNPTIYSLRNKEVKEAARKVWGRSRASR


[0198] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV3 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0199] The NOV3 nucleic acid sequence has a high degree of homology (93% identity) with the monkey (Macaca Sylvanus) olfactory receptor gene (GenBank Accession No.: AF 179792), as is shown in Table 11. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413.


[0200] OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains.
11TABLE 11NOV3:431+TL,gccatctgccagccactcaggtaccacgtgctcatgagccaccggctctgcgtgctgctg490(SEQ ID NO. 5)||||||||||||||||||||||||| ||||||||| |||||||||||||| |||||||||OLF:4gccatctgccagccactcaggtaccgcgtgctcatgaaccaccggctctgtgtgctgctg63(SEQ ID No. 34)NOV3:491atgggagctgcctgggtcctctgcctcctcaagtcggtgactgagatggtcatctccatg550 |||||||||||||||||||||||||||||||||||||||||||||  |||||  |||||OLF:64gtgggagctgcctgggtcctctgcctcctcaagtcggtgactgagacagtcattgccatg123NOV3:551aggctgcccttctgtggccaccacgtggtcagtcacttcacctgcaagatcctggcagtg610||||||||||||||||||||||||||||||||||||||||||||| |||||||||| |||OLF:124aggctgcccttctgtggccaccacgtggtcagtcacttcacctgcgagatcctggcggtg183NOV3:611ctgaagctggcatgcggcaacacgtcggtcagcgaagacttcctgctggcgggctccatc670||||||||| | ||||| ||||| ||||||||||| | ||||||||||| ||||||||||OLF:184ctgaagctgacgtgcggtaacacatcggtcagcgaggtcttcctgctggtgggctccatc243NOV3:671ctgctgctgcctgtacccctggcattcatctgcctgtcctacttgctcatcctggccacc730|||||||||||||| |||||||||||||| ||||||||||||||||||||||||||||||OLF:244ctgctgctgcctgtgcccctggcattcatttgcctgtcctacttgctcatcctggccacc303NOV3:731atcctgagggtgccctcggccgccaggtgctgcaaagccttctccacctgcttggcacac790||||||||||||||||| || ||  ||||| |||||||||||||||||||||  ||||||OLF:304atcctgagggtgccctcagctgctgggtgccgcaaagccttctccacctgctcagcacac363NOV3:791ctggctgtagtgctgcttttctacggcaccatcatcttcatgtacttgaagcccaagagt850|||||||| ||||||||||||||| ||||||||||||||| |||| ||||||||||||| OLF:364ctggctgtggtgctgcttttctacagcaccatcatcttcacgtacatgaagcccaagagc423NOV3:851aaggaagcccacatctctgatgaggtcttcacagtcctctatgccatggtcac903||||||||||||||||||||||||||||||||||||||||| |||||||||||OLF:424aaggaagcccacatctctgatgaggtcttcacagtcctctacgccatggtcac476


[0201] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, in one embodiment, the NOV3 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0202] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV3 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0203] cDNA was derived from various human samples representing multiple tissue types, normal and diseases states, physiological states, and developmental states from different donors. Samples were obtained as whole tissue, cell lines, primary cells, or tissue cultured primary cells and cell lines. Cells and cell lines may have been treated with biological or chemical agents that regulate gene expression, for example, growth factors, chemokines, steroids, etc. The cDNA thus derived was then sequenced using CuraGen's proprietary SeqCalling™ technology. Sequence traces were evaluated manually and edited for corrections if appropriate. cDNA sequences from all samples were assembled with themselves and with public ESTs using bioinformatics programs to generate CuraGen's human SeqCalling™ database of SeqCalling™ assemblies. Each assembly contains one or more overlapping cDNA sequences derived from one or more human sample(s). Fragments and ESTs were included as components for an assembly when the extent of identity with another component of the assembly was at least 95% over 50 bp. Each assembly can represent a gene and/or its variants such as splice forms and/or single nucleotide polymorphisms (SNPs) and their combinations.


[0204] The cDNA coding for the sequence was cloned by polymerase chain reaction (PCR) using the following primers: AGCTGTGGACCATCTCTTCAGAACTCT (SEQ ID NO:79) and CTCACCTGGAGGCCCGACTC (SEQ ID NO:80) on the following pools of human cDNAs: Pool 1—Adrenal gland, bone marrow, brain—amygdala, brain—cerebellum, brain—hippocampus, brain—substantia nigra, brain—thalamus, brain—whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma—Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Pool2—Cancer tissue pool and Pool 3—Developmental pool.


[0205] Primers were designed based on in silico predictions for the full length or part (one or more exons) of the DNA/protein sequence of the invention or by translated homology of the predicted exons to closely related human sequences or to sequences from other species. Usually multiple clones were sequenced to derive the sequence which was then assembled similar to the SeqCalling™ process. In addition, sequence traces were evaluated manually and edited for corrections if appropriate.


[0206] Variant sequences are also included in this application. A variant sequence can include a single nucleotide polymorphism (SNP). A SNP can, in some instances, be referred to as a “cSNP” to denote that the nucleotide sequence containing the SNP originates as a cDNA. A SNP can arise in several ways. For example, a SNP may be due to a substitution of one nucleotide for another at the polymorphic site. Such a substitution can be either a transition or a transversion. A SNP can also arise from a deletion of a nucleotide or an insertion of a nucleotide, relative to a reference allele. In this case, the polymorphic site is a site at which one allele bears a gap with respect to a particular nucleotide in another allele. SNPs occurring within genes may result in an alteration of the amino acid encoded by the gene at the position of the SNP. Intragenic SNPs may also be silent, however, in the case that a codon including a SNP encodes the same amino acid as a result of the redundancy of the genetic code. SNPs occurring outside the region of a gene, or in an intron within a gene, do not result in changes in any amino acid sequence of a protein but may result in altered regulation of the expression pattern for example, alteration in temporal expression, physiological response regulation, cell type expression regulation, intensity of expression, stability of transcribed message.


[0207] The DNA sequence and protein sequence for a novel olfactory receptor-like gene or one of its splice forms was obtained solely by exon linking and is reported here as CuraGen Acc. No. sggc_draft_ba52111520000804_dal.


[0208] The OR disclosed in this invention maps to chromosome 9. It is expressed in at least the following tissues: brain, neuroepithelium, nervous, olfactory cilia, male reproductive system. The following consensus position(s) (Cons. Pos.) of the nucleotide sequence have been identified as SNPs. Depth represents the number of clones covering the region of the SNP. The Putative Allele Frequency (Putative Allele Freq.) is the fration of these clones containing the SNP. A dash, when shown, means that a base is not present. The sign “>” means “is changed to”.


[0209] Cons.Pos.: 71 Depth: 97 Change: C>G


[0210] Putative Allele Freq.: 0.113


[0211] Cons.Pos.: 278 Depth: 102 Change: G>A


[0212] Putative Allele Freq.: 0.020


[0213] Cons.Pos.: 336 Depth: 101 Change: T>C


[0214] Putative Allele Freq.: 0.020


[0215] Cons.Pos.: 395 Depth: 100 Change: G>-


[0216] Putative Allele Freq.: 0.040


[0217] Cons.Pos.: 399 Depth: 100 Change: G>-


[0218] Putative Allele Freq.: 0.020


[0219] Cons.Pos.: 400 Depth: 100 Change: G>-


[0220] Putative Allele Freq.: 0.020


[0221] Cons.Pos.: 407 Depth: 101 Change: C>-


[0222] Putative Allele Freq.: 0.020


[0223] Cons.Pos.: 414 Depth: 106 Change: G>-


[0224] Putative Allele Freq.: 0.028


[0225] Cons.Pos.: 437 Depth: 116 Change: T>-


[0226] Putative Allele Freq.: 0.017


[0227] Cons.Pos.: 461 Depth: 137 Change: C>T


[0228] Putative Allele Freq.: 0.022


[0229] Cons.Pos.: 471 Depth: 139 Change: T>-


[0230] Putative Allele Freq.: 0.014


[0231] Cons.Pos.: 491 Depth: 155 Change: C>T


[0232] Putative Allele Freq.: 0.013


[0233] Cons.Pos.: 500 Depth: 162 Change: G>A


[0234] Putative Allele Freq.: 0.012


[0235] Cons.Pos.: 519 Depth: 166 Change: A>G


[0236] Putative Allele Freq.: 0.012


[0237] Cons.Pos.: 539 Depth: 167 Change: G>-


[0238] Putative Allele Freq.: 0.012


[0239] Cons.Pos.: 549 Depth: 163 Change: T>-


[0240] Putative Allele Freq.: 0.037


[0241] Cons.Pos.: 556 Depth: 160 Change: G>-


[0242] Putative Allele Freq.: 0.013


[0243] Cons.Pos.: 563 Depth: 155 Change: G>-


[0244] Putative Allele Freq.: 0.026


[0245] Cons.Pos.: 570 Depth: 154 Change: G>-


[0246] Putative Allele Freq.: 0.013


[0247] Cons.Pos.: 617 Depth: 135 Change: C>T


[0248] Putative Allele Freq.: 0.237


[0249] Cons.Pos.: 658 Depth: 109 Change: A>G


[0250] Putative Allele Freq.: 0.018


[0251] Cons.Pos.: 659 Depth: 109 Change: G>C


[0252] Putative Allele Freq.: 0.018


[0253] Cons.Pos.: 843 Depth: 105 Change: G>A


[0254] Putative Allele Freq.: 0.381


[0255] A NOV3 OR is expressed in at least the following tissues: brain, neuroepithelium, nervous, olfactory cilia, and male reproductive system.


[0256] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV3. PSORT analysis predicts that NOV3 is likely localized in the plasma membrane, the Golgi body, the endoplasmic reticulum (membrane), and the microbody (peroxisome). Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 47 and 48.


[0257] NOV4


[0258] A NOV4 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV4 nucleic acid and its encoded polypeptide includes the sequences shown in Table 12. The disclosed nucleic acid (SEQ ID NO: 6) is 1,031 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 22-24 and ends with a TAA stop codon at nucleotides 979-981. The representative ORF encodes a 319 amino acid polypeptide (SEQ ID NO: 7). Putative untranslated regions upstream and downstream of the coding sequence are underlined in SEQ ID NO: 6.
12TABLE 12TGATGGCAGAGGGGATATCACATGAAAAAGCCA(SEQ ID NO.: 6)ATGAGACCTCCCCTGTGATGGGGTTCGTTCTCCTGAGGCTCTCTGCCCACCCAGAGCTGGAAAAGACATTCTTCGTGCTCATCCTGCTGATGTACCTCGTGATCCTGCTGGGCAATGGGGTCCTCATCCTGGTGACCATCCTTGACTCCCGCCTGCACACGCCCATGTACTTCTTCCTAGGGAACCTCTCCTTCCTGGACATCTGCTTCACTACCTCCTCAGTCCCACTGGTCCTGGACAGCTTTTTGACTCCCCAGGAAACCATCTCCTTCTCAGCCTGTGCTGTGCAGATGGCACTCTCCTTTGCCATGGCAGGAACAGAGTGCTTGCTCCTGAGCATGATGGCATTTGATCGCTATGTGGCCATCTGCAACCCCCTTAGGTACTCCGTGATCATGAGCAAGGCTGCCTACATGCCCATGGCTGCCAGCTCCTGGGCTATTGGTGGTGCTGCTTCCGTGGTACACACATCCTTGGCAATTCAGCTGCCCTTCTGTGGAGACAATGTCATCAACCACTTCACCTGTGAGATTCTGGCTGTTCTAAAGTTGGCCTGTGCTGACATTTCCATCAATGTGATCAGCATGGAGGTGACGAATGTGATCTTCCTAGGAGTCCCGGTTCTGTTCATCTCTTTCTCCTATGTCTTCATCATCACCACCATCCTGAGGATCCCCTCAGCTGAGGGGAGGAAAAAGGTCTTCTCCACCTGCTCTGCCCACCTCACCGTGGTGATCGTCTTCTACGGGACCTTATTCTTCATGTATGGGAAGCCTAAGTCTAAGGACTCCATGGGAGCAGACAAAGAGGATCTTTCAGACAAACTCATCCCCCTTTTCTATGGGGTGGTGACCCCGATGCTCAACCCCATCATCTATAGCCTGAGGAACAAGGATGTGAAGGCTGCTGTGAGGAGACTGCTGAGACCAAAAGGCTTCACTCAGTGATGGTGGAAGGGTCCTCTGTGATTGTCACCCACATGGAAGTAAGGAATCAC     MEKANETSPVMGFVLLRLSAHPELEKTFF(SEQ ID NO.: 7)VLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCEILAVLKLACADISNVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRRLLRPKGFTQ


[0259] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV4 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue. A NOV4 nucleic acid was identified on human chromosome 1.


[0260] The NOV4 nucleic acid sequence is homologous to (100% identity) to a human genomic clone corresponding to chromosome 9p13.1-13.3 (CHR9) (GenBank Accession No.: AL135841), as is shown in Table 13. Also, the NOV4 polypeptide has homology (approximately 88% identity) to the human olfactory receptor, family 2, subfamily S, member 2 (OLF) (GenBank Accession No.: CAB96728), as is shown in Table 14. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413. OR proteins have seven transmembrane a-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV4 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of human (SEQ ID NO. 37) (GenBank Accession No.: CAB96728), rat (SEQ ID NO. 38) (GenBank Accession No.: AAC64588), and mouse (SEQ ID NO. 39) (GenBank Accession No.: CAB96147), as shown in Table 15.
13TABLE 13NOV4:1tgatggcagaggggatatcacatggaaaaagccaatgagacctcccctgtgatggggttc60(SEQ ID NO. 6)||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82721tgatggcagaggggatatcacatggaaaaagccaatgagacctcccctgtgatggggttc82662(SEQ ID NO. 35)NOV4:61gttctcctgaggctctctgcccacccagagctggaaaagacattcttcgtgctcatcctg120||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82661gttctcctgaggctctctgcccacccagagctggaaaagacattcttcgtgctcatcctg82602NOV4:121ctgatgtacctcgtgatcctgctgggcaatggggtcctcatcctggtgaccatccttgac180||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||HR9:82601ctgatgtacctcgtgatcctgctgggcaatggggtcctcatcctggtgaccatccttgac82542NOV4:181tcccgcctgcacacgcccatgtacttcttcctagggaacctctccttcctggacatctgc240||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82541tcccgcctgcacacgcccatgtacttcttcctagggaacctctccttcctggacatctgc82482NOV4:241ttcactacctcctcagtcccactggtcctggacagctttttgactccccaggaaaccatc300||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82481ttcactacctcctcagtcccactggtcctggacagctttttgactccccaggaaaccatc82422NOV4:301tccttctcagcctgtgctgtgcagatggcactctcctttgccatggcaggaacagagtgc360||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82421tccttctcagcctgtgctgtgcagatggcactctcctttgccatggcaggaacagagtgc82362NOV4:361ttgctcctgagcatgatggcatttgatcgctatgtggccatctgcaacccccttaggtac420||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82361ttgctcctgagcatgatggcatttgatcgctatgtggccatctgcaacccccttaggtac82302NOV4:421tccgtgatcatgagcaaggctgcctacatgcccatggctgccagctcctgggctattggt480||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82301tccgtgatcatgagcaaggctgcctacatgcccatggctgccagctcctgggctattggt82242NOV4:481ggtgctgcttccgtggtacacacatccttggcaattcagctgcccttctgtggagacaat540||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82241ggtgctgcttccgtggtacacacatccttggcaattcagctgcccttctgtggagacaat82182NOV4:541gtcatcaaccacttcacctgtgagattctggctgttctaaagttggcctgtgctgacatt600||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82181gtcatcaaccacttcacctgtgagattctggctgttctaaagttggcctgtgctgacatt82122NOV4:601tccatcaatgtgatcagcatggaggtgacgaatgtgatcttcctaggagtcccggttctg660||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82121tccatcaatgtgatcagcatggaggtgacgaatgtgatcttcctaggagtcccggttctg82062NOV4:661ttcatctctttctcctatgtcttcatcatcaccaccatcctgaggatcccctcagctgag720||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82061ttcatctctttctcctatgtcttcatcatcaccaccatcctgaggatcccctcagctgag82002NOV4:721gggaggaaaaaggtcttctccacctgctctgcccacctcaccgtggtgatcgtcttctac780||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82001gggaggaaaaaggtcttctccacctgctctgcccacctcaccgtggtgatcgtcttctac81942NOV4:781gggaccttattcttcatgtatgggaagcctaagtctaaggactccatgggagcagacaaa840||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:81941gggaccttattcttcatgtatgggaagcctaagtctaaggactccatgggagcagacaaa81882NOV4:841gaggatctttcagacaaactcatcccccttttctatggggtggtgaccccgatgctcaac900||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:81881gaggatctttcagacaaactcatcccccttttctatggggtggtgaccccgatgctcaac81822NOV4:901cccatcatctatagcctgaggaacaaggatgtgaaggctgctgtgaggagactgctgaga960||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:81821cccatcatctatagcctgaggaacaaggatgtgaaggctgctgtgaggagactgctgaga81762NOV4:961ccaaaaggcttcactcagtgatggtggaagggtcctctgtgattgtcacccacatggaag1020||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:81761ccaaaaggcttcactcagtgatggtggaagggtcctctgtgattgtcacccacatggaag81702NOV4:1021taaggaatcac1031|||||||||||CHR9:81701taaggaatcac81691


[0261]

14









TABLE 14










NOV4:
11
MGFVLLRLSAHPELEKTFFXXXXXXXXXXXXXXXXXXXXXXXDSRLHTPMYFFLGNLSFL
70
(SEQ ID NO. 7)




MGFVLLRLSAHPELEKTFF                       DSRLHTPMYFFLGNLSFL


OLF:
1
MGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFL
60
(SEQ ID NO. 36)





NOV4:
71
DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNP
130




DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNP


OLF:
61
DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNP
120





NOV4:
131
LRYSVIMSKAAYMPMXXXXXXXXXXXXVVHTSLAIQLPFCGDNVINHFTCEILAVLKLAC
190




LRYSVIMSKAAYMPM            VVHTSLAIQLPFCGDNVINHFTCEILAVLKLAC


OLF:
121
LRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCEILAVLKLAC
180





NOV4:
191
ADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVI
250




ADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVI


OLF:
181
ADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVI
240





NOV4:
251
VFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRR
310




VFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRR


OLF:
241
VFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRR
300





NOV4:
311
LLRPKGFTQ
319




LLRPKGFTQ


OLF:
301
LLRPKGFTQ
309










[0262]

15







TABLE 15










NOV4
MEKANETSPVMGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM
(SEQ ID NO. 7)


Human_OLF
----------MGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM
(SEQ ID NO. 37)


rat_OLF
------------------------------------------------------------
(SEQ ID NO. 38)


mouse_OLF
MDRSNETAPLSGFILLGLSAHPKLEKTFFVLILMMYLVILLGNGVLILVSILDSHLHTPM
(SEQ ID NO. 39)





NOV4
YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA


Human_OLF
YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA


rat_OLF
----SNLSFLDICYTTSSVPLILGSFLTPRKTISFSGCAVQMFLSFAMGATECVLLSMMA


mouse_OLF
YFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFLSFAMGATECVLLSMMA



    .********:*******:*.*****::*****.***** *****..***:******





NOV4
FDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC


Human_OLF
FDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC


rat_OLF
FDRYVAICNPLRYPVVMSKAVYVPMATGSWAAGIAASIVQTSLAMPLPFCGDNVINHFTC


mouse_OLF
FDRYVAICNPLRYPVVMNKAAYVPMAASSWAGGITNSVVQTSLAMRLPFCGDNVINHFTC



*************.*:*.**.*:***:.*** * : *:*:****::**************





NOV4


EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFITTTLRIPSAEGRKKVFS


Human_OLF
EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFITTTLRIPSAEGRKKVFS


rat_OLF
EILAVLKLACADISINIISMGVTNVIFLGVPVLFISFSYIFILSTLRIPSAEGRKKAFS


mouse_OLF
EILAVLKLACADISINVISMVVANMIFLAVPVLFIFVSYVFILVTLRIPSAEGRKKAFS



****************:*** *:*:***.****** .**:**: ************.**





NOV4
TCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR


Human_OLF
TCSAHLTVVIVFYGTLFFMYGKPKSKDSNGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR


rat_OLF
TCSAHLTVVIVFYGTILFMYGKPKSKDPLGADKQDPADKLISLFYGVLTPM---------


mouse_OLF
TCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVVTPMLNPIIYSLR



*********:*****::**********.:****:* :****.*****:***





NOV4
NKDVKAAVRRLLRPKGFTQ


Human_OLF
NKDVKAAVRRLLRPKGFTQ


rat_OLF
-------------------


mouse_OLF
NKDVRAAVRNLVGQKHLTE






Consensus key




*-single. fully conserved residue




:-conservation of strong groups




.-conservation of weak groups




-no consensus








[0263] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV4 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0264] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV4 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in treating and/or diagnosing a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0265] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV4. PSORT analysis predicts that NOV4 is likely localized in the plasma membrane, the Golgi body, the endoplasmic reticulum (membrane), and the endoplasmic reticulum (lumen). Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 44 and 45.


[0266] NOV5


[0267] A NOV5 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV5 nucleic acid and its encoded polypeptide includes the sequences shown in Table 16. The disclosed nucleic acid (SEQ ID NO: 8) is 1050 nucleotides in length and contains an open reading frame (ORF) that begins at nucleotides 72-74 and ends with a TGA stop codon at nucleotides 1020-1022. A representative ORF encodes a 316 amino acid polypeptide (SEQ ID NO: 9). A putative untranslated region downstream of the coding sequence is underlined in SEQ ID NO: 8.
16TABLE 16AAACTAGAGTTCATCTTAGCAAAAATTCATGAAGTA(SEQ ID NO.: 8)TCCATCTTGTTCTAGGTGATGAAAGAAACCACAGCATGGAGCTCTGGAACTTCACCTTGGGAAGTGGCTTCATTTTGGTGGGGATTCTGAATGACAGTGGGTCTCCTGAACTGCTCTGTGCTACAATTACAATCCTATACTTGTTGGCCCTGATCAGCAATGGCCTACTGCTCCTGGCTATCACCATGGAAGCCCGGCTCCACATGCCCATGTACCTCCTGCTTGGGCAGCTCTCTCTCATGGACCTCCTGTTCACATCTGTTGTCACTCCCAAGGCCCTTGCGGACTTTCTGCGCAGAGAAAACACCATCTCCTTTGGAGGCTGTGCCCTTCAGATGTTCCTGGCACTGACAATGGGTGGTGCTGAGGACCTCCTACTGGCCTTCATGGCCTATGACAGGTATGTGGCCATTTGTCATCCTCTGACATACATGACCCTCATGAGCTCAAGAGCCTGCTGGCTCATGGTGGCCACGTCCTGGATCCTGGCATCCCTAAGTGCCCTAATATATACCGTGTATACCATGCACTATCCCTTCTGCAGGGCCCAGGAGATCAGGCATCTTCTCTGTGAGATCCCACACTTGCTGAAGGTGGCCTGTGCTGATACCTCCAGATATGAGCTCATGGTATATGTGATGGGTGTGACCTTCCTGATTCCCTCTCTTGCTGCTATACTGGCCTCCTATACACAAATTCTACTCACTGTGCTCCATATGCCATCAAATGAGGGGAGGAAGAAAGCCCTTGTCACCTGCTCTTCCCACCTGACTGTGGTTGGGATGTTCTATGGAGCTGCCACATTCATGTATGTCTTGCCCAGTTCCTTCCACAGCACCAGACAAGACAACATCATCTCTGTTTTCTACACAATTGTCACTCCAGCCCTGAATCCACTCATCTACAGCCTGAGGAATAAGGAGGTCATGCGGGCCTTGAGGAGGGTCCTGGGAAAATACATGCTGCCAGCACACTCCACGCTCTAGGGAAGGATCATGGCTAGCTTCCAGAATTMELWNFTLGSGFILVGILNDSGSPELLCATITILYL(SEQ ID NO.: 9)LALISNGLLLLAITMEARLHMPMYLLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAYDRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCEIPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRALRRVLGKYMLPAHSTL


[0268] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV5 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0269] The NOV5 nucleic acid sequence has a high degree of homology (99% identity) to a human genomic clone RPC11-610120 from chromosome 11p.15.4 (CHR11) (GenBank Accession No.: AF321237), as shown in Table 17. The NOV5 polypeptide has homology (approximately 73% identity, 79% similarity) to a mouse T2 olfactory receptor (OLF) (GenBank Accession No.: AAG45196), as is shown in Table 18. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413. OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Thus, NOV5 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of mouse (SEQ ID NO. 42) (GenBank Accession No.: AAG45196), human (SEQ ID NO. 43) (GenBank Accession No.: AAC39611), and rat (SEQ ID NO. 44) (GenBank Accession No.: JC5836), as shown in Table 19.
17TABLE 17NOV5:523tggcatccctaagtgccctaatatataccgtgtataccatgcactatcccttctgcaggg582(SEQ ID NO. 8)||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:111126tggcatccctaagtgccctaatatataccgtgtataccatgcactatcccttctgcaggg111067(SEQ ID NO. 40)NOV5:583cccaggagatcaggcatcttctctgtgagatcccacacttgctgaaggtggcctgtgctg642||||||||||||||||||||||||||||||||||||||||||||||| ||||||||||||CHR11:111066cccaggagatcaggcatcttctctgtgagatcccacacttgctgaagttggcctgtgctg111007NOV5:643atacctccagatatgagctcatggtatatgtgatgggtgtgaccttcctgattccctctc702||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:111006atacctccagatatgagctcatggtatatgtgatgggtgtgaccttcctgattccctctc110947NOV5:703ttgctgctatactggcctcctatacacaaattctactcactgtgctccatatgccatcaa762||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:110946ttgctgctatactggcctcctatacacaaattctactcactgtgctccatatgccatcaa110887NOV5:763atgaggggaggaagaaagcccttgtcacctgctcttcccacctgactgtggttgggatgt822||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:110886atgaggggaggaagaaagcccttgtcacctgctcttcccacctgactgtggttgggatgt110827NOV5:823tctatggagctgccacattcatgtatgtcttgcccagttccttccacagcaccagacaag882||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:110826tctatggagctgccacattcatgtatgtcttgcccagttccttccacagcaccagacaag110767NOV5:883acaacatcatctctgttttctacacaattgtcactccagccctgaatccactcatctaca942||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:110766acaacatcatctctgttttctacacaattgtcactccagccctgaatccactcatctaca110707NOV5:943gcctgaggaataaggaggtcatgcgggccttgaggagggtcctgggaaaatacatgctgc1002||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||CHR11:110706gcctgaggaataaggaggtcatgggggccttgaggagggtcctgggaaaatacatgctgc110647NOV5:1003cagcacactccacgctctagggaaggatcatggctagcttccagaatt1050||||||||||||||||||||||||||||||||||||||||||| ||||CHR11:110646cagcacactccacgctctagggaaggatcatggctagcttccaaaatt110599


[0270]

18









TABLE 18










NOV5:
1
MELWNFTLGSGFILVGILNDSGSPEXXXXXXXXXXXXXXXXXXXXXXAITMEARLHMPMY
60
(SEQ ID NO. 9)




ME WN TL+ F LVGIL+DSGSPE                       ITM+ARLH+PMY


OLF:
1
MEPWNSTLGTDFNLVGILDDSGSPELLCATFTALYMLALISNGLLILVITMDARLHVPMY
60
(SEQ ID NO. 41)





NOV5:
61
XXXXXXXXXXXXFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAY
120




            FTSVVTPKA+ DFL R+NTISF GC+LQMFLALT+GGAEDLLLAFMAY


OLF:
61
FLLGQLSLMDLLFTSVVTPKAVIDFLLRDNTISFEGCSLQMFLALTLGGAEDLLLAFMAY
120





NOV5:
121
DRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCE
180




DRYVAICHPL YM  M    CWLMVATSW+LASL AL YT YTM Y +C++++IRHLLCE


OLF:
121
DRYVAICHPLNYMIFMRPSICWLMVATSWVLASLMALGYTTYTMQYSYCKSRKIRHLLCE
180





NOV5:
181
IPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVT
240




IP LLK+ACADTS+YELMVYVMGVTFLIP LAAILASY+ IL TVLHMPSNEGRKKALVT


OLF:
181
IPPLLKLACADTSKYELMVYVMGVTFLIPPLAAILASYSLILFTVLHMPSNEGRKKALVT
240





NOV5:
241
CSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRA
300




CSSHLTVVGMFYGAATFMYVLP+SFHS RQDNIISVFYTIVTPALNPLIYSLRNKEV  A


OLF:
241
CSSHLTVVGMFYGAATFMYVLPNSFHSPRQDNIISVFYTIVTPALNPLIYSLRNKEVTGA
300





NOV5:
301
LRRVLGKYMLPAHSTL
316




L RVLG+Y++PAH TL


OLF:
301
LIRVLGRYIVPAHPTL
316






Where ‘+’ denotes similarity.








[0271]

19







TABLE 19










mouse_OLF
---MEPWNSTLGTDFNLVGILDDSGSPELLCATFTALYMLALISNGLLILVITMDARLHV
(SEQ ID NO. 42)


NOV5 ---MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHM
(SEQ ID NO. 9)


Human_OLF
------------------------------------------------------------
(SEQ ID NO. 43)


Rat_OLF
MQTLRKENCSSVSEFTLLGFSSESQIRMALFIFFLLLYMVTLLGNGLIVALIYLDSRLHT
(SEQ ID NO. 44)





mouse_OLF
PMYFLLGQLSLMDLLFTSVVTPKAVIDFLLRDNTISFEGCSLQMFLALTLGGAEDLLLAF


NOV5
PMYLLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAF


Human_OLF
----------LIDMMYISTIVPKMLVNYLLDQRTISFVGCTAQHFLYLTLVGAEFFLLGL


Rat_OLF
PMYFFLSILSLVDMSYVTTTVPQMLVNMVCPKRTISWGACVAQMFIFLVLGIAECVLYAI



          *:*: : :. .*: : : :  ..***: .*  * *: *.:  ** .* .:





mouse_OLF
MAYDRYVAICHPLNYMIFMRPSICWLMVATSWVLASLMALGYTTYTMQYSYCKSRKIRHL


NOV5
MAYDRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHL


Human_OLF
MAYDRYVAICNPLRYPVLMSRRVCAKMIAGSWFGGSLDGFLLTPITMSFPFCNSREINHF


Rat_OLF
MAYDRYIAICFPLHYSVLMSRLVCAKMVTICSSISVTGALIYTVFTMRLPYCGPYKINHF



******:*** ** *  :*    *  ::: .   .   .:  *  **  .:* . :*.*:





mouse_OLF
LCEIPPLLKLACADTSKYELMVYVMGVTFLIPPLAAILASYSLILFTVLHMPSNEGRKKA


NOV5
LCEIPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKA


Human_OLF
FCEAPAVLKLACADTALYETVMYVCCVLMLLIPFSVVLASYARILTTVQCMSSVEGRKKA


Rat_OLF
FCEVPAVLKLACADTSFNDRLDFILGFVLLLVPTSLILASYACIFVSILRIRSSQGRLKS



:** * :**:*****:  : : ::  . :*: .:: :****: *: ::  : * :** *:





mouse_OLF
LVTCSSHLTVVGMFYGAATFMYVLPNSFHSPRQDNIISVFYTIVTPALNPLIYSLRNKEV


NOV5
LVTCSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEV


Human_OLF
FATCSSHMTVVSLFYGAAIVIYTYMLPHSYHKPAQDKVLSVFYTILTP------------


Rat_OLF
FSTCASHITVVTMFYGPAMVMYMRPGSWYDPERDKKLALFYNVVSAFLNPIIYSLRNKDV



: **:**:*** :***.*   *: * *::.. :*: :::**.:::.





mouse_OLF
TGALIRVLGRYIVPAHPTL


NOV5
MRALRRVLGKYMLPAHSTL


Human_OLF
-------------------


Rat_OLF
KGAFMKVLGGRGTAQ----






Consensus key




*-single, fully conserved residue




:-conservation of strong groups




.-conservation of weak groups




-no consensus








[0272] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Thus, the NOV5 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0273] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV5 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0274] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV5. PSORT analysis predicts that NOV5 is likely localized in the plasma membrane, the Golgi body, the endoplasmic reticulum (membrane), and the endoplasmic reticulum (lumen). Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 43 and 44.


[0275] NOV6


[0276] A NOV6 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV6 nucleic acid and its encoded polypeptide includes the sequences shown in Table 20. The disclosed nucleic acid (SEQ ID NO: 10) is 960 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 27-29 and ends with a TAA stop codon at nucleotides 999-1001. The representative ORF encodes a 324 amino acid polypeptide (SEQ ID NO: 11). Putative untranslated regions up- and downstream of the coding sequence are underlined in SEQ ID NO: 10.
20TABLE 20AGCTGGAGATCTGGAACTTCCACAGCATGGAGCT(SEQ ID NO.: 10)CTGGAACTACCACAGCATGGAGCTCTGGAACTTCACCTTdGGGAAGTGGCTTCATTTTGGTGGGGATTCTGAATGACAGTGGGTCTCCTGAACTGCTCTGTGCTACAATTACAATCCTATACTTGTTGGCCCTGATCAGCAATGGCCTACTGCTCCTGGCTATCACCATGGAAGCCCGGCTCCACATGCCCATGTACCTCCTGCTTGGGCAGCTCTCTCTCATGGACCTCCTGTTCACATCTGTTGTCACTCCCAAGGCCCTTGCGGACTTTCTGCGCAGAGAAAACACCATCTCCTTTGGAGGCTGTGCCCTTCAGATGTTCCTGGCACTGACAATGGGTGGTGCTGAGGACCTCCTACTGGCCTTCATGGCCTATGACAGGTATGTGGCCATTTGTCATCCTCTGACATACATGACCCTCATGAGCTCAAGAGCCTGCTGGCTCATGGTGGCCACGTCCTGGATCCTGGCATCCCTAAGTGCCCTAATATATACCGTGTATACCATGCACTATCCCTTCTGCAGGGCCCAGGAGATCAGGCATCTTCTCTGTGAGATCCCACACTTGCTGAAGTTGGCCTGTGCTGATACCTCCAGATATGAGCTCATGGTATATGTGATGGGTGTGACCTTCCTGATTCCCTCTCTTGCTGCTATACTGGCCTCCTATACACAAATTCTACTCACTGTGCTCCATATGCCATCAAATGAGGGGAGGAAGAAAGCCCTTGTCACCTGCTCTTCCCACCTGACTGTGGTTGGGATGTTCTATGGAGCTGCCACATTCATGTATGTCTTGCCCAGTTCCTTCCACAGCACCAGACAAGACAACATCATCTCTGTTTTCTACACAATTGTCACTCCAGCCCTGAATCCACTCATCTACAGCCTGAGGAATAAGGAGGTCATGCGGGCCTTGAGGAGGGTCCTGGGAAAATACATGCTGCCAGCACACTCCACGCTCTAGGGAAGGAMELWNYHSMELWNFTLGSGFILVGILNDSGSPEL(SEQ ID NO.: 11LCATITILYLLALISNGLLLLAITMEARLHMPMYLLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAYDRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCEIPHLLKLACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVTCSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRALRRVLGKYMLPAHSTL


[0277] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV6 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0278] The NOV6 nucleic acid sequence has a high degree of homology (99% identity) with a human genomic clone RPC11-610120 from chromosome 11p15.4 (CHR11) (GenBank Accession No.: AF321237), as is shown in Table 21. As shown in Table 22, the NOV6 polypeptide has homology (73% identity) with a mouse T2 olfactory receptor (OLF) (GenBank Accession No.: AAG45196). Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413.


[0279] OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV6 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of mouse (SEQ ID NO. 47) (GenBank Accession No.: AAG45196), human (SEQ ID NO. 48) (GenBank Accession No.: AAC39611), and rat (SEQ ID NO. 49) (GenBank Accession No.: JC5836), as shown in Table 23.
21TABLE 21NOV6:502tggcatccctaagtgccctaatatataccgtgtataccatgcactatcccttctgcaggg561(SEQ ID NO.10)||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:111126tggcatccctaagtgccctaatatataccgtgtataccatgcactatcccttctgcaggg111067(SEQ ID NO.45)NOV6:562cccaggagatcaggcatcttctctgtgagatcccacacttgctgaagttggcctgtgctg621||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:111066cccaggagatcaggcatcttctctgtgagatcccacacttgctgaagttggcctgtgctg111007NOV6:622atacctccagatatgagctcatggtatatgtgatgggtgtgaccttcctgattccctctc681||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:111006atacctccagatatgagctcatggtatatgtgatgggtgtgaccttcctgattccctctc110947NOV6:682ttgctgctatactggcctcctatacacaaattctactcactgtgctccatatgccatcaa741||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:110946ttgctgctatactggcctcctatacacaaattctactcactgtgctccatatgccatcaa110887NOV6:742atgaggggaggaagaaagcccttgtcacctgctcttcccacctgactgtggttgggatgt801||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:110886atgaggggaggaagaaagcccttgtcacctgctcttcccacctgactgtggttgggatgt110827NOV6:802tctatggagctgccacattcatgtatgtcttgcccagttccttccacagcaccagacaag861||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:110826tctatggagctgccacattcatgtatgtcttgcccagttccttccacagcaccagacaag110767NOV6:862acaacatcatctctgttttctacacaattgtcactccagccctgaatccactcatctaca921||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR11:110766acaacatcatctctgttttctacacaattgtcactccagccctgaatccactcatctaca110707NOV6:922gcctgaggaataaggaggtcatgcgggccttgaggagggtcctgggaaaatacatgctgc981||||||||||||||||||||||| ||||||||||||||||||||||||||||||||||||CHR11:110706gcctgaggaataaggaggtcatgggggccttgaggagggtcctgggaaaatacatgctgc110647NOV6:982cagcacactccacgctctagggaagga1008|||||||||||||||||||||||||||CHR11:110646cagcacactccacgctctagggaagga110620


[0280]

22









TABLE 22










NOV6:
9
MELWNFTLGSGFILVGILNDSGSPEXXXXXXXXXXXXXXXXXXXXXXAITMEARLHMPMY
68
(SEQ ID NO.11)




ME WN TLG+ F LVGIL+DSGSPE                       ITM+ARLH+PMY


OLF:
1
MEPWNSTLGTDFNLVGILDDSGSPELLCATFTALYMLALISNGLLTLVITMDARLHVPMY
60
(SEQ ID NO.46)





NOV6:
69
XXXXXXXXXXXXFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAY
128




            FTSVVTPKA+ DFL R+NTISF GC+LQMFLALT+GGAEDLLLAFMAY


OLF:
61
FLLGQLSLMDLLFTSVVTPKAVIDFLLRDNTISFEGCSLQMFLALTLGGAEDLLLAFMAY
120





NOV6:
129
DRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCE
188




DRYVAICHPL YM  M    CWLMVATSW+LASL AL YT YTM Y +C++++IRHLLCE


OLF:
121
DRYVAICHPLNYMIFMRPSICWLMVATSWVLASLMALGYTTYTMQYSYCKSRKIRHLLCE
180





NOV6:
189
IPHLLKLACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVT
248




IP LLKLACADTS+YELMVYVMGVTFLIP LAAILASY+ IL TVLHMPSNEGRKKALVT


OLF:
181
IPPLLKLACADTSKYELMVYVMGVTFLIPPLAAILASYSLILFTVLHMPSNEGRKKALVT
240





NOV6:
249
CSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRA
308




CSSHLTVVGMFYGAATFMYVLP+SFHS RQDNIISVFYTIVTPALNPLIYSLRNKEV A


OLF:
241
CSSHLTVVGMFYGAATFMYVLPNSFHSPRQDNIISVFYTIVTPALNPLIYSLRNKEVTGA
300





NOVG:
309
LRRVLGKYMLPAHSTL
324




L RVLG+Y++PAH TL


OLF:
301
LIRVLGRYIVPAHPTL
316






Where ‘+’ denotes similarity








[0281]

23







TABLE 23










mouse_OLF
--------MEPWNSTLGTDFNLVGILDDSGSPELLCATFTALYMLALISNGLLILVITMD
(SEQ ID NO.47)


NOV6
MELWNYHSMELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITME
(SEQ ID NO.11)


human_OLF
------------------------------------------------------------
(SEQ ID NO.48)


rat_OLF
-----MQTLRKENCSSVSEFILLGFSSESQIRMALFIFFLLLYMVTLLGNGLIVALIYLD
(SEQ ID NO.49)





mouse_OLF
ARLHVPMYFLLGQLSLMDLLFTSVVTPKAVIDFLLRDNTISFEGCSLQMFLALTLGGAED


NOV6
ARLHMPMYLLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAED


human_OLF
---------------LIDMMYISTIVPKMLVNYLLDQRTISFVGCTAQHFLYLTLVGAEF


rat_OLF
SRLHTPMYFFLSILSLVDMSYVTTTVPQMLVNMVCPKRTISWGACVAQMFIFLVLGIAEC



               *:*: : :. .*: : : : ..***: .* * *: *.: **





mouse_OLF
LLLAFMAYDRYVAICHPLNYMIFMRPSICWLMVATSWVLASLMALGYTTYTMQYSYCKSR


NOV6
LLLAFMAYDRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQ


human_OLF
FLLGLMAYDRYVAICNPLRYPVLMSRRVCWMIIAGSWFGGSLDGFLLTPITMSFPFCNSR


rat_OLF
VLYAIMAYDRYIAICFPLHYSVLMSRLVCAKMVTICSSISVTGALIYTVFTMRLPYCGPY



.* .:******:*** ** * :* * ::: . . .: * ** .:* .





mouse_OLF
KIRHLLCEIPPLLKLACADTSKYELMVYVMGVTFLIPPLAAILASYSLILFTVLHMPSNE


NOV6
EIRHLLCEIPHLLKLACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNE


human_OLF
EINHFFCEAPAVLKLACADTALYETVMYVCCVLMLLIPFSVVLASYARILTTVQCMSSVE


rat_OLF
KINHFFCEVPAVLKLACADTSFNDRLDFILGFVLLLVPLSLILASYACIFVSILRIRSSQ



:*.*::** * :********: : : :: . :*: .:: :****: *: :: : * :





mouse_OLF
GRKKALVTCSSHLTVVGMFYGAATFMYVLPNSFHSPRQDNIISVFYTIVTPALNPLIYSL


NOV6
GRKKALVTCSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSL


human_OLF
GRKKAFATCSSHMTVVSLFYGAAMYTYMLPHSYHKPAQDKVLSVFYTILTP---------


rat_OLF
GRLKSFSTCASHITVVTMFYGPAMVMYMRPGSWYDPERDKKLALFYNVVSAFLNPIIYSL



** *:: **:**:*** :***.* *: * *::.. :*: :::**.:::.





mouse_OLF
RNKEVTGALIRVLGRYIVPAHPTL


NOV6
RNKEVMRALRRVLGKYMLPAHSTL


human OLF
------------------------


rat_OLF
RNKDVKGAFMKVLGGRGTAQ----






Consensus key




*-single, fully conserved residue




:-conservation of strong groups




.-conservation of weak groups-no consensus








[0282] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV6 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0283] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV6 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0284] The OR encoded by NOV6 is expressed in at least one of the following tissues: adrenal gland, bone marrow, brain—amygdala, brain—cerebellum, brain—hippocampus, brain—substantia nigr, brain—thalamus, brain—whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma—Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid trachea, uterus.


[0285] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV6. PSORT analysis predicts that NOV6 is likely localized in the plasma membrane, the Golgi body, the endoplasmic reticulum (membrane), and the endoplasmic reticulum (lumen). Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 61 and 62.


[0286] Possible SNPs found include:


[0287] 212: A->C(19)


[0288] 119262540(i), phred 45


[0289] 121152646(i), phred 35


[0290] 121152648(i), phred 37


[0291] 121153180(i), phred 33


[0292] 121153206(i), phred 25


[0293] 122372640(i), phred 49


[0294] 122372632(i), phred 34


[0295] 121153186(i), phred 33


[0296] 121152662(i), phred 40


[0297] 122374195(i), phred 43


[0298] 124194065(i), phred 34


[0299] 124194090(i), phred 38


[0300] 124194219(i), phred 45


[0301] 124194340(i), phred 34


[0302] 124194477(i), phred 34


[0303] 124194430(i), phred 45


[0304] 124194392(i), phred 45


[0305] 124194284(i), phred 45


[0306] 124194128(i), phred 38


[0307] 253: T->C(2)


[0308] 121152648(i), phred 45


[0309] 121152662(i), phred 45


[0310] 365: A->C(3)


[0311] 119262540(i), phred 30


[0312] 121152646(i), phred 39


[0313] 122374195(i), phred 33


[0314] 383: G->A(2)


[0315] 119262608(i), phred 44


[0316] 119262565(i), phred 36


[0317] 433: C->T(19)


[0318] 121152648(i), phred 45


[0319] 121153180(i), phred 30


[0320] 122372640(i), phred 45


[0321] 122372632(i), phred 37


[0322] 121153186(i), phred 39


[0323] 121152662(i), phred 35


[0324] 124194065(i), phred 39


[0325] 124194090(i), phred 39


[0326] 124194219(i), phred 39


[0327] 124194340(i), phred 37


[0328] 124194477(i), phred 33


[0329] 124194430(i), phred 39


[0330] 124194392(i), phred 45


[0331] 124194284(i), phred 37


[0332] 124194128(i), phred37


[0333] 122374183(i), phred 27


[0334] 124219650(i), phred 18


[0335] 124219686(i), phred 33


[0336] 124219719(i), phred 33


[0337] 464: G->C(10)


[0338] 119262549(i), phred 21


[0339] 119262608(i), phred 40


[0340] 122372626(i), phred 36


[0341] 122372617(i), phred 34


[0342] 122374187(i), phred 33


[0343] 122374179(i), phred 33


[0344] 122374197(i), phred 38


[0345] 122374167(i), phred 33


[0346] 119246164(i), phred27


[0347] 122372636(i), phred 30


[0348] 504: T->gap(2)


[0349] 121153189(i), phred 123


[0350] 124219622(i), phred 123


[0351] 592: T->C(3)


[0352] 121153180(i), phred 31


[0353] 121152658(i), phred 45


[0354] 121152640(i), phred 40


[0355] 603: A->G(2)


[0356] 122372626(i), phred 29


[0357] 122374177(i), phred 45


[0358] 631 G->A(2)


[0359] 124194284(i), phred 36


[0360] 124219686(i), phred 33


[0361] 655 G->A(2)


[0362] 124194065(i), phred 38


[0363] 124219622(i), phred 34


[0364] 696: T->C(7)


[0365] 122374171(i), phred 37


[0366] 122374189(i), phred 35


[0367] 119246135(i), phred 33


[0368] 122374181(i), phred 38


[0369] 122374169(i), phred 33


[0370] 121152664(i), phred 38


[0371] 122372644(i), phred 38


[0372] 739: T->C(2)


[0373] 121152658(i), phred 49


[0374] 121152640(i), phred 45


[0375] 801:T->C(2)


[0376] 121152658(i), phred 40


[0377] 121152640(i), phred 45


[0378] 863: A->G(3)


[0379] 124219686(i), phred 35


[0380] 121152658(i), phred 33


[0381] 121152640(i), phred 33


[0382] 876: A->G(3)


[0383] 122374171(i), phred 45


[0384] 122374169(i), phred 30


[0385] 121152664(i), phred 51


[0386] 882. A->gap(3)


[0387] 124219719(i), phred 123


[0388] 119246162(i), phred 123


[0389] 121153182(i), phred 123


[0390] NOV7


[0391] A NOV7 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV7 nucleic acid and its encoded polypeptide includes the sequences shown in Table 24. The disclosed nucleic acid (SEQ ID NO:12) is 980 nucleotides in length and contains an open reading frame (ORF) that begins with an ACG initiation codon at nucleotide 40 and ends with a TGA termination codon at nucleotide 958. The representative ORF encodes a 306 amino acid polypeptide (SEQ ID NO:13). Putative untranslated regions are upstream of the initiation codon and downstream of the termination codon in SEQ ID NO: 12
24TABLE 24GCATCCATTTAATGAATAGTGGCAAGAGGGAAAGATGGCCATGGACAATGTCACAG(SEQ ID NO.12)CAGTGTTTCAGTTTCTCCTTATTGGCATTTCTAACTATCCTCAATGGAGAGACACGTTTTTCACATTAGTGCTGATAATTTACCTCAGCACATTGTTGGGGAATGGATTTATGATCTTTCTTATTCACTTTGACCCCAACCTCCACACTCCAATCTACTTCTTCCTTAGTAACCTGTCTTTCTTAGACCTTTGTTATGGAACAGCTTCCATGCCCCAGGCTTTGGTGCATTGTTTCTCTACCCATCCCTACCTCTCTTATCCCCGATGTTTGGCTCAAACGAGTGTCTCCTTGGCTTTGGCCACAGCAGAGTGCCTCCTACTGGCTGCCATGGCCTATGACCGTGTGGTTGCTATCAGCAATCCCCTGCGTTATTCAGTGGTTATGAATGGCCCAGTATGTGTCTGCTTGGTTGCTACCTCATGGGGGACATCACTTGTGCTCACTGCCATGCTCATCCTATCCCTGAGGCTTCACTTCTGTGGGGCTAATGTCATCAACCATTTTGCCTGTGAGATTCTCTCCCTCATTAAGCTGACCTGTTCTGATACCAGCCTCAATGAATTTATGATCCTCATCACCAGTATCTTCACCCTGCTGCTACCATTTGGGTTTGTTCTCCTCTCCTACATACGAATTGCTATGGCTATCATAAGGATTCGCTCACTCCAGGGCAGGCTCAAGGCCTTTACCACATGTGGCTCTCACCTGACCGTGGTGACAATCTTCTATGGGTCAGCCATCTCCATGTATATGAAAACTCAGTCCAAGTCCTACCCTGACCAGGACAAGTTTATCTCAGTGTTTTATGGAGCTTTGACACCCATGTTGAACCCCCTGATATATAGCCTGAGAAAAAAAGATGTTAAACGGGCAATAAGGAAAGTTATGTTGAAAAGGACATGAGCCTTCTTTGCTTCTAAAC     MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLH(SEQ ID NO.13)TPIYFFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAYDRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTCGSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAIRKVMLKRT


[0392] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. The NOV7 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0393] The NOV7 nucleic acid sequence has a high degree of homology (99% identity) with the human genomic clone RP1-154J13 from chromosome Xq26.1-26.3 (CHRX) (GenBank Accession No.: AL049734), as is shown in Table 25. The NOV7 polypeptide has homology (approximately 47% identity, 58% similarity) to a mouse B6 olfactory receptor (OLF) (GenBank Accession No.: AAG45201), as is shown in Table 26.


[0394] Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413. OR proteins have seven transmembrane (α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV7 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of human (SEQ ID NO. 52) (GenBank Accession No.: AAG45204), mouse (SEQ ID NO. 53) (GenBank Accession No.: AAB25299), and rat (SEQ ID NO. 54) (GenBank Accession No.: AAB25299), as shown in Table 27.
25TABLE 25NOV7:1gcatccatttaatgaatagtggcaagagggaaagatggccatggacaatgtcacagcagt60(SEQ ID NO.12)||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120327gcatccatttaatgaatagtggcaagagggaaagatggccatggacaatgtcacagcagt120386(SEQ ID NO.50)NOV7:61gtttcagtttctccttattggcatttctaactatcctcaatggagagacacgtttttcac120||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120387gtttcagtttctccttattggcatttctaactatcctcaatggagagacacgtttttcac120446NOV7:121attagtgctgataatttacctcagcacattgttggggaatggatttatgatctttcttat180||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120447attagtgctgataatttacctcagcacattgttggggaatggatttatgatctttcttat120506NOV7:181tcactttgaccccaacctccacactccaatctacttcttccttagtaacctgtctttctt240||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120507tcactttgaccccaacctccacactccaatctacttcttccttagtaacctgtctttctt120566NOV7:241agacctttgttatggaacagcttccatgccccaggctttggtgcattgtttctctaccca300||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120567agacctttgttatggaacagcttccatgccccaggctttggtgcattgtttctctaccca120626NOV7:301tccctacctctcttatccccgatgtttggctcaaacgagtgtctccttggctttggccac360||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120627tccctacctctcttatccccgatgtttggctcaaacgagtgtctccttggctttggccac120686NOV7:361agcagagtgcctcctactggctgccatggcctatgaccgtgtggttgctatcagcaatcc420||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120687agcagagtgcctcctactggctgccatggcctatgaccgtgtggttgctatcagcaatcc120746NOV7:421cctgcgttattcagtggttatgaatggcccagtatgtgtctgcttggttgctacctcatg480||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120747cctgcgttattcagtggttatgaatggcccagtatgtgtctgcttggttgctacctcatg120806NOV7:481ggggacatcacttgtgctcactgccatgctcatcctatccctgaggcttcacttctgtgg540||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120807ggggacatcacttgtgctcactgccatgctcatcctatccctgaggcttcacttctgtgg120866NOV7:541ggctaatgtcatcaaccattttgcctgtgagattctctccctcattaagctgacctgttc600||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120867ggctaatgtcatcaaccattttgcctgtgagattctctccctcattaagctgacctgttc120926NOV7:601tgataccagcctcaatgaatttatgatcctcatcaccagtatcttcaccctgctgctacc660||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120927tgataccagcctcaatgaatttatgatcctcatcaccagtatcttcaccctgctgctacc120986NOV7:661atttgggtttgttctcctctcctacatacgaattgctatggctatcataaggattcgctc720||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120987atttgggtttgttctcctctcctacatacgaattgctatggctatcataaggattcgctc121046NOV7:721actccagggcaggctcaaggcctttaccacatgtggctctcacctgaccgtggtgacaat780||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:121047actccagggcaggctcaaggcctttaccacatgtggctctcacctgaccgtggtgacaat121106NOV7:781cttctatgggtcagccatctccatgtatatgaaaactcagtccaagtcctaccctgacca840||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:121107cttctatgggtcagccatctccatgtatatgaaaactcagtccaagtcctaccctgacca121166NOV7:841ggacaagtttatctcagtgttttatggagctttgacacccatgttgaaccccctgatata900||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:121167ggacaagtttatctcagtgttttatggagctttgacacccatgttgaaccccctgatata121226NOV7:901tagcctgagnnnnnnngatgttaaacgggcaataaggaaagttatgttgaaaaggacatg960|||||||||       ||||||||||||||||||||||||||||||||||||||||||||CHRX:121227tagcctgagaaaaaaagatgttaaacgggcaataaggaaagttatgttgaaaaggacatg121286NOV7:961agccttctttgcttctaaac980||||||||||||||||||||CHRX:121287agccttctttgcttctaaac121306


[0395]

26









TABLE 26










NOV8:
2
DNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIYFFL
61
(SEQ ID NO.13)




DN T+V +F+ +G+S  PQ +   F L L IYL T+LGN +I LIH DP LETP+YFFL


OLF:
4
DNRTSVTEFIFLGLSQDPQTQVLLFFLFLFIYLLTVLGNLLIIVLIHSDPRLHTPMYFFL
63
(SEQ ID NO.51)





NOV8:
62
SNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSXXXXXXXXXXXXXXXYDRV
121




 NLSF DLC+ T ++PQ LVH       +S+  C  Q  V                YDR


OLF:
64
RNLSFADLCFSTTTVPQVLVHFLVKRKTISFAGCSTQIVVLLLVGCTECALLAVMSYDRY
123





NOV8:
122
VAISNPLRYSVVMNGPVCVCLVATSWGT-SLVLTAMLILSLRLHFCGANVINHFACEILS
180




VA+  PL YS +M   VCV L A SW + +LV       +LRL + G NVINEF CE  +


OLF:
124
VAVCKPLHYSTIMTHWVCVQLAAGSWASGALVSLVDTTFTLRLPYRGNNVINHFFCEPPA
183





NOV8:
181
LIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYXXXXXXXXXXXSLQGRLKAFTTCGS
240




L+KL  +DT   E  I    +  LL P   +L SY           S +GRLK F+TCGS


OLF:
184
LLKLASADTYSTEMAIFAMGVVILLAPVSLILTSYWNIISTVIQMQSGEGRLKVFSTCGS
243





NOV8:
241
HLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAIRK
300




HL VV +FYGSAI  YM+  SK   ++DK ISVFY A+TPMLNP+IYSLR KDVK A+R+


OLF:
244
HLIVVVLFYGSAIFAYMRPNSKIMNEKDKMISVFYSAVTPMLNPIIYSLRNKDVKGALRR
303





NOV8:
301
VMLK 304




+ LK


OLF:
304
ITLK 307






Where ‘+’ denotes similarity.








[0396]

27







TABLE 27










Human_OLF
MRQINQTQVTEFLLLGLSDGPHTEQLLFIVLLGVYLVTVLGN--LLLISLVHVDSQLHTP
(SEQ ID NO.52)


Mouse_OLF
MGEDNRTSVTEFIFLGLSQDPQTQVLLFFLFLFIYLLTVLGN--LLIIVLIHSDPRLHTP
(SEQ ID NO.53)


NOV7
--MDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGN--GFMIFLIHFDPNLHTP
(SEQ ID NO.13)


Rat_OLF
------------LLLGLSGYPKTEILYFVIVLVMYLVIHTGNGCYVLIIASIFDSHLHTP
(SEQ ID NO.54)



            :::*:*  *: .   * :.* :**    **   .:*     *..****





Human OLF
MYFFLCNLSLADLCFSTNIVPQALVHLLSRKKVIAFTLCAARLLFFLIFGCTQCALLAVM


Mouse_OLF
MYFFLRNLSFADLCFSTTTVPQVLVHFLVKRKTISFAGCSTQIVVLLLVGCTECALLAVM


NOV7
IYFFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAM


Rat_OLF
MYFFLGNLSFLDIT--TSSVPSTLVSLISKKRNISFSGCTVQMFVGFAMGSTECLLLGMM



:**** ***: *:   *  :*..**  :  :  :::. * .:  . : .. ::* **. *





Human_OLF
SYDRYVAICNPLRYPNIMTWKVCVQLATGSWTSGILVSVVDTTFTLRLPYRGSNSIAHFF


Mouse_OLF
SYDRYVAVCKPLHYSTIMTHWVCVQLAAGSWASGALVSLVDTTFTLRLPYRGNNVINHFF


NOV7
AYDRVVAISNPLRYSVVMNGPVCVCLVATSWGT-SLVLTAMLILSLRLHFCGANVINHFA


Rat_OLF
AFDRYVAICNPLRYSVIMSKEVYVSMASASWFSGGINSVVQTSLAMRLPFCGNNVINHFT



::** **:.:**:*. :*.  * * :.: ** :  :   .   :::** : * * * **





Human_OLF
CEAPALLILASTDTHASEMAIFLTGVVILLIPVFLILVSYGRIIVTVVKMKSTVGSLKAF


Mouse_OLF
CEPPALLKLASADTYSTEMAIFAMGVVILLAPVSLILTSYWNIISTVIQMQSGEGRLKVF


NOV7
CEILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAF


Rat_OLF
CEVLAVLKLACADISLNIVTMVISNMAFLVLPLLLIFFSYVLILYTILRMNSASGRRKAF



**  ::: *:.:*   . . :.  .:  *: *. ::: **  *  :::::.*  *  *.*





Human_OLF
STCGSHLMVVILFYGSAIITYMTPKS--SKQQE------KSVSVFYAIVTPMLNPLIYSL


Mouse OLF
STCGSHLIVVVLFYGSAIFAYMRPNSKIMNEKD------KMISVFYSAVTPMLNPIIYSL


NOV7
TTCGSHLTVVTIFYGSAISMYMKTQSKSYPDQD------KFISVFYGALTPMLNPLIYSL


Rat_OLF
STCSAHLTVVVIFYGTIFSMYAKPKSQDLTGKDKFQTSDKIISLFYGVVTPMLNPIIYSL



:**.:** ** :***: :  *  .:*     ::      * :*:**. :******:****





Human_OLF
RNKDVKAALRKVATRNFP-


Mouse_OLF
RNKDVKGALRRITLK----


NOV7
RKKDVKRAIRKVMLKRT--


Rat_OLF
RNKDVKAAVKYILKQKYIP



*:**** *:: :  :






Consensus key




*-single, fully conserved residue




:-conservation of strong groups




.-conservation of weak groups-no consensus








[0397] The OR family of the GPCR superfamily is a group of related proteins that are specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV7 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0398] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV7 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0399] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV7. PSORT analysis predicts that NOV7 is likely localized in the plasma membrane, the Golgi body, the endoplasmic reticulum (membrane), and the endoplasmic reticulum (lumen). Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 43 and 44.


[0400] NOV8


[0401] A NOV8 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV8 nucleic acid and its encoded polypeptide includes the sequences shown in Table 28. The disclosed nucleic acid (SEQ ID NO: 14) is 980 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotide 25 and ends with a TGA stop codon at nucleotide 949. The representative ORF encodes a 308 amino acid polypeptide (SEQ ID NO: 15). Putative untranslated regions up- and downstream of the coding sequence are underlined in SEQ ID NO: 14.
28TABLE 28TAATGAATAGTGGCAAGAGGGAAAGATGGCCATGGACAATGTCACAGCAGTGTTTC(SEQ ID NO.14)AGTTTCTCCTTATTGGCATTTCTAACTATCCTCAATGGAGAGACACGTTTTTCACATTAGTGCTGATAATTTACCTCAGCACATTGTTGGGGAATGGATTTATGATCTTTCTTATTCACTTTGACCCCAACCTCCACACTCCAATCTACTTCTTCCTTAGTAACCTGTCTTTCTTAGACCTTTGTTATGGAACAGCTTCCATGCCCCAGGCTTTGGTGCATTGTTTCTCTACCCATCCCTACCTCTCTTATCCCCGATGTTTGGCTCAAACGAGTGTCTCCTTGGCTTTGGCCACAGCAGAGTGCCTCCTACTGGCTGCCATGGCCTATGACCGTGTGGTTGCTATCAGCAATCCCCTGCGTTATTCAGTGGTTATGAATGGCCCAGTATGTGTCTGCTTGGTTGCTACCTCATGGGGGACATCACTTGTGCTCACTGCCATGCTCATCCTATCCCTGAGGCTTCACTTCTGTGGGGCTAATGTCATCAACCATTTTGCCTGTGAGATTCTCTCCCTCATTAAGCTGACCTGTTCTGATACCAGCCTCAATGAATTTATGATCCTCATCACCAGTATCTTCACCCTGCTGCTACCATTTGGGTTTGTTCTCCTCTCCTACATACGAATTGCTATGGCTATCATAAGGATTCGCTCACTCCAGGGCAGGCTCAAGGCCTTTACCACATGTGGCTCTCACCTGACCGTGGTGACAATCTTCTATGGGTCAGCCATCTCCATGTATATGAAAACTCAGTCCAAGTCCTACCCTGACCAGGACAAGTTTATCTCAGTGTTTTATGGAGCTTTGACACCCATGTTGAACCCCCTGATATATAGCCTGAGAAAAAAAGATGTTAAACGGGCAATAAGGAAAGTTATGTTGAAAAGGACATGAGCCTTCTTTGCTTCTAAACGTCTAAAATMAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIYFF(SEQ ID NO.15)LSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAYDRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTCGSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAIRKVMLKRT


[0402] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. NOV8 nucleic acids, polypeptides, antibodies, and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0403] The NOV8 nucleotide has a high degree of homology (99% identity) to a human genomic clone RP1-154J13 from chromosome Xq26.1-26.3 (CHRX) (GenBank Accession No.: AL049734), as shown in Table 29. The NOV8 polypeptide has homology (approximately 47% identity, 58% similarity) to a mouse B6 olfactory receptor (OLF) (GenBank Accession No.: AAG45201), as shown in Table 30. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413. OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV8 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of mouse (SEQ ID NO. 57) (GenBank Accession No.: AAB25299), rat (SEQ ID NO. 58) (GenBank Accession No.: AAB25299), and human (SEQ ID NO. 59) (GenBank Accession No.: AAG45204), as shown in Table 31.
29TABLE 29NOV8:1taatgaatagtggcaagagggaaagatggccatggacaatgtcacagcagtgtttcagtt60(SEQ ID NO.14) |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120336taatgaatagtggcaagagggaaagatggccatggacaatgtcacagcagtgtttcagtt120395(SEQ ID NO.55)NOV8:61tctccttattggcatttctaactatcctcaatggagagacacgtttttcacattagtgct120 |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120396tctccttattggcatttctaactatcctcaatggagagacacgtttttcacattagtgct120455NOV8:121gataatttacctcagcacattgttggggaatggatttatgatctttcttattcactttga180||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120456gataatttacctcagcacattgttggggaatggatttatgatctttcttattcactttga120515NOV8:181ccccaacctccacactccaatctacttcttccttagtaacctgtctttcttagacctttg240||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120516ccccaacctccacactccaatctacttcttccttagtaacctgtctttcttagacctttg120575NOV8:241ttatggaacagcttccatgccccaggctttggtgcattgtttctctacccatccctacct300||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120576ttatggaacagcttccatgccccaggctttggtgcattgtttctctacccatccctacct120635NOV8:301ctcttatccccgatgtttggctcaaacgagtgtctccttggctttggccacagcagagtg360||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120636ctcttatccccgatgtttggctcaaacgagtgtctccttggctttggccacagcagagtg120695NOV8:361cctcctactggctgccatggcctatgaccgtgtggttgctatcagcaatcccctgcgtta420||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120696cctcctactggctgccatggcctatgaccgtgtggttgctatcagcaatcccctgcgtta120755NOV8:421ttcagtggttatgaatggcccagtatgtgtctgcttggttgctacctcatgggggacatc480||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120756ttcagtggttatgaatggcccagtatgtgtctgcttggttgctacctcatgggggacatc120815NOV8:481acttgtgctcactgccatgctcatcctatccctgaggcttcacttctgtggggctaatgt540||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120816acttgtgctcactgccatgctcatcctatccctgaggcttcacttctgtggggctaatgt120875NOV8:541catcaaccattttgcctgtgagattctctccctcattaagctgacctgttctgataccag600||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120876catcaaccattttgcctgtgagattctctccctcattaagctgacctgttctgataccag120935NOV8:601cctcaatgaatttatgatcctcatcaccagtatcttcaccctgctgctaccatttgggtt660||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120936cctcaatgaatttatgatcctcatcaccagtatcttcaccctgctgctaccatttgggtt120995NOV8:661tgttctcctctcctacatacgaattgctatggctatcataaggattcgctcactccaggg720||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:120996tgttctcctctcctacatacgaattgctatggctatcataaggattcgctcactccaggg121055NOV8:721caggctcaaggcctttaccacatgtggctctcacctgaccgtggtgacaatcttctatgg780||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:121056caggctcaaggcctttaccacatgtggctctcacctgaccgtggtgacaatcttctatgg121115NOV8:781gtcagccatctccatgtatatgaaaactcagtccaagtcctaccctgaccaggacaagtt840||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:121116gtcagccatctccatgtatatgaaaactcagtccaagtcctaccctgaccaggacaagtt121175NOV8:841tatctcagtgttttatggagctttgacacccatgttgaaccccctgatatatagcctgag900||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:121176tatctcagtgttttatggagctttgacacccatgttgaaccccctgatatatagcctgag121235NOV8:901nnnnnnngatgttaaacgggcaataaggaaagttatgttgaaaaggacatgagccttctt960       ||||||||||||||||||||||||||||||||||||||||||||||||||||CHRX:121236aaaaaaagatgttaaacgggcaataaggaaagttatgttgaaaaggacatgagccttctt121295NOV8:961tgcttctaaacgtctaaaat980||||||||||||||||||||CHRX:121296tgcttctaaacgtctaaaat121315


[0404]

30









TABLE 30










NOV8:
1
MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIY
60
(SEQ ID NO.15)




M DN T+V +F+ +G+S  PQ +   F L L IYL T+LGN  +I LIH DP LHTP+Y


OLF:
1
MGEDNRTSVTEFIFLGLSQDPQTQVLLFFLFLFIYLLTVLGNLLIIVLIHSDPRLHTPMY
60
(SEQ ID NO.56)





NOV8:
61
FFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSXXXXXXXXXXXXXXXY
120




FFL NLSF DLC+ T ++PQ LVH       +S+  C  Q  V                Y


OLF:
61
FFLRNLSFADLCFSTTTVPQVLVHFLVKRKTISFAGCSTQIVVLLLVGCTECALLAVMSY
120





NOV8:
121
DRVVAISNPLRYSVVMNGPVCVCLVATSWGT-SLVLTAMLILSLRLHFCGANVINHFACE
179




DR VA+  PL YS +M   VCV L A SW + +LV       +LRL + G NVINHF CE


OLF:
121
DRYVAVCKPLHYSTIMTHWVCVQLAAGSWASGALVSLVDTTFTLRLPYRGNNVINHFFCE
180





NOV8:
180
ILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYXXXXXXXXXXXSLQGRLKAFTT
239




  +L+KL  +DT   E  I    +  LL P   +L SY           S +GRLK F+T


OLF:
181
PPALLKLASADTYSTEMAIFAMGVVILLAPVSLILTSYWNIISTVIQMQSGEGRLKVFST
240





NOV8:
240
CGSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRA
299




CGSHL VY +FYGSAI  YM+  SK   ++DK ISVFY A+TPMLNP+IYSLR KDVK A


OLF:
241
CGSHLIVVVLFYGSAIFAYMRPNSKIMNEKDKMISVFYSAVTPMLNPIIYSLRNKDVKGA
300





NOV8:
300
IRKVMLK
306




+R++ LK


OLF:
301
LRRITLK
307






Where ‘+’ denotes similarity








[0405]

31







TABLE 31










Mouse_OLF
MGEDNRTSVTEFIFLGLSQDPQTQVLLFFLFLFIYLLTVLGNL--LIIVLIHSDPRLHTP






NOV8
MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNG--FMIFLIHFDPNLHTP





Rat_OLF
------------LLLGLSGYPKTEILYFVIVLVMYLVIHTGNGCYVLIIASIFDSHLHTP





Human_OLF
---------MGFVLLRLSAHPELEKTFFVLILLMYLVILLGNG--VLILVTILDSRLHTP






            ::: :* *: .   * :.*.:**    **   .:*.    *..****





Mouse_OLF
MYFFLRNLSFADLCFSTTTVPQVLVHFLVKRKTISFAGCSTQIVVLLLVGCTECALLAVM





NOV8
IYFFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAM





Rat_OLF
MYFFLGNLSFLDI--TTSSVPSTLVSLISKKRNISFSGCTVQMFVGFAMGSTECLLLGMM





Human_OLF
MYFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMM






:**** **** *:   *:::* .*   :  :  :*:. * .*  : : :. :** **. *





Mouse_OLF
SYDRYVAVCKPLHYSTIMTHWVCVQLAAGSWASGALVSLVDTTFTLRLPYRGNNVINHFF





NOV8
AYDRVVAISNPLRYSVVMNGPVCVCLVATSWGT-SLVLTAMLILSLRLHFCGANVINHFA





Rat_OLF
AFDRYVAICNPLRYSVIMSKEVYVSMASASWFSGGINSVVQTSLAMRLPFCGNNVINHFT





Human_OLF
AFDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFT






::** **:.:**:**.:*.  . : :.: **   .    .   ::::* : * ******





Mouse_OLF
CEPPALLKLASADTYSTEMAIFAMGVVILLAPVSLILTSYWNIISTVIQMQSGEGRLKVF





NOV8
CEILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAF





Rat_OLF
CEVLAVLKLACADISLNIVTMVISNMAFLVLPLLLIFFSYVLILYTILRMNSASGRRKAF





Human_OLF
CEILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVF






** :::**:.:*    . . :   .:  *  *. ::  **  *  ::::: * .** *.*





Mouse_OLF
STCGSHLIVVVLFYGSAIFAYMRPNSK------IMNEKDKMISVFYSAVTPMLNPIIYSL





NOV8
TTCGSHLTVVTIFYGSAISMYMKTQSK------SYPDQDKFISVFYGALTPMLNPLIYSL





Rat_OLF
STCSAHLTVVVIFYGTIFSMYAKPKSQDLTGKDKFQTSDKIISLFYGVVTPMLNPIIYSL





Human_OLF
STCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSL






:**.:** ** :***: :  * :.:*:          .**:*.:**..:******:****





Mouse_OLF
RNKDVKGALRRLTLK----- (SEQ ID NO. 57)





NOVB
RKKDVKRAIRKVMLKRT--- (SEQ ID NO. 15)





Rat_OLF
RNKDVKAAVKYILKQKYIP- (SEQ ID NO. 58)





Human_OLF
RNKDVKAAVRRLLRPKGFTQ (SEQ ID NO. 59)






*:**** *:: :



Consensus key




* - single, fully conserved residue




: - conservation of strong groups




. - conservation of weak groups - no consensus








[0406] The OR family of the GPCR superfamily is a group of related proteins located at the ciliated surface of olfactory sensory neurons in the nasal epithelium. The OR family is involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV8 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0407] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV8 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0408] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV8. PSORT analysis predicts that NOV8 is likely localized in the plasma membrane, the Golgi body, the endoplasmic reticulum (membrane), and the endoplasmic reticulum (lumen). Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 43 and 44.


[0409] NOV9


[0410] A NOV9 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV9 nucleic acid and its encoded polypeptide includes the sequences shown in Table 32. The NOV8 nucleic acid sequence (SEQ ID NO. 14) was further analyzed by exon linking, and the resulting sequence was identified as NOV9. The disclosed nucleic acid (SEQ ID NO: 16) is 980 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotide 35 and ends with a TAG termination codon at nucleotide 958. The representative ORF encodes a 308 amino acid polypeptide (SEQ ID NO: 17). Putative untranslated regions are upstream of the initiation codon and downstream of the termination codon in SEQ ID NO: 16.
32TABLE 32GCATCCATTTAATGAATAGTGGCAAGAGGGAAAGATGGCCATGGACAATGTCACAG(SEQ ID NO. 16)CAGTGTTTCAGTTTCTCCTTATTGGCATTTCTAACTATCCTCAATGGAGAGACACGTTTTTCACATTAGTGCTGATAATTTACCTCAGCACATTGTTGGGGAATGGATTTATGATCTTTCTTATTCACTTTGACCCCAACCTCCACACTCCAATCTACTTCTTCCTTAGTAACCTGTCTTTCTAGACCTTTGTTATGGAACAGCTTCCATGCCCCAGGCTTTGGTGCATTGTTTCTCTACCCATCCCTACCTCTCTTATCCCCGATGTTTGGCTCAAACGAGTGTCTCCTTGGCTTTGGCCACAGCAGAGTGCCTCCTACTGGCTGCCATGGCCTATGACCGTGTGGTTGCTATCAGCAATCCCCTGCGTTATTCAGTGGTTATGAATGGCCCAGTGTGTGTCTGCTTGGTTGCTACCTCATGGGGGACATCACTTGTGCTCACTGCCATGCTCATCCTATCCCTGAGGCTTCACTTCTGTGGGGCTAATGTCATCAACCATTTTGCCTGTGAGATTCTCTCCCTCATTAAGCTGACCTGTTCTGATACCAGCCTCAATGAATTTATGATCCTCATCACCAGTATCTTCACCCTGCTGCTACCATTTGGGTTTGTTCTCCTCTCCTACATACGAATTGCTATGGCTATCATAAGGATTCGCTCACTCCAGGGCAGGCTCAAGGCCTTTACCACATGTGGCTCTCACCTGACCGTGGTGACAATCTTCTATGGGTCAGCCATCTCCATGTATATGAAAACTCAGTCCAAGTCCTCCCCTGACCAGGACAAGTTTATCTCAGTGTTTTATGGAGCTTTGACACCCATGTTGAACCCCCTGATATATAGCCTGAGAAAAAAAGATGTTAAACGGGCAATAAGGAAAGTTATGTTGAAAAGGACATGAGCCTTCTTTGCTTCTAAACGTCTAAAATMAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIYFF(SEQ ID NO. 17)LSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAYDRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTCGSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAIRKVMLKRT


[0411] A target sequence previously identified as Accession Number AL135784_A was subjected to the exon linking process in two separate procedures. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such suitable sequences were then employed as the forward and reverse primers in a PCR amplification based on a library containing a wide range of cDNA species. The resulting amplicons were gel purified, cloned and sequenced to high redundancy to provide the sequence reported below, which are designated Accession Numbers AC135784B and AC135784B_da1.


[0412] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium that are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV9 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0413] The NOV9 polypeptide has a high degree of homology (99% identity) to the NOV8 polypeptide as shown in Table 33. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413. Thus NOV8 and NOV9 belong to the same subfamily of ORs.


[0414] OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains.
33TABLE 33NOV9MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIYNOV8MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMTFLIHFDPNLHTPIY     ************************************************************NOV9FFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAYNOV8FFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAY     *************************************************************NOV9DRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEINOV8DRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEI     *************************************************************NOV9LSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTCNOV8LSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTC     ************************************************************NOV9GSHLTVVTIFYGSAISMYMKTQSKSYPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAINOV8GSHLTVVTIFYGSAISMYMKTQSKSSPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRAI      ************************************************************NOV9RKVMLKRT (SEQ ID NO:17)NOV8RKVMLKRT (SEQ ID NO:15)     ********      Consensus key* - single, fully conserved residue


[0415] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium that are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV9 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0416] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV9 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0417] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV9. PSORT analysis predicts that NOV9 is likely localized in the plasma membrane. Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 43 and 44.


[0418] Possible SNPs found:


[0419] 106: gap->C(7)


[0420] 126555085(i), phred 35


[0421] 126555099(i), phred 45


[0422] 126555115(i), phred 34


[0423] 126555172(i), phred 19


[0424] 126555218(i), phred 49


[0425] 126555196(i), phred 45


[0426] 126555131(i), phred 40


[0427] 185: A->C(7)


[0428] 126555085(i), phred 39


[0429] 126555099(i), phred 49


[0430] 126555115(i), phred 33


[0431] 126555172(i), phred 39


[0432] 126555218(i), phred 49


[0433] 126555196(i), phred 49


[0434] 126555131(i), phred 38


[0435] 317: C->T(6)


[0436] 126555085(i), phred 24


[0437] 126555099(i), phred 39


[0438] 126555115(i), phred 26


[0439] 126555218(i), phred 34


[0440] 126555196(i), phred 34


[0441] 126555131(i), phred 42


[0442] 691: A->G(6)


[0443] 119262851(i), phred 25


[0444] 119262805(i), phred 28


[0445] 119262828(i), phred 22


[0446] 119262814(i), phred 34


[0447] 119262799(i), phred 32


[0448] 119262822(i), phred 23


[0449] NOV10


[0450] A NOV10 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV10 nucleic acid and its encoded polypeptide includes the sequences shown in Table 34. The disclosed nucleic acid (SEQ ID NO: 18) is 1012 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 25-27 and ends with a TGA stop codon at nucleotides 988-990. The representative ORF encodes a 321 amino acid polypeptide (SEQ ID NO: 19). Putative untranslated regions up- and downstream of the coding sequence are underlined in SEQ ID NO: 18.
34TABLE 34TCATTTCCTTCATAGATTAGAAGAATGAGTGTCATAGAAGCCAATAACATTTCTGGG(SEQ ID NO. 18)CCTGTGAGTGAATTTATCCTCCTGGGCTTCCCTGCCTGCTGCAGGGAGACCAAGATCCTCCTCTTTGTGGTCTTCTCCCTCATCTACCTTCTGACCCTCATGGGTAACACATCCATCATCTGCGCTGTGTGGTCAAGCCAGAAACTCCACACACCTATGTACATCCTCTTGGCTAATTTCTCTTTCCTGGAGATCTGCTGCATTAGTTCTGATGTCCCAATGTTGGCCAATCTCATCTCCCATATCAAGAGCATCTCCTATGCTGGCTGCCTGCTCCAGTTCTTCTACTTCTCCATGTGTGCTGCAGAAGGCTACTTTCTGTCTGTGATGTCCTTTGATCGGTTCCTTACCATCTGTCGACCTTTGCATTATCCCACAGTCATGACTCACCACCTGTGTGTCCGATTAGTGGCCTTCTGCAGGGCAGGTGGTTTTCTATCCATACTGATGCCTGCAGTGCTTATGTCCCGAGTGCCTTTCTGTGGCCCTAACATCACTGACCATTTTTTCTGTAACCTGGGACCATTGCTGGCACTGTCCTGTGCCCCAGTTCCCAAAACTACTCTGACTTGTGCTACAGTAAGCTCTCTCATCATCTTCATCACCTTCCTCTACATTCTTGGGTCCCATATCTTAGTTTTGCGAGCTGTTCTGTGGGTCCCAGCTGGCTCAGGCAGGAACAAAGCTTTCTCTACATGTGCTTCCCATTTCTTGGTTGTTTCTTTCTTCTATGGCTCAGTCATGGTGATGTATGTGAGTCCAGGCTCCAGGAGCCGCCCTGGGACACAGAAATTTGTGACATTGTTTTACTGCACAGCAACCCCATTCTTTAATCCCCTGACCTACAGTCTCTGGAACAAAGATATGACAGATGCCCTTAAAAAAGTGCTGGGAGTGCCATCAAAAGAAATATATTGGAACACACTGAAATGATATACATTCTTCTACAATTATTMSVIEANNISGPVSEFILLGFPACCRETKILLFVVFSLIYLLTLMGNTSIICAVWSSQKLHTP(SEQ ID NO. 19)MYILLANFSFLEICCISSDVPMLANLISHIKSISYAGCLLQFFYFSMCAAEGYFLSVMSFDRFLTICRPLHYPTVMTHHLCVRLVAFCRAGGFLSILMPAVLMSRVPFCGPNITDHFFCNLGPLLALSCAPVPKTTLTCATVSSLIIFITFLYILGSHILVLRAVLWVPAGSGRNKAFSTCASHFLVVSFFYGSVMVMYVSPGSRSRPGTQKFVTLFYCTATPFFNPLTYSLWNKDMTDALKKVLGVPSKEIYWNTLK


[0451] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium that are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV10 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0452] The NOV10 polypeptide has homology (approximately 55% identity, 69% similarity) to mouse odorant receptor S1 (OLF) (GenBankAccession No.: AAD27592), as is shown in Table 35. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413.


[0453] OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV10 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of mouse (SEQ ID NO. 81) (GenBank Accession No.: NP064684), rat (SEQ ID NO. 82) (GenBank Accession No.: P23270), and human (SEQ ID NO. 99) (GenBank Accession No.: CAB42853), as shown in Table 36.
35TABLE 35NOV10:7NNISGPVSEFILLGFPACCRETKILLFVVFSLIYLLTLMGNTSIICAVWSSQKLHTPMYI66N +V+EF+LLGFP ++I LFV+F +Y+LTL+GN +IICAV +LHTPMYOLF:13NRSAAHVTEFVLLGFPGSWK-IQIFLFVLFLVFYVLTLLGNGAIICAVRCDSRLHTPMYF71NOV10:67LLANFSFLEICCISSDVP-MLANLISHIKSISYAGCLLQF-FYFSMCAAEGYFLSVMSFD124LL NFSFLEI  +SS +P +LAN++S  K+IS++GC LQF F+FS+   E  FL+VM++DOLF:72LLGNFSFLEIWYVSSTIPNILANILSKTKAISFSGCGLQFYFFFSLGTTECLFLAVMAYD131NOV10:125RFLTICRPLHYPTVMTHHLCVRLVAFCRAGGFLSILMPAVLMSRVPFCGPNITDHFFCNL184R+LICRPLHYPT+MT  LC LV+C   GFL   +P   +S++PFCG NI DHF C++OLF:132RYLAICRPLHYPTIMTRRLCCILVSSCWLIGFLGYPIPIFSISQLPFCGSNIIDHFLCDM191NOV10:185GPLLALSCAPVPKTTLTCATVSSLIIFITFLYILGSHILVLRAVLWVPAGSGRNKAFSTC244PL+ALSCAP P T       SS ++F T  YIL S+IL+LRAV  VP++GR KAFSTCOLF:192DPLMALSCAPAPITEFIFYAQSSFVLFFTIAYILRSYILLLRAVFQVPSAAGRRKAFSTC251NOV10:245ASHFLVVSFFYGSVMVMYVSPGSRSRPGTQKFVTLFYCTATPFFNPLTYSLWNKDMTDAL304SH +VVS FYG+VMVMYVSP        QK +TL   Y TP FNPL YSL NKDM ALOLF:252GSHLVVVSLFYGTVMVMYVSPTYGIPILMQKILTLVYSVMTPLFNPLIYSLRNKDMKLAL311NOV10:305KKVL 308 (SEQ ID NO. 19)+VLOLF:312RNVL 315 (SEQ ID NO. 78)Where ‘+ ’ denotes similarity.


[0454]

36







TABLE 36










mouse_OLF
MSLFPQRNLDAMNRSAAHVTEFVLLGFPG-SWKIQIFLFVLFLVFYVLTLLGNGAIICAV



NOV10
MSVIEANNISGP------VSEFILLGFPACCRETKILLFVVFSLIYLLTLMGNTSIICAV


rat_OLF
---MERRNHSGR------VSEFVLLGFPA-PAPLRVLLFFLSLLXYVLVLTENMLIIIAI


human_OLF
---MDQSNYSS-------LHGFILLGFSN-HPKMEMILSGVVAIFYLITLVGNTAIILAS






:  * ..    : *:****.    .::*  :  : *::.*  *  ** *





mouse_OLF
RCDSRLHTPMYFLLGNFSFLEIWYVSSTIPNILANILS----KTKAISFSGCFLQFYFFF


NOV10
WSSQKLHTPMYILLANFSFLEICCISSDVP-MLANLIS----HIKSISYAGCLLQF-FYF


rat_OLF
RNHPTLHKPMYFFLANMSFLEIWYVTVTIPKMLAGFIGSKENHGQLISFEWCMTQLYFFL


human_OLF
LLDSQLHTPMYFFLRNLSFLDLCFTTSIIPQMLVNLWG----PDKTISYVGCIIQLYVYM



  **.***::* *:***::  :  :* :*..: .   : **: .*: *: .::





mouse_OLF
SLGTTECLFLAVMAYDRYLAICRPLHYPTIMTRRLCCILVSSCWLIGFLGYPIPIFSISQ


NOV10
SMCAAEGYFLSVMSFDRFLTICRPLHYPTVMTHHLCVRLVAFCRAGGFLSILMPAVLMSR


rat_OLF
GLGCTECVLLAVMAYDRYVAICHPLHYPVIVSSRLCVQMAAGSWAGGFGISMVKVFLISR


human_OLF
WLGSVECLLLAVMSYDRFTAICKPLHYFVVMNPHLCLKMIIMIWSISLANSVVLCTLTLN



:  .*  :*:**::**: :**:**** .::. :**  :   .:  :   .





mouse_OLF
LPFCGSNIIDHFLCDMDPLMALSCAPAPITEFIFYAQSSFVLFFTIAYILRSYILLLRAV


NOV10
VPFCGPNITDHFFCNLGPLLALSCAPVPKTTLTCATVSSLIIFITFLYILGSHILVLRAV


rat_OLF
LSYCGPNTINHFFCDVSPLLNLSCTDMSTAEKTDFVLAIFILLGPLSVTGASYMAITGAV


human_OLF
LPTCGNNILDHFLCELPALVKIACVDTTTVEMSVFALGIIIVITPLILILISYGYIAKAV





:. ** *  :**:*:: .*: ::*. . . :  . . :::: .:  *:  :  **





mouse_OLF
FQVPSAAGRRKAFSTCGSHLVVVSLFYGTVMYMYVSPTYGIPILMQKILTLVYSVMTPLF


NOV10
LWVPAGSGRNKAFSTCASHFLVVSFFYGSVMVMYVSPGSRSRPGTQKFVTLFYCTATPFF


rat_OLF
MRIPSAAGRHKAFSTCASHLTVVIIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLF


human_OLF
LRTKSKASQRKAMNTCGSHLTVVSMFYGTIIYMYLQPGNRASKDQGKFLTLFYTVITPSL





:   : :.:.**:.**.**: ** :**.: : :*  *         *::::.* . .* :





mouse_OLF
NPLIYSLRNKDMKLALRNVL--LGMRIVKNM------- (SEQ ID NO. 81)


NOV10
NPLTYSLWNKDMTDALKKVLGVPSKEIYWNTLK----- (SEQ ID NO. 19)


rat_OLF
NPIIYCLRNQDVKRALRRTLH-LAQDQEANTNKGSKIG (SEQ ID NO. 82)


human_OLF
NPLIYTLRNKDMKDALKKLMRFHHKSTKIKRNCKS--- (SEQ ID NO. 99)



**: * * *:*:. **:. :         :


          Consensus key


* - single, fully conserved residue


: - conservation of strong groups


. - conservation of weak groups - no consensus










[0455] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium that are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV9 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0456] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV10 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0457] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV10. PSORT analysis predicts that NOV10 is likely localized in the plasma membrane, Golgi body, endoplasmic reticulum (membrane), and mitochondrial inner membrane. Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 46 and 47.


[0458] NOV11


[0459] A NOV11 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV11 nucleic acid and its encoded polypeptide includes the sequences shown in Table 37. The disclosed nucleic acid (SEQ ID NO:20) is 1,178 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotide 154 and ends with a TAG stop codon at nucleotide 1093. The representative ORF encodes a 312 amino acid polypeptide (SEQ ID NO:21). Putative untranslated regions up- and downstream of the coding sequence are underlined in SEQ ID NO. 20.
37TABLE 37TCATCCTTCCAAGGGGAAGAGAGCAGTATCCCAAATCCAAATTGAAGAAATAAAC(SEQ ID NO. 20)ATATATCTATTCACCAGAAGAGATAGAAGGGAGACAGGGCAGAATTTCTGTGGTTCTTACTATCTCTGTCACCTCTACAGGCCAAACCAGTGAGGACCTTGGAGACTACTAATACCACTGGATTTGTAAATGAGTTCATCCTCTTGGGCTTCCCCTGCCGCTGGGAGATCCAGATCCTCCTTTTTGTGGTCTTCTCTCTCATCTACCTTCTGACCCTCCTAGGTAACACATCCATCATCTGTGCTGTGTGGTCAAGCCAGAAACTCCACACACCTATGTACATCCTACTGGCCAATTTCTCCTTCCTGGAGATCTGCTGTGTCAGTTCTGACGTGCCCATAATGGCAGCCAATCTCATCTCCCAGACACAGAGCATCTCCTGTGCTGGCTGCCTGCTCCGGTTCTACTTCTTCTCCATGTGTGCTGCAGAGTGCTTATTTCTGTCAGTGATGTCTTTTGATAGGTTTCCTGCCATTTGTAGACCTTTGCACTATCCCACCTTAATGACCCATCACGTTTGTGCTCATTTTGTGATCTTCTGCTGGGTGGGTGGCTGTCTCTGGTTATTGACCCCTTTGACACTAATATCTCAGGTCCTCTTTTGTGGTCCAAACACTATCGACCATTTTTTCTGTGATCTGGCACCTTTGCTGGCACTGTCTTGTGCTCCAATACCTGGAATTACTCTGACTTGTGGTATCATTAGCGCTCTCATCATCTTTCTTACCTTCTTGTATATCCTTGGGACTTATTTCTGTGTTCTAAGCACAGTGCTACAGGTGCCTTCAGGCTTAGGAAGGCATAAGGCTTTCTCAACTTGTGGCTGTCACCTTGCTGTAGTGTCTCTCTTCTATGGTTCTCTTATGGTGATGTATGTTAGCCCAGGTTCTGGGGACTATCATGGGATAAAGAAATTTGTGACCTTGTTCTATACTTTGTCAACTCCATTCTTTAATCCTCTGATCTACAGTTTCCGGAACAAGGATATGAAAGAGGCACTAAAGAAATTTCTGAGGAATCGCCACACTGTCGATTGAACCAGTGTGGCGATTCCTCAGGGATCTAGAACTAGAAATACCATTTGACCCAGCCATCCCATTACTGGGTATATACCCAAAGGACLETTNTTGFVNEFILLGFPCRWEIQILLFVVFSLIYLLTLLGNTSIICAVWSSQKLHTPMYIL(SEQ ID NO. 21)LANFSFLEICCVSSDVPIMAANLISQTQSISCAGCLLRFYFFSMCAAECLFLSVMSFDRFPAICRPLHYPTLMTHHVCAHFVIFCWVGGCLWLLTPLTLISQVLFCGPNTIDHFFCDLAPLLALSCAPIPGITLTCGIISALIIFLTFLYILGTYFCVLSTVLQVPSGLGRHKAFSTCGCHLAVVSLFYGSLMVMYVSPGSGDYHGIKKFVTLFYTLSTPFFNPLIYSFRNKDMKEALKKFLRNRHTVD


[0460] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV10 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0461] The NOV11 polypeptide has homology (57% identity, 70% similarity) to a mouse odorant receptor S1 (OLF) (GenBank Accession No. AAD27592), as shown in Table 38. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413. OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV11 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of mouse (SEQ ID NO. 60) (GenBank Accession No.: NP064684), rat (SEQ ID NO. 61) (GenBank Accession No.: AAC17222), and human (SEQ ID NO. 62) (GenBank Accession No.: NP039225), as shown in Table 39.
38TABLE 38NOV11: 10VNEFILLGFPCRWEIQILLFVVFSLIYLLTLLGNTSIICAVWSSQKLHTPMYILLANFSF69V EF+LLGFP  W+IQI LFV+F + Y+LTLLGN +IICAV    +LHTPMY LL NFSFOLF: 19VTEFVLLGFPGSWKIQIFLFVLFLVFYVLTLLGNGAIICAVRCDSRLHTPMYFLLGNFSF78NOV11: 70LEICCVSSDVPIMAANLISQTQSISCAGCLLRFY-FFSMCAAECLFLSVMSFDRFPAICR128LEI  VSS +P + AN++S+T++IS +GC L+FY FFS+   ECLFL+VM++DR+ AICROLF: 79LEIWYVSSTIPNILANILSKTKAISFSGCFLQFYFFFSLGTTECLFLAVMAYDRYLAICR138NOV11: 129PLHYPTLMTHHVCAHFVIFCWVGGCLWLLTPLTLISQVLFCGPNTIDHFFCDLAPLLALS188PLHYPT+MT  +C   V   CW+ G L    P+  ISQ+ FCG N IDHF CD+ PL+ALSOLF: 139PLHYPTIMTRRLCCILVSSCWLIGFLGYPIPIFSISQLPFCGSNIIDHFLCDMDPLMALS198NOV11: 189CAPIPGITLTCGIISALIIFLTFLYILGTYFCVLSTVLQVPSGLGRHKAFSTCGCHLAVV248CAP P         S+ ++F T  YIL +Y+L  V QVPS GR KAFSTCG HL VVOLF: 199CAPAPITEFIFYAQSSFVLFFTIAYILRSYILLLRAVFQVPSAAGRRKAFSTCGSHLVVV258NOV11: 249SLFYGSLMVMYVSPGSGDYHGIKKFVTLFYTLSTPFFNPLIYSFRNKDMKEALKKFL 305 (SEQ ID NO. 21)SLFYG++MVMYVSP  G    ++K +TL Y++ TP FNPLIYS RNKDMK AL+  LOLF: 259SLFYGTVMVMYVSPTYGIPILMQKILTLVYSVMTPLFNPLIYSLRNKDMKLALRNVL 315 (SEQ ID NO. 100)Where ‘+’ denotes similarity.


[0462]

39







TABLE 39










Mouse_OLF
MSLFPQRNLDAMNRSAAHVTEFVLLGFPGSWKIQIFLFVLFLVFYVLTLLGNGAIICAVR






NOV11
--------LETTN-TTGFVNEFILLGFPCRWEIQILLFVVFSLIYLLTLLGNTSIICAVW





Human_OLF
--------MEIVSTGNETITEFVLLGFYDIPELHFLFFIVFTAVYVFIIIGNMLIIVAVV





Rat_OLF
----MTVNCSLWQENSLTVKHFAFAKFSEVPGECFLLFNLILLMFLVSLTGNTLIVLAIC






   . .   :..* : *    :::* :: .::. : ** *: *:





Mouse_OLF
CDSRLHTPMYFLLGNFSFLEIWYVSSTIPNILANILSKTKAISFSGCFLQFYFFFSLGTT





NOV11
SSQKLHTPMYILLANFSFLEICCVSSDVPIMAANLISQTQSISCAGCLLRFY-FFSMCAA





Human_OLF
SSQRLHKPMYIFLANLSFLDILYTSAVMPKMLEGFL-QEATISVAGCLLQFFIFGSLATA





Rat_OLF
TPSPLHTPMYFFLANLSLLEIGYTCSVIPKMLQSLVSEAREISREGCATQMFFFAFFGIT






 .  **.***::*.*:*:*:*  ..: :* :  .:: :   **  **  ::: *  :  :





Mous-OLF
ECLFLAVMAYDRYLAICRPLHYPTIMTRRLCCILVSSCWLIGFLGYPIPIFSISQLPFCG





NOV11
ECLFLSVMSFDRFPAICRPLHYPTLMTHHVCAHFVIFCWVGGCYWLLTPLTLISQVLFCG





Human_OLF
ECLLLAVMAYDRYLAICYPLHYPLLMGPRRYMGLVVTTWLSGFVVDGLVVALVAQLRFCG





Rat_OLF
ECCLLAAMAFDRCMAICSPLHYATRMSREVCAHLAIVSWGMGCIVSLGQTNFIFSLNFCG






** :*:.*::**  *** ****.  *  .    :.  *  * :         : .: ***





Mouse_OLF
SNIIDEFLCDMDPLMALSCAPAPITEFIFYAQSSFVIFFTTAYILRSYILLLRAVFQVPS
(SEQ ID NO. 60)





NOV11
PNTIDHFFCDLAPLLALSCAPIPGITLTCGIISALIIFLTFLYILGTYFCVLSTVLQVPS
(SEQ ID NO. 21)





Human_OLF
PNHIDQFYCDFMLFVGLACSDPRVAQVTTLILSVFCLTIPFGLILTSYARIVVAVLRVPA
(SEQ ID NO. 61)





Rat_OLF
PCEIDHFFCDLPPLLALACGDTSQNEAAIFVVAVLCISSPFLLIIYSYVKILIAVLLMPS
(SEQ ID NO. 62)






.  **:* **:  ::.*:*.            : : :  .:  *: :*  :: :*: :*:





           Consensus key


* - single, fully conserved residue


: - conservation of strong groups


. - conservation of weak groups - no consensus







[0463] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium that are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV11 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0464] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV11 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0465] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV11. PSORT analysis predicts that NOV11 is likely localized in the plasma membrane, Golgi body, endoplasmic reticulum (membrane), and mitochondrial inner membrane. Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 42 and 43.


[0466] NOV12


[0467] A NOV12 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV12 nucleic acid and its encoded polypeptide includes the sequences shown in Table 40. The disclosed nucleic acid (SEQ ID NO: 22) is 1,014 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 12-14 and ends with a TGA stop codon at nucleotides 969-971. The representative ORF encodes a 319 amino acid polypeptide (SEQ ID NO: 23). Putative untranslated regions are upstream of the initiation codon and downstream of the termination codon SEQ ID NO: 22.
40TABLE 40GGAGAGACCACACTGCCATGCCTCCCTCTGGGCCCCGAGGAACCCTCCTTCTGTCGC(SEQ ID NO. 22)TGCTGCTGCTGCTCCTGCTTCGCGCCGTGCTGGCTGTCCCCCTGGAGCGAGGGGCGCCCAACAAGGAGGAGACCCCTGCGACTGAGAGTCCCGACACAGGCCTGTACTACCACCGGTACCTCCAGGAGGTCATCGATGTACTGGAGACGGATGGGCATTTCCGAGAGAAGCTGCAGGCTGCCAATGCGGAGGACATCAAGAGCGGGAAGCTGAGCCGAGAGCTGGACTTTGTCAGCCACCACGTCCGCACCAAGCTGGATGAGCTCAAGCGACAGGAGGTGTCACGGCTGCGGATGCTGCTCAAGGCCAAGATGGACGCCGAGCAGGATCCCAATGTACAGGTGGATCATCTGAATCTCCTGAAACAGTTTGAACACCTGGACCCTCAGAACCAGCATACATTCGAGGCCCGCGACCTGGAGCTGCTGATCCAGACGGCCACCCGGGACCTTGCCCAGTACGACGCAGCCCATCATGAAGAGTTCAAGCGCTACGAGATGCTTAAGGAACACGAGAGACGGCGTTATCTGGAGTCACTGGGAGAGGAGCAGAGAAAGGAGGCGGAGAGGAAGCTGGAAGAGCAACAGCGCCGGCACCGCGAGCACCCTAAAGTCAACGTGCCTGGCAGCCAAGCCCAGTTGAAGGAGGTGTGGGAGGAGCTGGATGGACTGGACCCCAACAGGTTTAACCCCAAGACCTTCTTCATACTGCATGATATCAACAGTGATGGTGTCCTGGATGACAGGAGCTGGAGGCTCTCTTCACCAAGGAGCTGGAGAAAGTGTACGACCCAAAGAATGAGGAGGACGACATGCGGGAGATGGAGGAGGAGCGACTGCGCATGCGGGAGCAGTTGATGAAGAATGTGGACACCAACCAGGACCGCCTCGTGACCCTGGAGGAGTTCCTCGCATCCACTCAGAGGAAGGAGTTTGGGGACACCGGGGAGGGCTGGGAGACAGTGGAGATGCACCCTGCCTACACCGAGGAAGAGCTGAGGCGCTTTGAAGAGGAGCTGGCTGCCCGGGAGGCAGAGCTGAATGCCAAGGCCCAGCGCCTCAGCCAGGAGACAGAGGCTCTAGGGCGCTCCCAGGGCCGCTTGGAGGCCAAGAAGAGAGAGCTGCTGCTGGCTGTGCTGCACATGGAGCAGCGGAAGCAGCAGCAGCAGCAGCAGCAAGGCCACAAGGCCCCGGCTGCCCACCCTGAGGGGCAGCTCAAGTTCCACCCAGACACAGACGATGTACCTGTCCCAGCTCCAGCGGGTGACCAGAAGGAGGTGGACACTTCAGAAAAGAAACTTCTCGAGCGGCTCCCTGAGGTTGAGGTGCCCCAGCATCTGTGATCTCGGACCCCAGCCCTCAGGATTCCTGATGCTCCAAGGCGACTGATGGGCGCTGGATGAAGTGGCACAGTCAGCTTCCCTGGGGGCCGGTGTCATGTTGGGCTCCTGGGGCGGGGCACGGCCTGGCATTTCACCGATTGCTGCCACCCCAGATCCACCTGTCTCCACTTTCAMEKANETSPVMGFVLLGLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM(SEQ ID NO. 23)YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNPLRYSVIMSKAAYVPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCEILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRRLLRPKGFTQ


[0468] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV12 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0469] The NOV12 nucleotide has a high degree of homology (84% identity) to a mouse or37a gene (OLF) (GenBank Accession No.: AJ133424), as shown in Table 41. The NOV12 polypeptide has a high degree of homology (88% identity) to a human olfactory receptor, family 2, subfamily S, member 2 (OLF) (GenBank Accession No.: NP063950), as shown in Table 42. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413. OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV12 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of human (SEQ ID NO. 65) (GenBank Accession No.: NP063950), mouse (SEQ ID NO. 66) (GenBank Accession No.: NP063950), and rat (SEQ ID NO. 67) (GenBank Accession No.: S29711), as shown in Table 43.
41TABLE 41NOV12:3GGATATCACATGGAAAAAGCCAATGAGACCTCCCCTGTGATGGGGTTCGTTCTCCTGGGG62(SEQ ID NO.22)G AT T  CATGGA A A CCAATGAGACC CCCC  TG   GG TTC TTCTCCTGGGOLF:52GAATGTACCATGGACAGATCCAATGAGACCGCCCCCCTGTCCGGCTTCATTCTCCTGGGC111(SEQ ID NO.63)NOV12:63CTCTCTGCCCACCCAGAGCTGGAAAAGACATTCTTCGTGCTCATCCTGCTGATGTACCTC122CTCTCTGCCCACCCA AGCTGGA AA AC TTCTTCGTGCTCATCCTG TGATGTACCTOLF:112CTCTCTGCCCACCCAAAGCTGGAGAAAACCTTCTTCGTGCTCATCCTGATGATGTACCTG171NOV12:123GTGATCCTGCTGGGCAATGGGGTCCTCATCCTGGTGACCATCCTTGACTCCCGCCTGCAC182GTGATCCTGCTGGGCAA GG GTCCTCATCCTGGTGA CATCCT GACTCCC CCTGCACOLF:172GTGATCCTGCTGGGCAACGGCGTCCTCATCCTGGTGAGCATCCTCGACTCCCACCTGCAC231NOV12:183ACGCCCATGTACTTCTTCCTAGGGAACCTCTCCTTCCTGGACATCTGCTTCACTACCTCC242ACGCCCATGTACTTCTTCCT GGGAACCTCTCCTTCCTGGACATCTGCT CACTACCTCCOLF:232ACGCCCATGTACTTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTACACTACCTCC291NOV12:243TCAGTCCCACTGGTCCTGGACAGCTTTTTGACTCCCCAGGAA-ACCATCTCCTTCTCAGC301TC GTCCC CT  T CTGGACAGCTTT TGACTCCC AGGAA ACCATCTCCTTCTC GOLF:292TCTGTCCCCCTCATTCTGGACAGCTTTCTGACTCCC-AGGAAGACCATCTCCTTCTCGGG350NOV12:302CTGTGCTGTGCAGATGGCACTCTCCTTTGCCATGGCAGGAACAGAGTGCTTGCTCCTGAG361CTGTGC GTGCAGATG   CTCTCCTT GCCATGG AG  AC GAGTG  TGCTCCTGAGOLF:351CTGTGCCGTGCAGATGTTTCTCTCCTTCGCCATGGGAGCCACGGAGTGTGTGCTCCTGAG410NOV12:362CATGATGGCATTTGATCGCTATGTGGCCATCTGCAACCCCCTTAGGTACTCC-GTGATCA420 ATGATGGC TTTGATCG TATGTGGCCATCTGCAACCCCCTTAG TA TCC GTG TCAOLF:411TATGATGGCGTTTGATCGTTATGTGGCCATCTGCAACCCCCTTAGATA-TCCTGTGGTCA469NOV12:421TGAGCAAGGCTGCCTACGTGCCCATGGCTGCCAGCTCCTGGGCTATTGGTGGTGCTGCTT480TGA CAAGGCTGCCTA GTGCCCATGGCTGCCAG TCCTGGGC  TGGT    CT  TTOLF:470TGAACAAGGCTGCCTATGTGCCCATGGCTGCCAGTTCCTGGGCAGGTGGTATCACTAATT529NOV12:481CCGTGGTACACACATCCTTGGCAATTCAGCTGCCCTTCTGTGGAGACAATGTCATCAACC540C GT GT CA ACATC TTGGCAAT C GCTGCCCTTCTGTGG GACAATGTCATCAA COLF:530CTGTAGTGCAGACATCTTTGGCAATGCGGCTGCCCTTCTGTGGGGACAATGTCATCAATC589NOV12:541ACTTCACCTGTGAGATTCTGGCTGTTCTAAAGTTGGCCTGTGCTGACATTTCCATCAATG600ACTTCACCTGTGAGAT CTGGC GT CT AA  TGGCCTGTGCTGACAT TCCATCAATGOLF:590ACTTCACCTGTGAGATCCTGGCAGTCCTGAAACTGGCCTGTGCTGACATCTCCATCAATG649NOV12:601TGATCAGCATGGAGGTGACGAATGTGATCTTCCTAGGAGTCCCGGTTCTGTTCATCTCTT660T ATCAGCATGG  GTG C AA  TGATCTTC T G AGTCCC GT CT TTCATCT TOLF:650TCATCAGCATGGTTGTGGCCAACATGATCTTCTTGGCAGTCCCAGTCCTCTTCATCTTTG709NOV12:661TCTCCTATGTCTTCATCATCACCACCATCCTGAGGATCCCCTCAGCTGAGGGGAGGAAAA720TCTCCTATGTCTTCATC T    AC ATCCTGAGGATCCCCTC GCTGAGGGGAGGAA AOLF:710TCTCCTATGTCTTCATCCTTGTGACAATCCTGAGGATCCCCTCTGCTGAGGGGAGGAAGA769NOV12:721AGGTCTTCTCCACCTGCTCTGCCCACCTCACTGTGGTGATCGTCTTCTACGGGACCTTAT780AGG CTTCTCCACCTGCTCTGCCCACCTCAC GTGGT  T GTCTTCTA GG ACC TOLF:770AGGCCTTCTCCACCTGCTCTGCCCACCTCACCGTGGTACTTGTCTTCTATGGAACCATCC829NOV12:781TCTTCATGTATGGGAAGCCTAAGTCTAAGGACTCCA-TGGGAGCAGACAAAGAGGATCTT839TCTTCATGTA GGGAAGCC AAGTC AAGGAC CCA TGGG GCAGACAA  AGGA CTTOLF:830TCTTCATGTACGGGAAGCCCAAGTCCAAOOAC-CCACTGGGGGCAGACAAGCAGGACCTT888NOV12:840TCAGACAAACTCATCCCCCTTTTCTATGGGGTGGTGACCCCGATGCTCAACCCCATCATC899 CAGACAA CTCATC CCCT TTCTATGG GTGGTGACCCC ATGCT AACCCCATCATCOLF:889GCAGACAAGCTCATCTCCCTCTTCTATGGAGTGGTGACCCCCATGCTAAACCCCATCATC948NOV12:900TATAGCCTGAGGAACAAGGATGTGAAGGCTGCTGTGAGGAGACTGCTGAGACCA-AAAGG958TA AGC TGAG AACA GGA GTGA GGCTGCTGTGAGGA  CTG TG G CCA AAAOLF:949TACAGCTTGAGAAACAAGGACGTGAGGGCTGCTGTGAGGAACCTGGTGGG-CCAGAAACA1007NOV12:959CTTCACTCAGTGA971C T ACT AGTGAOLF:1008CCTAACTGAGTGA1020


[0470]

42










TABLE 42










NOV12:
1
MGFVLLGLSAHPELEKTFFXXXXXXXXXXXXXXXXXXXXXXXDSRLHTPMYFFLGNLSFL
70
(SEQ ID NO.23)





MGFVLL LSAHPELEKTFF                       DSRLHTPMYFFLGNLSFL


OLF:
1
MGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFL
60
(SEQ ID NO.64)





NOV12:
71
DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNP
130




DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNP


OLF:
61
DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNP
120





NOV12:
131
LRYSVIMSKAAYVPMXXXXXXXXXXXXVVHTSLAIQLPFCGDNVINHFTCEILAVLKLAC
190




LRYSVIMSKAAY+PM            VVHTSLAIQLPFCGDNVINHFTCEILAVLKLAC


OLF:
121
LRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCEILAVLKLAC
180





NOV12:
191
ADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVI
250




ADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVI


OLF:
181
ADISINVISMEVTNVIFLGVPVLFISESYVFIITTILRIPSAEGRKKVFSTCSAHLTVVI
240





NOV12:
251
VFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLEYGVVTPMLNPIIYSLRNKDVKAAVRR
310




VFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRR


OLF:
241
VFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRR
300





NOV12:
311
LLRPKGFTQ
319




LLRPKGFTQ


OLE:
301
LLRPKGFTQ
309






Where ‘+’ denotes similarity.








[0471]

43







TABLE 43










Human_OLF
----------MGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM
(SEQ ID NO.65)


NOV12
MEKANETSPVMGFVLLGLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM
(SEQ ID NO.23)


Mouse_OLF
MDRSNETAPLSGFILLGLSAHPKLEKTFFVLILMMYLVILLGNGVLILVTILDSHLHTPM
(SEQ ID NO.66)


Rat_OLF
-------------LLLGLSGYPKTEILYFVIVLVMYLVIHTGNGVLIIASIFDSHLHTPM
(SEQ ID NO.67)



             :** **.:*: *  :**::*:*****  ******:.:*:**:*****





Human_OLF
YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA


NOV12
YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA


Mouse_OLF
YFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFLSFAMGATECVLLSMMA


Rat_OLF
YFFLGNLSFLDICYTTSSVPSTLVSLISKKRNISFSGCTVQMFVGFAMGSTECLLLGMMA



*************:******  * *::: :..****.*:*** :.***..***:**.***





Human OLF
FDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC


NOV12
FDRYVAICNPLRYSVIMSKAAYVPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC


Mouse_OLF
FDRYVAICNPLRYPVVMNKAAYVPMAASSWAGGITNSVVQTSLAMRLPFCGDNVINHFTC


Rat_OLF
FDRYVAICNPLRYSVIMSKEVYVSMASASWFSGGINSVVQTSLAMRLFFCGNNVINHFTC



*************.*:*.* .*:.**::**  *   ***:****::*****:********





Human_OLF
EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFS


NOV12
EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFS


Mouse_OLF
EILAVLKLACADISINVISMVVANMIFLAVPVLFIFVSYVFILVTILRIPSAEGRKKAFS


Rat_OLF
EVLAVLKLACADISLNIVTMVISNMAFLVLPLLLIFFSYVLILYTILRMNSASGRRKAFS



*:************:*:::* ::*: ** :*:*:* .***:*: ****: **.**:*.**





Human_OLF
TCSAHLTVVIVFYGTLFFMYGKFKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR


NOV12
TCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR


Mouse_OLF
TCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVVTPMLNPIIYSLR


Rat_OLF
TCSAHLTVVVTFYGTIFSMYAKPKSQDLTGKDKFQTSDKIISLFYGVVTPMLNPIIYSLR



*********::****:: **.****:*  * ** : :**:*.******************





Human OLF
NKDVKAAVRRLLRPKGFTQ


NOV12
NKDVKAAVRRLLRPKGFTQ


Mouse_OLF
NKDVRAAVRNLVGQKHLTE


Rat_OLF
NKDVKAAVKYILKQKYIP-



****:***: ::  * :.






Consensus key




* - single, fully conserved residue




: - conservation of strong groups




. - conservation of weak groups - no consensus








[0472] The cDNA coding for the sequence was cloned by polymerase chain reaction (PCR) using the following primers:
44Set 1:5′-CTGTGATGGGGTTCGTTCTCCTGAG-3′(SEQ ID NO:83)(forward primer) and5′-CATCACTGAGTGAAGCCTTTTGGTCTC-3′(SEQ ID NO:84)(reverse primer), andSet 2:5′-ATGGGGAGAAACCAGCAAGAAAAG-3′(SEQ ID NO:85)(forward primer) and5′-TCATGATTTGGCTGTTTGTCTG-3′(SEQ ID NO:86)(reverse primer)


[0473] on the following pool of human cDNAs: adrenal gland, bone marrow, brain—amygdala, brain—cerebellum, brain—hippocampus, brain—substantia nigra, brain—thalamus, brain—whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma—Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Primers were designed based on in silico predictions for a part (one or more exons) of the DNA/Protein sequence of the invention or by translated homology of the predicted exons to closely related human sequences or to sequence from other species. The PCR product derived by exon linking was cloned into the pCR2.1 vector from Invitrogen. Usually, multiple clones were sequenced to derive the sequence which was then assembled. In addition, sequence traces were evaluated manually and edited for corrections, if appropriate.


[0474] Variant sequences are also included in this application. A variant sequence can include a single nucleotide polymorphism (SNP). A SNP can, in some instances, be referred to as a “cSNP” to denote that the nucleotide sequence containing the SNP originates as a cDNA. A SNP can arise in several ways. For example, a SNP may be due to a substitution of one nucleotide for another at the polymorphic site. Such a substitution can be either a transition or a transversion. A SNP can also arise from a deletion of a nucleotide or an insertion of a nucleotide, relative to a reference allele. In this case, the polymorphic site is a site at which one allele bears a gap with respect to a particular nucleotide in another allele. SNPs occurring within genes may result in an alteration of the amino acid encoded by the gene at the position of the SNP. Intragenic SNPs may also be silent, however, in the case that a codon including a SNP encodes the same amino acid as a result of the redundancy of the genetic code. SNPs occurring outside the region of a gene, or in an intron within a gene, do not result in changes in any amino acid sequence of a protein but may result in altered regulation of the expression pattern for example, alteration in temporal expression, physiological response regulation, cell type expression regulation, intensity of expression, stability of transcribed message.


[0475] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium that are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV12 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0476] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV12 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0477] A NOV12 OR is expressed in at least some of the following tissues: adrenal gland, bone marrow, brain—amygdala, brain—cerebellum, brain—hippocampus, brain—substantia nigra, brain—thalamus, brain—whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma—Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. In addition, the sequence is predicted to be expressed in brain because of the expression pattern of many OR in that organ.


[0478] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV12. PSORT analysis predicts that NOV12 is likely localized in the plasma membrane, Golgi body, endoplasmic reticulum (membrane), endoplasmic reticulum (lumen). Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 44 and45.


[0479] NOV13


[0480] A NOV13 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV13 nucleic acid and its encoded polypeptide includes the sequences shown in Table 44. The disclosed nucleic acid (SEQ ID NO:24) is 980 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 26-28 and ends with a TGA stop codon at nucleotides 950-952. The representative ORF encodes a 308 amino acid polypeptide (SEQ ID NO:25). Putative untranslated regions up- and downstream of the coding sequence are underlined in SEQ ID NO: 24.
45TABLE 44TAATGAATAGTGGCAAGAGGGAAAGATGGCCATGGACAATGTCACAGCAGTGTTTC(SEQ ID NO.24)AGTTTCTCCTTATTGGCATTTCTAACTATCCTCAATGGAGAGACACGTTTTTCACATTAGTGCTGATAATTTACCTCAGCACATTGTTGGGGAATGGATTTATGATCTTTCTTATTCACTTTGACCCCAACCTCCACACTCCAATCTACTTCTTCCTTAGTAACCTGTCTTTCTTAGACCTTTGTTATGGAACAGCTTCCATGCCCCAGGCTTTGGTGCATTGTTTCTCTACCCATCCCTACCTCTCTTATCCCCGATGTTTGGCTCAAACGAGTGTCTCCTTGGCTTTGGCCACAGCAGAGTGCCTCCTACTGGCTGCCATGGCCTATGACCGTGTGGTTGCTATCAGCAATCCCCTGCGTTATTCAGTGGTTATGAATGGCCCAGTGTGTGTCTGCTTGGTTGCTACCTCATGGGGGACATCACTTGTGCTCACTGCCATGCTCATCCTATCCCTGAGGCTTCACTTCTGTGGGGCTAATGTCATCAACCATTTTGCCTGTGAGATTCTCTCCCTCATTAAGCTGACCTGTTCTGATACCAGCCTCAATGAATTTATGATCCTCATCACCAGTATCTTCACCCTGCTGCTACCATTTGGGTTTGTTCTCCTCTCCTACATACGAATTGCTATGGCTATCATAAGGATTCGCTCACTCCAGGGCAGGCTCAAGGCCTTTACCACATGTGGCTCTCACCTGACCGTGGTGACAATCTTCTATGGGTCAGCCATCTCCATGTATATGAAAACTCAGTCCAAGTCCTCCCCTGACCAGGACAAGTTTATCTCAGTGTTTTATGGAGCTTTGACACCCATGTTGAACCCCCTGATATATAGCCTGAGAAAAAAAGATGTTAAACGGGCAATAAGGAAAGTTATGTTGAAAAGGACATGAGCCTTCTTTGCTTCTAAACGTCTAAAATMAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIYFF(SEQ ID NO.25)LSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAYDRVVAISNPLRYSVVMNGPVCVCLVATSWGTSLVLTAMLILSLRLHFCGANVINHFACEILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTTCGSHLTVVTIFYGSAISMYMKTQSKSSPDQDKFISVFYGALTPMLNPLIYSLRKKRDVKRAIRKVMLKRT


[0481] cDNA was derived from various human samples representing multiple tissue types, normal and diseases states, physiological states, and developmental states from different donors. Samples were obtained as whole tissue, cell lines, primary cells, or tissue cultured primary cells and cell lines. Cells and cell lines may have been treated with biological or chemical agents that regulate gene expression, for example, growth factors, chemokines, steroids, etc. The cDNA thus derived was then sequenced using CuraGen's proprietary SeqCalling™ technology. Sequence traces were evaluated manually and edited for corrections if appropriate. cDNA sequences from all samples were assembled with themselves and with public ESTs using bioinformatics programs to generate CuraGen's human SeqCalling™ database of SeqCalling™ assemblies. Each assembly contains one or more overlapping cDNA sequences derived from one or more human sample(s). Fragments and ESTs were included as components for an assembly when the extent of identity with another component of the assembly was at least 95% over 50 bp. Each assembly can represent a gene and/or its variants such as splice forms and/or single nucleotide polymorphisms (SNPs) and their combinations.


[0482] The cDNA coding for the sequence was cloned by polymerase chain reaction (PCR) on the following pool of human cDNAs: Pool 1—Adrenal gland, bone marrow, brain—amygdala, brain—cerebellum, brain—hippocampus, brain—substantia nigra, brain—thalamus, brain—whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma—Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus.


[0483] Primers were designed based on in silico predictions for the full length or part (one or more exons) of the DNA/protein sequence of the invention or by translated homology of the predicted exons to closely related human sequences or to sequences from other species. Usually multiple clones were sequenced to derive the sequence which was then assembled similar to the SeqCalling™ process. In addition, sequence traces were evaluated manually and edited for corrections if appropriate.


[0484] The PCR product derived by exon linking was cloned into the pCR2.1 vector from Invitrogen. The bacterial clone AC135784B.244187.E8 has an insert covering the entire open reading frame cloned into the pCR2.1 vector from Invitrogen.


[0485] Variant sequences are also included in this application. A variant sequence can include a single nucleotide polymorphism (SNP). A SNP can, in some instances, be referred to as a “cSNP” to denote that the nucleotide sequence containing the SNP originates as a cDNA. A SNP can arise in several ways. For example, a SNP may be due to a substitution of one nucleotide for another at the polymorphic site. Such a substitution can be either a transition or a transversion. A SNP can also arise from a deletion of a nucleotide or an insertion of a nucleotide, relative to a reference allele. In this case, the polymorphic site is a site at which one allele bears a gap with respect to a particular nucleotide in another allele. SNPs occurring within genes may result in an alteration of the amino acid encoded by the gene at the position of the SNP. Intragenic SNPs may also be silent, however, in the case that a codon including a SNP encodes the same amino acid as a result of the redundancy of the genetic code. SNPs occurring outside the region of a gene, or in an intron within a gene, do not result in changes in any amino acid sequence of a protein but may result in altered regulation of the expression pattern for example, alteration in temporal expression, physiological response regulation, cell type expression regulation, intensity of expression, stability of transcribed message.


[0486] The DNA sequence and protein sequence for a novel olfactory receptor-like gene or one of its splice forms was obtained solely by exon linking and is reported here as CuraGen Acc. No. CG53935-02.


[0487] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV13 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0488] The NOV13 nucleotide has a high degree of homology (99% identity) to a human olfactory receptor (OLF) (GenBank Accession No.: AL049734), as shown in Table 45. The NOV13 polypeptide has homology (47% identity, 58% similarity) to the mouse B6 olfactory receptor (OLF) (GenBank Accession No.: AAG45201), as shown in Table 46. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413. OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV13 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of rat (SEQ ID NO. 70) (GenBank Accession No.: S29711), human (SEQ ID NO. 71) (GenBank Accession No.: XP00428), and mouse (SEQ ID NO. 72) (GenBank Accession No.: AAG45201), as shown in Table 47.
46TABLE 45NOV13:1taatgaatagtggcaagagggaaagatggccatggacaatgtcacagcagtgtttcagtt60(SEQ ID NO.24)||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120336taatgaatagtggcaagagggaaagatggccatggacaatgtcacagcagtgtttcagtt120395(SEQ ID NO.68)NOV13:61tctccttattggcatttctaactatcctcaatggagagacacgtttttcacattagtgct120||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120396tctccttattggcatttctaactatcctcaatggagagacacgtttttcacattagtgct120455NOV13:121gataatttacctcagcacattgttggggaatggatttatgatctttcttattcactttga180||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120456gataatttacctcagcacattgttggggaatggatttatgatctttcttattcactttga120515NOV13:181ccccaacctccacactccaatctacttcttccttagtaacctgtctttcttagacctttg240||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120516ccccaacctccacactccaatctacttcttccttagtaacctgtctttcttagacctttg120575NOV13:241ttatggaacagcttccatgccccaggctttggtgcattgtttctctacccatccctacct300||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120576ttatggaacagcttccatgccccaggctttggtgcattgtttctctacccatccctacct120635NOV13:301ctcttatccccgatgtttggctcaaacgagtgtctccttggctttggccacagcagagtg360||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120636ctcttatccccgatgtttggctcaaacgagtgtctccttggctttggccacagcagagtg120695NOV13:361cctcctactggctgccatggcctatgaccgtgtggttgctatcagcaatcccctgcgtta420||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120696cctcctactggctgccatggcctatgaccgtgtggttgctatcagcaatcccctgcgtta120755NOV13:421ttcagtggttatgaatggcccagtgtgtgtctgcttggttgctacctcatgggggacatc480||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120756ttcagtggttatgaatggcccagtatgtgtctgcttggttgctacctcatgggggacatc120815NOV13:481acttgtgctcactgccatgctcatcctatccctgaggcttcacttctgtggggctaatgt540||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120816acttgtgctcactgccatgctcatcctatccctgaggcttcacttctgtggggctaatgt120875NOV13:541catcaaccattttgcctgtgagattctctccctcattaagctgacctgttctgataccag600||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120876catcaaccattttgcctgtgagattctctccctcattaagctgacctgttctgataccag120935NOV13:601cctcaatgaatttatgatcctcatcaccagtatcttcaccctgctgctaccatttgggtt660||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120936cctcaatgaatttatgatcctcatcaccagtatcttcaccctgctgctaccatttgggtt120995NOV13:661tgttctcctctcctacatacgaattgctatggctatcataaggattcgctcactccaggg720||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:120996tgttctcctctcctacatacgaattgctatggctatcataaggattcgctcactccaggg121055NOV13:721caggctcaaggcctttaccacatgtggctctcacctgaccgtggtgacaatcttctatgg780||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:121056caggctcaaggcctttaccacatgtggctctcacctgaccgtggtgacaatcttctatgg121115NOV13:781gtcagccatctccatgtatatgaaaactcagtccaagtcctcccctgaccaggacaagtt840||||||||||||||||||||||||||||||||||||||||| ||||||||||||||||||OLF:121116gtcagccatctccatgtatatgaaaactcagtccaagtcctaccctgaccaggacaagtt121175NOV13:841tatctcagtgttttatggagctttgacacccatgttgaaccccctgatatatagcctgag900||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:121176tatctcagtgttttatggagctttgacacccatgttgaaccccctgatatatagcctgag121235NOV13:901nnnnnnngatgttaaacgggcaataaggaaagttatgttgaaaaggacatgagccttctt960       |||||||||||||||||||||||||||||||||||||||||||||||||||||OLF:121236aaaaaaagatgttaaacgggcaataaggaaagttatgttgaaaaggacatgagccttctt121295NOV13:961tgcttctaaacgtctaaaat980||||||||||||||||||||OLF:121296tgcttctaaacgtctaaaat121315


[0489]

47









TABLE 46










NOV13:
1
MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIY
60
(SEQ ID NO.25)




M  DN T+V +F+ +G+S  PQ +   F L L IYL T+LGN  +I LIH DP LHTP+Y


OLF:
1
MGEDNRTSVTEFIFLGLSQDPQTQVLLFFLFLFIYLLTVLGNLLIIVLIHSDPRLHTPMY
60
(SEQ ID NO.69)





NOV13:
61
FFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSXXXXXXXXXXXXXXXY
120




FFL NLSF DLC+ T++PQ LVH       +S+  C  Q  V                Y


OLF:
61
FFLRNLSFADLCFSTTTVPQVLVHFLVKRKTISFAGCSTQIVVLLLVGCTECALLAVMSY
120





NOV13:
121
DRVVAISNPLRYSVVMNGPVCVCLVATSWGT-SLVLTAMLILSLRLHFCGANVINHFACE
179




DR VA+  PL YS +M   VCV L A SW + +LV       +LRL + G NVINHF CE


OLF:
121
DRYVAVCKPLHYSTIMTHWVCVQLAAGSWASGALVSLVDTTFTLRLPYRGNNVINHFFCE
180





NOV13:
180
ILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYXXXXXXXXXXXSLQGRLKAFTT
239




  +L+KL  +DT   E  I    +  LL P   +L SY           S +GRLK F+T


OLF:
181
PPALLKLASADTYSTEMAIFAMGVVILLAPVSLILTSYWNIISTVIQMQSGEGRLKVFST
240





NOV13:
240
CGSHLTVVTIFYGSAISMYMKTQSKSSPDQDKFISVFYGALTPMLNPLIYSLRKKDVKRA
299




CGSHL VV +FYGSAI YM+  SK   ++DK ISVFY A+TPMLNP+IYSLR KDVK A


OLF:
241
CGSHLIVVVLFYGSAIFAYMRPNSKIMNEKDKMISVFYSAVTPMLNPIIYSLRNKDVKGA
300





NOV13:
300
IRKVMLK
306




+R++ LK


OLF:
301
LRRITLK
307






Where ‘+’ denotes similarity.








[0490]

48







TABLE 47










NOV13
MAMDNVTAVFQFLLIGISNYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHFDPNLHTPIY
(SEQ ID NO.25)


Rat_OLF
------------LLLGLSGYPKTEILYFVIVLVMYLVIHTGNGVLIIASIFDSHLHTPMY
(SEQ ID NO.70)


Human_OLF
MGTDNQTWVSEFILLGLSSDWDTRVSLFVLFLVMYVVTVLGNCLIVLLIRLDSRLHTPMY
(SEQ ID NO.71)


Mouse_OLF
MGEDNRTSVTEFIFLGLSQDPQTQVLLFFLFLFIYLLTVLGNLLIIVLIHSDPRLHTPNY
(SEQ ID NO.72)



            :::*:*   . .   * :.*.:*:    ** .::.    *..****:*





NOV13
FFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAECLLLAAMAY


Rat_OLF
FFLGNLSFLDICYTTSSVPSTLVSLISKKRNISFSGCTVQMFVGFAMGSTECLLLGMMAF


Human_OLF
FFLTNLSLVDVSYATSVVPQLLAHFLAEHKAIPFQSCAAQLFFSLALGGIEFVLLAVMAY


Mouse_OLF
FFLRNLSFADLCFSTTTVPQVLVHFLVKRKTISFAGCSTQIVVLLLVGCTECALLAVMSY



*** ***: *:.: *: :*. *.  :  :  :.:  * .*  . : :.  *  **. *::





NOV13
DRVVAISNPLRYSVVMNGPVCVCLVATSWGTS-LVLTAMLILSLRLHFCGANVINHFACE


Rat_OLF
DRYVAICNPLRYSVIMSKEVYVSMASASWFSGGINSVVQTSLAMRLPFCGNNVINHFTCE


Human_OLF
DRYVAVCDALRYSAIMHGGLCARLAITSWVSGFISSPVQTAITFQLPMCRNKFIDHISCE


Mouse_OLF
DRYVAVCKPLHYSTIMTHWVCVQLAAGSWASGALVSLVDTTFTLRLPYRGNNVINHFFCE



** **:...*:**.:*   : . :.  ** :. :   .   ::::*     :.*:*: **





NOV13
ILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLQGRLKAFTT


Rat_OLF
VLAVLKLACADISLNIVTMVISNMAFLVLPLLLIFFSYVLILYTILRMNSASGRRKAFST


Human_OLF
LLAVVRLACVDTSSNEVTIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSREGRKKAFHT


Mouse_OLF
PPALLKLASADTYSTEMAIFAMGVVILLAPVSLILTSYWNIISTVIQMQSGEGRLKVFST



  ::::*:. *   . . :.  .:  *: *. ::: **  *  :::::.* .** *.* *





NOV13
CGSHLTVVTIFYGSAISMYMKTQSK--SSPD----QDKFISVFYGALTPMLNPLIYSLRK


Rat_OLF
CSAHLTVVVIFYGTIFSMYAKPKSQDLTGKDKFQTSDKIISLFYGVVTPMLNPIIYSLRN


Human_OLF
CASHLTVVALCYGVAIFTYIQPHSSPSVL------QEKLFSVFYAILTPMLNPMIYSLRN


Mouse_OLF
CGSHLIVVVLFYGSAIFAYMRPNSKIMNE------KDKMISVFYSAVTPMLNPIIYSLRN



*.:** **.: **  :  * :.:*.          .:*::*:**. :******:*****:





NOV13
KDVKRAIRKVMLKRT--------


Rat_OLF
KDVKAAVKYILKQKYIP------


Human_OLF
KEVKGAWQKLLWKFSGLTSKLAT


Mouse OLF
KDVKGALRRITLK----------



*:** * : : :






Consensus key




* - single, fully conserved residue




: - conservation of strong groups




. - conservation of weak groups - no consensus








[0491] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium that are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV13 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0492] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV13 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0493] A NOV13 OR is expressed in at least the following tissues: Apical microvilli of the retinal pigment epithelium, arterial (aortic), basal forebrain, brain, Burkitt lymphoma cell lines, corpus callosum, cardiac (atria and ventricle), caudate nucleus, CNS and peripheral tissue, cerebellum, cerebral cortex, colon, cortical neurogenic cells, endothelial (coronary artery and umbilical vein) cells, palate epithelia, eye, neonatal eye, frontal cortex, fetal hematopoietic cells, heart, hippocampus, hypothalamus, leukocytes, liver, fetal liver, lung, lung lymphoma cell lines, fetal lymphoid tissue, adult lymphoid tissue, those that express MHC II and III, nervous, medulla subthalamic nucleus, ovary, pancreas, pituitary, placenta, pons, prostate, putamen, serum, skeletal muscle, small intestine, smooth muscle (coronary artery in aortic), spinal cord, spleen, stomach, taste receptor cells of the tongue, testis, thalamus, and thymus tissue.


[0494] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV13. PSORT analysis predicts that NOV13 is likely localized in the plasma membrane, Golgi body, endoplasmic reticulum (membrane), and endoplasmic reticulum (lumen). Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 43 and 44.


[0495] Moreover, in the following positions, one or more consensus positions (Cons. Pos.) of the nucleotide sequence have been identified as SNPs. “Depth” represents the number of clones covering the region of the SNP. The Putative Allele Frequency (Putative Allele Freq.) is the fraction of all the clones containing a SNP. A dash (“-”), when shown, means that a base is not present. The sign “>” means “is changed to”.


[0496] Cons.Pos.: 415 Depth: 15 Change: G>A


[0497] Putative Allele Freq.: 0.267


[0498] NOV14


[0499] A NOV14 sequence according to the invention is a nucleic acid sequence encoding a polypeptide related to the human odorant receptor (OR) family of the G-protein coupled receptor (GPCR) superfamily of proteins. A NOV14 nucleic acid and its encoded polypeptide includes the sequences shown in Table 48. The disclosed nucleic acid (SEQ ID NO: 26) is 1,031 nucleotides in length and contains an open reading frame (ORF) that begins with an ATG initiation codon at nucleotides 22-24 and ends with a TAA stop codon at nucleotides 979-981. The representative ORF encodes a 319 amino acid polypeptide (SEQ ID NO:27). Putative untranslated regions up- and downstream of the coding sequence are underlined in SEQ ID NO: 26.
49TABLE 48TGATGGCAGAGGGGATATCACATGGAAAAAGCCAATGAGACCTCCCCTGTGATGGG(SEQ ID NO.:26)GTTCGTTCTCCTGAGGCTCTCTGCCCACCCAGAGCTGGAAAAGACATTCTTCGTGCTCATCCTGCTGATGTACCTCGTGATCCTGCTGGGCAATGGGGTCCTCATCCTGGTGACCATCCTTGACTCCCGCCTGCACACGCCCATGTACTTCTTCCTAGGGAACCTCTCCTTCCTGGACATCTGCTTCACTACCTCCTCAGTCCCACTGGTCCTGGACAGCTTTTTGACTCCCCAGGAAACCATCTCCTTCTCAGCCTGTGCTGTGCAGATGGCACTCTCCTTTGCCATGGCAGGAACAGAGTGCTTGCTCCTGAGCATGATGGCATTTGATCGCTATGTGGCCATCTGCAACCCCCTTAGGTACTCCGTGATCATGAGCAAGGCTGCCTACATGCCCATGGCTGCCAGCTCCTGGGCTATTGGTGGTGCTGCTTCCGTGGTACACACATCCTTGGCAATTCAGCTGCCCTTCTGTGGAGACAATGTCATCAACCACTTCACCTGTGAGATTCTGGCTGTTCTAAAGTTGGCCTGTGCTGACATTTCCATCAATGTGATCAGCATGGAGGTGACGAATGTGATCTTCCTAGGAGTCCCGGTTCTGTTCATCTCTTTCTCCTATGTCTTCATCATCACCACCATCCTGAGGATCCCCTCAGCTGAGGGGAGGAAAAAGGTCTTCTCCACCTGCTCTGCCCACCTCACCGTGGTGATCGTCTTCTACGGGACCTTATTCTTCATGTATGGGAAGCCTAAGTCTAAGGACTCCATGGGAGCAGACAAAGAGGATCTTTCAGACAAACTCATCCCCCTTTTCTATGGGGTGGTGACCCCGATGCTCAACCCCATCATCTATAGCCTGAGGAACAAGGATGTGAAGGCTGCTGTGAGGAGACTGCTGAGACCAAAAGGCTTCACTCAGTGATGGTGGAAGGGTCCTCTGTGATTGTCACCCACATGGAAGTAAGGAATCACMEKANETSPVMGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM(SEQ ID NO.:27)YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCEILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRRLLRPKGFTQ


[0500] A target sequence identified previously as Accession Number AL135841 was subjected to the exon linking process to confirm the sequence. PCR primers were designed by starting at the most upstream sequence available, for the forward primer, and at the most downstream sequence available for the reverse primer. In each case, the sequence was examined, walking inward from the respective termini toward the coding sequence, until a suitable sequence that is either unique or highly selective was encountered, or, in the case of the reverse primer, until the stop codon was reached. Such primers were designed based on in silico predictions for the full length cDNA, part (one or more exons) of the DNA/protein sequence of the invention or by translated homology of the predicted exons to closely related human sequences or to sequences from other species. These primers were then employed in PCR amplification based on the following pool of human cDNAs: adrenal gland, bone marrow, brain—amygdala, brain—cerebellum, brain—hippocampus, brain—substantia nigra, brain—thalamus, brain—whole, fetal brain, fetal kidney, fetal liver, fetal lung, heart, kidney, lymphoma—Raji, mammary gland, pancreas, pituitary gland, placenta, prostate, salivary gland, skeletal muscle, small intestine, spinal cord, spleen, stomach, testis, thyroid, trachea, uterus. Usually the resulting amplicons were gel purified, cloned and sequenced to high redundancy. The resulting sequence from all clones were assembled with themselve, with other fragments in CuraGen Corporation's database and with public ESTs. Fragments and ESTs were included as components for an assembly when the extent of their identy with another component of the assembly was at least 95% over 50 bp. In addition, sequence traces were evaluated manually and edited for correction if appropriate. These procedures provide the sequence reported, which is designated Accession Number AL135841_da1, which differs from Accession Number AL135841 at bp 757.


[0501] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium and are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV14 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0502] The NOV14 nucleotide sequence has a high degree of homology (100% identity) to the human genomic clone RP11-327L3 from chromosome 9p13.1-13.3 (CHR9) (GenBank Accession No.: AL135841), as shown in Table 49. The NOV14 polypeptide has a high degree of homology (88% identity) to a human olfactory receptor, family 2, subfamily S, member 2 (OLF) (GenBank Accession No.: NP063950), as is shown in Table 50. Overall amino acid sequence identity within the mammalian OR family ranges from 45% to >80%. OR genes that are 80% or more identical to each other at the amino acid level are considered by convention to belong to the same subfamily. See Dryer and Berghard, Trends in Pharmacological Sciences, 1999, 20:413. OR proteins have seven transmembrane α-helices separated by three extracellular and three cytoplasmic loops, with an extracellular amino-terminus and a cytoplasmic carboxy-terminus. Multiple sequence aligment suggests that the ligand-binding domain of the ORs is between the second and sixth transmembrane domains. Thus, NOV14 is predicted to have a seven transmembrane region and is similar in that region to representative olfactory receptor GPCRs of human (SEQ ID NO. 75) (GenBank Accession No.: NP063950), mouse (SEQ ID NO. 76) (GenBank Accession No.: NP063950), and rat (SEQ ID NO. 77) (GenBank Accession No.: S29711), as shown in Table 51.
50TABLE 49NOV14:1tgatggcagaggggatatcacatggaaaaagccaatgagacctcccctgtgatggggttc60(SEQ ID NO.26)||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82721tgatggcagaggggatatcacatggaaaaagccaatgagacctcccctgtgatggggttc82662(SEQ ID NO.73)NOV14:61gttctcctgaggctctctgcccacccagagctggaaaagacattcttcgtgctcatcctg120||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82661gttctcctgaggctctctgcccacccagagctggaaaagacattcttcgtgctcatcctg82602NOV14:121ctgatgtacctcgtgatcctgctgggcaatggggtcctcatcctggtgaccatccttgac180||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82601ctgatgtacctcgtgatcctgctgggcaatggggtcctcatcctggtgaccatccttgac82542NOV14:181tcccgcctgcacacgcccatgtacttcttcctagggaacctctccttcctggacatctgc240||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82541tcccgcctgcacacgcccatgtacttcttcctagggaacctctccttcctggacatctgc82482NOV14:241ttcactacctcctcagtcccactggtcctggacagctttttgactccccaggaaaccatc300||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82481ttcactacctcctcagtcccactggtcctggacagctttttgactccccaggaaaccatc82422NOV14:301tccttctcagcctgtgctgtgcagatggcactctcctttgccatggcaggaacagagtgc360||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82421tccttctcagcctgtgctgtgcagatggcactctcctttgccatggcaggaacagagtgc82362NOV14:361ttgctcctgagcatgatggcatttgatcgctatgtggccatctgcaacccccttaggtac420||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82361ttgctcctgagcatgatggcatttgatcgctatgtggccatctgcaacccccttaggtac82302NOV14:421tccgtgatcatgagcaaggctgcctacatgcccatggctgccagctcctgggctattggt480||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82301tccgtgatcatgagcaaggctgcctacatgcccatggctgccagctcctgggctattggt82242NOV14:481ggtgctgcttccgtggtacaoacatccttggcaattcagctgcccttctgtggagacaat540||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82241ggtgctgcttccgtggtacacacatccttggcaattcagctgcccttctgtggagacaat82182NOV14:541gtcatcaaccacttcacctgtgagattctggctgttctaaagttggcctgtgctgacatt600||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82181gtcatcaaccacttcacctgtgagattctggctgttCtaaagttggcctgtgctgacatt82122NOV14:601tccatcaatgtgatcagcatggaggtgacgaatgtgatcttcctaggagtcccggttctg660||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82121tccatcaatgtgatcagcatggaggtgacgaatgtgatcttcctaggagtcccggttctg82062NOV14:661ttcatctctttctcctatgtcttcatcatcaccaccatcctgaggatcccctcagctgag720||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82061ttcatctctttctcctatgtcttcatcatcaccaccatcctgaggatcccctcagctgag82002NOV14:721gggaggaaaaaggtcttctccacctgctctgcccacctcaccgtggtgatcgtcttctac780||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:82001gggaggaaaaaggtcttctccacctgctctgcccacctcaccgtggtgatcgtcttctac81942NOV14:781gggaccttattcttcatgtatgggaagcctaagtctaaggactccatgggagcagacaaa840||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:81941gggaccttattcttcatgtatgggaagcctaagtctaaggactccatgggagcagacaaa81882NOV14:841gaggatctttcagacaaactcatcccccttttctatggggtggtgaccccgatgctcaac900||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHP9:81881gaggatctttcagacaaactcatcccccttttctatggggtggtgaccccgatgctcaac81822NOV14:901cccatcatctatagcctgaggaacaaggatgtgaaggctgctgtgaggagactgctgaga960||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:81821cccatcatctatagcctgaggaacaaggatgtgaaggctgctgtgaggagactgctgaga81762NOV14:961ccaaaaggcttcactcagtgatggtggaagggtcctctgtgattgtcacccacatggaag1020||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||CHR9:81761ccaaaaggcttcactcagtgatggtggaagggtcctctgtgattgtcacccacatggaag81702NOV14:1021taaggaatcac1031|||||||||||CHR9:81701taaggaatcac81691


[0503]

51









TABLE 50










NOV14:
11
MGFVLLRLSAHPELEKTFFXXXXXXXXXXXXXXXXXXXXXXXDSRLHTPMYFFLGNLSFL
70
(SEQ ID NO.27)




MGFVLLRLSAHPELEKTFF                       DSRLHTPMYFFLGNLSFL


OLF:
1
MGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPMYFFLGNLSFL
60
(SEQ ID NO.74)





NOV14:
71
DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNP
130




DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNP


OLF:
61
DICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMAFDRYVAICNP
120





NOV14:
131
LRYSVIMSKAAYMPMXXXXXXXXXXXXVVHTSLAIQLPFCGDNVINHFTCEILAVLKLAC
190




LRYSVIMSKAAYMPM            VVHTSLAIQLPFCGDNVINHFTCEILAVLKLAC


OLF:
121
LRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTCEILAVLKLAC
180





NOV14:
191
ADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVI
250




ADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVI


OLF:
181
ADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFSTCSAHLTVVI
240





NOV14:
251
VFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRR
310




VFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRR


OLF:
241
VFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLRNKDVKAAVRR
300





NOV14:
311
LLRPKGFTQ
319




LLRPKGFTQ


OLF:
301
LLRPKGFTQ
309










[0504]

52







TABLE 51










NOV14
MEKANETSPVMGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM
(SEQ ID NO.27)


Human_OLF
----------MGFVLLRLSAHPELEKTFFVLILLMYLVILLGNGVLILVTILDSRLHTPM
(SEQ ID NO.75)


Mouse_OLF
MDRSNETAPLSGFILLGLSAHPKLEKTFFVLILMMYLVILLGNGVLILVSILDSHLHTPM
(SEQ ID NO.76)


Rat_OLF
-------------LLLGLSGYPKTEILYFVIVLVMYLVIHTGNGVLIIASIFDSHLHTPM
(SEQ ID NO.77)



             :** **.:*: *  :**::*******  ******:.:*:**:*****





NOV14
YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA


Human_OLF
YFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTECLLLSMMA


Mouse_OLF
YFFLGNLSFLDICYTTSSVPLILDSFLTPRKTISFSGCAVQMFLSFAMGATECVLLSMMA


Rat_OLF
YFFLGNLSFLDICYTTSSVPSTLVSLISKKRNISFSGCTVQMFVGFAMGSTECLLLGMMA



*************:******  * *::: :..****.*:*** :.***..***:**.***





NOV14
FDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC


Human_OLF
FDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNVINHFTC


Mouse_OLF
FDRYVAICNPLRYPVVMNKAAYVPMAASSWAGGITNSVVQTSLAMRLPFCGDNVINHFTC


Rat_OLF
FDRYVAICNPLRYSVIMSKEVYVSMASASWFSGGINSVVQTSLAMRLPFCGDNVINHFTC



*************.*:*.* .*:.**::**  *   ***:****::*****:********





NOV14
EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFS


Human_OLF
EILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAEGRKKVFS


Mouse_OLF
EILAVLKLACADISINVISMVVANMIFLAVPVLFIFVSYVFILVTILRIPSAEGRKKAFS


Rat_OLF
EVLAVLKLACADISLNIVTMVISNMAFLVLPLLLIFFSYVLILYTILRMNSASGRRKAFS



*:************:*:::* ::*: ** :*:*:* .***:*: ****: **.**:*.**





NOV14
TCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR


Human_OLF
TCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNPIIYSLR


Mouse_OLF
TCSAHLTVVLVFYGTILFMYGKPKSKDPLGADKQDLADKLISLFYGVVTPMLNPIIYSLR


Rat_OLF
TCSAHLTVVVIFYGTIFSMYAKPKSQDLTGKDKFQTSDKIISLFYGVVTPMLNPIIYSLR



*********::****:: **.****:*  * ** : :**:*.******************





NOV14
NKDVKAAVRRLLRPKGFTQ


Human_OLF
NKDVKAAVRRLLRPKGFTQ


Mouse_OLF
NKDVRAAVRNLVGQKHLTE


Rat_OLF
NKDVKAAVKYILKQKYIP-






Consensus key




* - single, fully conserved residue




: - conservation of strong groups




. - conservation of weak groups - no consensus








[0505] The OR family of the GPCR superfamily is a group of related proteins specifically located at the ciliated surface of olfactory sensory neurons in the nasal epithelium that are involved in the initial steps of the olfactory signal transduction cascade. Accordingly, the NOV14 nucleic acid, polypeptide, antibodies and other compositions of the present invention can be used to detect nasal epithelial neuronal tissue.


[0506] Based on its relatedness to the known members of the OR family of the GPCR superfamily, NOV14 satisfies a need in the art by providing new diagnostic or therapeutic compositions useful in the treatment of disorders associated with alterations in the expression of members of OR family-like proteins. Nucleic acids, polypeptides, antibodies, and other compositions of the present invention are useful in the treatment and/or diagnosis of a variety of diseases and pathologies, including by way of nonlimiting example, those involving neurogenesis, cancer and wound healing.


[0507] Hydrophobicity analysis confirms the prediction of the presence of seven transmembrane domains in NOV14. PSORT analysis predicts that NOV14 is likely localized in the plasma membrane. Likewise, SignalP analysis indicates that there is most likely a cleavage site between positions 44 and 45.


[0508] Possible SNP Position(s) include:


[0509] Cons.Pos.: 324 Depth: 23 Change: G>A


[0510] Putative Allele Freq.: 0.130


[0511] ->126604820(+,i) unrev. Fpos: 372


[0512] ->128715801(+,i) unrev. Fpos: 407


[0513] ->128903077(+,i) unrev. Fpos: 396


[0514] Cons.Pos.: 429 Depth: 21 Change: A>G


[0515] Putative Allele Freq.: 0.095


[0516] ->128715801(+,i) unrev. Fpos: 512


[0517] ->128903077(+,i) unrev. Fpos: 501


[0518] Cons.Pos.: 493 Depth: 30 Change: T>-


[0519] Putative Allele Freq.: 0.100


[0520] ->128784002(−,i) unrev. Fpos: 595


[0521] ->28784101(−,i) unrev. Fpos: 592


[0522] ->128784168(−,i) unrev. Fpos: 590


[0523] Cons.Pos.: 510 Depth: 28 Change: A>-


[0524] Putative Allele Freq.: 0.071


[0525] ->126604731(+,i) unrev. Fpos: 558


[0526] ->128903043(+,i) unrev. Fpos: 591


[0527] Cons.Pos.: 721 Depth: 18 Change: G>A


[0528] Putative Allele Freq.: 0.111


[0529] ->126604674(−,i) unrev. Fpos: 321


[0530] ->126604747(−,i) unrev. Fpos: 330


[0531] Cons.Pos.: 760 Depth: 18 Change: C>T


[0532] Putative Allele Freq.: 0.222


[0533] ->126604632(−,i) unrev. Fpos: 280


[0534] ->126604646(−,i) unrev. Fpos: 288


[0535] ->126604705(−,i) unrev. Fpos: 287


[0536] ->126604806(−,i) unrev. Fpos: 287


[0537] Table 52 shows a multiple sequence alignment of NOV1-14 polypeptides with a known human olfactory receptor, family 2, subfamily S, member 2 (GenBank Accession No.: NP063950), indicating the homology between the present invention and known members of a protein family.
53TABLE 52NOV8--------MAMDNVTAVFQFLLIGIS-NYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHF(SEQ ID NO:15)NOV7----------MDNVTAVFQFLLIGIS-NYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHF(SEQ ID NO:13)NOV9--------MAMDNVTAVFQFLLIGIS-NYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHF(SEQ ID NO:17)NOV13--------MAMDNVTAVFQFLLIGIS-NYPQWRDTFFTLVLIIYLSTLLGNGFMIFLIHF(SEQ ID NO:23)NOV4-------MEKANETSPVMGFVLLRLS-AHPELEKTFFVLILLMYLVILLGNGVLILVTIL(SEQ ID NO:7)Human_OLF-----------------MGFVLLRLS-AHPELEKTFFVLILLMYLVILLGNGVLILVTIL(SEQ ID NO:101)NOV14-------MEKANETSPVMGFVLLRLS-AHPELEKTFFVLILLMYLVILLGNGVLILVTIL(SEQ ID NO:27)NOV12-------MEKANETSPVMGFVLLGLS-AHPELEKTFFVLILLMYLVILLGNGVLILVTIL(SEQ ID NO:23)NOV3-------MEPLNRT-EVSEFFLKGFS-GYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVL(SEQ ID NO:4)NOV2-------MEPLNRT-EVSEFFLKGFS-GYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVL(SEQ ID NO:4)NOV1-------MEPLNRT-EVSEFFLKGFS-GYPALEHLLFPLCSAMYLVTLLGNTAIMAVSVL(SEQ ID NO:2)NOV6MELWNYHSMELWNFTLGSGFILVGIL-NDSGSPELLCATITILYLLALISNGLLLLAITM(SEQ ID NO:11)NOV5--------MELWNFTLGSGFILVGIL-NDSGSPELLCATITILYLLALISNGLLLLAITM(SEQ ID NO:9)NOV11-------LETTNTTGFVNEFILLGFP-CRWEIQILLFVVFSLIYLLTLLGNTSIICAVWS(SEQ ID NO:21)NOV10----MSVIEANNISGPVSEFILLGFPACCRETKILLFVVFSLIYLLTLMGNTSIICAVWS(SEQ ID NO:19)                   *.*  :          :      :**  *:.*  ::NOV8DPNLHTPIYFFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAENOV7DPNLHTPIYFFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAENOV9DPNLHTPIYFFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAENOV13DPNLHTPIYFFLSNLSFLDLCYGTASMPQALVHCFSTHPYLSYPRCLAQTSVSLALATAENOV4DSRLHTPMYFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTEHuman_OLFDSRLHTPMYFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTENOV14DSPLHTPMYFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTENOV12DSRLHTPMYFFLGNLSFLDICFTTSSVPLVLDSFLTPQETISFSACAVQMALSFAMAGTENOV3DIHLHTPVYFFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTENOV2DIHLHTPVYFFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTENOV1DIHLHTPVYFFLGNLSTLDICYTPTFVPLMLVHLLSSRKTISFAVCAIQMCLSLSTGSTENOV6EARLHMPMYLLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAENOV5EARLHMPMYLLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAENOV11SQKLHTPMYILLANFSFLEICCVSSDVPIMAANLISQTQSISCAGCLLRFYF-FSMCAAENOV10SQKLHTPMYILLANFSFLEICCISSDVP-MLANLISHIKSISYAGCLLQFFY-FSMCAAE. .** *:*::*.::* :::   .   *      :     :*   *  :    ::   :*NOV8CLLLAAMAYDRVVAISNPLRYSVVNNGPVCVCLVATSWGTS-LVLTAMLILSLRLHFCGANOV7CLLLAAMAYDRVVAISNPLRYSVVMNGPVCVCLVATSWGTS-LVLTAMLILSLRLHFCGANOV9CLLLAAMAYDRVVAISNPLRYSVVMNGPVCVCLVATSWGTS-LVLTAMLILSLRLHFCGANOV13CLLLAAMAYDRVVAISNPLRYSVVMNGPVCVCLVATSWGTS-LVLTAMLILSLRLHFCGANOV4CLLLSMMAFDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDHuman_OLFCLLLSMMAFDRYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNOV14CLLLSMMAFDPYVAICNPLRYSVIMSKAAYMPMAASSWAIGGAASVVHTSLAIQLPFCGDNOV12CLLLSMMAFDRYVAICNPLRYSVIMSKAAYVPMAASSWAIGGAASVVHTSLAIQLPFCGDNOV3CLLLAITAYDRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGHNOV2CLLLAITAYDRYLAICQPLRYHVLMSHRLCVLLMGAANVLCLLKSVTEMVISMRLPFCGHNOV1CLLLAITAYDRYLAICQPLRYHVLMSHRLCVLLMGAAWVLCLLKSVTEMVISMRLPFCGHNOVGDLLLAFMAYDRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRANOV5DLLLAFMAYDRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRANOV11CLFLSVMSFDRFPAICRPLHYPTLMTHHVCAHFVIFCWVGGCLWLLTPLTLISQVLFCGPNOV10GYFLSVMSFDRFLTICRPLHYPTVMTHHLCVRLVAFCRAGGFLSILMPAVLMSRVPFCGP  :*:  ::**  :*..** * .:*.      :   .                :  **NOV8NVINHFACEILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRTRSLNOV7NVINHFACEILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSYIRIAMAIIRIRSLNOV9NVINHFACEILSLIKLTCSDTSLNEFMILITSIFTLLLPFGFVLLSVIRIAMAIIRIRSLNOV13NVINHFACEILSLIKLTCSDTSLNEFMILITSIFTILLPFGFVLLSYIRIAMAIIRIRSLNOV4NVINHFTCEILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSAHuman_OLFNVINHFTCEILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSANOV14NVINHFTCEILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSANOV12NVINHFTCEILAVLKLACADISINVISMEVTNVIFLGVPVLFISFSYVFIITTILRIPSANOV3HVVSHFTCKILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSANOV2HVVSHFTCKILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSANOV1HVVSHFTCKILAVLKLACGNTSVSEDFLLAGSILLLPVPLAFICLSYLLILATILRVPSANOV6QEIRHLLCEIPHLLKLACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHNPSNNOV5QEIRHLLCEIPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNNOV11NTIDHFFCDLAPLLALSCAPIPGITLTCGIISALIIFLTFLYILGTYFCVLSTVLQVPSGNOV10NITDHFFCNLGPLLALSCAPVPKTTLTCATVSSLIIFITFLYILGSHILVLRAVLWVPAG:   *: *.:  :: ::*.  .         .   :  ..:  ::  :  ::: : :NOV8QGRLKAFTTCGSHLTVVTIFYGSAISMYMKTQSKS------YPDQDKFISVFYGALTPMLNOV7QGRLKAFTTCGSHLTVVTIFYGSAISMYMKTQSKS------YPDQDKFISVFYGALTPMLNOV9QGRLKAFTTCGSHLTVVTIFYGSAISMYMKTQSKS------SPDQDKFISVFYGALTPMLNOV13QGRLKAFTTCGSHLTVVTIFYGSAISMYNKTQSKS------SPDQDKFISVFYGALTPMLNOV4EGRKKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLHuman OLFEGRKKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNOV14EGRKKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNOV12EGRKKVFSTCSAHLTVVIVFYGTLFFMYGKPKSKDSMGADKEDLSDKLIPLFYGVVTPMLNOV3ARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKE------AHISDEVFTVLYAMVTTMLNOV2ARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKE------AHISDEVFTVLYAMVTTMLNOV1ARCCKAFSTCLAHLAVVLLFYGTIIFMYLKPKSKE------AHISDEVFTVLYAMVTTMLNOV6EGRKKALVTCSSHLTVVGMFYGAATFMYVLPSSFH------STRQDNIISVFYTIVTPALNOV5EGRKKALVTCSSHLTVVGMFYGAATFMYVLPSSFH------STRQDNIISVFYTIVTPALNOV11LGRHKAFSTCGCHLAVVSLFYGSLMVMYVSPGSGD------YHGIKKFVTLFYTLSTPFFNOV10SGRNKAFSTCASHFLVVSFFYGSVMVMYVSPGSRS------RPGTQKFVTLFYCTATPFF    *.: ** .*: ** .***:   **  . *            .:...::*   *. :NOV8NPLIYSLRKKDVKRAIRKVMLKRT---------NOV7NPLIYSLRKKDVKRAIRKVMLKRT---------NOV9NPLIYSLRKKDVKRAIRKVMLKRT---------NOV12NPLIYSLRKKDVKRAIRKVMLKRT---------NOV4NPIIYSLRNKDVKAAVRPLLRPKGFTQ------Human_OLFNPIIYSLRNKDVKAAVRRLLRPKGFTQ------NOV14NPIIYSLRNKDVKAAVRRLLRPKGFTQ------NOV12NPIIYSLRNKDVKAAVRPLLRPKGFTQ------NOV3NPTIYSLRNKEVKEAARKVWGRSRASR------NOV2NPTIYSLRNKEVKEAARKVWGRSRASR------NOV1NPTIYSLRNKEVKEAARKVWGRSRASR------NOV6NPLIYSLRNKEVMRALRRVLGKYMLPAHSTL--NOV5NPLIYSLRNKEVMRALRRVLGKYMLPAHSTL--NOV11NPLIYSFRNKDMKEALKKFLRN------RHTVDNOV10NPLTYSLWNKDMTDALKKVLGVPSKEIYWNTLK**  **: :*::  * ::.Where “*” indicates a single, fully conserved residue, “:” indicates conservation of strong groups, and “.” indicates conservation of weak groups, and Human_OLF is a known human olfactory receptor, family 2, subfamily S, member 2 (GenBank Accession No.: NP_063950).


[0538] The nucleic acids and proteins of the invention are useful in potential therapeutic applications implicated in disorders of the neuro-olfactory system, such as those induced by trauma, surgery and/or neoplastic disorders. For example, a cDNA encoding the olfactory receptor protein may be useful in gene therapy for treating such disorders, and the olfactory receptor protein may be useful when administered to a subject in need thereof. By way of nonlimiting example, the compositions of the present invention will have efficacy for treatment of patients suffering from disorders of the neuro-olfactory system. The novel nucleic acids encoding olfactory receptor protein, and the olfactory receptor protein of the invention, or fragments thereof, may further be useful in the treatment of adenocarcinoma; lymphoma; prostate cancer; uterus cancer, immune response, AIDS, asthma, Crohn's disease, multiple sclerosis, treatment of Albright hereditary ostoeodystrophy, development of powerful assay system for functional analysis of various human disorders which will help in understanding of pathology of the disease, and development of new drug targets for various disorders. They may also be used in diagnostic applications, wherein the presence or amount of the nucleic acid or the protein are to be assessed. These materials are further useful in the generation of antibodies that bind immunospecifically to the novel substances of the invention for use in therapeutic or diagnostic methods.


[0539] NOVX Nucleic Acids


[0540] The nucleic acids of the invention include those that encode a NOVX polypeptide or protein. As used herein, the terms polypeptide and protein are interchangeable.


[0541] In some embodiments, a NOVX nucleic acid encodes a mature NOVX polypeptide. As used herein, a “mature” form of a polypeptide or protein described herein relates to the product of a naturally occurring polypeptide or precursor form or proprotein. The naturally occurring polypeptide, precursor or proprotein includes, by way of nonlimiting example, the full-length gene product, encoded by the corresponding gene. Alternatively, it may be defined as the polypeptide, precursor or proprotein encoded by an open reading frame described herein. The product “mature” form arises, again by way of nonlimiting example, as a result of one or more naturally occurring processing steps that may take place within the cell in which the gene product arises. Examples of such processing steps leading to a “mature” form of a polypeptide or protein include the cleavage of the N-terminal methionine residue encoded by the initiation codon of an open reading frame, or the proteolytic cleavage of a signal peptide or leader sequence. Thus a mature form arising from a precursor polypeptide or protein that has residues 1 to N, where residue 1 is the N-terminal methionine, would have residues 2 through N remaining after removal of the N-terminal methionine. Alternatively, a mature form arising from a precursor polypeptide or protein having residues 1 to N, in which an N-terminal signal sequence from residue 1 to residue M is cleaved, would have the residues from residue M+1 to residue N remaining. Further as used herein, a “mature” form of a polypeptide or protein may arise from a step of post-translational modification other than a proteolytic cleavage event. Such additional processes include, by way of non-limiting example, glycosylation, myristoylation or phosphorylation. In general, a mature polypeptide or protein may result from the operation of only one of these processes, or a combination of any of them.


[0542] Among the NOVX nucleic acids is the nucleic acid whose sequence is provided in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or a fragment thereof. Additionally, the invention includes mutant or variant nucleic acids of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or a fragment thereof, any of whose bases may be changed from the corresponding bases shown in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, while still encoding a protein that maintains at least one of its NOVX-like activities and physiological functions (i.e., modulating angiogenesis, neuronal development). The invention further includes the complement of the nucleic acid sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, including fragments, derivatives, analogs and homologs thereof. The invention additionally includes nucleic acids or nucleic acid fragments, or complements thereto, whose structures include chemical modifications.


[0543] One aspect of the invention pertains to isolated nucleic acid molecules that encode NOVX proteins or biologically active portions thereof. Also included are nucleic acid fragments sufficient for use as hybridization probes to identify NOVX-encoding nucleic acids (e.g., NOVX mRNA) and fragments for use as polymerase chain reaction (PCR) primers for the amplification or mutation of NOVX nucleic acid molecules. As used herein, the term “nucleic acid molecule” is intended to include DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), analogs of the DNA or RNA generated using nucleotide analogs, and derivatives, fragments and homologs thereof. The nucleic acid molecule can be single-stranded or double-stranded, but preferably is double-stranded DNA.


[0544] “Probes” refer to nucleic acid sequences of variable length, preferably between at least about 10 nucleotides (nt), 100 nt, or as many as about, e.g., 6,000 nt, depending on use. Probes are used in the detection of identical, similar, or complementary nucleic acid sequences. Longer length probes are usually obtained from a natural or recombinant source, are highly specific and much slower to hybridize than oligomers. Probes may be single- or double-stranded and designed to have specificity in PCR, membrane-based hybridization technologies, or ELISA-like technologies.


[0545] An “isolated” nucleic acid molecule is one that is separated from other nucleic acid molecules that are present in the natural source of the nucleic acid. Examples of isolated nucleic acid molecules include, but are not limited to, recombinant DNA molecules contained in a vector, recombinant DNA molecules maintained in a heterologous host cell, partially or substantially purified nucleic acid molecules, and synthetic DNA or RNA molecules. Preferably, an “isolated” nucleic acid is free of sequences which naturally flank the nucleic acid (i.e., sequences located at the 5′ and 3′ ends of the nucleic acid) in the genomic DNA of the organism from which the nucleic acid is derived. For example, in various embodiments, the isolated NOVX nucleic acid molecule can contain less than about 50 kb, 25 kb, 5 kb, 4 kb, 3 kb, 2 kb, 1 kb, 0.5 kb or 0.1 kb of nucleotide sequences which naturally flank the nucleic acid molecule in genomic DNA of the cell from which the nucleic acid is derived. Moreover, an “isolated” nucleic acid molecule, such as a cDNA molecule, can be substantially free of other cellular material or culture medium when produced by recombinant techniques, or of chemical precursors or other chemicals when chemically synthesized.


[0546] A nucleic acid molecule of the present invention, e.g., a nucleic acid molecule having the nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or a complement of any of this nucleotide sequence, can be isolated using standard molecular biology techniques and the sequence information provided herein. Using all or a portion of the nucleic acid sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, as a hybridization probe, NOVX nucleic acid sequences can be isolated using standard hybridization and cloning techniques (e.g., as described in Sambrook et al., eds., MOLECULAR CLONING: A LABORATORY MANUAL 2nd Ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989; and Ausubel, et al., eds., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, N.Y., 1993.)


[0547] A nucleic acid of the invention can be amplified using cDNA, mRNA or alternatively, genomic DNA, as a template and appropriate oligonucleotide primers according to standard PCR amplification techniques. The nucleic acid so amplified can be cloned into an appropriate vector and characterized by DNA sequence analysis. Furthermore, oligonucleotides corresponding to NOVX nucleotide sequences can be prepared by standard synthetic techniques, e.g., using an automated DNA synthesizer.


[0548] As used herein, the term “oligonucleotide” refers to a series of linked nucleotide residues, which oligonucleotide has a sufficient number of nucleotide bases to be used in a PCR reaction. A short oligonucleotide sequence may be based on, or designed from, a genomic or cDNA sequence and is used to amplify, confirm, or reveal the presence of an identical, similar or complementary DNA or RNA in a particular cell or tissue. Oligonucleotides comprise portions of a nucleic acid sequence having about 10 nt, 50 nt, or 100 nt in length, preferably about 15 nt to 30 nt in length. In one embodiment, an oligonucleotide comprising a nucleic acid molecule less than 100 nt in length would further comprise at lease 6 contiguous nucleotides of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or a complement thereof. Oligonucleotides may be chemically synthesized and may be used as probes.


[0549] In another embodiment, an isolated nucleic acid molecule of the invention comprises a nucleic acid molecule that is a complement of the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or a portion of this nucleotide sequence. A nucleic acid molecule that is complementary to the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 is one that is sufficiently complementary to the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 that it can hydrogen bond with little or no mismatches to the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, thereby forming a stable duplex.


[0550] As used herein, the term “complementary” refers to Watson-Crick or Hoogsteen base pairing between nucleotide units of a nucleic acid molecule, and the term “binding” means the physical or chemical interaction between two polypeptides or compounds or associated polypeptides or compounds or combinations thereof. Binding includes ionic, non-ionic, Von der Waals, hydrophobic interactions, etc. A physical interaction can be either direct or indirect. Indirect interactions may be through or due to the effects of another polypeptide or compound. Direct binding refers to interactions that do not take place through, or due to, the effect of another polypeptide or compound, but instead are without other substantial chemical intermediates.


[0551] Moreover, the nucleic acid molecule of the invention can comprise only a portion of the nucleic acid sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, e.g., a fragment that can be used as a probe or primer, or a fragment encoding a biologically active portion of NOVX. Fragments provided herein are defined as sequences of at least 6 (contiguous) nucleic acids or at least 4 (contiguous) amino acids, a length sufficient to allow for specific hybridization in the case of nucleic acids or for specific recognition of an epitope in the case of amino acids, respectively, and are at most some portion less than a full length sequence. Fragments may be derived from any contiguous portion of a nucleic acid or amino acid sequence of choice. Derivatives are nucleic acid sequences or amino acid sequences formed from the native compounds either directly or by modification or partial substitution. Analogs are nucleic acid sequences or amino acid sequences that have a structure similar to, but not identical to, the native compound but differs from it in respect to certain components or side chains. Analogs may be synthetic or from a different evolutionary origin and may have a similar or opposite metabolic activity compared to wild type.


[0552] Derivatives and analogs may be full length or other than full length, if the derivative or analog contains a modified nucleic acid or amino acid, as described below. Derivatives or analogs of the nucleic acids or proteins of the invention include, but are not limited to, molecules comprising regions that are substantially homologous to the nucleic acids or proteins of the invention, in various embodiments, by at least about 70%, 80%, 85%, 90%, 95%, 98%, or even 99% identity (with a preferred identity of 80-99%) over a nucleic acid or amino acid sequence of identical size or when compared to an aligned sequence in which the alignment is done by a computer homology program known in the art, or whose encoding nucleic acid is capable of hybridizing to the complement of a sequence encoding the aforementioned proteins under stringent, moderately stringent, or low stringent conditions. See e.g. Ausubel, et al., CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, New York, N.Y., 1993, and below. An exemplary program is the Gap program (Wisconsin Sequence Analysis Package, Version 8 for UNIX, Genetics Computer Group, University Research Park, Madison, Wis.) using the default settings, which uses the algorithm of Smith and Waterman (Adv. Appl. Math., 1981, 2: 482-489, which is incorporated herein by reference in its entirety).


[0553] A “homologous nucleic acid sequence” or “homologous amino acid sequence,” or variations thereof, refer to sequences characterized by a homology at the nucleotide level or amino acid level as discussed above. Homologous nucleotide sequences encode those sequences coding for isoforms of a NOVX polypeptide. Isoforms can be expressed in different tissues of the same organism as a result of, for example, alternative splicing of RNA. Alternatively, isoforms can be encoded by different genes. In the present invention, homologous nucleotide sequences include nucleotide sequences encoding for a NOVX polypeptide of species other than humans, including, but not limited to, mammals, and thus can include, e.g., mouse, rat, rabbit, dog, cat cow, horse, and other organisms. Homologous nucleotide sequences also include, but are not limited to, naturally occurring allelic variations and mutations of the nucleotide sequences set forth herein. A homologous nucleotide sequence does not, however, include the nucleotide sequence encoding human NOVX protein. Homologous nucleic acid sequences include those nucleic acid sequences that encode conservative amino acid substitutions (see below) in SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27, as well as a polypeptide having NOVX activity. Biological activities of the NOVX proteins are described below. A homologous amino acid sequence does not encode the amino acid sequence of a human NOVX polypeptide.


[0554] The nucleotide sequence determined from the cloning of the human NOVX gene allows for the generation of probes and primers designed for use in identifying and/or cloning NOVX homologues in other cell types, e.g., from other tissues, as well as NOVX homologues from other mammals. The probe/primer typically comprises a substantially purified oligonucleotide. The oligonucleotide typically comprises a region of nucleotide sequence that hybridizes under stringent conditions to at least about 12, 25, 50, 100, 150, 200, 250, 300, 350 or 400 or more consecutive sense strand nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26; or an anti-sense strand nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26; or of a naturally occurring mutant of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26.


[0555] Probes based on the human NOVX nucleotide sequence can be used to detect transcripts or genomic sequences encoding the same or homologous proteins. In various embodiments, the probe further comprises a label group attached thereto, e.g., the label group can be a radioisotope, a fluorescent compound, an enzyme, or an enzyme co-factor. Such probes can be used as a part of a diagnostic test kit for identifying cells or tissue which misexpress a NOVX protein, such as by measuring a level of a NOVX-encoding nucleic acid in a sample of cells from a subject e.g., detecting NOVX mRNA levels or determining whether a genomic NOVX gene has been mutated or deleted.


[0556] A “polypeptide having a biologically active portion of NOVX” refers to polypeptides exhibiting activity similar, but not necessarily identical to, an activity of a polypeptide of the present invention, including mature forms, as measured in a particular biological assay, with or without dose dependency. A nucleic acid fragment encoding a “biologically active portion of NOVX” can be prepared by isolating a portion of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 that encodes a polypeptide having a NOVX biological activity (biological activities of the NOVX proteins are described below), expressing the encoded portion of NOVX protein (e.g., by recombinant expression in vitro) and assessing the activity of the encoded portion of NOVX. For example, a nucleic acid fragment encoding a biologically active portion of NOVX can optionally include an ATP-binding domain. In another embodiment, a nucleic acid fragment encoding a biologically active portion of NOVX includes one or more regions.


[0557] NOVX Variants


[0558] The invention further encompasses nucleic acid molecules that differ from the nucleotide sequences shown in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 due to the degeneracy of the genetic code. These nucleic acids thus encode the same NOVX protein as that encoded by the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 e.g., the polypeptide of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27. In another embodiment, an isolated nucleic acid molecule of the invention has a nucleotide sequence encoding a protein having an amino acid sequence shown in SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27.


[0559] In addition to the human NOVX nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, it will be appreciated by those skilled in the art that DNA sequence polymorphisms that lead to changes in the amino acid sequences of NOVX may exist within a population (e.g., the human population). Such genetic polymorphism in the NOVX gene may exist among individuals within a population due to natural allelic variation. As used herein, the terms “gene” and “recombinant gene” refer to nucleic acid molecules comprising an open reading frame encoding a NOVX protein, preferably a mammalian NOVX protein. Such natural allelic variations can typically result in 1-5% variance in the nucleotide sequence of the NOVX gene. Any and all such nucleotide variations and resulting amino acid polymorphisms in NOVX that are the result of natural allelic variation and that do not alter the functional activity of NOVX are intended to be within the scope of the invention.


[0560] Moreover, nucleic acid molecules encoding NOVX proteins from other species, and thus that have a nucleotide sequence that differs from the human sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 are intended to be within the scope of the invention. Nucleic acid molecules corresponding to natural allelic variants and homologues of the NOVX cDNAs of the invention can be isolated based on their homology to the human NOVX nucleic acids disclosed herein using the human cDNAs, or a portion thereof, as a hybridization probe according to standard hybridization techniques under stringent hybridization conditions. For example, a soluble human NOVX cDNA can be isolated based on its homology to human membrane-bound NOVX. Likewise, a membrane-bound human NOVX cDNA can be isolated based on its homology to soluble human NOVX.


[0561] Accordingly, in another embodiment, an isolated nucleic acid molecule of the invention is at least 6 nucleotides in length and hybridizes under stringent conditions to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26. In another embodiment, the nucleic acid is at least 10, 25, 50, 100, 250, 500 or 750 nucleotides in length. In another embodiment, an isolated nucleic acid molecule of the invention hybridizes to the coding region. As used herein, the term “hybridizes under stringent conditions” is intended to describe conditions for hybridization and washing under which nucleotide sequences at least 60% homologous to each other typically remain hybridized to each other.


[0562] Homologs (i.e., nucleic acids encoding NOVX proteins derived from species other than human) or other related sequences (e.g., paralogs) can be obtained by low, moderate or high stringency hybridization with all or a portion of the particular human sequence as a probe using methods well known in the art for nucleic acid hybridization and cloning.


[0563] As used herein, the phrase “stringent hybridization conditions” refers to conditions under which a probe, primer or oligonucleotide will hybridize to its target sequence, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures than shorter sequences. Generally, stringent conditions are selected to be about 5° C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength and pH. The Tm is the temperature (under defined ionic strength, pH and nucleic acid concentration) at which 50% of the probes complementary to the target sequence hybridize to the target sequence at equilibrium. Since the target sequences are generally present at excess, at Tm, 50% of the probes are occupied at equilibrium. Typically, stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30° C. for short probes, primers or oligonucleotides (e.g., 10 nt to 50 nt) and at least about 60° C. for longer probes, primers and oligonucleotides. Stringent conditions may also be achieved with the addition of destabilizing agents, such as formamide.


[0564] Stringent conditions are known to those skilled in the art and can be found in CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, N.Y. (1989), 6.3.1-6.3.6. Preferably, the conditions are such that sequences at least about 65%, 70%, 75%, 85%, 90%, 95%, 98%, or 99% homologous to each other typically remain hybridized to each other. A non-limiting example of stringent hybridization conditions is hybridization in a high salt buffer comprising 6×SSC, 50 mM Tris-HCl (pH 7.5), 1 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.02% BSA, and 500 mg/ml denatured salmon sperm DNA at 65° C. This hybridization is followed by one or more washes in 0.2×SSC, 0.01% BSA at 50° C. An isolated nucleic acid molecule of the invention that hybridizes under stringent conditions to the sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 corresponds to a naturally occurring nucleic acid molecule. As used herein, a “naturally-occurring” nucleic acid molecule refers to an RNA or DNA molecule having a nucleotide sequence that occurs in nature (e.g., encodes a natural protein).


[0565] In a second embodiment, a nucleic acid sequence that is hybridizable to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or fragments, analogs or derivatives thereof, under conditions of moderate stringency is provided. A non-limiting example of moderate stringency hybridization conditions are hybridization in 6×SSC, 5×Denhardt's solution, 0.5% SDS and 100 mg/ml denatured salmon sperm DNA at 55° C., followed by one or more washes in 1×SSC, 0.1% SDS at 37° C. Other conditions of moderate stringency that may be used are well known in the art. See, e.g., Ausubel et al. (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Kriegler, 1990, GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY.


[0566] In a third embodiment, a nucleic acid that is hybridizable to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or fragments, analogs or derivatives thereof, under conditions of low stringency, is provided. A non-limiting example of low stringency hybridization conditions are hybridization in 35% formamide, 5×SSC, 50 mM Tris-HCl (pH 7.5), 5 mM EDTA, 0.02% PVP, 0.02% Ficoll, 0.2% BSA, 100 mg/ml denatured salmon sperm DNA, 10% (wt/vol) dextran sulfate at 40° C., followed by one or more washes in 2×SSC, 25 mM Tris-HCl (pH 7.4), 5 mM EDTA, and 0.1% SDS at 50° C. Other conditions of low stringency that may be used are well known in the art (e.g., as employed for cross-species hybridizations). See, e.g., Ausubel et al. (eds.), 1993, CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, NY, and Kriegler, 1990, GENE TRANSFER AND EXPRESSION, A LABORATORY MANUAL, Stockton Press, NY; Shilo and Weinberg, 1981, Proc Natl Acad Sci USA 78: 6789-6792.


[0567] Conservative Mutations


[0568] In addition to naturally-occurring allelic variants of the NOVX sequence that may exist in the population, the skilled artisan will further appreciate that changes can be introduced by mutation into the nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, thereby leading to changes in the amino acid sequence of the encoded NOVX protein, without altering the functional ability of the NOVX protein. For example, nucleotide substitutions leading to amino acid substitutions at “non-essential” amino acid residues can be made in the sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26. A “non-essential” amino acid residue is a residue that can be altered from the wild-type sequence of NOVX without altering the biological activity, whereas an “essential” amino acid residue is required for biological activity. For example, amino acid residues that are conserved among the NOVX proteins of the present invention, are predicted to be particularly unamenable to alteration.


[0569] Another aspect of the invention pertains to nucleic acid molecules encoding NOVX proteins that contain changes in amino acid residues that are not essential for activity. Such NOVX proteins differ in amino acid sequence from SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27, yet retain biological activity. In one embodiment, the isolated nucleic acid molecule comprises a nucleotide sequence encoding a protein, wherein the protein comprises an amino acid sequence at least about 75% homologous to the amino acid sequence of SEQ ID NO: 2, 4, 6, or 8. Preferably, the protein encoded by the nucleic acid is at least about 80% homologous to SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27, more preferably at least about 90%, 95%, 98%, and most preferably at least about 99% homologous to SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27.


[0570] An isolated nucleic acid molecule encoding a NOVX protein homologous to the protein of can be created by introducing one or more nucleotide substitutions, additions or deletions into the nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, such that one or more amino acid substitutions, additions or deletions are introduced into the encoded protein.


[0571] Mutations can be introduced into the nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 by standard techniques, such as site-directed mutagenesis and PCR-mediated mutagenesis. Preferably, conservative amino acid substitutions are made at one or more predicted non-essential amino acid residues. A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine). Thus, a predicted nonessential amino acid residue in NOVX is replaced with another amino acid residue from the same side chain family. Alternatively, in another embodiment, mutations can be introduced randomly along all or part of a NOVX coding sequence, such as by saturation mutagenesis, and the resultant mutants can be screened for NOVX biological activity to identify mutants that retain activity. Following mutagenesis of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 the encoded protein can be expressed by any recombinant technology known in the art and the activity of the protein can be determined.


[0572] In one embodiment, a mutant NOVX protein can be assayed for (1) the ability to form protein:protein interactions with other NOVX proteins, other cell-surface proteins, or biologically active portions thereof, (2) complex formation between a mutant NOVX protein and a NOVX receptor; (3) the ability of a mutant NOVX protein to bind to an intracellular target protein or biologically active portion thereof; (e.g., avidin proteins); (4) the ability to bind NOVX protein; or (5) the ability to specifically bind an anti-NOVX protein antibody.


[0573] Antisense NOVX Nucleic Acids


[0574] Another aspect of the invention pertains to isolated antisense nucleic acid molecules that are hybridizable to or complementary to the nucleic acid molecule comprising the nucleotide sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or fragments, analogs or derivatives thereof. An “antisense” nucleic acid comprises a nucleotide sequence that is complementary to a “sense” nucleic acid encoding a protein, e.g., complementary to the coding strand of a double-stranded cDNA molecule or complementary to an mRNA sequence. In specific aspects, antisense nucleic acid molecules are provided that comprise a sequence complementary to at least about 10, 25, 50, 100, 250 or 500 nucleotides or an entire NOVX coding strand, or to only a portion thereof. Nucleic acid molecules encoding fragments, homologs, derivatives and analogs of a NOVX protein of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 or antisense nucleic acids complementary to a NOVX nucleic acid sequence of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 are additionally provided.


[0575] In one embodiment, an antisense nucleic acid molecule is antisense to a “coding region” of the coding strand of a nucleotide sequence encoding NOVX. The term “coding region” refers to the region of the nucleotide sequence comprising codons which are translated into amino acid residues (e.g., the protein coding region of human NOVX corresponds to SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27). In another embodiment, the antisense nucleic acid molecule is antisense to a “noncoding region” of the coding strand of a nucleotide sequence encoding NOVX. The term “noncoding region” refers to 5′ and 3′ sequences which flank the coding region that are not translated into amino acids (i.e., also referred to as 5′ and 3′ untranslated regions).


[0576] Given the coding strand sequences encoding NOVX disclosed herein (e.g., SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26), antisense nucleic acids of the invention can be designed according to the rules of Watson and Crick or Hoogsteen base pairing. The antisense nucleic acid molecule can be complementary to the entire coding region of NOVX mRNA, but more preferably is an oligonucleotide that is antisense to only a portion of the coding or noncoding region of NOVX mRNA. For example, the antisense oligonucleotide can be complementary to the region surrounding the translation start site of NOVX mRNA. An antisense oligonucleotide can be, for example, about 5, 10, 15, 20, 25, 30, 35, 40, 45 or 50 nucleotides in length. An antisense nucleic acid of the invention can be constructed using chemical synthesis or enzymatic ligation reactions using procedures known in the art. For example, an antisense nucleic acid (e.g., an antisense oligonucleotide) can be chemically synthesized using naturally occurring nucleotides or variously modified nucleotides designed to increase the biological stability of the molecules or to increase the physical stability of the duplex formed between the antisense and sense nucleic acids, e.g., phosphorothioate derivatives and acridine substituted nucleotides can be used.


[0577] Examples of modified nucleotides that can be used to generate the antisense nucleic acid include: 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl)uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5′-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl)uracil, (acp3)w, and 2,6-diaminopurine. Alternatively, the antisense nucleic acid can be produced biologically using an expression vector into which a nucleic acid has been subcloned in an antisense orientation (i.e., RNA transcribed from the inserted nucleic acid will be of an antisense orientation to a target nucleic acid of interest, described further in the following subsection).


[0578] The antisense nucleic acid molecules of the invention are typically administered to a subject or generated in situ such that they hybridize with or bind to cellular mRNA and/or genomic DNA encoding a NOVX protein to thereby inhibit expression of the protein, e.g., by inhibiting transcription and/or translation. The hybridization can be by conventional nucleotide complementarity to form a stable duplex, or, for example, in the case of an antisense nucleic acid molecule that binds to DNA duplexes, through specific interactions in the major groove of the double helix. An example of a route of administration of antisense nucleic acid molecules of the invention includes direct injection at a tissue site. Alternatively, antisense nucleic acid molecules can be modified to target selected cells and then administered systemically. For example, for systemic administration, antisense molecules can be modified such that they specifically bind to receptors or antigens expressed on a selected cell surface, e.g., by linking the antisense nucleic acid molecules to peptides or antibodies that bind to cell surface receptors or antigens. The antisense nucleic acid molecules can also be delivered to cells using the vectors described herein. To achieve sufficient intracellular concentrations of antisense molecules, vector constructs in which the antisense nucleic acid molecule is placed under the control of a strong pol II or pol III promoter are preferred.


[0579] In yet another embodiment, the antisense nucleic acid molecule of the invention is an α-anomeric nucleic acid molecule. An α-anomeric nucleic acid molecule forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual β-units, the strands run parallel to each other (Gaultier et al. (1987) Nucleic Acids Res 15: 6625-6641). The antisense nucleic acid molecule can also comprise a 2′-o-methylribonucleotide (Inoue et al. (1987) Nucleic Acids Res 15: 6131-6148) or a chimeric RNA-DNA analogue (Inoue et al. (1987) FEBS Lett 215: 327-330).


[0580] Such modifications include, by way of nonlimiting example, modified bases, and nucleic acids whose sugar phosphate backbones are modified or derivatized. These modifications are carried out at least in part to enhance the chemical stability of the modified nucleic acid, such that they may be used, for example, as antisense binding nucleic acids in therapeutic applications in a subject.


[0581] NOVX Ribozymes and PNA Moieties


[0582] In still another embodiment, an antisense nucleic acid of the invention is a ribozyme. Ribozymes are catalytic RNA molecules with ribonuclease activity that are capable of cleaving a single-stranded nucleic acid, such as a mRNA, to which they have a complementary region. Thus, ribozymes (e.g., hammerhead ribozymes (described in Haselhoff and Gerlach (1988) Nature 334:585-591)) can be used to catalytically cleave NOVX mRNA transcripts to thereby inhibit translation of NOVX mRNA. A ribozyme having specificity for a NOVX-encoding nucleic acid can be designed based upon the nucleotide sequence of a NOVX DNA disclosed herein (i.e., SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26). For example, a derivative of a Tetrahymena L-19 IVS RNA can be constructed in which the nucleotide sequence of the active site is complementary to the nucleotide sequence to be cleaved in a NOVX-encoding mRNA. See, e.g., Cech et al. U.S. Pat. No. 4,987,071; and Cech et al. U.S. Pat. No. 5,116,742. Alternatively, NOVX mRNA can be used to select a catalytic RNA having a specific ribonuclease activity from a pool of RNA molecules. See, e.g., Bartel et al., (1993) Science 261:1411-1418.


[0583] Alternatively, NOVX gene expression can be inhibited by targeting nucleotide sequences complementary to the regulatory region of the NOVX (e.g., the NOVX promoter and/or enhancers) to form triple helical structures that prevent transcription of the NOVX gene in target cells. See generally, Helene. (1991) Anticancer Drug Des. 6: 569-84; Helene. et al. (1992) Ann. N. Y. Acad. Sci. 660:27-36; and Maher (1992) Bioassays 14: 807-15.


[0584] In various embodiments, the nucleic acids of NOVX can be modified at the base moiety, sugar moiety or phosphate backbone to improve, e.g., the stability, hybridization, or solubility of the molecule. For example, the deoxyribose phosphate backbone of the nucleic acids can be modified to generate peptide nucleic acids (see Hyrup et al. (1996) Bioorg Med Chem 4: 5-23). As used herein, the terms “peptide nucleic acids” or “PNAs” refer to nucleic acid mimics, e.g., DNA mimics, in which the deoxyribose phosphate backbone is replaced by a pseudopeptide backbone and only the four natural nucleobases are retained. The neutral backbone of PNAs has been shown to allow for specific hybridization to DNA and RNA under conditions of low ionic strength. The synthesis of PNA oligomers can be performed using standard solid phase peptide synthesis protocols as described in Hyrup et al. (1996) above; Perry-O'Keefe et al. (1996) PNAS 93: 14670-675.


[0585] PNAs of NOVX can be used in therapeutic and diagnostic applications. For example, PNAs can be used as antisense or antigene agents for sequence-specific modulation of gene expression by, e.g., inducing transcription or translation arrest or inhibiting replication. PNAs of NOVX can also be used, e.g., in the analysis of single base pair mutations in a gene by, e.g., PNA directed PCR clamping; as artificial restriction enzymes when used in combination with other enzymes, e.g., S1 nucleases (Hyrup B. (1996) above); or as probes or primers for DNA sequence and hybridization (Hyrup et al. (1996), above; Perry-O'Keefe (1996), above).


[0586] In another embodiment, PNAs of NOVX can be modified, e.g., to enhance their stability or cellular uptake, by attaching lipophilic or other helper groups to PNA, by the formation of PNA-DNA chimeras, or by the use of liposomes or other techniques of drug delivery known in the art. For example, PNA-DNA chimeras of NOVX can be generated that may combine the advantageous properties of PNA and DNA. Such chimeras allow DNA recognition enzymes, e.g., RNase H and DNA polymerases, to interact with the DNA portion while the PNA portion would provide high binding affinity and specificity. PNA-DNA chimeras can be linked using linkers of appropriate lengths selected in terms of base stacking, number of bonds between the nucleobases, and orientation (Hyrup (1996) above). The synthesis of PNA-DNA chimeras can be performed as described in Hyrup (1996) above and Finn et al. (1996) Nucl Acids Res 24: 3357-63. For example, a DNA chain can be synthesized on a solid support using standard phosphoramidite coupling chemistry, and modified nucleoside analogs, e.g., 5′-(4-methoxytrityl)amino-5′-deoxy-thymidine phosphoramidite, can be used between the PNA and the 5′ end of DNA (Mag et al. (1989) Nucl Acid Res 17: 5973-88). PNA monomers are then coupled in a stepwise manner to produce a chimeric molecule with a 5′PNA segment and a 3′DNA segment (Finn et al. (1996) above). Alternatively, chimeric molecules can be synthesized with a 5′DNA segment and a 3′PNA segment. See, Petersen et al. (1975) Bioorg Med Chem Lett 5: 1119-11124.


[0587] In other embodiments, the oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al., 1989, Proc. Natl. Acad. Sci. U.S.A. 86:6553-6556; Lemaitre et al., 1987, Proc. Natl. Acad. Sci. 84:648-652; PCT Publication No. W088/09810) or the blood-brain barrier (see, e.g., PCT Publication No. W089/10134). In addition, oligonucleotides can be modified with hybridization triggered cleavage agents (See, e.g., Krol et al., 1988, BioTechniques 6:958-976) or intercalating agents. (See, e.g., Zon, 1988, Pharm. Res. 5: 539-549). To this end, the oligonucleotide may be conjugated to another molecule, e.g., a peptide, a hybridization triggered cross-linking agent, a transport agent, a hybridization-triggered cleavage agent, etc.


[0588] NOVX Polypeptides


[0589] A NOVX polypeptide of the invention includes the NOVX-like protein whose sequence is provided in SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27. The invention also includes a mutant or variant protein any of whose residues may be changed from the corresponding residue shown in SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 while still encoding a protein that maintains its NOVX-like activities and physiological functions, or a functional fragment thereof. In some embodiments, up to 20% or more of the residues may be so changed in the mutant or variant protein. In some embodiments, the NOVX polypeptide according to the invention is a mature polypeptide.


[0590] In general, a NOVX-like variant that preserves NOVX-like function includes any variant in which residues at a particular position in the sequence have been substituted by other amino acids, and further include the possibility of inserting an additional residue or residues between two residues of the parent protein as well as the possibility of deleting one or more residues from the parent sequence. Any amino acid substitution, insertion, or deletion is encompassed by the invention. In favorable circumstances, the substitution is a conservative substitution as defined above.


[0591] One aspect of the invention pertains to isolated NOVX proteins, and biologically active portions thereof, or derivatives, fragments, analogs or homologs thereof. Also provided are polypeptide fragments suitable for use as immunogens to raise anti-NOVX antibodies. In one embodiment, native NOVX proteins can be isolated from cells or tissue sources by an appropriate purification scheme using standard protein purification techniques. In another embodiment, NOVX proteins are produced by recombinant DNA techniques. Alternative to recombinant expression, a NOVX protein or polypeptide can be synthesized chemically using standard peptide synthesis techniques.


[0592] An “isolated” or “purified” protein or biologically active portion thereof is substantially free of cellular material or other contaminating proteins from the cell or tissue source from which the NOVX protein is derived, or substantially free from chemical precursors or other chemicals when chemically synthesized. The language “substantially free of cellular material” includes preparations of NOVX protein in which the protein is separated from cellular components of the cells from which it is isolated or recombinantly produced. In one embodiment, the language “substantially free of cellular material” includes preparations of NOVX protein having less than about 30% (by dry weight) of non-NOVX protein (also referred to herein as a “contaminating protein”), more preferably less than about 20% of non-NOVX protein, still more preferably less than about 10% of non-NOVX protein, and most preferably less than about 5% non-NOVX protein. When the NOVX protein or biologically active portion thereof is recombinantly produced, it is also preferably substantially free of culture medium, i.e., culture medium represents less than about 20%, more preferably less than about 10%, and most preferably less than about 5% of the volume of the protein preparation.


[0593] The language “substantially free of chemical precursors or other chemicals” includes preparations of NOVX protein in which the protein is separated from chemical precursors or other chemicals that are involved in the synthesis of the protein. In one embodiment, the language “substantially free of chemical precursors or other chemicals” includes preparations of NOVX protein having less than about 30% (by dry weight) of chemical precursors or non-NOVX chemicals, more preferably less than about 20% chemical precursors or non-NOVX chemicals, still more preferably less than about 10% chemical precursors or non-NOVX chemicals, and most preferably less than about 5% chemical precursors or non-NOVX chemicals.


[0594] Biologically active portions of a NOVX protein include peptides comprising amino acid sequences sufficiently homologous to or derived from the amino acid sequence of the NOVX protein, e.g., the amino acid sequence shown in SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 that include fewer amino acids than the full length NOVX proteins, and exhibit at least one activity of a NOVX protein. Typically, biologically active portions comprise a domain or motif with at least one activity of the NOVX protein. A biologically active portion of a NOVX protein can be a polypeptide which is, for example, 10, 25, 50, 100 or more amino acids in length.


[0595] A biologically active portion of a NOVX protein of the present invention may contain at least one of the above-identified domains conserved between the NOVX proteins, e.g. TSR modules. Moreover, other biologically active portions, in which other regions of the protein are deleted, can be prepared by recombinant techniques and evaluated for one or more of the functional activities of a native NOVX protein.


[0596] In an embodiment, the NOVX protein has an amino acid sequence shown in SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27. In other embodiments, the NOVX protein is substantially homologous to SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 and retains the functional activity of the protein of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 yet differs in amino acid sequence due to natural allelic variation or mutagenesis, as described in detail below. Accordingly, in another embodiment, the NOVX protein is a protein that comprises an amino acid sequence at least about 45% homologous to the amino acid sequence of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 and retains the functional activity of the NOVX proteins of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27.


[0597] Determining Homology Between Two or More Sequence


[0598] To determine the percent homology of two amino acid sequences or of two nucleic acids, the sequences are aligned for optimal comparison purposes (e.g., gaps can be introduced in either of the sequences being compared for optimal alignment between the sequences). The amino acid residues or nucleotides at corresponding amino acid positions or nucleotide positions are then compared. When a position in the first sequence is occupied by the same amino acid residue or nucleotide as the corresponding position in the second sequence, then the molecules are homologous at that position (i.e., as used herein amino acid or nucleic acid “homology” is equivalent to amino acid or nucleic acid “identity”).


[0599] The nucleic acid sequence homology may be determined as the degree of identity between two sequences. The homology may be determined using computer programs known in the art, such as GAP software provided in the GCG program package. See, Needleman and Wunsch 1970 J Mol Biol 48: 443-453. Using GCG GAP software with the following settings for nucleic acid sequence comparison: GAP creation penalty of 5.0 and GAP extension penalty of 0.3, the coding region of the analogous nucleic acid sequences referred to above exhibits a degree of identity preferably of at least 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 99%, with the CDS (encoding) part of the DNA sequence shown in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26.


[0600] The term “sequence identity” refers to the degree to which two polynucleotide or polypeptide sequences are identical on a residue-by-residue basis over a particular region of comparison. The term “percentage of sequence identity” is calculated by comparing two optimally aligned sequences over that region of comparison, determining the number of positions at which the identical nucleic acid base (e.g., A, T, C, G, U, or I, in the case of nucleic acids) occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the region of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of sequence identity. The term “substantial identity” as used herein denotes a characteristic of a polynucleotide sequence, wherein the polynucleotide comprises a sequence that has at least 80 percent sequence identity, preferably at least 85 percent identity and often 90 to 95 percent sequence identity, more usually at least 99 percent sequence identity as compared to a reference sequence over a comparison region. The term “percentage of positive residues” is calculated by comparing two optimally aligned sequences over that region of comparison, determining the number of positions at which the identical and conservative amino acid substitutions, as defined above, occur in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the region of comparison (i.e., the window size), and multiplying the result by 100 to yield the percentage of positive residues.


[0601] Chimeric and Fusion Proteins


[0602] The invention also provides NOVX chimeric or fusion proteins. As used herein, a NOVX “chimeric protein” or “fusion protein” comprises a NOVX polypeptide operatively linked to a non-NOVX polypeptide. An “NOVX polypeptide” refers to a polypeptide having an amino acid sequence corresponding to NOVX, whereas a “non-NOVX polypeptide” refers to a polypeptide having an amino acid sequence corresponding to a protein that is not substantially homologous to the NOVX protein, e.g., a protein that is different from the NOVX protein and that is derived from the same or a different organism. Within a NOVX fusion protein the NOVX polypeptide can correspond to all or a portion of a NOVX protein. In one embodiment, a NOVX fusion protein comprises at least one biologically active portion of a NOVX protein. In another embodiment, a NOVX fusion protein comprises at least two biologically active portions of a NOVX protein. Within the fusion protein, the term “operatively linked” is intended to indicate that the NOVX polypeptide and the non-NOVX polypeptide are fused in-frame to each other. The non-NOVX polypeptide can be fused to the N-terminus or C-terminus of the NOVX polypeptide.


[0603] For example, in one embodiment a NOVX fusion protein comprises a NOVX polypeptide operably linked to the extracellular domain of a second protein. Such fusion proteins can be further utilized in screening assays for compounds that modulate NOVX activity (such assays are described in detail below).


[0604] In another embodiment, the fusion protein is a GST-NOVX fusion protein in which the NOVX sequences are fused to the C-terminus of the GST (i.e., glutathione S-transferase) sequences. Such fusion proteins can facilitate the purification of recombinant NOVX.


[0605] In another embodiment, the fusion protein is a NOVX-immunoglobulin fusion protein in which the NOVX sequences comprising one or more domains are fused to sequences derived from a member of the immunoglobulin protein family. The NOVX-immunoglobulin fusion proteins of the invention can be incorporated into pharmaceutical compositions and administered to a subject to inhibit an interaction between a NOVX ligand and a NOVX protein on the surface of a cell, to thereby suppress NOVX-mediated signal transduction in vivo. In one nonlimiting example, a contemplated NOVX ligand of the invention is the NOVX receptor. The NOVX-immunoglobulin fusion proteins can be used to affect the bioavailability of a NOVX cognate ligand. Inhibition of the NOVX ligand/NOVX interaction may be useful therapeutically for both the treatment of proliferative and differentiative disorders, e.g., cancer as well as modulating (e.g., promoting or inhibiting) cell survival, as well as acute and chronic inflammatory disorders and hyperplastic wound healing, e.g. hypertrophic scars and keloids. Moreover, the NOVX-immunoglobulin fusion proteins of the invention can be used as immunogens to produce anti-NOVX antibodies in a subject, to purify NOVX ligands, and in screening assays to identify molecules that inhibit the interaction of NOVX with a NOVX ligand.


[0606] A NOVX chimeric or fusion protein of the invention can be produced by standard recombinant DNA techniques. For example, DNA fragments coding for the different polypeptide sequences are ligated together in-frame in accordance with conventional techniques, e.g., by employing blunt-ended or stagger-ended termini for ligation, restriction enzyme digestion to provide for appropriate termini, filling-in of cohesive ends as appropriate, alkaline phosphatase treatment to avoid undesirable joining, and enzymatic ligation. In another embodiment, the fusion gene can be synthesized by conventional techniques including automated DNA synthesizers. Alternatively, PCR amplification of gene fragments can be carried out using anchor primers that give rise to complementary overhangs between two consecutive gene fragments that can subsequently be annealed and reamplified to generate a chimeric gene sequence (see, for example, Ausubel et al. (eds.) CURRENT PROTOCOLS IN MOLECULAR BIOLOGY, John Wiley & Sons, 1992). Moreover, many expression vectors are commercially available that already encode a fusion moiety (e.g., a GST polypeptide). A NOVX-encoding nucleic acid can be cloned into such an expression vector such that the fusion moiety is linked in-frame to the NOVX protein.


[0607] NOVX Agonists and Antagonists


[0608] The present invention also pertains to variants of the NOVX proteins that function as either NOVX agonists (mimetics) or as NOVX antagonists. Variants of the NOVX protein can be generated by mutagenesis, e.g., discrete point mutation or truncation of the NOVX protein. An agonist of the NOVX protein can retain substantially the same, or a subset of, the biological activities of the naturally occurring form of the NOVX protein. An antagonist of the NOVX protein can inhibit one or more of the activities of the naturally occurring form of the NOVX protein by, for example, competitively binding to a downstream or upstream member of a cellular signaling cascade which includes the NOVX protein. Thus, specific biological effects can be elicited by treatment with a variant of limited function. In one embodiment, treatment of a subject with a variant having a subset of the biological activities of the naturally occurring form of the protein has fewer side effects in a subject relative to treatment with the naturally occurring form of the NOVX proteins.


[0609] Variants of the NOVX protein that function as either NOVX agonists (mimetics) or as NOVX antagonists can be identified by screening combinatorial libraries of mutants, e.g., truncation mutants, of the NOVX protein for NOVX protein agonist or antagonist activity. In one embodiment, a variegated library of NOVX variants is generated by combinatorial mutagenesis at the nucleic acid level and is encoded by a variegated gene library. A variegated library of NOVX variants can be produced by, for example, enzymatically ligating a mixture of synthetic oligonucleotides into gene sequences such that a degenerate set of potential NOVX sequences is expressible as individual polypeptides, or alternatively, as a set of larger fusion proteins (e.g., for phage display) containing the set of NOVX sequences therein. There are a variety of methods which can be used to produce libraries of potential NOVX variants from a degenerate oligonucleotide sequence. Chemical synthesis of a degenerate gene sequence can be performed in an automatic DNA synthesizer, and the synthetic gene then ligated into an appropriate expression vector. Use of a degenerate set of genes allows for the provision, in one mixture, of all of the sequences encoding the desired set of potential NOVX sequences. Methods for synthesizing degenerate oligonucleotides are known in the art (see, e.g., Narang (1983) Tetrahedron 39:3; Itakura et al. (1984) Annu Rev Biochem 53:323; Itakura et al. (1984) Science 198:1056; Ike et al. (1983) Nucl Acid Res 11:477.


[0610] Polypeptide Libraries


[0611] In addition, libraries of fragments of the NOVX protein coding sequence can be used to generate a variegated population of NOVX fragments for screening and subsequent selection of variants of a NOVX protein. In one embodiment, a library of coding sequence fragments can be generated by treating a double stranded PCR fragment of a NOVX coding sequence with a nuclease under conditions wherein nicking occurs only about once per molecule, denaturing the double stranded DNA, renaturing the DNA to form double stranded DNA that can include sense/antisense pairs from different nicked products, removing single stranded portions from reformed duplexes by treatment with S1 nuclease, and ligating the resulting fragment library into an expression vector. By this method, an expression library can be derived which encodes N-terminal and internal fragments of various sizes of the NOVX protein.


[0612] Several techniques are known in the art for screening gene products of combinatorial libraries made by point mutations or truncation, and for screening cDNA libraries for gene products having a selected property. Such techniques are adaptable for rapid screening of the gene libraries generated by the combinatorial mutagenesis of NOVX proteins. The most widely used techniques, which are amenable to high throughput analysis, for screening large gene libraries typically include cloning the gene library into replicable expression vectors, transforming appropriate cells with the resulting library of vectors, and expressing the combinatorial genes under conditions in which detection of a desired activity facilitates isolation of the vector encoding the gene whose product was detected. Recrusive ensemble mutagenesis (REM), a new technique that enhances the frequency of functional mutants in the libraries, can be used in combination with the screening assays to identify NOVX variants (Arkin and Yourvan (1992) PNAS 89:7811-7815; Delgrave et al. (1993) Protein Engineering 6:327-331).


[0613] NOVX Antibodies


[0614] Also included in the invention are antibodies to NOVX proteins, or fragments of NOVX proteins. The term “antibody” as used herein refers to immunoglobulin molecules and immunologically active portions of immunoglobulin (Ig) molecules, i.e., molecules that contain an antigen binding site that specifically binds (immunoreacts with) an antigen. Such antibodies include, but are not limited to, polyclonal, monoclonal, chimeric, single chain, Fab, Fab, and F(ab′)2 fragments, and an Fab expression library. In general, an antibody molecule obtained from humans relates to any of the classes IgG, IgM, IgA, IgE and IgD, which differ from one another by the nature of the heavy chain present in the molecule. Certain classes have subclasses as well, such as IgG1, IgG2, and others. Furthermore, in humans, the light chain may be a kappa chain or a lambda chain. Reference herein to antibodies includes a reference to all such classes, subclasses and types of human antibody species.


[0615] An isolated NOVX-related protein of the invention may be intended to serve as an antigen, or a portion or fragment thereof, and additionally can be used as an immunogen to generate antibodies that immunospecifically bind the antigen, using standard techniques for polyclonal and monoclonal antibody preparation. The full-length protein can be used or, alternatively, the invention provides antigenic peptide fragments of the antigen for use as immunogens. An antigenic peptide fragment comprises at least 6 amino acid residues of the amino acid sequence of the full length protein, such as an amino acid sequence shown in SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, or 20, and encompasses an epitope thereof such that an antibody raised against the peptide forms a specific immune complex with the full length protein or with any fragment that contains the epitope. Preferably, the antigenic peptide comprises at least 10 amino acid residues, or at least 15 amino acid residues, or at least 20 amino acid residues, or at least 30 amino acid residues. Preferred epitopes encompassed by the antigenic peptide are regions of the protein that are located on its surface; commonly these are hydrophilic regions.


[0616] In certain embodiments of the invention, at least one epitope encompassed by the antigenic peptide is a region of NOVX-related protein that is located on the surface of the protein, e.g., a hydrophilic region. A hydrophobicity analysis of the human NOVX-related protein sequence will indicate which regions of a NOVX-related protein are particularly hydrophilic and, therefore, are likely to encode surface residues useful for targeting antibody production. As a means for targeting antibody production, hydropathy plots showing regions of hydrophilicity and hydrophobicity may be generated by any method well known in the art, including, for example, the Kyte Doolittle or the Hopp Woods methods, either with or without Fourier transformation. See, e.g., Hopp and Woods, 1981, Proc. Nat. Acad. Sci. USA 78: 3824-3828; Kyte and Doolittle 1982, J. Mol. Biol. 157: 105-142, each of which is incorporated herein by reference in its entirety. Antibodies that are specific for one or more domains within an antigenic protein, or derivatives, fragments, analogs or homologs thereof, are also provided herein.


[0617] A protein of the invention, or a derivative, fragment, analog, homolog or ortholog thereof, may be utilized as an immunogen in the generation of antibodies that immunospecifically bind these protein components.


[0618] Various procedures known within the art may be used for the production of polyclonal or monoclonal antibodies directed against a protein of the invention, or against derivatives, fragments, analogs homologs or orthologs thereof (see, for example, Antibodies: A Laboratory Manual, Harlow E, and Lane D, 1988, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., incorporated herein by reference). Some of these antibodies are discussed below.


[0619] Polyclonal Antibodies


[0620] For the production of polyclonal antibodies, various suitable host animals (e.g., rabbit, goat, mouse or other mammal) may be immunized by one or more injections with the native protein, a synthetic variant thereof, or a derivative of the foregoing. An appropriate immunogenic preparation can contain, for example, the naturally occurring immunogenic protein, a chemically synthesized polypeptide representing the immunogenic protein, or a recombinantly expressed immunogenic protein. Furthermore, the protein may be conjugated to a second protein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. The preparation can further include an adjuvant. Various adjuvants used to increase the immunological response include, but are not limited to, Freund's (complete and incomplete), mineral gels (e.g., aluminum hydroxide), surface active substances (e.g., lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, dinitrophenol, etc.), adjuvants usable in humans such as Bacille Calmette-Guerin and Corynebacterium parvum, or similar immunostimulatory agents. Additional examples of adjuvants which can be employed include MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate).


[0621] The polyclonal antibody molecules directed against the immunogenic protein can be isolated from the mammal (e.g., from the blood) and further purified by well known techniques, such as affinity chromatography using protein A or protein G, which provide primarily the IgG fraction of immune serum. Subsequently, or alternatively, the specific antigen which is the target of the immunoglobulin sought, or an epitope thereof, may be immobilized on a column to purify the immune specific antibody by immunoaffinity chromatography. Purification of immunoglobulins is discussed, for example, by D. Wilkinson (The Scientist, published by The Scientist, Inc., Philadelphia Pa., Vol. 14, No. 8 (Apr. 17, 2000), pp. 25-28).


[0622] Monoclonal Antibodies


[0623] The term “monoclonal antibody” (MAb) or “monoclonal antibody composition”, as used herein, refers to a population of antibody molecules that contain only one molecular species of antibody molecule consisting of a unique light chain gene product and a unique heavy chain gene product. In particular, the complementarity determining regions (CDRs) of the monoclonal antibody are identical in all the molecules of the population. MAbs thus contain an antigen binding site capable of inmunoreacting with a particular epitope of the antigen characterized by a unique binding affinity for it.


[0624] Monoclonal antibodies can be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975). In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes can be immunized in vitro.


[0625] The immunizing agent will typically include the protein antigen, a fragment thereof or a fusion protein thereof. Generally, either peripheral blood lymphocytes are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, (1986) pp. 59-103). Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells can be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which substances prevent the growth of HGPRT-deficient cells.


[0626] Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, Calif. and the American Type Culture Collection, Manassas, Va. Human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York, (1987) pp. 51-63).


[0627] The culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the antigen. Preferably, the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbent assay (ELISA). Such techniques and assays are known in the art. The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollard, Anal. Biochem., 107:220 (1980). Preferably, antibodies having a high degree of specificity and a high binding affinity for the target antigen are isolated.


[0628] After the desired hybridoma cells are identified, the clones can be subcloned by limiting dilution procedures and grown by standard methods. Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640 medium. Alternatively, the hybridoma cells can be grown iv vivo as ascites in a mammal.


[0629] The monoclonal antibodies secreted by the subclones can be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-Sepharose, hydroxylapatite chromatography, gel electrophoresis, dialysis, or affinity chromatography.


[0630] The monoclonal antibodies can also be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567. DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies). The hybridoma cells of the invention serve as a preferred source of such DNA. Once isolated, the DNA can be placed into expression vectors, which are then transfected into host cells such as simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also can be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences (U.S. Pat. No. 4,816,567; Morrison, Nature 368, 812-13 (1994)) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Such a non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.


[0631] Humanized Antibodies


[0632] The antibodies directed against the protein antigens of the invention can further comprise humanized antibodies or human antibodies. These antibodies are suitable for administration to humans without engendering an immune response by the human against the administered immunoglobulin. Humanized forms of antibodies are chimeric immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab′, F(ab′)2 or other antigen-binding subsequences of antibodies) that are principally comprised of the sequence of a human immunoglobulin, and contain minimal sequence derived from a non-human immunoglobulin. Humanization can be performed following the method of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988)), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. (See also U.S. Pat. No. 5,225,539.) In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies can also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., 1986; Riechmann et al., 1988; and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992)).


[0633] Human Antibodies


[0634] Fully human antibodies relate to antibody molecules in which essentially the entire sequences of both the light chain and the heavy chain, including the CDRs, arise from human genes. Such antibodies are termed “human antibodies”, or “fully human antibodies” herein. Human monoclonal antibodies can be prepared by the trioma technique; the human B-cell hybridoma technique (see Kozbor, et al., 1983 Immunol Today 4: 72) and the EBV hybridoma technique to produce human monoclonal antibodies (see Cole, et al., 1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96). Human monoclonal antibodies may be utilized in the practice of the present invention and may be produced by using human hybridomas (see Cote, et al., 1983. Proc Natl Acad Sci USA 80: 2026-2030) or by transforming human B-cells with Epstein Barr Virus in vitro (see Cole, et al., 1985 In: MONOCLONAL ANTIBODIES AND CANCER THERAPY, Alan R. Liss, Inc., pp. 77-96).


[0635] In addition, human antibodies can also be produced using additional techniques, including phage display libraries (Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)). Similarly, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,016, and in Marks et al. (Bio/Technology 10, 779-783 (1992)); Lonberg et al. (Nature 368 856-859 (1994)); Morrison (Nature 368 812-13 (1994)); Fishwild et al, (Nature Biotechnology 14, 845-51 (1996)); Neuberger (Nature Biotechnology 14, 826 (1996)); and Lonberg and Huszar (Intern. Rev. Immunol. 13 65-93 (1995)).


[0636] Human antibodies may additionally be produced using transgenic nonhuman animals which are modified so as to produce fully human antibodies rather than the animal's endogenous antibodies in response to challenge by an antigen. (See PCT publication WO94/02602). The endogenous genes encoding the heavy and light immunoglobulin chains in the nonhuman host have been incapacitated, and active loci encoding human heavy and light chain immunoglobulins are inserted into the host's genome. The human genes are incorporated, for example, using yeast artificial chromosomes containing the requisite human DNA segments. An animal which provides all the desired modifications is then obtained as progeny by crossbreeding intermediate transgenic animals containing fewer than the full complement of the modifications. The preferred embodiment of such a nonhuman animal is a mouse, and is termed the Xenomouse™ as disclosed in PCT publications WO 96/33735 and WO 96/34096. This animal produces B cells which secrete fully human immunoglobulins. The antibodies can be obtained directly from the animal after immunization with an immunogen of interest, as, for example, a preparation of a polyclonal antibody, or alternatively from immortalized B cells derived from the animal, such as hybridomas producing monoclonal antibodies. Additionally, the genes encoding the immunoglobulins with human variable regions can be recovered and expressed to obtain the antibodies directly, or can be further modified to obtain analogs of antibodies such as, for example, single chain Fv molecules.


[0637] An example of a method of producing a nonhuman host, exemplified as a mouse, lacking expression of an endogenous immunoglobulin heavy chain is disclosed in U.S. Pat. No. 5,939,598. It can be obtained by a method including deleting the J segment genes from at least one endogenous heavy chain locus in an embryonic stem cell to prevent rearrangement of the locus and to prevent formation of a transcript of a rearranged immunoglobulin heavy chain locus, the deletion being effected by a targeting vector containing a gene encoding a selectable marker; and producing from the embryonic stem cell a transgenic mouse whose somatic and germ cells contain the gene encoding the selectable marker.


[0638] A method for producing an antibody of interest, such as a human antibody, is disclosed in U.S. Pat. No. 5,916,771. It includes introducing an expression vector that contains a nucleotide sequence encoding a heavy chain into one mammalian host cell in culture, introducing an expression vector containing a nucleotide sequence encoding a light chain into another mammalian host cell, and fusing the two cells to form a hybrid cell. The hybrid cell expresses an antibody containing the heavy chain and the light chain.


[0639] In a further improvement on this procedure, a method for identifying a clinically relevant epitope on an immunogen, and a correlative method for selecting an antibody that binds immunospecifically to the relevant epitope with high affinity, are disclosed in PCT publication WO 99/53049.


[0640] Fab Fragments and Single Chain Antibodies


[0641] According to the invention, techniques can be adapted for the production of single-chain antibodies specific to an antigenic protein of the invention (see e.g., U.S. Pat. No. 4,946,778). In addition, methods can be adapted for the construction of Fab expression libraries (see e.g., Huse, et al., 1989 Science 246: 1275-1281) to allow rapid and effective identification of monoclonal Fab fragments with the desired specificity for a protein or derivatives, fragments, analogs or homologs thereof. Antibody fragments that contain the idiotypes to a protein antigen may be produced by techniques known in the art including, but not limited to: (i) an F(ab′)2 fragment produced by pepsin digestion of an antibody molecule; (ii) an Fab fragment generated by reducing the disulfide bridges of an F(ab′)2 fragment; (iii) an Fab fragment generated by the treatment of the antibody molecule with papain and a reducing agent and (iv) Fv fragments.


[0642] Bispecific Antibodies


[0643] Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens. In the present case, one of the binding specificities is for an antigenic protein of the invention. The second binding target is any other antigen, and advantageously is a cell-surface protein or receptor or receptor subunit.


[0644] Methods for making bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature, 305:537-539 (1983)). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of ten different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO 93/08829, published May 13, 1993, and in Traunecker et al., 1991 EMBO J., 10:3655-3659.


[0645] Antibody variable domains with the desired binding specificities (antibody-antigen combining sites) can be fused to immunoglobulin constant domain sequences. The fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CH1) containing the site necessary for light-chain binding present in at least one of the fusions. DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co-transfected into a suitable host organism. For further details of generating bispecific antibodies see, for example, Suresh et al., Methods in Enzymology, 121:210 (1986).


[0646] According to another approach described in WO 96/27011, the interface between a pair of antibody molecules can be engineered to maximize the percentage of heterodimers which are recovered from recombinant cell culture. The preferred interface comprises at least a part of the CH3 region of an antibody constant domain. In this method, one or more small amino acid side chains from the interface of the first antibody molecule are replaced with larger side chains (e.g. tyrosine or tryptophan). Compensatory “cavities” of identical or similar size to the large side chain(s) are created on the interface of the second antibody molecule by replacing large amino acid side chains with smaller ones (e.g. alanine or threonine). This provides a mechanism for increasing the yield of the heterodimer over other unwanted end-products such as homodimers.


[0647] Bispecific antibodies can be prepared as full length antibodies or antibody fragments (e.g. F(ab′)2 bispecific antibodies). Techniques for generating bispecific antibodies from antibody fragments have been described in the literature. For example, bispecific antibodies can be prepared using chemical linkage. Brennan et al., Science 229:81 (1985) describe a procedure wherein intact antibodies are proteolytically cleaved to generate F(ab′)2 fragments. These fragments are reduced in the presence of the dithiol complexing agent sodium arsenite to stabilize vicinal dithiols and prevent intermolecular disulfide formation. The Fab′ fragments generated are then converted to thionitrobenzoate (TNB) derivatives. One of the Fab′-TNB derivatives is then reconverted to the Fab′-thiol by reduction with mercaptoethylamine and is mixed with an equimolar amount of the other Fab′-TNB derivative to form the bispecific antibody. The bispecific antibodies produced can be used as agents for the selective immobilization of enzymes.


[0648] Additionally, Fab′ fragments can be directly recovered from E. coli and chemically coupled to form bispecific antibodies. Shalaby et al., J. Exp. Med. 175:217-225 (1992) describe the production of a fully humanized bispecific antibody F(ab′)2 molecule. Each Fab′ fragment was separately secreted from E. coli and subjected to directed chemical coupling in vitro to form the bispecific antibody. The bispecific antibody thus formed was able to bind to cells overexpressing the ErbB2 receptor and normal human T cells, as well as trigger the lytic activity of human cytotoxic lymphocytes against human breast tumor targets.


[0649] Various techniques for making and isolating bispecific antibody fragments directly from recombinant cell culture have also been described. For example, bispecific antibodies have been produced using leucine zippers. Kostelny et al., J. Immunol. 148(5):1547-1553 (1992). The leucine zipper peptides from the Fos and Jun proteins were linked to the Fab′ portions of two different antibodies by gene fusion. The antibody homodimers were reduced at the hinge region to form monomers and then re-oxidized to form the antibody heterodimers. This method can also be utilized for the production of antibody homodimers. The “diabody” technology described by Hollinger et al., Proc. Natl. Acad. Sci. USA 90:6444-6448 (1993) has provided an alternative mechanism for making bispecific antibody fragments. The fragments comprise a heavy-chain variable domain (VH) connected to a light-chain variable domain (VL) by a linker which is too short to allow pairing between the two domains on the same chain. Accordingly, the VH and VL domains of one fragment are forced to pair with the complementary VL and VH domains of another fragment, thereby forming two antigen-binding sites. Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See, Gruber et al., J. Immunol. 152:5368 (1994).


[0650] Antibodies with more than two valencies are contemplated. For example, trispecific antibodies can be prepared. Tuft et al., J. Immunol. 147:60 (1991).


[0651] Exemplary bispecific antibodies can bind to two different epitopes, at least one of which originates in the protein antigen of the invention. Alternatively, an anti-antigenic arm of an immunoglobulin molecule can be combined with an arm which binds to a triggering molecule on a leukocyte such as a T-cell receptor molecule (e.g. CD2, CD3, CD28, or B7), or Fc receptors for IgG (Fc R), such as Fc RI (CD64), Fc RII (CD32) and Fc RIII (CD16) so as to focus cellular defense mechanisms to the cell expressing the particular antigen. Bispecific antibodies can also be used to direct cytotoxic agents to cells which express a particular antigen. These antibodies possess an antigen-binding arm and an arm which binds a cytotoxic agent or a radionuclide chelator, such as EOTUBE, DPTA, DOTA, or TETA. Another bispecific antibody of interest binds the protein antigen described herein and further binds tissue factor (TF).


[0652] Heteroconjugate Antibodies


[0653] Heteroconjugate antibodies are also within the scope of the present invention. Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S. Pat. No. 4,676,980), and for treatment of HIV infection (WO 91/00360; WO 92/200373; EP 03089). It is contemplated that the antibodies can be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins can be constructed using a disulfide exchange reaction or by forming a thioether bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S. Pat. No. 4,676,980.


[0654] Effector Function Engineering


[0655] It can be desirable to modify the antibody of the invention with respect to effector function, so as to enhance, e.g., the effectiveness of the antibody in treating cancer. For example, cysteine residue(s) can be introduced into the Fc region, thereby allowing interchain disulfide bond formation in this region. The homodimeric antibody thus generated can have improved internalization capability and/or increased complement-mediated cell killing and antibody-dependent cellular cytotoxicity (ADCC). See Caron et al., J. Exp Med., 176: 1191-1195 (1992) and Shopes, J. Immunol., 148: 2918-2922 (1992). Homodimeric antibodies with enhanced anti-tumor activity can also be prepared using heterobifunctional cross-linkers as described in Wolff et al. Cancer Research, 53: 2560-2565 (1993). Alternatively, an antibody can be engineered that has dual Fc regions and can thereby have enhanced complement lysis and ADCC capabilities. See Stevenson et al., Anti-Cancer Drug Design, 3: 219-230 (1989).


[0656] Immunoconjugates


[0657] The invention also pertains to immunoconjugates comprising an antibody conjugated to a cytotoxic agent such as a chemotherapeutic agent, toxin (e.g., an enzymatically active toxin of bacterial, fungal, plant, or animal origin, or fragments thereof), or a radioactive isotope (i.e., a radioconjugate).


[0658] Chemotherapeutic agents useful in the generation of such immunoconjugates have been described above. Enzymatically active toxins and fragments thereof that can be used include diphtheria A chain, nonbinding active fragments of diphtheria toxin, exotoxin A chain (from Pseudomonas aeruginosa), ricin A chain, abrin A chain, modeccin A chain, alpha-sarcin, Aleurites fordii proteins, dianthin proteins, Phytolaca americana proteins (PAPI, PAPII, and PAP-S), momordica charantia inhibitor, curcin, crotin, sapaonaria officinalis inhibitor, gelonin, mitogellin, restrictocin, phenomycin, enomycin, and the tricothecenes. A variety of radionuclides are available for the production of radioconjugated antibodies. Examples include 212Bi, 131I, 131In, 90Y, and 186Re.


[0659] Conjugates of the antibody and cytotoxic agent are made using a variety of bifunctional protein-coupling agents such as N-succinimidyl-3-(2-pyridyldithiol)propionate (SPDP), iminothiolane (IT), bifunctional derivatives of imidoesters (such as dimethyl adipimidate HCL), active esters (such as disuccinimidyl suberate), aldehydes (such as glutareldehyde), bis-azido compounds (such as bis(p-azidobenzoyl)hexanediamine), bis-diazonium derivatives (such as bis-(p-diazoniumbenzoyl)-ethylenediamine), diisocyanates (such as tolyene 2,6-diisocyanate), and bis-active fluorine compounds (such as 1,5-difluoro-2,4-dinitrobenzene). For example, a ricin immunotoxin can be prepared as described in Vitetta et al., Science, 238: 1098 (1987). Carbon-14-labeled 1-isothiocyanatobenzyl-3-methyldiethylene triaminepentaacetic acid (MX-DTPA) is an exemplary chelating agent for conjugation of radionucleotide to the antibody. See WO94/11026.


[0660] In another embodiment, the antibody can be conjugated to a “receptor” (such streptavidin) for utilization in tumor pretargeting wherein the antibody-receptor conjugate is administered to the patient, followed by removal of unbound conjugate from the circulation using a clearing agent and then administration of a “ligand” (e.g., avidin) that is in turn conjugated to a cytotoxic agent.


[0661] NOVX Recombinant Expression Vectors and Host Cells


[0662] Another aspect of the invention pertains to vectors, preferably expression vectors, containing a nucleic acid encoding a NOVX protein, or derivatives, fragments, analogs or homologs thereof. As used herein, the term “vector” refers to a nucleic acid molecule capable of transporting another nucleic acid to which it has been linked. One type of vector is a “plasmid”, which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, wherein additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively-linked. Such vectors are referred to herein as “expression vectors”. In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, “plasmid” and “vector” can be used interchangeably as the plasmid is the most commonly used form of vector. However, the invention is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.


[0663] The recombinant expression vectors of the invention comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell, which means that the recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, that is operatively-linked to the nucleic acid sequence to be expressed. Within a recombinant expression vector, “operably-linked” is intended to mean that the nucleotide sequence of interest is linked to the regulatory sequence(s) in a manner that allows for expression of the nucleotide sequence (e.g., in an in vitro transcription/translation system or in a host cell when the vector is introduced into the host cell).


[0664] The term “regulatory sequence” is intended to includes promoters, enhancers and other expression control elements (e.g., polyadenylation signals). Such regulatory sequences are described, for example, in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cell and those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein (e.g., NOVX proteins, mutant forms of NOVX proteins, fusion proteins, etc.).


[0665] The recombinant expression vectors of the invention can be designed for expression of NOVX proteins in prokaryotic or eukaryotic cells. For example, NOVX proteins can be expressed in bacterial cells such as Escherichia coli, insect cells (using baculovirus expression vectors) yeast cells or mammalian cells. Suitable host cells are discussed further in Goeddel, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990). Alternatively, the recombinant expression vector can be transcribed and translated in vitro, for example using T7 promoter regulatory sequences and T7 polymerase.


[0666] Expression of proteins in prokaryotes is most often carried out in Escherichia coli with vectors containing constitutive or inducible promoters directing the expression of either fusion or non-fusion proteins. Fusion vectors add a number of amino acids to a protein encoded therein, usually to the amino terminus of the recombinant protein. Such fusion vectors typically serve three purposes: (i) to increase expression of recombinant protein; (ii) to increase the solubility of the recombinant protein; and (iii) to aid in the purification of the recombinant protein by acting as a ligand in affinity purification. Often, in fusion expression vectors, a proteolytic cleavage site is introduced at the junction of the fusion moiety and the recombinant protein to enable separation of the recombinant protein from the fusion moiety subsequent to purification of the fusion protein. Such enzymes, and their cognate recognition sequences, include Factor Xa, thrombin and enterokinase. Typical fusion expression vectors include pGEX (Pharmacia Biotech Inc; Smith and Johnson, 1988. Gene 67: 31-40), pMAL (New England Biolabs, Beverly, Mass.) and pRIT5 (Pharmacia, Piscataway, N.J.) that fuse glutathione S-transferase (GST), maltose E binding protein, or protein A, respectively, to the target recombinant protein.


[0667] Examples of suitable inducible non-fusion E. coli expression vectors include pTrc (Amrann et al., (1988) Gene 69:301 -315) and pET 11d (Studier et al., GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 60-89).


[0668] One strategy to maximize recombinant protein expression in E. coli is to express the protein in a host bacteria with an impaired capacity to proteolytically cleave the recombinant protein. See, e.g., Gottesman, GENE EXPRESSION TECHNOLOGY: METHODS IN ENZYMOLOGY 185, Academic Press, San Diego, Calif. (1990) 119-128. Another strategy is to alter the nucleic acid sequence of the nucleic acid to be inserted into an expression vector so that the individual codons for each amino acid are those preferentially utilized in E. coli (see, e.g., Wada, et al., 1992. Nucl. Acids Res. 20: 2111-2118). Such alteration of nucleic acid sequences of the invention can be carried out by standard DNA synthesis techniques.


[0669] In another embodiment, the NOVX expression vector is a yeast expression vector. Examples of vectors for expression in yeast Saccharomyces cerivisae include pYepSec1 (Baldari, et al., 1987. EMBO J. 6: 229-234), pMFa (Kurjan and Herskowitz, 1982. Cell 30: 933-943), pJRY88 (Schultz et al., 1987. Gene 54: 113-123), pYES2 (Invitrogen Corporation, San Diego, Calif.), and picZ (InVitrogen Corp, San Diego, Calif.).


[0670] Alternatively, NOVX can be expressed in insect cells using baculovirus expression vectors. Baculovirus vectors available for expression of proteins in cultured insect cells (e.g., SF9 cells) include the pAc series (Smith, et al., 1983. Mol. Cell. Biol. 3: 2156-2165) and the pVL series (Lucklow and Summers, 1989. Virology 170: 31-39).


[0671] In yet another embodiment, a nucleic acid of the invention is expressed in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, 1987. Nature 329: 840) and pMT2PC (Kaufman, et al., 1987. EMBO J. 6: 187-195). When used in mammalian cells, the expression vector's control functions are often provided by viral regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, and simian virus 40. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et al., MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.


[0672] In another embodiment, the recombinant mammalian expression vector is capable of directing expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Tissue-specific regulatory elements are known in the art. Non-limiting examples of suitable tissue-specific promoters include the albumin promoter (liver-specific; Pinkert, et al., 1987. Genes Dev. 1: 268-277), lymphoid-specific promoters (Calame and Eaton, 1988. Adv. Immunol. 43: 235-275), in particular promoters of T cell receptors (Winoto and Baltimore, 1989. EMBO J. 8: 729-733) and immunoglobulins (Banerji, et al., 1983. Cell 33: 729-740; Queen and Baltimore, 1983. Cell 33: 741-748), neuron-specific promoters (e.g., the neurofilament promoter; Byrne and Ruddle, 1989. Proc. Natl. Acad. Sci. USA 86: 5473-5477), pancreas-specific promoters (Edlund, et al., 1985. Science 230: 912-916), and mammary gland-specific promoters (e.g., milk whey promoter; U.S. Pat. No. 4,873,316 and European Application Publication No. 264,166). Developmentally-regulated promoters are also encompassed, e.g., the murine hox promoters (Kessel and Gruss, 1990. Science 249: 374-379) and the α-fetoprotein promoter (Campes and Tilghman, 1989. Genes Dev. 3: 537-546).


[0673] The invention further provides a recombinant expression vector comprising a DNA molecule of the invention cloned into the expression vector in an antisense orientation. That is, the DNA molecule is operatively-linked to a regulatory sequence in a manner that allows for expression (by transcription of the DNA molecule) of an RNA molecule that is antisense to NOVX mRNA. Regulatory sequences operatively linked to a nucleic acid cloned in the antisense orientation can be chosen that direct the continuous expression of the antisense RNA molecule in a variety of cell types, for instance viral promoters and/or enhancers, or regulatory sequences can be chosen that direct constitutive, tissue specific or cell type specific expression of antisense RNA. The antisense expression vector can be in the form of a recombinant plasmid, phagemid or attenuated virus in which antisense nucleic acids are produced under the control of a high efficiency regulatory region, the activity of which can be determined by the cell type into which the vector is introduced. For a discussion of the regulation of gene expression using antisense genes see, e.g., Weintraub, et al., “Antisense RNA as a molecular tool for genetic analysis,” Reviews-Trends in Genetics, Vol. 1(1) 1986.


[0674] Another aspect of the invention pertains to host cells into which a recombinant expression vector of the invention has been introduced. The terms “host cell” and “recombinant host cell” are used interchangeably herein. It is understood that such terms refer not only to the particular subject cell but also to the progeny or potential progeny of such a cell. Because certain modifications may occur in succeeding generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, but are still included within the scope of the term as used herein.


[0675] A host cell can be any prokaryotic or eukaryotic cell. For example, NOVX protein can be expressed in bacterial cells such as E. coli, insect cells, yeast or mammalian cells (such as human, Chinese hamster ovary cells (CHO) or COS cells). Other suitable host cells are known to those skilled in the art.


[0676] Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. As used herein, the terms “transformation” and “transfection” are intended to refer to a variety of art-recognized techniques for introducing foreign nucleic acid (e.g., DNA) into a host cell, including calcium phosphate or calcium chloride co-precipitation, DEAE-dextran-mediated transfection, lipofection, or electroporation. Suitable methods for transforming or transfecting host cells can be found in Sambrook, et al. (MOLECULAR CLONING: A LABORATORY MANUAL. 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989), and other laboratory manuals.


[0677] For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Various selectable markers include those that confer resistance to drugs, such as G418, hygromycin and methotrexate. Nucleic acid encoding a selectable marker can be introduced into a host cell on the same vector as that encoding NOVX or can be introduced on a separate vector. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die).


[0678] A host cell of the invention, such as a prokaryotic or eukaryotic host cell in culture, can be used to produce (i.e., express) NOVX protein. Accordingly, the invention further provides methods for producing NOVX protein using the host cells of the invention. In one embodiment, the method comprises culturing the host cell of invention (into which a recombinant expression vector encoding NOVX protein has been introduced) in a suitable medium such that NOVX protein is produced. In another embodiment, the method further comprises isolating NOVX protein from the medium or the host cell.


[0679] Transgenic NOVX Animals


[0680] The host cells of the invention can also be used to produce non-human transgenic animals. For example, in one embodiment, a host cell of the invention is a fertilized oocyte or an embryonic stem cell into which NOVX protein-coding sequences have been introduced. Such host cells can then be used to create non-human transgenic animals in which exogenous NOVX sequences have been introduced into their genome or homologous recombinant animals in which endogenous NOVX sequences have been altered. Such animals are useful for studying the function and/or activity of NOVX protein and for identifying and/or evaluating modulators of NOVX protein activity. As used herein, a “transgenic animal” is a non-human animal, preferably a mammal, more preferably a rodent such as a rat or mouse, in which one or more of the cells of the animal includes a transgene. Other examples of transgenic animals include non-human primates, sheep, dogs, cows, goats, chickens, amphibians, etc. A transgene is exogenous DNA that is integrated into the genome of a cell from which a transgenic animal develops and that remains in the genome of the mature animal, thereby directing the expression of an encoded gene product in one or more cell types or tissues of the transgenic animal. As used herein, a “homologous recombinant animal” is a non-human animal, preferably a mammal, more preferably a mouse, in which an endogenous NOVX gene has been altered by homologous recombination between the endogenous gene and an exogenous DNA molecule introduced into a cell of the animal, e.g., an embryonic cell of the animal, prior to development of the animal.


[0681] A transgenic animal of the invention can be created by introducing NOVX-encoding nucleic acid into the male pronuclei of a fertilized oocyte (e.g., by microinjection, retroviral infection) and allowing the oocyte to develop in a pseudopregnant female foster animal. Sequences including SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 can be introduced as a transgene into the genome of a non-human animal. Alternatively, a non-human homologue of the human NOVX gene, such as a mouse NOVX gene, can be isolated based on hybridization to the human NOVX cDNA (described further supra) and used as a transgene. Intronic sequences and polyadenylation signals can also be included in the transgene to increase the efficiency of expression of the transgene. A tissue-specific regulatory sequence(s) can be operably-linked to the NOVX transgene to direct expression of NOVX protein to particular cells. Methods for generating transgenic animals via embryo manipulation and microinjection, particularly animals such as mice, have become conventional in the art and are described, for example, in U.S. Pat. Nos. 4,736,866; 4,870,009; and 4,873,191; and Hogan, 1986. In: MANIPULATING THE MOUSE EMBRYO, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. Similar methods are used for production of other transgenic animals. A transgenic founder animal can be identified based upon the presence of the NOVX transgene in its genome and/or expression of NOVX mRNA in tissues or cells of the animals. A transgenic founder animal can then be used to breed additional animals carrying the transgene. Moreover, transgenic animals carrying a transgene-encoding NOVX protein can further be bred to other transgenic animals carrying other transgenes.


[0682] To create a homologous recombinant animal, a vector is prepared which contains at least a portion of a NOVX gene into which a deletion, addition or substitution has been introduced to thereby alter, e.g., functionally disrupt, the NOVX gene. The NOVX gene can be a human gene (e. g., the DNA of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26), but more preferably, is a non-human homologue of a human NOVX gene. For example, a mouse homologue of human NOVX gene of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 can be used to construct a homologous recombination vector suitable for altering an endogenous NOVX gene in the mouse genome. In one embodiment, the vector is designed such that, upon homologous recombination, the endogenous NOVX gene is functionally disrupted (i.e., no longer encodes a functional protein; also referred to as a “knock out” vector).


[0683] Alternatively, the vector can be designed such that, upon homologous recombination, the endogenous NOVX gene is mutated or otherwise altered but still encodes functional protein (e.g., the upstream regulatory region can be altered to thereby alter the expression of the endogenous NOVX protein). In the homologous recombination vector, the altered portion of the NOVX gene is flanked at its 5′- and 3′-termini by additional nucleic acid of the NOVX gene to allow for homologous recombination to occur between the exogenous NOVX gene carried by the vector and an endogenous NOVX gene in an embryonic stem cell. The additional flanking NOVX nucleic acid is of sufficient length for successful homologous recombination with the endogenous gene. Typically, several kilobases of flanking DNA (both at the 5′- and 3′-termini) are included in the vector. See, e.g., Thomas, et al., 1987. Cell 51: 503 for a description of homologous recombination vectors. The vector is ten introduced into an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced NOVX gene has homologously-recombined with the endogenous NOVX gene are selected. See, e.g., Li, et al., 1992. Cell 69: 915.


[0684] The selected cells are then injected into a blastocyst of an animal (e.g., a mouse) to form aggregation chimeras. See, e.g., Bradley, 1987. In: TERATOCARCINOMAS AND EMBRYONIC STEM CELLS: A PRACTICAL APPROACH, Robertson, ed. IRL, Oxford, pp. 113-152. A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal and the embryo brought to term. Progeny harboring the homologously-recombined DNA in their germ cells can be used to breed animals in which all cells of the animal contain the homologously-recombined DNA by germline transmission of the transgene. Methods for constructing homologous recombination vectors and homologous recombinant animals are described further in Bradley, 1991. Curr. Opin. Biotechnol. 2: 823-829; PCT International Publication Nos.: WO 90/11354; WO 91/01140; WO 92/0968; and WO 93/04169.


[0685] In another embodiment, transgenic non-humans animals can be produced that contain selected systems that allow for regulated expression of the transgene. One example of such a system is the cre/loxP recombinase system of bacteriophage P1. For a description of the cre/loxP recombinase system, See, e.g., Lakso, et al., 1992. Proc. Natl. Acad. Sci. USA 89: 6232-6236. Another example of a recombinase system is the FLP recombinase system of Saccharomyces cerevisiae. See, O'Gorman, et al., 1991. Science 251:1351-1355. If a cre/loxP recombinase system is used to regulate expression of the transgene, animals containing transgenes encoding both the Cre recombinase and a selected protein are required. Such animals can be provided through the construction of “double” transgenic animals, e.g., by mating two transgenic animals, one containing a transgene encoding a selected protein and the other containing a transgene encoding a recombinase.


[0686] Clones of the non-human transgenic animals described herein can also be produced according to the methods described in Wilmut, et al., 1997. Nature 385: 810-813. In brief, a cell (e.g., a somatic cell) from the transgenic animal can be isolated and induced to exit the growth cycle and enter G0 phase. The quiescent cell can then be fused, e.g., through the use of electrical pulses, to an enucleated oocyte from an animal of the same species from which the quiescent cell is isolated. The reconstructed oocyte is then cultured such that it develops to morula or blastocyte and then transferred to pseudopregnant female foster animal. The offspring borne of this female foster animal will be a clone of the animal from which the cell (e.g., the somatic cell) is isolated.


[0687] Pharmaceutical Compositions


[0688] The NOVX nucleic acid molecules, NOVX proteins, and anti-NOVX antibodies (also referred to herein as “active compounds”) of the invention, and derivatives, fragments, analogs and homologs thereof, can be incorporated into pharmaceutical compositions suitable for administration. Such compositions typically comprise the nucleic acid molecule, protein, or antibody and a pharmaceutically acceptable carrier. As used herein, “pharmaceutically acceptable carrier” is intended to include any and all solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic and absorption delaying agents, and the like, compatible with pharmaceutical administration. Suitable carriers are described in the most recent edition of Remington's Pharmaceutical Sciences, a standard reference text in the field, which is incorporated herein by reference. Preferred examples of such carriers or diluents include, but are not limited to, water, saline, finger's solutions, dextrose solution, and 5% human serum albumin. Liposomes and non-aqueous vehicles such as fixed oils may also be used. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the active compound, use thereof in the compositions is contemplated. Supplementary active compounds can also be incorporated into the compositions.


[0689] The antibodies disclosed herein can also be formulated as immunoliposomes. Liposomes containing the antibody are prepared by methods known in the art, such as described in Epstein et al., Proc. Natl. Acad. Sci. USA, 82: 3688 (1985); Hwang et al., Proc. Natl Acad. Sci. USA, 77: 4030 (1980); and U.S. Pat. Nos. 4,485,045 and 4,544,545. Liposomes with enhanced circulation time are disclosed in U.S. Pat. No. 5,013,556.


[0690] Particularly useful liposomes can be generated by the reverse-phase evaporation method with a lipid composition comprising phosphatidylcholine, cholesterol, and PEG-derivatized phosphatidylethanolamine (PEG-PE). Liposomes are extruded through filters of defined pore size to yield liposomes with the desired diameter. Fab′ fragments of the antibody of the present invention can be conjugated to the liposomes as described in Martin et al., J. Biol. Chem., 257: 286-288 (1982) via a disulfide-interchange reaction. A chemotherapeutic agent (such as Doxorubicin) is optionally contained within the liposome. See Gabizon et al., J. National Cancer Inst., 81(19): 1484 (1989).


[0691] A pharmaceutical composition of the invention is formulated to be compatible with its intended route of administration. Examples of routes of administration include parenteral, e.g., intravenous, intradermal, subcutaneous, oral (e.g., inhalation), transdermal (i.e., topical), transmucosal, and rectal administration. Solutions or suspensions used for parenteral, intradermal, or subcutaneous application can include the following components: a sterile diluent such as water for injection, saline solution, fixed oils, polyethylene glycols, glycerine, propylene glycol or other synthetic solvents; antibacterial agents such as benzyl alcohol or methyl parabens; antioxidants such as ascorbic acid or sodium bisulfite; chelating agents such as ethylenediaminetetraacetic acid (EDTA); buffers such as acetates, citrates or phosphates, and agents for the adjustment of tonicity such as sodium chloride or dextrose. The pH can be adjusted with acids or bases, such as hydrochloric acid or sodium hydroxide. The parenteral preparation can be enclosed in ampoules, disposable syringes or multiple dose vials made of glass or plastic.


[0692] Pharmaceutical compositions suitable for injectable use include sterile aqueous solutions (where water soluble) or dispersions and sterile powders for the extemporaneous preparation of sterile injectable solutions or dispersion. For intravenous administration, suitable carriers include physiological saline, bacteriostatic water, Cremophor EL™ (BASF, Parsippany, N.J.) or phosphate buffered saline (PBS). In all cases, the composition must be sterile and should be fluid to the extent that easy syringeability exists. It must be stable under the conditions of manufacture and storage and must be preserved against the contaminating action of microorganisms such as bacteria and fungi. The carrier can be a solvent or dispersion medium containing, for example, water, ethanol, polyol (for example, glycerol, propylene glycol, and liquid polyethylene glycol, and the like), and suitable mixtures thereof. The proper fluidity can be maintained, for example, by the use of a coating such as lecithin, by the maintenance of the required particle size in the case of dispersion and by the use of surfactants. Prevention of the action of microorganisms can be achieved by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, ascorbic acid, thimerosal, and the like. In many cases, it will be preferable to include isotonic agents, for example, sugars, polyalcohols such as manitol, sorbitol, sodium chloride in the composition. Prolonged absorption of the injectable compositions can be brought about by including in the composition an agent which delays absorption, for example, aluminum monostearate and gelatin.


[0693] Sterile injectable solutions can be prepared by incorporating the active compound (e.g., a NOVX protein or anti-NOVX antibody) in the required amount in an appropriate solvent with one or a combination of ingredients enumerated above, as required, followed by filtered sterilization. Generally, dispersions are prepared by incorporating the active compound into a sterile vehicle that contains a basic dispersion medium and the required other ingredients from those enumerated above. In the case of sterile powders for the preparation of sterile injectable solutions, methods of preparation are vacuum drying and freeze-drying that yields a powder of the active ingredient plus any additional desired ingredient from a previously sterile-filtered solution thereof.


[0694] Oral compositions generally include an inert diluent or an edible carrier. They can be enclosed in gelatin capsules or compressed into tablets. For the purpose of oral therapeutic administration, the active compound can be incorporated with excipients and used in the form of tablets, troches, or capsules. Oral compositions can also be prepared using a fluid carrier for use as a mouthwash, wherein the compound in the fluid carrier is applied orally and swished and expectorated or swallowed. Pharmaceutically compatible binding agents, and/or adjuvant materials can be included as part of the composition. The tablets, pills, capsules, troches and the like can contain any of the following ingredients, or compounds of a similar nature: a binder such as microcrystalline cellulose, gum tragacanth or gelatin; an excipient such as starch or lactose, a disintegrating agent such as alginic acid, Primogel, or corn starch; a lubricant such as magnesium stearate or Sterotes; a glidant such as colloidal silicon dioxide; a sweetening agent such as sucrose or saccharin; or a flavoring agent such as peppermint, methyl salicylate, or orange flavoring.


[0695] For administration by inhalation, the compounds are delivered in the form of an aerosol spray from pressured container or dispenser which contains a suitable propellant, e.g., a gas such as carbon dioxide, or a nebulizer.


[0696] Systemic administration can also be by transmucosal or transdermal means. For transmucosal or transdermal administration, penetrants appropriate to the barrier to be permeated are used in the formulation. Such penetrants are generally known in the art, and include, for example, for transmucosal administration, detergents, bile salts, and fusidic acid derivatives. Transmucosal administration can be accomplished through the use of nasal sprays or suppositories. For transdermal administration, the active compounds are formulated into ointments, salves, gels, or creams as generally known in the art.


[0697] The compounds can also be prepared in the form of suppositories (e.g., with conventional suppository bases such as cocoa butter and other glycerides) or retention enemas for rectal delivery.


[0698] In one embodiment, the active compounds are prepared with carriers that will protect the compound against rapid elimination from the body, such as a controlled release formulation, including implants and microencapsulated delivery systems. Biodegradable, biocompatible polymers can be used, such as ethylene vinyl acetate, polyanhydrides, polyglycolic acid, collagen, polyorthoesters, and polylactic acid. Methods for preparation of such formulations will be apparent to those skilled in the art. The materials can also be obtained commercially from Alza Corporation and Nova Pharmaceuticals, Inc. Liposomal suspensions (including liposomes targeted to infected cells with monoclonal antibodies to viral antigens) can also be used as pharmaceutically acceptable carriers. These can be prepared according to methods known to those skilled in the art, for example, as described in U.S. Pat. No. 4,522,811.


[0699] It is especially advantageous to formulate oral or parenteral compositions in dosage unit form for ease of administration and uniformity of dosage. Dosage unit form as used herein refers to physically discrete units suited as unitary dosages for the subject to be treated; each unit containing a predetermined quantity of active compound calculated to produce the desired therapeutic effect in association with the required pharmaceutical carrier. The specification for the dosage unit forms of the invention are dictated by and directly dependent on the unique characteristics of the active compound and the particular therapeutic effect to be achieved, and the limitations inherent in the art of compounding such an active compound for the treatment of individuals.


[0700] The nucleic acid molecules of the invention can be inserted into vectors and used as gene therapy vectors. Gene therapy vectors can be delivered to a subject by, for example, intravenous injection, local administration (see, e.g., U.S. Pat. No. 5,328,470) or by stereotactic injection (see, e.g., Chen, et al., 1994. Proc. Natl. Acad. Sci. USA 91: 3054-3057). The pharmaceutical preparation of the gene therapy vector can include the gene therapy vector in an acceptable diluent, or can comprise a slow release matrix in which the gene delivery vehicle is imbedded. Alternatively, where the complete gene delivery vector can be produced intact from recombinant cells, e.g., retroviral vectors, the pharmaceutical preparation can include one or more cells that produce the gene delivery system.


[0701] Antibodies specifically binding a protein of the invention, as well as other molecules identified by the screening assays disclosed herein, can be administered for the treatment of various disorders in the form of pharmaceutical compositions. Principles and considerations involved in preparing such compositions, as well as guidance in the choice of components are provided, for example, in Remington: The Science And Practice Of Pharmacy 19th ed. (Alfonso R. Gennaro, et al., editors) Mack Pub. Co., Easton, Pa.: 1995; Drug Absorption Enhancement: Concepts, Possibilities, Limitations, And Trends, Harwood Academic Publishers, Langhorne, Pa., 1994; and Peptide And Protein Drug Delivery (Advances In Parenteral Sciences, Vol. 4), 1991, M. Dekker, New York. If the antigenic protein is intracellular and whole antibodies are used as inhibitors, internalizing antibodies are preferred. However, liposomes can also be used to deliver the antibody, or an antibody fragment, into cells. Where antibody fragments are used, the smallest inhibitory fragment that specifically binds to the binding domain of the target protein is preferred. For example, based upon the variable-region sequences of an antibody, peptide molecules can be designed that retain the ability to bind the target protein sequence. Such peptides can be synthesized chemically and/or produced by recombinant DNA technology. See, e.g., Marasco et al., 1993 Proc. Natl. Acad. Sci. USA, 90: 7889-7893. The formulation herein can also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Alternatively, or in addition, the composition can comprise an agent that enhances its function, such as, for example, a cytotoxic agent, cytokine, chemotherapeutic agent, or growth-inhibitory agent. Such molecules are suitably present in combination in amounts that are effective for the purpose intended. The active ingredients can also be entrapped in microcapsules prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsules and poly-(methylmethacrylate) microcapsules, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles, and nanocapsules) or in macroemulsions.


[0702] The formulations to be used for iv vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.


[0703] Sustained-release preparations can be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g., films, or microcapsules. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(−)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods.


[0704] The pharmaceutical compositions can be included in a container, pack, or dispenser together with instructions for administration.


[0705] Screening and Detection Methods


[0706] The isolated nucleic acid molecules of the invention can be used to express NOVX protein (e.g., via a recombinant expression vector in a host cell in gene therapy applications), to detect NOVX mRNA (e.g., in a biological sample) or a genetic lesion in a NOVX gene, and to modulate NOVX activity, as described further, below. In addition, the NOVX proteins can be used to screen drugs or compounds that modulate the NOVX protein activity or expression as well as to treat disorders characterized by insufficient or excessive production of NOVX protein or production of NOVX protein forms that have decreased or aberrant activity compared to NOVX wild-type protein. In addition, the anti-NOVX antibodies of the invention can be used to detect and isolate NOVX proteins and modulate NOVX activity. For example, NOVX activity includes growth and differentiation, antibody production, and tumor growth.


[0707] The invention further pertains to novel agents identified by the screening assays described herein and uses thereof for treatments as described, supra.


[0708] Screening Assays


[0709] The invention provides a method (also referred to herein as a “screening assay”) for identifying modulators, i.e., candidate or test compounds or agents (e.g., peptides, peptidomimetics, small molecules or other drugs) that bind to NOVX proteins or have a stimulatory or inhibitory effect on, e.g., NOVX protein expression or NOVX protein activity. The invention also includes compounds identified in the screening assays described herein.


[0710] In one embodiment, the invention provides assays for screening candidate or test compounds which bind to or modulate the activity of the membrane-bound form of a NOVX protein or polypeptide or biologically-active portion thereof. The test compounds of the invention can be obtained using any of the numerous approaches in combinatorial library methods known in the art, including: biological libraries; spatially addressable parallel solid phase or solution phase libraries; synthetic library methods requiring deconvolution; the “one-bead one-compound” library method; and synthetic library methods using affinity chromatography selection. The biological library approach is limited to peptide libraries, while the other four approaches are applicable to peptide, non-peptide oligomer or small molecule libraries of compounds. See, e.g., Lam, 1997. Anticancer Drug Design 12:145.


[0711] A “small molecule” as used herein, is meant to refer to a composition that has a molecular weight of less than about 5 kD and most preferably less than about 4 kD. Small molecules can be, e.g., nucleic acids, peptides, polypeptides, peptidomimetics, carbohydrates, lipids or other organic or inorganic molecules. Libraries of chemical and/or biological mixtures, such as fungal, bacterial, or algal extracts, are known in the art and can be screened with any of the assays of the invention.


[0712] Examples of methods for the synthesis of molecular libraries can be found in the art, for example in: DeWitt, et al., 1993. Proc. Natl. Acad. Sci. U.S.A. 90: 6909; Erb, et al., 1994. Proc. Natl. Acad. Sci. U.S.A. 91: 11422; Zuckermann, et al., 1994. J. Med. Chem. 37: 2678; Cho, et al., 1993. Science 261: 1303; Carrell, et al., 1994. Angew. Chem. Int. Ed. Engl. 33: 2059; Carell, et al., 1994. Angew. Chem. Int. Ed. Engl. 33: 2061; and Gallop, et al., 1994. J. Med. Chem. 37: 1233.


[0713] Libraries of compounds may be presented in solution (e.g., Houghten, 1992. Biotechniques 13: 412-421), or on beads (Lam, 1991. Nature 354: 82-84), on chips (Fodor, 1993. Nature 364: 555-556), bacteria (Ladner, U.S. Pat. No. 5,223,409), spores (Ladner, U.S. Pat. No. 5,233,409), plasmids (Cull, et al., 1992. Proc. Natl. Acad. Sci. USA 89: 1865-1869) or on phage (Scott and Smith, 1990. Science 249: 386-390; Devlin, 1990. Science 249: 404-406; Cwirla, et al., 1990. Proc. Natl. Acad. Sci. U.S.A. 87: 6378-6382; Felici, 1991. J. Mol. Biol. 222: 301-310; Ladner, U.S. Pat. No. 5,233,409.).


[0714] In one embodiment, an assay is a cell-based assay in which a cell which expresses a membrane-bound form of NOVX protein, or a biologically-active portion thereof, on the cell surface is contacted with a test compound and the ability of the test compound to bind to a NOVX protein determined. The cell, for example, can be of mammalian origin or a yeast cell. Determining the ability of the test compound to bind to the NOVX protein can be accomplished, for example, by coupling the test compound with a radioisotope or enzymatic label such that binding of the test compound to the NOVX protein or biologically-active portion thereof can be determined by detecting the labeled compound in a complex. For example, test compounds can be labeled with 125I, 35S, 14C, or 3H, either directly or indirectly, and the radioisotope detected by direct counting of radioemission or by scintillation counting. Alternatively, test compounds can be enzymatically-labeled with, for example, horseradish peroxidase, alkaline phosphatase, or luciferase, and the enzymatic label detected by determination of conversion of an appropriate substrate to product. In one embodiment, the assay comprises contacting a cell which expresses a membrane-bound form of NOVX protein, or a biologically-active portion thereof, on the cell surface with a known compound which binds NOVX to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with a NOVX protein, wherein determining the ability of the test compound to interact with a NOVX protein comprises determining the ability of the test compound to preferentially bind to NOVX protein or a biologically-active portion thereof as compared to the known compound.


[0715] In another embodiment, an assay is a cell-based assay comprising contacting a cell expressing a membrane-bound form of NOVX protein, or a biologically-active portion thereof, on the cell surface with a test compound and determining the ability of the test compound to modulate (e.g., stimulate or inhibit) the activity of the NOVX protein or biologically-active portion thereof. Determining the ability of the test compound to modulate the activity of NOVX or a biologically-active portion thereof can be accomplished, for example, by determining the ability of the NOVX protein to bind to or interact with a NOVX target molecule. As used herein, a “target molecule” is a molecule with which a NOVX protein binds or interacts in nature, for example, a molecule on the surface of a cell which expresses a NOVX interacting protein, a molecule on the surface of a second cell, a molecule in the extracellular milieu, a molecule associated with the internal surface of a cell membrane or a cytoplasmic molecule. A NOVX target molecule can be a non-NOVX molecule or a NOVX protein or polypeptide of the invention In one embodiment, a NOVX target molecule is a component of a signal transduction pathway that facilitates transduction of an extracellular signal (e.g. a signal generated by binding of a compound to a membrane-bound NOVX molecule) through the cell membrane and into the cell. The target, for example, can be a second intercellular protein that has catalytic activity or a protein that facilitates the association of downstream signaling molecules with NOVX.


[0716] Determining the ability of the NOVX protein to bind to or interact with a NOVX target molecule can be accomplished by one of the methods described above for determining direct binding. In one embodiment, determining the ability of the NOVX protein to bind to or interact with a NOVX target molecule can be accomplished by determining the activity of the target molecule. For example, the activity of the target molecule can be determined by detecting induction of a cellular second messenger of the target (i.e. intracellular Ca2+, diacylglycerol, IP3, etc.), detecting catalytic/enzymatic activity of the target an appropriate substrate, detecting the induction of a reporter gene (comprising a NOVX-responsive regulatory element operatively linked to a nucleic acid encoding a detectable marker, e.g., luciferase), or detecting a cellular response, for example, cell survival, cellular differentiation, or cell proliferation.


[0717] In yet another embodiment, an assay of the invention is a cell-free assay comprising contacting a NOVX protein or biologically-active portion thereof with a test compound and determining the ability of the test compound to bind to the NOVX protein or biologically-active portion thereof. Binding of the test compound to the NOVX protein can be determined either directly or indirectly as described above. In one such embodiment, the assay comprises contacting the NOVX protein or biologically-active portion thereof with a known compound which binds NOVX to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with a NOVX protein, wherein determining the ability of the test compound to interact with a NOVX protein comprises determining the ability of the test compound to preferentially bind to NOVX or biologically-active portion thereof as compared to the known compound.


[0718] In still another embodiment, an assay is a cell-free assay comprising contacting NOVX protein or biologically-active portion thereof with a test compound and determining the ability of the test compound to modulate (e.g. stimulate or inhibit) the activity of the NOVX protein or biologically-active portion thereof. Determining the ability of the test compound to modulate the activity of NOVX can be accomplished, for example, by determining the ability of the NOVX protein to bind to a NOVX target molecule by one of the methods described above for determining direct binding. In an alternative embodiment, determining the ability of the test compound to modulate the activity of NOVX protein can be accomplished by determining the ability of the NOVX protein further modulate a NOVX target molecule. For example, the catalytic/enzymatic activity of the target molecule on an appropriate substrate can be determined as described above.


[0719] In yet another embodiment, the cell-free assay comprises contacting the NOVX protein or biologically-active portion thereof with a known compound which binds NOVX protein to form an assay mixture, contacting the assay mixture with a test compound, and determining the ability of the test compound to interact with a NOVX protein, wherein determining the ability of the test compound to interact with a NOVX protein comprises determining the ability of the NOVX protein to preferentially bind to or modulate the activity of a NOVX target molecule.


[0720] The cell-free assays of the invention are amenable to use of both the soluble form or the membrane-bound form of NOVX protein. In the case of cell-free assays comprising the membrane-bound form of NOVX protein, it may be desirable to utilize a solubilizing agent such that the membrane-bound form of NOVX protein is maintained in solution. Examples of such solubilizing agents include non-ionic detergents such as n-octylglucoside, n-dodecylglucoside, n-dodecylmaltoside, octanoyl-N-methylglucaamide, decanoyl-N-methylglucamide, Triton® X-100, Triton® X-114, Thesit®, Isotridecypoly(ethylene glycol ether)n, N-dodecyl--N,N-dimethyl-3-ammonio-1-propane sulfonate, 3-(3-cholamidopropyl)dimethylamminiol-1-propane sulfonate (CHAPS), or 3-(3-cholamidopropyl)dimethylamminiol-2-hydroxy-1-propane sulfonate (CHAPSO).


[0721] In more than one embodiment of the above assay methods of the invention, it may be desirable to immobilize either NOVX protein or its target molecule to facilitate separation of complexed from uncomplexed forms of one or both of the proteins, as well as to accommodate automation of the assay. Binding of a test compound to NOVX protein, or interaction of NOVX protein with a target molecule in the presence and absence of a candidate compound, can be accomplished in any vessel suitable for containing the reactants. Examples of such vessels include microtiter plates, test tubes, and micro-centrifuge tubes. In one embodiment, a fusion protein can be provided that adds a domain that allows one or both of the proteins to be bound to a matrix. For example, GST-NOVX fusion proteins or GST-target fusion proteins can be adsorbed onto glutathione sepharose beads (Sigma Chemical, St. Louis, Mo.) or glutathione derivatized microtiter plates, that are then combined with the test compound or the test compound and either the non-adsorbed target protein or NOVX protein, and the mixture is incubated under conditions conducive to complex formation (e.g., at physiological conditions for salt and pH). Following incubation, the beads or microtiter plate wells are washed to remove any unbound components, the matrix immobilized in the case of beads, complex determined either directly or indirectly, for example, as described, supra. Alternatively, the complexes can be dissociated from the matrix, and the level of NOVX protein binding or activity determined using standard techniques.


[0722] Other techniques for immobilizing proteins on matrices can also be used in the screening assays of the invention. For example, either the NOVX protein or its target molecule can be immobilized utilizing conjugation of biotin and streptavidin. Biotinylated NOVX protein or target molecules can be prepared from biotin-NHS (N-hydroxy-succinimide) using techniques well-known within the art (e.g., biotinylation kit, Pierce Chemicals, Rockford, Ill.), and immobilized in the wells of streptavidin-coated 96 well plates (Pierce Chemical). Alternatively, antibodies reactive with NOVX protein or target molecules, but which do not interfere with binding of the NOVX protein to its target molecule, can be derivatized to the wells of the plate, and unbound target or NOVX protein trapped in the wells by antibody conjugation. Methods for detecting such complexes, in addition to those described above for the GST-immobilized complexes, include immunodetection of complexes using antibodies reactive with the NOVX protein or target molecule, as well as enzyme-linked assays that rely on detecting an enzymatic activity associated with the NOVX protein or target molecule.


[0723] In another embodiment, modulators of NOVX protein expression are identified in a method wherein a cell is contacted with a candidate compound and the expression of NOVX mRNA or protein in the cell is determined. The level of expression of NOVX mRNA or protein in the presence of the candidate compound is compared to the level of expression of NOVX mRNA or protein in the absence of the candidate compound. The candidate compound can then be identified as a modulator of NOVX mRNA or protein expression based upon this comparison. For example, when expression of NOVX mRNA or protein is greater (i.e., statistically significantly greater) in the presence of the candidate compound than in its absence, the candidate compound is identified as a stimulator of NOVX mRNA or protein expression. Alternatively, when expression of NOVX mRNA or protein is less (statistically significantly less) in the presence of the candidate compound than in its absence, the candidate compound is identified as an inhibitor of NOVX mRNA or protein expression. The level of NOVX mRNA or protein expression in the cells can be determined by methods described herein for detecting NOVX mRNA or protein.


[0724] In yet another aspect of the invention, the NOVX proteins can be used as “bait proteins” in a two-hybrid assay or three hybrid assay (see, e.g, U.S. Pat. No. 5,283,317; Zervos, et al., 1993. Cell 72: 223-232; Madura, et al., 1993. J. Biol. Chem. 268: 12046-12054; Bartel, et al., 1993. Biotechniques 14: 920-924; Iwabuchi, et al., 1993. Oncogene 8: 1693-1696; and Brent WO 94/10300), to identify other proteins that bind to or interact with NOVX (“NOVX-binding proteins” or “NOVX-bp”) and modulate NOVX activity. Such NOVX-binding proteins are also likely to be involved in the propagation of signals by the NOVX proteins as, for example, upstream or downstream elements of the NOVX pathway.


[0725] The two-hybrid system is based on the modular nature of most transcription factors, which consist of separable DNA-binding and activation domains. Briefly, the assay utilizes two different DNA constructs. In one construct, the gene that codes for NOVX is fused to a gene encoding the DNA binding domain of a known transcription factor (e.g., GAL-4). In the other construct, a DNA sequence, from a library of DNA sequences, that encodes an unidentified protein (“prey” or “sample”) is fused to a gene that codes for the activation domain of the known transcription factor. If the “bait” and the “prey” proteins are able to interact, in vivo, forming a NOVX-dependent complex, the DNA-binding and activation domains of the transcription factor are brought into close proximity. This proximity allows transcription of a reporter gene (e.g., LacZ) that is operably linked to a transcriptional regulatory site responsive to the transcription factor. Expression of the reporter gene can be detected and cell colonies containing the functional transcription factor can be isolated and used to obtain the cloned gene that encodes the protein which interacts with NOVX.


[0726] The invention further pertains to novel agents identified by the aforementioned screening assays and uses thereof for treatments as described herein.


[0727] Detection Assays


[0728] Portions or fragments of the cDNA sequences identified herein (and the corresponding complete gene sequences) can be used in numerous ways as polynucleotide reagents. By way of example, and not of limitation, these sequences can be used to: (i) identify an individual from a minute biological sample (tissue typing); and (ii) aid in forensic identification of a biological sample. Some of these applications are described in the subsections, below.


[0729] Tissue Typing


[0730] The NOVX sequences of the invention can be used to identify individuals from minute biological samples. In this technique, an individual's genomic DNA is digested with one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identification. The sequences of the invention are useful as additional DNA markers for RFLP (“restriction fragment length polymorphisms,” described in U.S. Pat. No. 5,272,057).


[0731] Furthermore, the sequences of the invention can be used to provide an alternative technique that determines the actual base-by-base DNA sequence of selected portions of an individual's genome. Thus, the NOVX sequences described herein can be used to prepare two PCR primers from the 5′- and 3′-termini of the sequences. These primers can then be used to amplify an individual's DNA and subsequently sequence it.


[0732] Panels of corresponding DNA sequences from individuals, prepared in this manner, can provide unique individual identifications, as each individual will have a unique set of such DNA sequences due to allelic differences. The sequences of the invention can be used to obtain such identification sequences from individuals and from tissue. The NOVX sequences of the invention uniquely represent portions of the human genome. Allelic variation occurs to some degree in the coding regions of these sequences, and to a greater degree in the noncoding regions. It is estimated that allelic variation between individual humans occurs with a frequency of about once per each 500 bases. Much of the allelic variation is due to single nucleotide polymorphisms (SNPs), which include restriction fragment length polymorphisms (RFLPs).


[0733] Each of the sequences described herein can, to some degree, be used as a standard against which DNA from an individual can be compared for identification purposes. Because greater numbers of polymorphisms occur in the noncoding regions, fewer sequences are necessary to differentiate individuals. The noncoding sequences can comfortably provide positive individual identification with a panel of perhaps 10 to 1,000 primers that each yield a noncoding amplified sequence of 100 bases. If predicted coding sequences, such as those in SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 are used, a more appropriate number of primers for positive individual identification would be 500-2,000.


[0734] Predictive Medicine


[0735] The invention also pertains to the field of predictive medicine in which diagnostic assays, prognostic assays, pharmacogenomics, and monitoring clinical trials are used for prognostic (predictive) purposes to thereby treat an individual prophylactically. Accordingly, one aspect of the invention relates to diagnostic assays for determining NOVX protein and/or nucleic acid expression as well as NOVX activity, in the context of a biological sample (e.g., blood, serum, cells, tissue) to thereby determine whether an individual is afflicted with a disease or disorder, or is at risk of developing a disorder, associated with aberrant NOVX expression or activity. Disorders associated with aberrant NOVX expression of activity include, for example, disorders of olfactory loss, e.g. trauma, HIV illness, neoplastic growth, and neurological disorders, e.g. Parkinson's disease and Alzheimer's disease.


[0736] The invention also provides for prognostic (or predictive) assays for determining whether an individual is at risk of developing a disorder associated with NOVX protein, nucleic acid expression or activity. For example, mutations in a NOVX gene can be assayed in a biological sample. Such assays can be used for prognostic or predictive purpose to thereby prophylactically treat an individual prior to the onset of a disorder characterized by or associated with NOVX protein, nucleic acid expression, or biological activity.


[0737] Another aspect of the invention provides methods for determining NOVX protein, nucleic acid expression or activity in an individual to thereby select appropriate therapeutic or prophylactic agents for that individual (referred to herein as “pharmacogenomics”). Pharmacogenomics allows for the selection of agents (e.g., drugs) for therapeutic or prophylactic treatment of an individual based on the genotype of the individual (e.g., the genotype of the individual examined to determine the ability of the individual to respond to a particular agent.)


[0738] Yet another aspect of the invention pertains to monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of NOVX in clinical trials.


[0739] These and other agents are described in further detail in the following sections.


[0740] Diagnostic Assays


[0741] An exemplary method for detecting the presence or absence of NOVX in a biological sample involves obtaining a biological sample from a test subject and contacting the biological sample with a compound or an agent capable of detecting NOVX protein or nucleic acid (e.g., MRNA, genomic DNA) that encodes NOVX protein such that the presence of NOVX is detected in the biological sample. An agent for detecting NOVX mRNA or genomic DNA is a labeled nucleic acid probe capable of hybridizing to NOVX mRNA or genomic DNA. The nucleic acid probe can be, for example, a full-length NOVX nucleic acid, such as the nucleic acid of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or a portion thereof, such as an oligonucleotide of at least 15, 30, 50, 100, 250 or 500 nucleotides in length and sufficient to specifically hybridize under stringent conditions to NOVX mRNA or genomic DNA. Other suitable probes for use in the diagnostic assays of the invention are described herein.


[0742] One agent for detecting NOVX protein is an antibody capable of binding to NOVX protein, preferably an antibody with a detectable label. Antibodies directed against a protein of the invention may be used in methods known within the art relating to the localization and/or quantitation of the protein (e.g., for use in measuring levels of the protein within appropriate physiological samples, for use in diagnostic methods, for use in imaging the protein, and the like). In a given embodiment, antibodies against the proteins, or derivatives, fragments, analogs or homologs thereof, that contain the antigen binding domain, are utilized as pharmacologically-active compounds.


[0743] An antibody specific for a protein of the invention can be used to isolate the protein by standard techniques, such as immunoaffinity chromatography or immunoprecipitation. Such an antibody can facilitate the purification of the natural protein antigen from cells and of recombinantly produced antigen expressed in host cells. Moreover, such an antibody can be used to detect the antigenic protein (e.g., in a cellular lysate or cell supernatant) in order to evaluate the abundance and pattern of expression of the antigenic protein. Antibodies directed against the protein can be used diagnostically to monitor protein levels in tissue as part of a clinical testing procedure, e.g., to, for example, determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling (i.e., physically linking) the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, and radioactive materials. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, β-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin, and examples of suitable radioactive material include 125I, 131I, 35S or 3H.


[0744] Antibodies can be polyclonal, or more preferably, monoclonal. An intact antibody, or a fragment thereof (e.g., Fab or F(ab′)2) can be used. The term “labeled”, with regard to the probe or antibody, is intended to encompass direct labeling of the probe or antibody by coupling (i.e., physically linking) a detectable substance to the probe or antibody, as well as indirect labeling of the probe or antibody by reactivity with another reagent that is directly labeled. Examples of indirect labeling include detection of a primary antibody using a fluorescently-labeled secondary antibody and end-labeling of a DNA probe with biotin such that it can be detected with fluorescently-labeled streptavidin. The term “biological sample” is intended to include tissues, cells and biological fluids isolated from a subject, as well as tissues, cells and fluids present within a subject. That is, the detection method of the invention can be used to detect NOVX mRNA, protein, or genomic DNA in a biological sample in vitro as well as in vivo. For example, in vitro techniques for detection of NOVX mRNA include Northern hybridizations and in situ hybridizations. In vitro techniques for detection of NOVX protein include enzyme linked immunosorbent assays (ELISAs), Western blots, immunoprecipitations, and immunofluorescence. In vitro techniques for detection of NOVX genomic DNA include Southern hybridizations. Furthermore, in vivo techniques for detection of NOVX protein include introducing into a subject a labeled anti-NOVX antibody. For example, the antibody can be labeled with a radioactive marker whose presence and location in a subject can be detected by standard imaging techniques.


[0745] In one embodiment, the biological sample contains protein molecules from the test subject. Alternatively, the biological sample can contain mRNA molecules from the test subject or genomic DNA molecules from the test subject. A preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject.


[0746] In one embodiment, the methods further involve obtaining a control biological sample from a control subject, contacting the control sample with a compound or agent capable of detecting NOVX protein, mRNA, or genomic DNA, such that the presence of NOVX protein, mRNA or genomic DNA is detected in the biological sample, and comparing the presence of NOVX protein, mRNA or genomic DNA in the control sample with the presence of NOVX protein, mRNA or genomic DNA in the test sample.


[0747] The invention also encompasses kits for detecting the presence of NOVX in a biological sample. For example, the kit can comprise: a labeled compound or agent capable of detecting NOVX protein or mRNA in a biological sample; means for determining the amount of NOVX in the sample; and means for comparing the amount of NOVX in the sample with a standard. The compound or agent can be packaged in a suitable container. The kit can further comprise instructions for using the kit to detect NOVX protein or nucleic acid.


[0748] Prognostic Assays


[0749] The diagnostic methods described herein can furthermore be utilized to identify subjects having or at risk of developing a disease or disorder associated with aberrant NOVX expression or activity. For example, the assays described herein, such as the preceding diagnostic assays or the following assays, can be utilized to identify a subject having or at risk of developing a disorder associated with NOVX protein, nucleic acid expression or activity. Such disorders include for example, disorders of olfactory loss, e.g. trauma, HIV illness, neoplastic growth, and neurological disorders, e.g. Parkinson's disease and Alzheimer's disease.


[0750] Alternatively, the prognostic assays can be utilized to identify a subject having or at risk for developing a disease or disorder. Thus, the invention provides a method for identifying a disease or disorder associated with aberrant NOVX expression or activity in which a test sample is obtained from a subject and NOVX protein or nucleic acid (e.g., mRNA, genomic DNA) is detected, wherein the presence of NOVX protein or nucleic acid is diagnostic for a subject having or at risk of developing a disease or disorder associated with aberrant NOVX expression or activity. As used herein, a “test sample” refers to a biological sample obtained from a subject of interest. For example, a test sample can be a biological fluid (e.g., serum), cell sample, or tissue.


[0751] Furthermore, the prognostic assays described herein can be used to determine whether a subject can be administered an agent (e.g., an agonist, antagonist, peptidomimetic, protein, peptide, nucleic acid, small molecule, or other drug candidate) to treat a disease or disorder associated with aberrant NOVX expression or activity. For example, such methods can be used to determine whether a subject can be effectively treated with an agent for a disorder. Thus, the invention provides methods for determining whether a subject can be effectively treated with an agent for a disorder associated with aberrant NOVX expression or activity in which a test sample is obtained and NOVX protein or nucleic acid is detected (e.g., wherein the presence of NOVX protein or nucleic acid is diagnostic for a subject that can be administered the agent to treat a disorder associated with aberrant NOVX expression or activity).


[0752] The methods of the invention can also be used to detect genetic lesions in a NOVX gene, thereby determining if a subject with the lesioned gene is at risk for a disorder characterized by aberrant cell proliferation and/or differentiation. In various embodiments, the methods include detecting, in a sample of cells from the subject, the presence or absence of a genetic lesion characterized by at least one of an alteration affecting the integrity of a gene encoding a NOVX-protein, or the misexpression of the NOVX gene. For example, such genetic lesions can be detected by ascertaining the existence of at least one of: (i) a deletion of one or more nucleotides from a NOVX gene; (ii) an addition of one or more nucleotides to a NOVX gene; (iii) a substitution of one or more nucleotides of a NOVX gene, (iv) a chromosomal rearrangement of a NOVX gene; (v) an alteration in the level of a messenger RNA transcript of a NOVX gene, (vi) aberrant modification of a NOVX gene, such as of the methylation pattern of the genomic DNA, (vii) the presence of a non-wild-type splicing pattern of a messenger RNA transcript of a NOVX gene, (viii) a non-wild-type level of a NOVX protein, (ix) allelic loss of a NOVX gene, and (x) inappropriate post-translational modification of a NOVX protein. As described herein, there are a large number of assay techniques known in the art which can be used for detecting lesions in a NOVX gene. A preferred biological sample is a peripheral blood leukocyte sample isolated by conventional means from a subject. However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.


[0753] In certain embodiments, detection of the lesion involves the use of a probe/primer in a polymerase chain reaction (PCR) (see, e.g., U.S. Pat. Nos. 4,683,195 and 4,683,202), such as anchor PCR or RACE PCR, or, alternatively, in a ligation chain reaction (LCR) (see, e.g., Landegran, et al., 1988. Science 241: 1077-1080; and Nakazawa, et al., 1994. Proc. Natl. Acad. Sci. USA 91: 360-364), the latter of which can be particularly useful for detecting point mutations in the NOVX-gene (see, Abravaya, et al., 1995. Nucl. Acids Res. 23: 675-682). This method can include the steps of collecting a sample of cells from a patient, isolating nucleic acid (e.g., genomic, mRNA or both) from the cells of the sample, contacting the nucleic acid sample with one or more primers that specifically hybridize to a NOVX gene under conditions such that hybridization and amplification of the NOVX gene (if present) occurs, and detecting the presence or absence of an amplification product, or detecting the size of the amplification product and comparing the length to a control sample. It is anticipated that PCR and/or LCR may be desirable to use as a preliminary amplification step in conjunction with any of the techniques used for detecting mutations described herein.


[0754] Alternative amplification methods include: self sustained sequence replication (see, Guatelli, et al., 1990. Proc. Natl. Acad. Sci. USA 87: 1874-1878), transcriptional amplification system (see, Kwoh, et al., 1989. Proc. Natl. Acad. Sci. USA 86: 1173-1177); Qβ Replicase (see, Lizardi, et al, 1988. BioTechnology 6: 1197), or any other nucleic acid amplification method, followed by the detection of the amplified molecules using techniques well known to those of skill in the art. These detection schemes are especially useful for the detection of nucleic acid molecules if such molecules are present in very low numbers.


[0755] In an alternative embodiment, mutations in a NOVX gene from a sample cell can be identified by alterations in restriction enzyme cleavage patterns. For example, sample and control DNA is isolated, amplified (optionally), digested with one or more restriction endonucleases, and fragment length sizes are determined by gel electrophoresis and compared. Differences in fragment length sizes between sample and control DNA indicates mutations in the sample DNA. Moreover, the use of sequence specific ribozymes (see, e.g., U.S. Pat. No. 5,493,531) can be used to score for the presence of specific mutations by development or loss of a ribozyme cleavage site.


[0756] In other embodiments, genetic mutations in NOVX can be identified by hybridizing a sample and control nucleic acids, e.g., DNA or RNA, to high-density arrays containing hundreds or thousands of oligonucleotides probes. See, e.g., Cronin, et al., 1996. Human Mutation 7: 244-255; Kozal, et al., 1996. Nat. Med. 2: 753-759. For example, genetic mutations in NOVX can be identified in two dimensional arrays containing light-generated DNA probes as described in Cronin, et al., supra. Briefly, a first hybridization array of probes can be used to scan through long stretches of DNA in a sample and control to identify base changes between the sequences by making linear arrays of sequential overlapping probes. This step allows the identification of point mutations. This is followed by a second hybridization array that allows the characterization of specific mutations by using smaller, specialized probe arrays complementary to all variants or mutations detected. Each mutation array is composed of parallel probe sets, one complementary to the wild-type gene and the other complementary to the mutant gene.


[0757] In yet another embodiment, any of a variety of sequencing reactions known in the art can be used to directly sequence the NOVX gene and detect mutations by comparing the sequence of the sample NOVX with the corresponding wild-type (control) sequence. Examples of sequencing reactions include those based on techniques developed by Maxim and Gilbert, 1977. Proc. Natl. Acad. Sci. USA 74: 560 or Sanger, 1977. Proc. Natl. Acad. Sci. USA 74: 5463. It is also contemplated that any of a variety of automated sequencing procedures can be utilized when performing the diagnostic assays (see, e.g., Naeve, et al., 1995. Biotechniques 19: 448), including sequencing by mass spectrometry (see, e.g., PCT International Publication No. WO 94/16101; Cohen, et al., 1996. Adv. Chromatography 36: 127-162; and Griffin, et al., 1993. Appl. Biochem. Biotechnol. 38: 147-159).


[0758] Other methods for detecting mutations in the NOVX gene include methods in which protection from cleavage agents is used to detect mismatched bases in RNA/RNA or RNA/DNA heteroduplexes. See, e.g., Myers, et al., 1985. Science 230: 1242. In general, the art technique of “mismatch cleavage” starts by providing heteroduplexes of formed by hybridizing (labeled) RNA or DNA containing the wild-type NOVX sequence with potentially mutant RNA or DNA obtained from a tissue sample. The double-stranded duplexes are treated with an agent that cleaves single-stranded regions of the duplex such as which will exist due to basepair mismatches between the control and sample strands. For instance, RNA/DNA duplexes can be treated with RNase and DNA/DNA hybrids treated with S1 nuclease to enzymatically digesting the mismatched regions. In other embodiments, either DNA/DNA or RNA/DNA duplexes can be treated with hydroxylamine or osmium tetroxide and with piperidine in order to digest mismatched regions. After digestion of the mismatched regions, the resulting material is then separated by size on denaturing polyacrylamide gels to determine the site of mutation. See, e.g., Cotton, et al., 1988. Proc. Natl. Acad. Sci. USA 85: 4397; Saleeba, et al., 1992. Methods Enzymol. 217: 286-295. In an embodiment, the control DNA or RNA can be labeled for detection.


[0759] In still another embodiment, the mismatch cleavage reaction employs one or more proteins that recognize mismatched base pairs in double-stranded DNA (so called “DNA mismatch repair” enzymes) in defined systems for detecting and mapping point mutations in NOVX cDNAs obtained from samples of cells. For example, the mutY enzyme of E. coli cleaves A at G/A mismatches and the thymidine DNA glycosylase from HeLa cells cleaves T at G/T mismatches. See, e.g., Hsu, et al., 1994. Carcinogenesis 15: 1657-1662. According to an exemplary embodiment, a probe based on a NOVX sequence, e.g., a wild-type NOVX sequence, is hybridized to a cDNA or other DNA product from a test cell(s). The duplex is treated with a DNA mismatch repair enzyme, and the cleavage products, if any, can be detected from electrophoresis protocols or the like. See, e.g., U.S. Pat. No. 5,459,039.


[0760] In other embodiments, alterations in electrophoretic mobility will be used to identify mutations in NOVX genes. For example, single strand conformation polymorphism (SSCP) may be used to detect differences in electrophoretic mobility between mutant and wild type nucleic acids. See, e.g., Orita, et al., 1989. Proc. Natl. Acad. Sci. USA: 86: 2766; Cotton, 1993. Mutat. Res. 285: 125-144; Hayashi, 1992. Genet. Anal. Tech. Appl. 9: 73-79. Single-stranded DNA fragments of sample and control NOVX nucleic acids will be denatured and allowed to renature. The secondary structure of single-stranded nucleic acids varies according to sequence, the resulting alteration in electrophoretic mobility enables the detection of even a single base change. The DNA fragments may be labeled or detected with labeled probes. The sensitivity of the assay may be enhanced by using RNA (rather than DNA), in which the secondary structure is more sensitive to a change in sequence. In one embodiment, the subject method utilizes heteroduplex analysis to separate double stranded heteroduplex molecules on the basis of changes in electrophoretic mobility. See, e.g., Keen, et al., 1991. Trends Genet. 7: 5.


[0761] In yet another embodiment, the movement of mutant or wild-type fragments in polyacrylamide gels containing a gradient of denaturant is assayed using denaturing gradient gel electrophoresis (DGGE). See, e.g., Myers, et al., 1985. Nature 313: 495. When DGGE is used as the method of analysis, DNA will be modified to insure that it does not completely denature, for example by adding a GC clamp of approximately 40 bp of high-melting GC-rich DNA by PCR. In a further embodiment, a temperature gradient is used in place of a denaturing gradient to identify differences in the mobility of control and sample DNA. See, e.g., Rosenbaum and Reissner, 1987. Biophys. Chem. 265: 12753.


[0762] Examples of other techniques for detecting point mutations include, but are not limited to, selective oligonucleotide hybridization, selective amplification, or selective primer extension. For example, oligonucleotide primers may be prepared in which the known mutation is placed centrally and then hybridized to target DNA under conditions that permit hybridization only if a perfect match is found. See, e.g., Saiki, et al., 1986. Nature 324: 163; Saiki, et al., 1989. Proc. Natl. Acad. Sci. USA 86: 6230. Such allele specific oligonucleotides are hybridized to PCR amplified target DNA or a number of different mutations when the oligonucleotides are attached to the hybridizing membrane and hybridized with labeled target DNA.


[0763] Alternatively, allele specific amplification technology that depends on selective PCR amplification may be used in conjunction with the instant invention. Oligonucleotides used as primers for specific amplification may carry the mutation of interest in the center of the molecule (so that amplification depends on differential hybridization; see, e.g., Gibbs, et al., 1989. Nucl. Acids Res. 17: 2437-2448) or at the extreme 3′-terminus of one primer where, under appropriate conditions, mismatch can prevent, or reduce polymerase extension (see, e.g., Prossner, 1993. Tibtech. 11: 238). In addition it may be desirable to introduce a novel restriction site in the region of the mutation to create cleavage-based detection. See, e.g., Gasparini, et al., 1992. Mol. Cell Probes 6: 1. It is anticipated that in certain embodiments amplification may also be performed using Taq ligase for amplification. See, e.g., Barany, 1991. Proc. Natl. Acad. Sci. USA 88: 189. In such cases, ligation will occur only if there is a perfect match at the 3′-terminus of the 5′ sequence, making it possible to detect the presence of a known mutation at a specific site by looking for the presence or absence of amplification.


[0764] The methods described herein may be performed, for example, by utilizing pre-packaged diagnostic kits comprising at least one probe nucleic acid or antibody reagent described herein, which may be conveniently used, e.g., in clinical settings to diagnose patients exhibiting symptoms or family history of a disease or illness involving a NOVX gene.


[0765] Furthermore, any cell type or tissue, preferably peripheral blood leukocytes, in which NOVX is expressed may be utilized in the prognostic assays described herein. However, any biological sample containing nucleated cells may be used, including, for example, buccal mucosal cells.


[0766] Pharmacogenomics


[0767] Agents, or modulators that have a stimulatory or inhibitory effect on NOVX activity (e.g., NOVX gene expression), as identified by a screening assay described herein can be administered to individuals to treat (prophylactically or therapeutically) disorders (e.g. disorders of olfactory loss, e.g. trauma, HIV illness, neoplastic growth, and neurological disorders, e.g. Parkinson's disease and Alzheimer's disease). In conjunction with such treatment, the pharmacogenomics (i.e., the study of the relationship between an individual's genotype and that individual's response to a foreign compound or drug) of the individual may be considered. Differences in metabolism of therapeutics can lead to severe toxicity or therapeutic failure by altering the relation between dose and blood concentration of the pharmacologically active drug. Thus, the pharmacogenomics of the individual permits the selection of effective agents (e.g., drugs) for prophylactic or therapeutic treatments based on a consideration of the individual's genotype. Such pharmacogenomics can further be used to determine appropriate dosages and therapeutic regimens. Accordingly, the activity of NOVX protein, expression of NOVX nucleic acid, or mutation content of NOVX genes in an individual can be determined to thereby select appropriate agent(s) for therapeutic or prophylactic treatment of the individual.


[0768] Pharmacogenomics deals with clinically significant hereditary variations in the response to drugs due to altered drug disposition and abnormal action in affected persons. See e.g., Eichelbaum, 1996. Clin. Exp. Pharmacol. Physiol., 23: 983-985; Linder, 1997. Clin. Chem., 43: 254-266. In general, two types of pharmacogenetic conditions can be differentiated. Genetic conditions transmitted as a single factor altering the way drugs act on the body (altered drug action) or genetic conditions transmitted as single factors altering the way the body acts on drugs (altered drug metabolism). These pharmacogenetic conditions can occur either as rare defects or as polymorphisms. For example, glucose-6-phosphate dehydrogenase (G6PD) deficiency is a common inherited enzymopathy in which the main clinical complication is hemolysis after ingestion of oxidant drugs (anti-malarials, sulfonamides, analgesics, nitrofurans) and consumption of fava beans.


[0769] As an illustrative embodiment, the activity of drug metabolizing enzymes is a major determinant of both the intensity and duration of drug action. The discovery of genetic polymorphisms of drug metabolizing enzymes (e.g., N-acetyltransferase 2 (NAT 2) and cytochrome P450 enzymes CYP2D6 and CYP2C19) has provided an explanation as to why some patients do not obtain the expected drug effects or show exaggerated drug response and serious toxicity after taking the standard and safe dose of a drug. These polymorphisms are expressed in two phenotypes in the population, the extensive metabolizer (EM) and poor metabolizer (PM). The prevalence of PM is different among different populations. For example, the gene coding for CYP2D6 is highly polymorphic and several mutations have been identified in PM, which all lead to the absence of functional CYP2D6. Poor metabolizers of CYP2D6 and CYP2C19 quite frequently experience exaggerated drug response and side effects when they receive standard doses. If a metabolite is the active therapeutic moiety, PM show no therapeutic response, as demonstrated for the analgesic effect of codeine mediated by its CYP2D6-formed metabolite morphine. At the other extreme are the so called ultra-rapid metabolizers who do not respond to standard doses. Recently, the molecular basis of ultra-rapid metabolism has been identified to be due to CYP2D6 gene amplification.


[0770] Thus, the activity of NOVX protein, expression of NOVX nucleic acid, or mutation content of NOVX genes in an individual can be determined to thereby select appropriate agent(s) for therapeutic or prophylactic treatment of the individual. In addition, pharmacogenetic studies can be used to apply genotyping of polymorphic alleles encoding drug-metabolizing enzymes to the identification of an individual's drug responsiveness phenotype. This knowledge, when applied to dosing or drug selection, can avoid adverse reactions or therapeutic failure and thus enhance therapeutic or prophylactic efficiency when treating a subject with a NOVX modulator, such as a modulator identified by one of the exemplary screening assays described herein.


[0771] Monitoring of Effects During Clinical Trials


[0772] Monitoring the influence of agents (e.g., drugs, compounds) on the expression or activity of NOVX (e.g., the ability to modulate aberrant cell proliferation) can be applied not only in basic drug screening, but also in clinical trials. For example, the effectiveness of an agent determined by a screening assay as described herein to increase NOVX gene expression, protein levels, or upregulate NOVX activity, can be monitored in clinical trails of subjects exhibiting decreased NOVX gene expression, protein levels, or downregulated NOVX activity. Alternatively, the effectiveness of an agent determined by a screening assay to decrease NOVX gene expression, protein levels, or downregulate NOVX activity, can be monitored in clinical trails of subjects exhibiting increased NOVX gene expression, protein levels, or upregulated NOVX activity. In such clinical trials, the expression or activity of NOVX and, preferably, other genes that have been implicated in, for example, a cellular proliferation or immune disorder can be used as a “read out” or markers of the immune responsiveness of a particular cell.


[0773] By way of example, and not of limitation, genes, including NOVX, that are modulated in cells by treatment with an agent (e.g., compound, drug or small molecule) that modulates NOVX activity (e.g., identified in a screening assay as described herein) can be identified. Thus, to study the effect of agents on cellular proliferation disorders, for example, in a clinical trial, cells can be isolated and RNA prepared and analyzed for the levels of expression of NOVX and other genes implicated in the disorder. The levels of gene expression (i.e., a gene expression pattern) can be quantified by Northern blot analysis or RT-PCR, as described herein, or alternatively by measuring the amount of protein produced, by one of the methods as described herein, or by measuring the levels of activity of NOVX or other genes. In this manner, the gene expression pattern can serve as a marker, indicative of the physiological response of the cells to the agent. Accordingly, this response state may be determined before, and at various points during, treatment of the individual with the agent.


[0774] In one embodiment, the invention provides a method for monitoring the effectiveness of treatment of a subject with an agent (e.g., an agonist, antagonist, protein, peptide, peptidomimetic, nucleic acid, small molecule, or other drug candidate identified by the screening assays described herein) comprising the steps of (i) obtaining a pre-administration sample from a subject prior to administration of the agent; (ii) detecting the level of expression of a NOVX protein, mRNA, or genomic DNA in the preadministration sample; (iii) obtaining one or more post-administration samples from the subject; (iv) detecting the level of expression or activity of the NOVX protein, MRNA, or genomic DNA in the post-administration samples; (v) comparing the level of expression or activity of the NOVX protein, mRNA, or genomic DNA in the pre-administration sample with the NOVX protein, mRNA, or genomic DNA in the post administration sample or samples; and (vi) altering the administration of the agent to the subject accordingly. For example, increased administration of the agent may be desirable to increase the expression or activity of NOVX to higher levels than detected, i.e., to increase the effectiveness of the agent. Alternatively, decreased administration of the agent may be desirable to decrease expression or activity of NOVX to lower levels than detected, i.e., to decrease the effectiveness of the agent.


[0775] Methods of Treatment


[0776] The invention provides for both prophylactic and therapeutic methods of treating a subject at risk of (or susceptible to) a disorder or having a disorder associated with aberrant NOVX expression or activity. Disorders associated with aberrant NOVX expression include, for example, disorders of olfactory loss, e.g. trauma, HIV illness, neoplastic growth, and neurological disorders, e.g. Parkinson's disease and Alzheimer's disease.


[0777] These methods of treatment will be discussed more fully, below.


[0778] Disease and Disorders


[0779] Diseases and disorders that are characterized by increased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics that antagonize (i.e., reduce or inhibit) activity. Therapeutics that antagonize activity may be administered in a therapeutic or prophylactic manner. Therapeutics that may be utilized include, but are not limited to: (i) an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof, (ii) antibodies to an aforementioned peptide; (iii) nucleic acids encoding an aforementioned peptide; (iv) administration of antisense nucleic acid and nucleic acids that are “dysfunctional” (i.e., due to a heterologous insertion within the coding sequences of coding sequences to an aforementioned peptide) that are utilized to “knockout” endogenous function of an aforementioned peptide by homologous recombination (see, e.g., Capecchi, 1989. Science 244: 1288-1292); or (v) modulators (i.e., inhibitors, agonists and antagonists, including additional peptide mimetic of the invention or antibodies specific to a peptide of the invention) that alter the interaction between an aforementioned peptide and its binding partner.


[0780] Diseases and disorders that are characterized by decreased (relative to a subject not suffering from the disease or disorder) levels or biological activity may be treated with Therapeutics that increase (i.e., are agonists to) activity. Therapeutics that upregulate activity may be administered in a therapeutic or prophylactic manner. Therapeutics that may be utilized include, but are not limited to, an aforementioned peptide, or analogs, derivatives, fragments or homologs thereof; or an agonist that increases bioavailability.


[0781] Increased or decreased levels can be readily detected by quantifying peptide and/or RNA, by obtaining a patient tissue sample (e.g., from biopsy tissue) and assaying it in vitro for RNA or peptide levels, structure and/or activity of the expressed peptides (or mRNAs of an aforementioned peptide). Methods that are well-known within the art include, but are not limited to, immunoassays (e.g., by Western blot analysis, immunoprecipitation followed by sodium dodecyl sulfate (SDS) polyacrylamide gel electrophoresis, immunocytochemistry, etc.) and/or hybridization assays to detect expression of mRNAs (e.g., Northern assays, dot blots, in situ hybridization, and the like).


[0782] Prophylactic Methods


[0783] In one aspect, the invention provides a method for preventing, in a subject, a disease or condition associated with an aberrant NOVX expression or activity, by administering to the subject an agent that modulates NOVX expression or at least one NOVX activity. Subjects at risk for a disease that is caused or contributed to by aberrant NOVX expression or activity can be identified by, for example, any or a combination of diagnostic or prognostic assays as described herein. Administration of a prophylactic agent can occur prior to the manifestation of symptoms characteristic of the NOVX aberrancy, such that a disease or disorder is prevented or, alternatively, delayed in its progression. Depending upon the type of NOVX aberrancy, for example, a NOVX agonist or NOVX antagonist agent can be used for treating the subject. The appropriate agent can be determined based on screening assays described herein. The prophylactic methods of the invention are further discussed in the following subsections.


[0784] Therapeutic Methods


[0785] Another aspect of the invention pertains to methods of modulating NOVX expression or activity for therapeutic purposes. The modulatory method of the invention involves contacting a cell with an agent that modulates one or more of the activities of NOVX protein activity associated with the cell. An agent that modulates NOVX protein activity can be an agent as described herein, such as a nucleic acid or a protein, a naturally-occurring cognate ligand of a NOVX protein, a peptide, a NOVX peptidomimetic, or other small molecule. In one embodiment, the agent stimulates one or more NOVX protein activity. Examples of such stimulatory agents include active NOVX protein and a nucleic acid molecule encoding NOVX that has been introduced into the cell. In another embodiment, the agent inhibits one or more NOVX protein activity. Examples of such inhibitory agents include antisense NOVX nucleic acid molecules and anti-NOVX antibodies. These modulatory methods can be performed in vitro (e.g., by culturing the cell with the agent) or, alternatively, in vivo (e.g., by administering the agent to a subject). As such, the invention provides methods of treating an individual afflicted with a disease or disorder characterized by aberrant expression or activity of a NOVX protein or nucleic acid molecule. In one embodiment, the method involves administering an agent (e.g., an agent identified by a screening assay described herein), or combination of agents that modulates (e.g., up-regulates or down-regulates) NOVX expression or activity. In another embodiment, the method involves administering a NOVX protein or nucleic acid molecule as therapy to compensate for reduced or aberrant NOVX expression or activity.


[0786] Stimulation of NOVX activity is desirable in situations in which NOVX is abnormally downregulated and/or in which increased NOVX activity is likely to have a beneficial effect. One example of such a situation is where a subject has a disorder characterized by aberrant cell proliferation and/or differentiation (e.g., cancer or immune associated ). Another example of such a situation is where the subject has an immunodeficiency disease (e.g., AIDS).


[0787] Antibodies of the invention, including polyclonal, monoclonal, humanized and fully human antibodies, may used as therapeutic agents. Such agents will generally be employed to treat or prevent a disease or pathology in a subject. An antibody preparation, preferably one having high specificity and high affinity for its target antigen, is administered to the subject and will generally have an effect due to its binding with the target. Such an effect may be one of two kinds, depending on the specific nature of the interaction between the given antibody molecule and the target antigen in question. In the first instance, administration of the antibody may abrogate or inhibit the binding of the target with an endogenous ligand to which it naturally binds. In this case, the antibody binds to the target and masks a binding site of the naturally occurring ligand, wherein the ligand serves as an effector molecule. Thus the receptor mediates a signal transduction pathway for which ligand is responsible.


[0788] Alternatively, the effect may be one in which the antibody elicits a physiological result by virtue of binding to an effector binding site on the target molecule. In this case the target, a receptor having an endogenous ligand which may be absent or defective in the disease or pathology, binds the antibody as a surrogate effector ligand, initiating a receptor-based signal transduction event by the receptor.


[0789] A therapeutically effective amount of an antibody of the invention relates generally to the amount needed to achieve a therapeutic objective. As noted above, this may be a binding interaction between the antibody and its target antigen that, in certain cases, interferes with the functioning of the target, and in other cases, promotes a physiological response. The amount required to be administered will furthermore depend on the binding affinity of the antibody for its specific antigen, and will also depend on the rate at which an administered antibody is depleted from the free volume other subject to which it is administered. Common ranges for therapeutically effective dosing of an antibody or antibody fragment of the invention may be, by way of nonlimiting example, from about 0.1 mg/kg body weight to about 50 mg/kg body weight. Common dosing frequencies may range, for example, from twice daily to once a week.


[0790] Determination of the Biological Effect of the Therapeutic


[0791] In various embodiments of the invention, suitable in vitro or in vivo assays are performed to determine the effect of a specific Therapeutic and whether its administration is indicated for treatment of the affected tissue.


[0792] In various specific embodiments, in vitro assays may be performed with representative cells of the type(s) involved in the patient's disorder, to determine if a given Therapeutic exerts the desired effect upon the cell type(s). Compounds for use in therapy may be tested in suitable animal model systems including, but not limited to rats, mice, chicken, cows, monkeys, rabbits, and the like, prior to testing in human subjects. Similarly, for in vivo testing, any of the animal model system known in the art may be used prior to administration to human subjects.







[0793] The invention will be further described in the following examples, which do not limit the scope of the invention described in the claims.


EXAMPLES


Example 1


Method of Identifying the Nucleic Acids Encoding the G-Protein Coupled Receptors

[0794] Novel nucleic acid sequences were identified by TblastN using CuraGen Corporation's sequence file run against the Genomic Daily Files made available by GenBank. The nucleic acids were further predicted by the program GenScan™, including selection of exons. These were further modified by means of similarities using BLAST searches. The sequences were then manually corrected for apparent inconsistencies, thereby obtaining the sequences encoding the full-length protein.



Example 2


Quantitative Expression Analysis of NOV 1, NOV8, NOV10, and NOV11 in Various Cells and Tissues

[0795] RTQ-PCR Panel Ag431 Description:


[0796] As shown in Table 53 below, this 96 well plate (2 control wells, 94 test samples) panel and its variants (Panel 1) are composed of RNA/cDNA isolated from various human cell lines that have been established from human malignant tissues (Tumors). These cell lines have been extensively characterized by investigators in both academia and the commercial sector regarding their tumorgenicity, metastatic potential, drug resistance, invasive potential and other cancer-related properties. They serve as suitable tools for pre-clinical evaluation of anti-cancer agents and promising therapeutic strategies. RNA from these various human cancer cell lines was isolated by and procured from the Developmental Therapeutic Branch (DTB) of the National Cancer Institute (USA). Basic information regarding their biological behavior, gene expression, and resistance to various cytotoxic agents are known in the art. In addition, RNA/cDNA was obtained from various human tissues derived from human autopsies performed on deceased elderly people or sudden death victims (accidents, etc.). These tissue were ascertained to be free of disease and were purchased from various high quality commercial sources such as Clontech, Inc., Research Genetics, and Invitrogen.


[0797] RNA integrity from all samples is controlled for quality by visual assessment of agarose gel electrophoresis using 28s and 18s ribosomal RNA staining intensity ratio as a guide (2:1 to 2.5:1 28s:18s) and the presence of low molecular weight RNAs indicative of degradation products. Samples are quality controlled for genomic DNA contamination by reactions run in the absence of reverse transcriptase using probe and primer sets designed to amplify across the span of a single exon.


[0798] RTQ-PCR Panel Ag2691 Description-


[0799] As shown in Table 54 below, this 96 well (2 control wells, 94 test samples) panel and its variants (Panel 2) are composed of RNA/cDNA isolated from human tissue procured by surgeons working in close cooperation with the National Cancer Institute's Cooperative Human Tissue Network (CHTN) or the National Disease Research Initiative (NDRI). The tissues procured are derived from human malignancies and in cases where indicated many malignant tissues have “matched margins” (NAT: normal adjacent tissue). The tumor tissue and the “matched margins” are evaluated by two independent pathologists (the surgical pathologists and again by a pathologists at NDRI or CHTN). This analysis provides a gross histopathological assessment of tumor differentiation grade. Moreover, most samples include the original surgical pathology report that provides information regarding the clinical stage of the patient. These matched margins are taken from the tissue surrounding (i.e. immediately proximal) to the zone of surgery. In addition, RNA/cDNA was obtained from various human tissues derived from human autopsies performed on deceased elderly people or sudden death victims (accidents, etc.). These tissue were ascertained to be free of disease and were purchased from various high quality commercial sources such as Clontech, Inc., Research Genetics, and Invitrogen. RNA integrity from all samples is controlled for quality by visual assessment of agarose gel electrophoresis using 28s and 18s ribosomal RNA staining intensity ratio as a guide (2:1 to 2.5:1 28s:18s) and the presence of low molecular weight RNAs indicative of degradation products. Samples are quality controlled for genomic DNA contamination by reactions run in the absence of reverse transcriptase using probe and primer sets designed to amplify across the span of a single exon.


[0800] RTQ-PCR Panel Ag379 Description-


[0801] As shown in Table 55 below, this 96 well (2 control wells, 94 test samples) panel and its variants (Panel 2) are composed of RNA/cDNA isolated from human tissue procured by surgeons working in close cooperation with the National Cancer Institute's Cooperative Human Tissue Network (CHTN) or the National Disease Research Initiative (NDRI). The tissues procured are derived from human malignancies and in cases where indicated many malignant tissues have “matched margins” (NAT: normal adjacent tissue). The tumor tissue and the “matched margins” are evaluated by two independent pathologists (the surgical pathologists and again by a pathologists at NDRI or CHTN). This analysis provides a gross histopathological assessment of tumor differentiation grade. Moreover, most samples include the original surgical pathology report that provides information regarding the clinical stage of the patient. These matched margins are taken from the tissue surrounding (i.e. immediately proximal) to the zone of surgery. In addition, RNA/cDNA was obtained from various human tissues derived from human autopsies performed on deceased elderly people or sudden death victims (accidents, etc.). These tissue were ascertained to be free of disease and were purchased from various high quality commercial sources such as Clontech, Inc., Research Genetics, and Invitrogen. RNA integrity from all samples is controlled for quality by visual assessment of agarose gel electrophoresis using 28s and 18s ribosomal RNA staining intensity ratio as a guide (2:1 to 2.5:1 28s:18s) and the presence of low molecular weight RNAs indicative of degradation products. Samples are quality controlled for genomic DNA contamination by reactions run in the absence of reverse transcriptase using probe and primer sets designed to amplify across the span of a single exon.


[0802] RTQ-PCR Panel Ag371 Description-


[0803] As shown in Table 56 below, this 96 well (2 control wells, 94 test samples) panel and its variants (Panel 2) are composed of RNA/cDNA isolated from human tissue procured by surgeons working in close cooperation with the National Cancer Institute's Cooperative Human Tissue Network (CHTN) or the National Disease Research Initiative (NDRI). The tissues procured are derived from human malignancies and in cases where indicated many malignant tissues have “matched margins” (NAT: normal adjacent tissue). The tumor tissue and the “matched margins” are evaluated by two independent pathologists (the surgical pathologists and again by a pathologists at NDRI or CHTN). This analysis provides a gross histopathological assessment of tumor differentiation grade. Moreover, most samples include the original surgical pathology report that provides information regarding the clinical stage of the patient. These matched margins are taken from the tissue surrounding (i.e. immediately proximal) to the zone of surgery. In addition, RNA/cDNA was obtained from various human tissues derived from human autopsies performed on deceased elderly people or sudden death victims (accidents, etc.). These tissue were ascertained to be free of disease and were purchased from various high quality commercial sources such as Clontech, Inc., Research Genetics, and Invitrogen. RNA integrity from all samples is controlled for quality by visual assessment of agarose gel electrophoresis using 28s and 18s ribosomal RNA staining intensity ratio as a guide (2:1 to 2.5:1 28s:18s) and the presence of low molecular weight RNAs indicative of degradation products. Samples are quality controlled for genomic DNA contamination by reactions run in the absence of reverse transcriptase using probe and primer sets designed to amplify across the span of a single exon.


[0804] Methods:


[0805] The quantitative expression of various clones was assessed in about 41 normal and about 55 tumor samples by real time quantitative PCR (TaqMan®) performed on a Perkin-Elmer Biosystems ABI PRISM®7700 Sequence Detection System. See Tables 53-56.


[0806] First, 96 RNA samples were normalized to β-actin and GAPDH. RNA (˜50 ng total or ˜1 ng polyA+) was converted to cDNA using the TAQMAN® Reverse Transcription Reagents Kit (PE Biosystems, Foster City, Calif.; Catalog No. N808-0234) and random hexamers according to the manufacturer's protocol. Reactions were performed in 20 ul and incubated for 30 min. at 48° C. cDNA (5 ul) was then transferred to a separate plate for the TAQMAN® reaction using β-actin and GAPDH TAQMAN® Assay Reagents (PE Biosystems; Catalog Nos. 4310881E and 4310884E, respectively) and TAQMAN® universal PCR Master Mix (PE Biosystems; Catalog No. 4304447) according to the manufacturer's protocol. Reactions were performed in 25 ul using the following parameters: 2 min. at 50° C.; 10 min. at 95° C.; 15 sec. at 95° C./1 min. at 60° C. (40 cycles). Results were recorded as CT values (cycle at which a given sample crosses a threshold level of fluorescence) using a log scale, with the difference in RNA concentration between a given sample and the sample with the lowest CT value being represented as 2 to the power of delta CT. The percent relative expression is then obtained by taking the reciprocal of this RNA difference and multiplying by 100. The average CT values obtained for β-actin and GAPDH were used to normalize RNA samples. The RNA sample generating the highest CT value required no further diluting, while all other samples were diluted relative to this sample according to their β-actin/GAPDH average CT values.


[0807] Normalized RNA (5 ul) was converted to cDNA and analyzed via TAQMAN® using One Step RT-PCR Master Mix Reagents (PE Biosystems; Catalog No. 4309169) and gene-specific primers according to the manufacturer's instructions. Probes and primers were designed for each assay according to Perkin Elmer Biosystem's Primer Express Software package (version I for Apple Computer's Macintosh Power PC) or a similar algorithm using the target sequence as input. Default settings were used for reaction conditions and the following parameters were set before selecting primers: primer concentration=250 nM, primer melting temperature (Tm) range=58°-60° C., primer optimal Tm=59° C., maximum primer difference=2° C., probe does not have 5′ G, probe Tm must be 10° C. greater than primer Tm, amplicon size 75 bp to 100 bp. The probes and primers selected (see below, Tables 57-60) were synthesized by Synthegen (Houston, Tex., USA). Probes were double purified by HPLC to remove uncoupled dye and evaluated by mass spectroscopy to verify coupling of reporter and quencher dyes to the 5′ and 3′ ends of the probe, respectively. Their final concentrations were: forward and reverse primers, 900 nM each, and probe, 200 nM.


[0808] TaqMan oligo set Ag431 for the NOV1 gene (i.e., AL135841_B) include the forward, probe, and reverse oligomers shown below:
54TABLE 57PrimersSequencesLengthStart PositionForward5′-AGTCACTTCACCTGCAAGATCCT-3′(SEQ ID NO:87)23581ProbeTET-5′-(SEQ ID NO:88)22CCGCATGCCAGCTTCAGCACTG-3′-TAMRAReverse5′-CTTCGCTGACCGACGTGTT-3′(SEQ ID NO:89)19629Gene: AL135841_B Probe Name: Ag431


[0809] TaqMan oligo set Ag2691 for the NOV8 gene (i.e., AL135784_A) include the forward, probe, and reverse oligomers shown below:
55TABLE 58PrimersSequencesTMLengthStart PositionForward5′-(SEQ ID NO:90)59.522628CAGTATCTTCACCCTGCTGCTA-3′ProbeFAM-5′-(SEQ ID NO:91)68.828650CCATTTGGGTTTGTTCTCCTCTCCTACA-3′-TAMRAReverse5′-(SEQ ID NO:92)59.622695GGAGTGAGCGAATCCTTATGAT-3′Gene: AL135784_A Probe Name: Ag2691


[0810] TaqMan oligo set Ag379 for the NOV10 gene (i.e., AC020679_B) include the forward, probe, and reverse oligomers shown below:
56TABLE 59PrimersSequencesLengthStart PositionForward5′-(SEQ ID NO:93)21454TGTGTCCGATTAGTGGCCTTC-3′ProbeTET-5′-(SEQ ID NO:94)31CATCAGTATGGATAGAAAACCACCTGCCCTG-3′-TAMRAReverse5′-(SEQ ID NO:95)20510CTCGGGACATAAGCACTGCA-3′Gene: AC020679_B Probe Name: Ag379


[0811] TaqMan oligo set Ag371 for the NOV11 gene (i.e., AC020679_A) include the forward, probe, and reverse oligomers shown below:
57TABLE 60PrimersSequencesTMLengthStart PositionForward5′-(SEQ ID NO:96)23AGACCTTTGCACTATCCCACCTT-3′536ProbeTET-5′-(SEQ ID NO:97)27TGACCCATCACGTTTGTGCTCATTTTG-3′-TAMRA561Reverse5′-AGCCACCCACCCAGCAG-3′(SEQ ID NO:98)17Gene: AC020679_A Probe Name: Ag371


[0812] PCR conditions: Normalized RNA from each tissue and each cell line was spotted in each well of a 96 well PCR plate (Perkin Elmer Biosystems). PCR cocktails including two probes (SEQX-specific and another gene-specific probe multiplexed with the SEQX probe) were set up using 1×TaqMan™ PCR Master Mix for the PE Biosystems 7700, with 5 mM MgCl2, dNTPs (dA, G, C, U at 1:1:1:2 ratios), 0.25 U/ml AmpliTaq Gold™ (PE Biosystems), and 0.4 U/μl RNase inhibitor, and 0.25 U/μl reverse transcriptase. Reverse transcription was performed at 48° C. for 30 minutes followed by amplification/PCR cycles as follows: 95° C. 10 min, then 40 cycles of 95° C. for 15 seconds, 60° C. for 1 minute. The results are shown below in Tables 61-64.
58TABLE 61Tissue_Name/Run_Name1.3Dtm3630t_ag431Tissue_Name/Run_Name2Dtm3631t_ag431Liver adenocarcinoma3.74Normal Colon GENPAK 0610036.93Heart (fetal)083219 CC Well to Mod Diff4.84(ODO3866)Pancreas083220 CC NAT (ODO3866)0Pancreatic ca.6.7583221 CC Gr.2 rectosigmoid5.4CAPAN 2(ODO3868)Adrenal gland083222 CC NAT (ODO3868)6.61Thyroid083235 CC Mod Diff (ODO3920)2.88Salivary gland083236 CC NAT (ODO3920)3.79Pituitary gland083237 CC Gr.2 ascend colon6.38(ODO3921)Brain (fetal)14.6683238 CC NAT (ODO3921)6.98Brain (whole)22.3883241 CC from Partial Hepatectomy0(ODO4309)Brain (amygdala)39.583242 Liver NAT (ODO4309)4.18Brain (cerebellum)26.6187472 Colon mets to lung30.99(OD04451-01)Brain (hippocampus)10087473 Lung NAT (OD04451-02)2.24Brain (thalamus)8.54Normal Prostate Clontech A+12.166546-1Cerebral Cortex57.8384140 Prostate Cancer (OD04410)10.37Spinal cord8.9684141 Prostate NAT (OD04410)23.65CNS ca. (glio/astro)087073 Prostate Cancer (OD04720-23.33U87-MG01)CNS ca. (glio/astro)087074 Prostate NAT (OD04720-02)26.61U-118-MGCNS ca. (astro)0Normal Lung GENPAK 0610102.05SW1783CNS ca.* (neuro; met)11.9983239 Lung Met to Muscle0SK-N-AS(ODO4286)CNS ca. (astro)3.8283240 Muscle NAT (ODO4286)2.03SF-539CNS ca. (astro)6.9384136 Lung Malignant Cancer6.75SNB-75(OD03126)CNS ca. (glio)084137 Lung NAT (OD03126)14.36SNB-19CNS ca. (glio)7.6984871 Lung Cancer (OD04404)0U251CNS ca. (glio)13.9784872 Lung NAT (OD04404)3.15SF-295Heart4.5884875 Lung Cancer (OD04565)0Skeletal muscle10.0885950 Lung Cancer (OD04237-01)1.76Bone marrow085970 Lung NAT (OD04237-02)0Thymus083255 Ocular Mel Met to Liver0(ODO4310)Spleen5.3383256 Liver NAT (ODO4310)0Lymph node4.7484139 Melanoma Mets to Lung0(OD04321)Colorectal30.5784138 Lung NAT (OD04321)8.42Stomach0Normal Kidney GENPAK 0610088.42Small intestine083786 Kidney Ca, Nuclear grade 23.06(OD04338)Colon ca.8.383787 Kidney NAT (OD04338)0SW480Colon ca.* (SW480083788 Kidney Ca Nuclear grade 1/20met)SW620(OD04339)Colon ca.083789 Kidney NAT (OD04339)10.37HT29Colon ca.083790 Kidney Ca, Clear cell type0HCT-116(OD04340)Colon ca.083791 Kidney NAT (OD04340)0CaCo-283219 CC Well to083792 Kidney Ca, Nuclear grade 30Mod Diff (ODO3866)(OD04348)Colon ca.7.7583793 Kidney NAT (OD04348)9.02HCC-2998Gastric ca.* (liver met)15.3987474 Kidney Cancer (OD04622-3.59NCI-N8701)Bladder087475 Kidney NAT (OD04622-03)0Trachea085973 Kidney Cancer (OD04450-001)Kidney7.5485974 Kidney NAT (OD04450-03)17.08Kidney (fetal)4.7Kidney Cancer Clontech 81206070Renal ca.0Kidney NAT Clontech 81206080786-0Renal ca.0Kidney Cancer Clontech 81206130A498Renal ca.0Kidney NAT Clontech 81206140RXF 393Renal ca.0Kidney Cancer Clontech 90103200ACHNRenal ca.0Kidney NAT Clontech 901032170.22UO-31Renal ca.0Normal Uterus GENPAK 0610186.08TK-10Liver0Uterus Cancer GENPAK 06401116.49Liver (fetal)0Normal Thyroid Clontech A+06570-1Liver ca. (hepatoblast)0Thyroid Cancer GENPAK 0640100HepG2Lung0Thyroid Cancer INVITROGEN0A302152Lung (fetal)18.56Thyroid NAT INVITROGEN6.34A302153Lung ca. (small cell)15.28Normal Breast GENPAK 0610193.12LX-1Lung ca. (small cell)084877 Breast Cancer (OD04566)100NCI-H69Lung ca. (s. cell var.)5.1185975 Breast Cancer (OD04590-01)9.41SHP-77Lung ca. (large085976 Breast Cancer Mets0cell)NCI-H460(OD04590-03)Lung ca. (non-sm.087070 Breast Cancer Metastasis49.31cell) A549(OD04655-05)Lung ca. (non-s.cell)4.21GENPAK Breast Cancer 06400631.86NCI-H23Lung ca (non-s.cell)0Breast Cancer Clontech 910026613.4HOP-62Lung ca. (non-s.cl)4.67Breast NAT Clontech 91002654.36NCI-H522Lung ca. (squam.)5.08Breast Cancer INVITROGEN4.74SW 900A209073Lung ca. (squam.)0Breast NAT INVITROGEN9.21NCI-H596A2090734Mammary gland7.08Normal Liver GENPAK 0610090Breast ca.* (pl.0Liver Cancer GENPAK 0640032.5effusion) MCF-7Breast ca.* (pl. ef)4.21Liver Cancer Research Genetics0MDA-MB-231RNA 1025Breast ca.* (pl.0Liver Cancer Research Genetics0effusion) T47DRNA 1026Breast ca.0Paired Liver Cancer Tissue Research7.48BT-549Genetics RNA 6004-TBreast ca.11.34Paired Liver Tissue Research8.13MDA-NGenetics RNA 6004-NOvary0Paired Liver Cancer Tissue Research0Genetics RNA 6005-TOvarian ca.0Paired Liver Tissue Research0OVCAR-3Genetics RNA 6005-NOvarian ca.0Normal Bladder GENPAK 06100112.07OVCAR-4Ovarian ca.0Bladder Cancer Research Genetics9.34OVCAR-5RNA 1023Ovarian ca.0Bladder Cancer INVITROGEN9.47OVCAR-8A302173Ovarian ca.087071 Bladder Cancer (OD04718-2.68IGROV-101)Ovarian ca.* (ascites)087072 Bladder Normal Adjacent10.73SK-OV-3(OD04718-03)Uterus0Normal Ovary Res. Gen.0Plancenta0Ovarian Cancer GENPAK 0640086.65Prostate087492 Ovary Cancer (OD04768-07)0Prostate ca.* (bone087493 Ovary NAT (OD04768-08)0met)PC-3Testis13.87Normal Stomach GENPAK 06101716.38Melanoma0NAT Stomach Clontech 90603590Hs688(A).TMelanoma* (met)0Gastric Cancer Clontech 90603959.67Hs688(B).TMelanoma4.27NAT Stomach Clontech 90603941.95UACC-62Melanoma0Gastric Cancer Clontech 90603971.92M14Melanoma0NAT Stomach Clontech 90603960LOX IMVIMelanoma* (met)0Gastric Cancer GENPAK 0640051.9SK-MEL-5Adipose0


[0813]

59









TABLE 62








Tissue_Name/Run_Name
1.3dtm3480f_ag2691
Tissue_Name/Run_Name
2dtm3481f_ag2691
2dtm3688f_ag2691



















Liver adenocarcinoma
5.75
Normal Colon GENPAK 061003
0
0


Heart (fetal)
0
83219 CC Well to Mod Diff
0.5
0




(ODO3866)


Pancreas
0
83220 CC NAT (ODO3866)
0
0


Pancreatic ca.
0
83221 CC Gr.2 rectosigmoid
0
0


CAPAN 2

(ODO3868)


Adrenal gland
0
83222 CC NAT (ODO3868)
0
0


Thyroid
0
83235 CC Mod Diff (ODO3920)
0.09
0.29


Salivary gland
0
83236 CC NAT (ODO3920)
0
0


Pituitary gland
0
83237 CC Gr.2 ascend colon
0
0




(ODO3921)


Brain (fetal)
0
83238 CC NAT (ODO3921)
0
0


Brain (whole)
0
83241 CC from Partial Hepatectomy
0
0




(ODO4309)


Brain (amygdala)
0
83242 Liver NAT (ODO4309)
0
0


Brain (cerebellum)
0
87472 Colon mets to lung
0
0




(OD04451-01)


Brain (hippocampus)
0
87473 Lung NAT (OD04451-02)
0
0


Brain (thalamus)
0
Normal Prostate Clontech A+
0
0




6546-1


Cerebral Cortex
0
84140 Prostate Cancer (OD04410)
0
0


Spinal cord
0
84141 Prostate NAT (OD04410)
0
0


CNS Ca. (glio/astro)
0
87073 Prostate Cancer (OD04720-
0
0


U87-MG

01)


CNS Ca. (glio/astro)
0
87074 Prostate NAT (OD04720-02)
0
0


U-118-MG


CNS ca. (astro)
2.94
Normal Lung GENPAK 061010
0
0.32


SW1783


CNS ca.* (neuro; met)
0
83239 Lung Met to Muscle
0
0


SK-N-AS

(ODO4286)


CNS ca. (astro)
0
83240 Muscle NAT (ODO4286)
0
0


SF-539


CNS ca. (astro)
2.61
84136 Lung Malignant Cancer
0
0


SNB-75

(OD03126)


CNS ca. (glio)
0
84137 Lung NAT (OD03126)
0
0


SNB-19


CNS ca. (glio)
0
84871 Lung Cancer (OD04404)
5.95
5.48


U251


CNS ca. (glio)
27.93
84872 Lung NAT (OD04404)
0
0


SF-295


Heart
0
84875 Lung Cancer (OD04565)
2.9
3.37


Skeletal muscle
0
85950 Lung Cancer (OD04237-01)
0
0.12


Bone marrow
0
85970 Lung NAT (OD04237-02)
0
0


Thymus
0
83255 Ocular Mel Met to Liver
0
0




(ODO4310)


Spleen
0
83256 Liver NAT (ODO4310)
0
0


Lymph node
0
84139 Melanoma Mets to Lung
0
0




(OD04321)


Colorectal
0
84138 Lung NAT (OD04321)
0
0


Stomach
0
Normal Kidney GENPAK 061008
0
0.15


Small intestine
0
83786 Kidney Ca, Nuclear grade 2
0
0




(OD04338)


Colon ca.
0
83787 Kidney NAT (OD04338)
0.09
0


SW480


Colon ca.* (SW480
0
83788 Kidney Ca Nuclear grade 1/2
0.17
0


met)SW620

(OD04339)


Colon ca.
0
83789 Kidney NAT (OD04339)
0
0


HT29


Colon ca.
3.19
83790 Kidney Ca, Clear cell type
0
0


HCT-116

(OD04340)


Colon ca.
22.69
83791 Kidney NAT (OD04340)
0
0


CaCo-2


83219 CC Well to
0
83792 Kidney Ca, Nuclear grade 3
0
0


Mod Diff (ODO3866)

(OD04348)


Colon ca.
0
83793 Kidney NAT (OD04348)
0.1
0.24


HCC-2998


Gastric ca.* (liver met)
59.05
87474 Kidney Cancer (OD04622-
0
0


NCI-N87

01)


Bladder
0
87475 Kidney NAT (OD04622-03)
0
0


Trachea
0
85973 Kidney Cancer (OD04450-
0.18
0




01)


Kidney
0
85974 Kidney NAT (OD04450-03)
0
0


Kidney (fetal)
0
Kidney Cancer Clontech 8120607
0
0


Renal ca.
0
Kidney NAT Clontech 8120608
0
0


786-0


Renal ca.
0.78
Kidney Cancer Clontech 8120613
0
0


A498


Renal ca.
5.44
Kidney NAT Clontech 8120614
0
0


RXF 393


Renal ca.
0
Kidney Cancer Clontech 9010320
2.18
1.81


ACHN


Renal ca.
0
Kidney NAT Clontech 9010321
0
0


UO-31


Renal ca.
0
Normal Uterus GENPAK 061018
0
0


TK-10


Liver
0
Uterus Cancer GENPAK 064011
0
0


Liver (fetal)
0
Normal Thyroid Clontech A+
0
0




6570-1


Liver Ca. (hepatoblast)
0
Thyroid Cancer GENPAK 064010
0
0


HepG2


Lung
0
Thyroid Cancer INVITROGEN
0
0




A302152


Lung (fetal)
0
Thyroid NAT INVITROGEN
0
0




A302153


Lung ca. (small cell)
7.75
Normal Breast GENPAK 061019
1.18
1.96


LX-1


Lung ca. (small cell)
0.93
84877 Breast Cancer (OD04566)
0
0


NCI-H69


Lung ca. (s.cell var.)
20.03
85975 Breast Cancer (OD04590-01)
0
0


SHP-77


Lung ca. (large
7.08
85976 Breast Cancer Mets
0
0


cell)NCI-H460

(OD04590-03)


Lung ca. (non-sm.
21.61
87070 Breast Cancer Metastasis
0
0


cell) A549

(OD04655-05)


Lung ca. (non-s.cell)
100
GENPAK Breast Cancer 064006
0.85
0.68


NCI-H23


Lung ca (non-s.cell)
0
Breast Cancer Clontech 9100266
1.95
1.9


HOP-62


Lung ca. (non-s.cl)
0
Breast NAT Clontech 9100265
0
0.15


NCI-H522


Lung ca. (squam.)
0.73
Breast Cancer INVITROGEN
1.99
0.13


SW 900

A209073


Lung ca. (squam.)
1.85
Breast NAT INVITROGEN
0.16
0


NCI-H596

A2090734


Mammary gland
0
Normal Liver GENPAK 061009
0
0


Breast ca.* (pl.
0
Liver Cancer GENPAK 064003
1.24
0.69


effusion) MCF-7


Breast ca.* (pl.ef)
0
Liver Cancer Research Genetics
0
0


MDA-MB-231

RNA 1025


Breast ca.* (pl.
13.87
Liver Cancer Research Genetics
0
0


effusion) T47D

RNA 1026


Breast ca.
0
Paired Liver Cancer Tissue Research
0
0.14


BT-549

Genetics RNA 6004-T


Breast ca.
0
Paired Liver Tissue Research
1.85
2.92


MDA-N

Genetics RNA 6004-N


Ovary
0
Paired Liver Cancer Tissue Research
0
0




Genetics RNA 6005-T


Ovarian ca.
9.61
Paired Liver Tissue Research
0
0


OVCAR-3

Genetics RNA 6005-N


Ovarian ca.
0
Normal Bladder GENPAK 061001
0
0


OVCAR-4


Ovarian ca.
0
Bladder Cancer Research Genetics
0
0


OVCAR-5

RNA 1023


Ovarian ca.
2.7
Bladder Cancer INVITROGEN
9.21
14.46


OVCAR-8

A302173


Ovarian ca.
0
87071 Bladder Cancer (OD04718-
0
0


IGROV-1

01)


Ovarian ca.* (ascites)
1.75
87072 Bladder Normal Adjacent
0
0


SK-OV-3

(OD04718-03)


Uterus
0
Normal Ovary Res. Gen.
0
0


Plancenta
1.54
Ovarian Cancer GENPAK 064008
2.13
3.28


Prostate
0
87492 Ovary Cancer (OD04768-07)
100
100


Prostate ca.* (bone
0
87493 Ovary NAT (OD04768-08)
0
0


met)PC-3


Testis
0
Normal Stomach GENPAK 061017
0
0


Melanoma
0
NAT Stomach Clontech 9060359
0
0


Hs688(A).T


Melanoma* (met)
0
Gastric Cancer Clontech 9060395
0
0


Hs688(B).T


Melanoma
0
NAT Stomach Clontech 9060394
0.32
0


UACC-62


Melanoma
0
Gastric Cancer Clontech 9060397
0
0


M14


Melanoma
0.81
NAT Stomach Clontech 9060396
0
0


LOX IMVI


Melanoma* (met)
0
Gastric Cancer GENPAK 064005
0
0


SK-MEL-5


Adipose
2.94










[0814]

60








TABLE 63








Tissue_Name/Run_Name
1.3Dtm3681t_ag379
Tissue_Name/Run_Name
2Dtm3682t_ag379


















Liver adenocarcinoma
4.64
Normal Colon GENPAK 061003
1.21


Heart (fetal)
0
83219 CC Well to Mod Diff
2.88




(ODO3866)


Pancreas
0
83220 CC NAT (ODO3866)
3.77


Pancreatic ca.
0
83221 CC Gr.2 rectosigmoid
2.42


CAPAN 2

(ODO3868)


Adrenal gland
0
83222 CC NAT (ODO3868)
0


Thyroid
0
83235 CC Mod Diff (ODO3920)
0


Salivary gland
0
83236 CC NAT (ODO3920)
0


Pituitary gland
0
83237 CC Gr.2 ascend colon
0




(ODO3921)


Brain (fetal)
0
83238 CC NAT (ODO3921)
3.64


Brain (whole)
7.38
83241 CC from Partial Hepatectomy
0




(ODO4309)


Brain (amygdala)
0
83242 Liver NAT (ODO4309)
0


Brain (cerebellum)
0
87472 Colon mets to lung
0




(OD04451-01)


Brain (hippocampus)
2.18
87473 Lung NAT (OD04451-02)
3.72


Brain (thalamus)
2.06
Normal Prostate Clontech A+
2.19




6546-1


Cerebral Cortex
28.13
84140 Prostate Cancer (OD04410)
23


Spinal cord
3.06
84141 Prostate NAT (OD04410)
6.12


CNS ca. (glio/astro)
3.54
87073 Prostate Cancer (OD04720-
0


U87-MG

01)


CNS ca. (glio/astro)
9.61
87074 Prostate NAT (OD04720-02)
4.77


U-118-MG


CNS ca. (astro)
0
Normal Lung GENPAK 061010
5.4


SW1783


CNS ca.* (neuro; met)
0
83239 Lung Met to Muscle
1.27


SK-N-AS

(ODO4286)


CNS ca. (astro)
18.43
83240 Muscle NAT (ODO4286)
2.27


SF-539


CNS ca. (astro)
0
84136 Lung Malignant Cancer
0


SNB-75

(OD03126)


CNS ca. (glio)
15.39
84137 Lung NAT (OD03126)
0


SNB-19


CNS ca. (glio)
3.49
84871 Lung Cancer (OD04404)
0


U251


CNS ca. (glio)
0
84872 Lung NAT (OD04404)
0


SF-295


Heart
0
84875 Lung Cancer (OD04565)
0


Skeletal muscle
2.37
85950 Lung Cancer (OD04237-01)
14.66


Bone marrow
0
85970 Lung NAT (OD04237-02)
0


Thymus
0
83255 Ocular Mel Met to Liver
1.83




(ODO4310)


Spleen
0
83256 Liver NAT (ODO4310)
0


Lymph node
3.98
84139 Melanoma Mets to Lung
0




(OD04321)


Colorectal
6.79
84138 Lung NAT (OD04321)
9.15


Stomach
0
Normal Kidney GENPAK 061008
1.54


Small intestine
0
83786 Kidney Ca, Nuclear grade 2
8.25




(OD04338)


Colon ca.
4.21
83787 Kidney NAT (OD04338)
0


SW480


Colon ca.* (SW480
0
83788 Kidney Ca Nuclear grade 1/2
2.15


met)SW620

(OD04339)


Colon ca.
0
83789 Kidney NAT (OD04339)
0


HT29


Colon ca.
0
83790 Kidney Ca, Clear cell type
0


HCT-116

(OD04340)


Colon ca.
0
83791 Kidney NAT (OD04340)
0


CaCo-2


83219 CC Well to
0
83792 Kidney Ca, Nuclear grade 3
0


Mod Diff (ODO3866)

(OD04348)


Colon ca.
0
83793 Kidney NAT (OD04348)
0


HCC-2998


Gastric ca.* (liver met)
0
87474 Kidney Cancer (OD04622-
0


NCI-N87

01)


Bladder
4.74
87475 Kidney NAT (OD04622-03)
0


Trachea
0
85973 Kidney Cancer (OD04450-
0




01)


Kidney
0
85974 Kidney NAT (OD04450-03)
0


Kidney (fetal)
0
Kidney Cancer Clontech 8120607
1.9


Renal ca.
3.26
Kidney NAT Clontech 8120608
0


786-0


Renal ca.
0
Kidney Cancer Clontech 8120613
0


A498


Renal ca.
0
Kidney NAT Clontech 8120614
1.6


RXF 393


Renal ca.
0
Kidney Cancer Clontech 9010320
0


ACHN


Renal ca.
0
Kidney NAT Clontech 9010321
1.23


UO-31


Renal ca.
3.17
Normal Uterus GENPAK 061018
0


TK-10


Liver
3.12
Uterus Cancer GENPAK 064011
2.35


Liver (fetal)
0
Normal Thyroid Clontech A+
0




6570-1


Liver ca. (hepatoblast)
0
Thyroid Cancer GENPAK 064010
3.54


HepG2


Lung
3.3
Thyroid Cancer INVITROGEN
2.65




A302152


Lung (fetal)
0
Thyroid NAT INVITROGEN
0




A302153


Lung ca. (small cell)
0
Normal Breast GENPAK 061019
7.91


LX-1


Lung ca. (small cell)
0
84877 Breast Cancer (OD04566)
2.4


NCI-H69


Lung ca. (s.cell var.)
0
85975 Breast Cancer (OD04590-01)
63.73


SHP-77


Lung ca. (large
5.01
85976 Breast Cancer Mets
100


cell)NCI-H460

(OD04590-03)


Lung ca. (non-sm.
3.1
87070 Breast Cancer Metastasis
0


cell) A549

(OD04655-05)


Lung ca. (non-s.cell)
0
GENPAK Breast Cancer 064006
3.52


NCI-H23


Lung ca (non-s.cell)
2.8
Breast Cancer Clontech 9100266
0


HOP-62


Lung ca. (non-s.cl)
0
Breast NAT Clontech 9100265
0


NCI-H522


Lung ca. (squam.)
0
Breast Cancer INVITROGEN
2.3


SW 900

A209073


Lung ca. (squam.)
0
Breast NAT INVITROGEN
1.13


NCI-H596

A2090734


Mammary gland
0
Normal Liver GENPAK 061009
0


Breast ca.* (pl.
2.12
Liver Cancer GENPAK 064003
2.03


effusion) MCF-7


Breast ca.* (pl.ef)
7.86
Liver Cancer Research Genetics
1.32


MDA-MB-231

RNA 1025


Breast ca.* (pl.
0
Liver Cancer Research Genetics
0


effusion) T47D

RNA 1026


Breast ca.
0
Paired Liver Cancer Tissue Research
0


BT-549

Genetics RNA 6004-T


Breast ca.
0
Paired Liver Tissue Research
2.5


MDA-N

Genetics RNA 6004-N


Ovary
0
Paired Liver Cancer Tissue Research
0




Genetics RNA 6005-T


Ovarian ca.
0
Paired Liver Tissue Research
1.61


OVCAR-3

Genetics RNA 6005-N


Ovarian ca.
0
Normal Bladder GENPAK 061001
0


OVCAR-4


Ovarian ca.
0
Bladder Cancer Research Genetics
0


OVCAR-5

RNA 1023


Ovarian ca.
6.38
Bladder Cancer INVITROGEN
14.26


OVCAR-8

A302173


Ovarian ca.
0
87071 Bladder Cancer (OD04718-
0


IGROV-1

01)


Ovarian ca.* (ascites)
5.75
87072 Bladder Normal Adjacent
1.99


SK-OV-3

(OD04718-03)


Uterus
0
Normal Ovary Res. Gen.
0


Plancenta
0
Ovarian Cancer GENPAK 064008
2.16


Prostate
3.69
87492 Ovary Cancer (OD04768-07)
0


Prostate ca.* (bone
3.19
87493 Ovary NAT (OD04768-08)
1


met)PC-3


Testis
100
Normal Stomach GENPAK 061017
0


Melanoma
3.37
NAT Stomach Clontech 9060359
0


Hs688(A).T


Melanoma* (met)
0
Gastric Cancer Clontech 9060395
1.3


Hs688(B).T


Melanoma
0
NAT Stomach Clontech 9060394
2.03


UACC-62


Melanoma
4.09
Gastric Cancer Clontech 9060397
11.27


M14


Melanoma
0
NAT Stomach Clontech 9060396
1.87


LOX IMVI


Melanoma* (met)
0
Gastric Cancer GENPAK 064005
0.93


SK-MEL-5


Adipose
0










[0815]

61








TABLE 64








Tissue_Name/Run_Name
2Dtm3670t_ag371
Tissue_Name/Run_Name
1.3Dtm3669t_ag371


















Normal Colon
1.19
Liver adenocarcinoma
0


GENPAK 061003


83219 CC Well to
0.88
Heart (fetal)
0


Mod Diff (ODO3866)


83220 CC NAT
0.27
Pancreas
0


(ODO3866)


83221 CC Gr.2
0.59
Pancreatic ca. CAPAN 2
0


rectosigmoid


(ODO3868)


83222 CC NAT
0
Adrenal gland
1.92


(ODO3868)


83235 CC Mod Diff
2.47
Thyroid
0


(ODO3920)


83236 CC NAT
0
Salivary gland
0


(ODO3920)


83237 CC Gr.2 ascend
2.98
Pituitary gland
1.19


colon (ODO3921)


83238 CC NAT
1.15
Brain (fetal)
0


(ODO3921)


83241 CC from Partial
0
Brain (whole)
1.1


Hepatectomy


(ODO4309)


83242 Liver NAT
0
Brain (amygdala)
0


(ODO4309)


87472 Colon mets to
0
Brain (cerebellum)
0


lung (OD04451-01)


87473 Lung NAT
0
Brain (hippocampus)
1.65


(OD04451-02)


Normal Prostate
1.4
Brain (thalamus)
0


Clontech A+ 6546-1


84140 Prostate Cancer
12.07
Cerebral Cortex
0


(OD04410)


84141 Prostate NAT
7.86
Spinal cord
0


(OD04410)


87073 Prostate Cancer
0.69
CNS ca. (glio/astro) U87-MG
0


(OD04720-01)


87074 Prostate NAT
1.2
CNS ca. (glio/astro) U-118-MG
0


(OD04720-02)


Normal Lung
2.68
CNS ca. (astro) SW1783
0


GENPAK 061010


83239 Lung Met to
1.06
CNS ca.* (neuro; met) SK-N-AS
0


Muscle (ODO4286)


83240 Muscle NAT
0
CNS ca. (astro) SF-539
2.5


(ODO4286)


84136 Lung Malignant
0
CNS ca. (astro) SNB-75
8.66


Cancer (OD03126)


84137 Lung NAT
0.52
CNS ca. (glio) SNB-19
6.16


(OD03126)


84871 Lung Cancer
0.54
CNS ca. (glio) U251
1.07


(OD04404)


84872 Lung NAT
4.8
CNS ca. (glio) SF-295
3.08


(OD04404)


84875 Lung Cancer
0
Heart
0


(OD04565)


85950 Lung Cancer
7.91
Skeletal muscle
0


(OD04237-01)


85970 Lung NAT
2.32
Bone marrow
0.86


(OD04237-02)


83255 Ocular Mel
0
Thymus
0


Met to Liver


(ODO4310)


83256 Liver NAT
0
Spleen
0


(ODO4310)


84139 Melanoma Mets
0
Lymph node
0


to Lung (OD04321)


84138 Lung NAT
0
Colorectal
3.21


(OD04321)


Normal Kidney
0
Stomach
2.1


GENPAK 061008


83786 Kidney Ca,
3.61
Small intestine
0


Nuclear grade 2


(OD04338)


83787 Kidney NAT
0.34
Colon ca. SW480
1.86


(OD04338)


83788 Kidney Ca
0.87
Colon ca.* (SW480 met)SW620
2.12


Nuclear grade 1/2


(OD04339)


83789 Kidney NAT
0
Colon ca. HT29
6.93


(OD04339)


83790 Kidney Ca,
0
Colon ca. HCT-116
0


Clear cell type


(OD04340)


83791 Kidney NAT
0
Colon ca. CaCo-2
0


(OD04340)


83792 Kidney Ca,
0
83219 CC Well to Mod Diff
0


Nuclear grade 3

(ODO3866)


(OD04348)


83793 Kidney NAT
0
Colon ca. HCC-2998
0.88


(OD04348)


87474 Kidney Cancer
1.57
Gastric ca.* (liver met) NCI-N87
1.06


(OD04622-01)


87475 Kidney NAT
1.16
Bladder
3.35


(OD04622-03)


85973 Kidney Cancer
0
Trachea
0


(OD04450-01)


85974 Kidney NAT
0
Kidney
0


(OD04450-03)


Kidney Cancer
0
Kidney (fetal)
0


Clontech 8120607


Kidney NAT Clontech
0
Renal ca. 786-0
0


8120608


Kidney Cancer
0
Renal ca. A498
0


Clontech 8120613


Kidney NAT Clontech
0
Renal ca. RXF 393
0


8120614


Kidney Cancer
0
Renal ca. ACHN
6.38


Clontech 9010320


Kidney NAT Clontech
0
Renal ca. UO-31
0


9010321


Normal Uterus
0
Renal ca. TK-10
0


GENPAK 061018


Uterus Cancer
2.54
Liver
0


GENPAK 064011


Normal Thyroid
0
Liver (fetal)
0


Clontech A+ 6570-1


Thyroid Cancer
1.05
Liver Ca. (hepatoblast) HepG2
1.36


GENPAK 064010


Thyroid Cancer
1.05
Lung
0


INVITROGEN


A302152


Thyroid NAT
0.94
Lung (fetal)
0


INVITROGEN


A302153


Normal Breast
2.4
Lung Ca. (small cell) LX-1
1.35


GENPAK 061019


84877 Breast Cancer
0
Lung Ca. (small cell) NCI-H69
0


(OD04566)


85975 Breast Cancer
51.41
Lung ca. (s. cell var.) SHP-77
1.53


(OD04590-01)


85976 Breast Cancer
100
Lung ca. (large cell)NCI-H460
0


Mets (OD04590-03)


87070 Breast Cancer
0
Lung ca. (non-sm. cell) A549
0


Metastasis (OD04655-


05)


GENPAK Breast
0.45
Lung Ca. (non-s. cell) NCI-H23
0


Cancer 064006


Breast Cancer
0
Lung ca (non-s. cell) HOP-62
0


Clontech 9100266


Breast NAT Clontech
0
Lung ca. (non-s. cl) NCI-H522
0


9100265


Breast Cancer
1.83
Lung ca. (squam.) SW 900
0


INVITROGEN


A209073


Breast NAT
0
Lung ca. (squam.) NCI-H596
3.37


INVITROGEN


A2090734


Normal Liver
0
Mammary gland
3.52


GENPAK 061009


Liver Cancer
1.04
Breast ca.* (pl. effusion) MCF-7
0


GENPAK 064003


Liver Cancer Research
0
Breast ca.* (pl. ef) MDA-MB-231
2.57


Genetics RNA 1025


Liver Cancer Research
0
Breast ca.* (pl. effusion) T47D
2.59


Genetics RNA 1026


Paired Liver Cancer
0
Breast ca. BT-549
0


Tissue Research


Genetics RNA 6004-T


Paired Liver Tissue
1.81
Breast ca. MDA-N
0


Research Genetics


RNA 6004-N


Paired Liver Cancer
0
Ovary
1.78


Tissue Research


Genetics RNA 6005-T


Paired Liver Tissue
0
Ovarian ca. OVCAR-3
0


Research Genetics


RNA 6005-N


Normal Bladder
1
Ovarian ca. OVCAR-4
0


GENPAK 061001


Bladder Cancer
1.1
Ovarian ca. OVCAR-5
0


Research Genetics


RNA 1023


Bladder Cancer
3.3
Ovarian ca. OVCAR-8
3.67


INVITROGEN


A302173


87071 Bladder Cancer
0.68
Ovarian ca. IGROV-1
1.92


(OD04718-01)


87072 Bladder Normal
0
Ovarian ca.* (ascites) SK-OV-3
0


Adjacent (OD04718-


03)


Normal Ovary Res.
0.51
Uterus
0


Gen.


Ovarian Cancer
0.42
Plancenta
1.41


GENPAK 064008


87492 Ovary Cancer
0
Prostate
1.18


(OD04768-07)


87493 Ovary NAT
0
Prostate ca.* (bone met)PC-3
0


(OD04768-08)


Normal Stomach
0
Testis
100


GENPAK 061017


NAT Stomach
0
Melanoma Hs688(A).T
0


Clontech 9060359


Gastric Cancer
0
Melanoma* (met) Hs688(B).T
0


Clontech 9060395


NAT Stomach
0
Melanoma UACC-62
0


Clontech 9060394


Gastric Cancer
0
Melanoma M14
0


Clontech 9060397


NAT Stomach
0
Melanoma LOX IMVI
0


Clontech 9060396


Gastric Cancer
0
Melanoma* (met) SK-MEL-5
0


GENPAK 064005




Adipose
0






In Tables 61-64, the following abbreviations are used:




ca. = carcinoma,




*= established from metastasis,




met = metastasis,




s cell var = small cell variant,




non-s = non-sm = non-small,




squam = squamous,




pl. eff = pl effusion = pleural effusion,




glio = glioma,




astro = astrocytoma, and




neuro = neuroblastoma.








[0816] These results are summarized in Table 65.
62TABLE 65NOVXInternal Accession NumberResultsNOV1AL135841_BAg431, potential utilities for breastcancer, several cancer in panel 2and couple of cell lines in panel 1NOV8AL135784_AAg2691 panel 1 many cancer celllines panel 2 high inovarian>>NAT, also lung as inpanel 1, bladderNOV10AC020679_BAg379 Overexpressed in breastlow expression in several cell linesNOV11AC020679_AAg371 Overexpressed in breastcancer and low expression inseveral cell lines



OTHER EMBODIMENTS

[0817] While the invention has been described in conjunction with the detailed description thereof, the foregoing description is intended to illustrate and not limit the scope of the invention, which is defined by the scope of the appended claims. Other aspects, advantages, and modifications are within the scope of the following claims.


Claims
  • 1. An isolated polypeptide comprising an amino acid sequence selected from the group consisting of: a) a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27; b) a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27, wherein any amino acid in the mature form is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; c) the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27; d) a variant of the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 wherein any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed; and e) a fragment of any of a) through d).
  • 2. The polypeptide of claim 1 that is a naturally occurring allelic variant of the sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27.
  • 3. The polypeptide of claim 2, wherein the variant is the translation of a single nucleotide polymorphism.
  • 4. The polypeptide of claim 1 that is a variant polypeptide described therein, wherein any amino acid specified in the chosen sequence is changed to provide a conservative substitution.
  • 5. An isolated nucleic acid molecule comprising a nucleic acid sequence encoding a polypeptide comprising an amino acid sequence selected from the group consisting of: a) a mature form of the amino acid sequence given SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27; b) a variant of a mature form of the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 wherein any amino acid in the mature form of the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence of the mature form are so changed; c) the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27; d) a variant of the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27, in which any amino acid specified in the chosen sequence is changed to a different amino acid, provided that no more than 15% of the amino acid residues in the sequence are so changed; e) a nucleic acid fragment encoding at least a portion of a polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 or any variant of said polypeptide wherein any amino acid of the chosen sequence is changed to a different amino acid, provided that no more than 10% of the amino acid residues in the sequence are so changed; and f) the complement of any of said nucleic acid molecules.
  • 6. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule comprises the nucleotide sequence of a naturally occurring allelic nucleic acid variant.
  • 7. The nucleic acid molecule of claim 5 that encodes a variant polypeptide, wherein the variant polypeptide has the polypeptide sequence of a naturally occurring polypeptide variant.
  • 8. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule comprises a single nucleotide polymorphism encoding said variant polypeptide.
  • 9. The nucleic acid molecule of claim 5, wherein said nucleic acid molecule comprises a nucleotide sequence selected from the group consisting of a) the nucleotide sequence selected from the group consisting of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26; b) a nucleotide sequence wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed; c) a nucleic acid fragment of the sequence selected from the group consisting of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26; and d) a nucleic acid fragment wherein one or more nucleotides in the nucleotide sequence selected from the group consisting of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26 is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides are so changed.
  • 10. The nucleic acid molecule of claim 5, wherein said nucleic acid molecule hybridizes under stringent conditions to the nucleotide sequence selected from the group consisting of SEQ ID NO: 1, 3, 5, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or 26, or a complement of said nucleotide sequence.
  • 11. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule comprises a nucleotide sequence in which any nucleotide specified in the coding sequence of the chosen nucleotide sequence is changed from that selected from the group consisting of the chosen sequence to a different nucleotide provided that no more than 15% of the nucleotides in the chosen coding sequence are so changed, an isolated second polynucleotide that is a complement of the first polynucleotide, or a fragment of any of them.
  • 12. A vector comprising the nucleic acid molecule of claim 11.
  • 13. The vector of claim 12, further comprising a promoter operably linked to said nucleic acid molecule.
  • 14. A cell comprising the vector of claim 12.
  • 15. An antibody that binds immunospecifically to the polypeptide of claim 1.
  • 16. The antibody of claim 15, wherein said antibody is a monoclonal antibody.
  • 17. The antibody of claim 15, wherein the antibody is a humanized antibody.
  • 18. A method for determining the presence or amount of the polypeptide of claim 1 in a sample, the method comprising: (a) providing said sample; (b) introducing said sample to an antibody that binds immunospecifically to the polypeptide; and (c) determining the presence or amount of antibody bound to said polypeptide, thereby determining the presence or amount of polypeptide in said sample.
  • 19. A method for determining the presence or amount of the nucleic acid molecule of claim 5 in a sample, the method comprising: (a) providing said sample; (b) introducing said sample to a probe that binds to said nucleic acid molecule; and (c) determining the presence or amount of said probe bound to said nucleic acid molecule, thereby determining the presence or amount of the nucleic acid molecule in said sample.
  • 20. A method of identifying an agent that binds to the polypeptide of claim 1, the method comprising: (a) introducing said polypeptide to said agent; and (b) determining whether said agent binds to said polypeptide.
  • 21. A method for identifying a potential therapeutic agent for use in treatment of a pathology, wherein the pathology is related to aberrant expression or aberrant physiological interactions of the polypeptide of claim 1, the method comprising: (a) providing a cell expressing the polypeptide of claim 1 and having a property or function ascribable to the polypeptide; (b) contacting the cell with a composition comprising a candidate substance; and (c) determining whether the substance alters the property or function ascribable to the polypeptide; whereby, if an alteration observed in the presence of the substance is not observed when the cell is contacted with a composition devoid of the substance, the substance is identified as a potential therapeutic agent.
  • 22. A method for modulating the activity of the polypeptide of claim 1, the method comprising introducing a cell sample expressing the polypeptide of said claim with a compound that binds to said polypeptide in an amount sufficient to modulate the activity of the polypeptide.
  • 23. A method of treating or preventing a pathology associated with the polypeptide of claim 1, said method comprising administering the polypeptide of claim 1 to a subject in which such treatment or prevention is desired in an amount sufficient to treat or prevent said pathology in said subject.
  • 24. The method of claim 23, wherein said subject is a human.
  • 25. A method of treating or preventing a pathology associated with the polypeptide of claim 1, said method comprising administering to a subject in which such treatment or prevention is desired a NOVX nucleic acid in an amount sufficient to treat or prevent said pathology in said subject.
  • 26. The method of claim 25, wherein said subject is a human.
  • 27. A method of treating or preventing a pathology associated with the polypeptide of claim 1, said method comprising administering to a subject in which such treatment or prevention is desired a NOVX antibody in an amount sufficient to treat or prevent said pathology in said subject.
  • 28. The method of claim 27, wherein the subject is a human.
  • 29. A pharmaceutical composition comprising the polypeptide of claim 1 and a pharmaceutically acceptable carrier.
  • 30. A pharmaceutical composition comprising the nucleic acid molecule of claim 5 and a pharmaceutically acceptable carrier.
  • 31. A pharmaceutical composition comprising the antibody of claim 15 and a pharmaceutically acceptable carrier.
  • 32. A kit comprising in one or more containers, the pharmaceutical composition of claim 29.
  • 33. A kit comprising in one or more containers, the pharmaceutical composition of claim 30.
  • 34. A kit comprising in one or more containers, the pharmaceutical composition of claim 31.
  • 35. The use of a therapeutic in the manufacture of a medicament for treating a syndrome associated with a human disease, the disease selected from a pathology associated with the polypeptide of claim 1, wherein said therapeutic is the polypeptide of claim 1.
  • 36. The use of a therapeutic in the manufacture of a medicament for treating a syndrome associated with a human disease, the disease selected from a pathology associated with the polypeptide of claim 1, wherein said therapeutic is a NOVX nucleic acid.
  • 37. The use of a therapeutic in the manufacture of a medicament for treating a syndrome associated with a human disease, the disease selected from a pathology associated with the polypeptide of claim 1, wherein said therapeutic is a NOVX antibody.
  • 38. A method for screening for a modulator of activity or of latency or predisposition to a pathology associated with the polypeptide of claim 1, said method comprising: a) administering a test compound to a test animal at increased risk for a pathology associated with the polypeptide of claim 1, wherein said test animal recombinantly expresses the polypeptide of claim 1;b) measuring the activity of said polypeptide in said test animal after administering the compound of step (a); and c) comparing the activity of said protein in said test animal with the activity of said polypeptide in a control animal not administered said polypeptide, wherein a change in the activity of said polypeptide in said test animal relative to said control animal indicates the test compound is a modulator of latency of, or predisposition to, a pathology associated with the polypeptide of claim 1.
  • 39. The method of claim 38, wherein said test animal is a recombinant test animal that expresses a test protein transgene or expresses said transgene under the control of a promoter at an increased level relative to a wild-type test animal, and wherein said promoter is not the native gene promoter of said transgene.
  • 40. A method for determining the presence of or predisposition to a disease associated with altered levels of the polypeptide of claim 1 in a first mammalian subject, the method comprising: a) measuring the level of expression of the polypeptide in a sample from the first mammalian subject; and b) comparing the amount of said polypeptide in the sample of step (a) to the amount of the polypeptide present in a control sample from a second mammalian subject known not to have, or not to be predisposed to, said disease, wherein an alteration in the expression level of the polypeptide in the first subject as compared to the control sample indicates the presence of or predisposition to said disease.
  • 41. A method for determining the presence of or predisposition to a disease associated with altered levels of the nucleic acid molecule of claim 5 in a first mammalian subject, the method comprising: a) measuring the amount of the nucleic acid in a sample from the first mammalian subject; and b) comparing the amount of said nucleic acid in the sample of step (a) to the amount of the nucleic acid present in a control sample from a second mammalian subject known not to have or not be predisposed to, the disease; wherein an alteration in the level of the nucleic acid in the first subject as compared to the control sample indicates the presence of or predisposition to the disease.
  • 42. A method of treating a pathological state in a mammal, the method comprising administering to the mammal a polypeptide in an amount that is sufficient to alleviate the pathological state, wherein the polypeptide is a polypeptide having an amino acid sequence at least 95% identical to a polypeptide comprising the amino acid sequence selected from the group consisting of SEQ ID NO: 2, 4, 7, 9, 11, 13, 15, 17, 19, 21, 23, 25, or 27 or a biologically active fragment thereof.
  • 43. A method of treating a pathological state in a mammal, the method comprising administering to the mammal the antibody of claim 15 in an amount sufficient to alleviate the pathological state.
RELATED APPLICATIONS

[0001] This application claims priority to U.S. Ser. No. 60/180,646, filed Feb. 7, 2000; U.S. Ser. No. 60/220,262, filed Jul. 24, 2000; U.S. Ser. No. 60/245,292, filed Nov. 2, 2000; U.S. Ser. No. 60/180,511, filed Feb. 7, 2000; U.S. Ser. No. 60/180,630, filed Feb. 7, 2000; U.S. Ser. No. 60/220,594, filed Jul. 25, 2000; U.S. Ser. No. 60/181,013, filed Feb. 8, 2000; U.S. Ser. No. 60/181,043, filed Feb. 8, 2000; U.S. Ser. No. 60/224,596, filed Aug. 11, 2000; U.S. Ser. No. 60/181,004, filed Feb. 8, 2000; and U.S. Ser. No. 60/180,930, filed Feb. 8, 2000 which are incorporated herein by reference in their entirety.

Provisional Applications (11)
Number Date Country
60180646 Feb 2000 US
60220262 Jul 2000 US
60245292 Nov 2000 US
60180511 Feb 2000 US
60180630 Feb 2000 US
60220594 Jul 2000 US
60181013 Feb 2000 US
60181043 Feb 2000 US
60224596 Aug 2000 US
60181004 Feb 2000 US
60180930 Feb 2000 US