Patent Grant
10544228
Antibodies and fragments thereof that target CD40, and do not exhibit CD40 agonist activity, compositions comprising the same, and methods of using the same for treatment of diseases involving CD40 activity are provided.
The instant application contains a Sequence Listing in ASCII format that is hereby incorporated by reference in its entirety. Said ASCII copy, created on Sep. 20, 2016, is named 200896_0004_01_US.txt and is 1, 188, 821 bytes in size.
CD40 is a co-stimulatory molecule belonging to the tumor necrosis factor (TNF) receptor superfamily that is present on antigen presenting cells (APC), including dendritic cells, B cells, and macrophages. APCs are activated when CD40 binds its ligand, CD154 (CD40L), on TH cells. CD40-mediated APC activation is involved in a variety of immune responses, including cytokine production, up-regulation of co-stimulatory molecules (such as CD86), and enhanced antigen presentation and B cell proliferation. CD40 can also be expressed by endothelial cells, smooth muscle cells, fibroblasts, and epithelial cells.
CD40 activation is also involved in a variety of undesired T cell responses related to autoimmunity, transplant rejection, or allergic responses, for example. One strategy for controlling undesirable T cell responses is to target CD40 with an antagonistic antibody. For example, monoclonal antibody HCD122 (Lucatumumab), formerly known as Chiron 1212, is currently in clinical trials for the treatment of certain CD40-mediated inflammatory diseases. See “Study of HCD122 (Lucatumumab) and Bendamustine Combination Therapy in CD40+ Rituximab-Refractory Follicular Lymphoma,” Clinical Trials Feeds, on the Internet at hypertext transfer protocol: clinicaltrialsfeeds.org/clinical-trials/show/NCT01275209 (last updated Jan. 11, 2011). Monoclonal antibodies, however, can display agonist activity. For example, the usefulness of the anti-CD40 antibody Chi220 is limited by its weak stimulatory potential. See Adams, et al., “Development of a chimeric anti-CD40 monoclonal antibody that synergizes with LEA29Y to prolong islet allograft survival,” J. Immunol. 174: 542-50 (2005).
Anti-CD40 antibody antagonists that do not possess partial agonist activity are still needed in a clinical setting. Novel antibody polypeptides that specifically bind a novel epitope of human CD40 are provided. The CD40 epitope does not overlap the Chi220 epitope, as shown by competition analysis and by the structure derived from co-crystallization of an antibody polypeptide with CD40. The antibody polypeptides advantageously do not exhibit CD40 agonist activity. The antibody polypeptides are useful in the treatment of diseases involving CD40 activation, including autoimmune diseases, transplant rejection, and allergic responses. The antibody polypeptides comprise a variable domain. In one embodiment, the antibody polypeptides are in the form of a domain antibody (dAb) that contains a single variable domain. In another embodiment, the dAbs are bi-specific reagents that comprise a second variable domain that can bind human serum albumin (HSA), for example.
Provided is an antibody polypeptide comprising a first variable domain, where said antibody polypeptide specifically binds an epitope of human CD40, where the epitope comprises the amino acid sequence of SEQ ID NO: 1, where the antibody polypeptide competes with the binding of domain antibody (dAb) BMS3h-56-269 (SEQ ID NO: 417), and where the epitope comprises at least one CD40 amino acid residue selected from the group consisting of Trp109, Leu121, His122, Ser124, Ser156, Ala157, Phe158, Glu159, and His162.
Further provided is an antibody polypeptide where the first variable domain comprises the amino acid sequence of one of the antibody polypeptides selected from the lineage group consisting of BMS3h-37, BMS3h-38, BMS3h-56, and BMS3h-198, and where the first variable domain has an apparent binding constant of 1 pM to 100 nM. Further provided is an antibody polypeptide where the first variable domain has an apparent binding constant of 1 pM to 10 nM.
Also provided is an antibody polypeptide where the amino acid sequence of the first variable domain comprises (a) a CDR1 region which differs from the CDR1 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids, (b) a CDR2 region which differs from the CDR2 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids, (c) a CDR3 region which differs from the CDR3 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids, (d) a FR1 region which differs from the FR1 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids, (e) a FR2 region which differs from the FR2 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids, (f) a FR3 region which differs from the FR3 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids, and (g) a FR4 region which differs from the FR4 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids.
Also provided is an antibody polypeptide where the amino acid sequence of the first variable domain comprises (a) a CDR1 region which differs from the CDR1 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids, (b) a CDR2 region which differs from the CDR2 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids, (c) a CDR3 region which differs from the CDR3 region of BMS3h-56-269 (SEQ ID NO: 417) by up to two amino acids.
Further provided is an antibody polypeptide where the amino acid sequence of the first variable domain differs from the amino acid sequence of BMS3h-56-258 (SEQ ID NO: 10) or BMS3h-56-269 (SEQ ID NO: 417) by up to 10 amino acids.
Further provided is an antibody polypeptide where the amino acid sequence of the first variable domain differs from the amino acid sequence of BMS3h-56-258 (SEQ ID NO: 10) or BMS3h-56-269 (SEQ ID NO: 417) by up to 5 amino acids.
Further provided is an antibody polypeptide where the amino acid sequence of the first variable domain differs from the amino acid sequence of BMS3h-56-258 (SEQ ID NO: 10) or BMS3h-56-269 (SEQ ID NO: 417) by two amino acids.
Further provided is an antibody polypeptide where the amino acid sequence of the first variable domain differs from the amino acid sequence of BMS3h-56-258 (SEQ ID NO: 10) or BMS3h-56-269 (SEQ ID NO: 417) by one amino acid.
Further provided is an antibody polypeptide where the antibody polypeptide is selected from the lineage group of BMS3h-56, and where the amino acid sequence of the first variable domain further comprises: (a) a CDR1 region having a sequence X1-Tyr-Glu-Y1-Trp (SEQ ID NO: 1274), where X1 is Asp or Gly, and Y1 is Met or Leu; (b) a CDR2 region having a sequence Ala-Ile-Asn-Pro-X2-Gly-Y2-Z2-Thr-Tyr-Tyr-Ala-Asp-Ser-Val-A2-Gly (SEQ ID NO: 1275), where X2 is Gln, Tyr, Pro, Trp, or Ala, Y2 is Thr, Ser, Asn, Gly, Met, or Gln, Z2 is Arg, Leu, Tyr, His, or Phe, and A2 is Lys or Met; and (c) a CDR3 region having a sequence X3-Pro-Y3-Z3-Phe-A3-B3 (SEQ ID NO: 1276), where X3 is Leu or Pro, Y3 is Phe, Gln, Thr, or Met, Z3 is Tyr, Pro, Leu, Thr, Ile, Phe, or Met, A3 is Gln, His, Asp, Ser, Lys, Glu, or Gly, and B3 is Glu, Asp, or Tyr.
Further provided is an antibody polypeptide where the amino acid sequence of the first variable domain comprises: (a) a FR1 region having a sequence Glu-Val-Gln-Leu-Leu-Glu-Ser-Gly-Gly-Gly-Leu-Val-Gln-Pro-Gly-Gly-Ser-X-Arg-Leu-Ser-Cys-Ala-Ala-Ser-Gly-Phe-Thr-Phe-Y1 (SEQ ID NO: 1277), where X1 is Leu or Arg, and Y1 is Arg or Ala; (b) a FR2 region having a sequence Trp-Val-Arg-X2-Ala-Pro-Gly-Y2-Z2-Leu-Glu-Arg-Val-Ser (SEQ ID NO: 1278), where X2 is Gln or Arg, Y2 is Lys or Arg, and Z2 is Gly or Val; (c) a FR3 region having a sequence Arg-Phe-Thr-Ile-Ser-Arg-Asp-Asn-Ser-Lys-Asn-X3-Leu-Tyr-Leu-Gln-Met-Asn-Ser-Leu-Arg-Ala-Y3-Asp-Thr-Z3-Val-Tyr-A3-Cys-B3-Lys (SEQ ID NO: 1279), where X3 is Thr or Met, Y3 is Glu or Asp, Z3 is Ala or Ser, A3 is Tyr or His, and B3 is Ala or Thr; and (d) a FR4 region having a sequence X4-Gly-Y4-Gly-Thr-Leu-Val-Thr-Val-Ser-Z4 (SEQ ID NO: 1280), where X4 is Trp or Arg, Y4 is Gln or Pro, and Z4 is Ser or Asn.
Further provided is an antibody polypeptide where the first variable domain comprises the amino acid sequence of BMS3h-56-258 (SEQ ID NO: 10) or BMS3h-56-269 (SEQ ID NO:417).
Further provided is an antibody polypeptide where the antibody polypeptide is selected from the lineage group of BMS3h-37, where the first variable domain comprises the sequence Glu-Val-Gln-Leu-Leu-Glu-Ser-Gly-Gly-Gly-Leu-Val-X1-Pro-Gly-Gly-Ser-Leu-Arg-Leu-Ser-Cys-Ala-Ala-Ser-Gly-Phe-Thr-Phe-Glu-Trp-Tyr-Glu-Met-Gln-Trp-Val-Arg-Arg-Ala-Pro-Gly-Lys-Gly-Leu-Glu-Trp-Val-Ser-Ala-Ile-Ser-Gly-Asp-Gly- Tyr-Arg-Thr-Tyr-Tyr-Ala-Asp-Ser-Val-Lys-Gly-Arg-Phe-Thr-Ile-Ser-Arg-Asp-Asn-Ser-Lys-Asn-Thr-Leu-Tyr-Leu-Gln-Met-Asn-Ser-Leu-Arg-Ala-Glu-Asp-Thr-Ala-Val-Tyr-Tyr-Cys-Ala-Lys-Y1-Leu-Z1-A1-Phe-Asp-Tyr-B1-Gly-Arg-Gly-Thr-Leu-Val-Thr-Val-Ser-Ser (SEQ ID NO: 1281); and where X1 is Gln or Arg; Y1 is Glu or Gly; Z1 is Ala, Leu, or Glu; A1 is Phe or Tyr; and B1 is Trp or Arg.
Also provided is an antibody polypeptide where the antibody polypeptide is selected from the lineage group of BMS3h-38, where the first variable domain comprises the sequence Glu-Val-Gln-Leu-Leu-Ala-Ser-Gly-Gly-Gly-Leu-Val-Gln-Pro-Gly-Gly-Ser-Leu-Arg-Leu-Ser-Cys-Ala-Ala-Ser-Gly-Phe-X1-Phe-Glu-Glu-Glu-Glu-Met-Ile-Trp-Val-Arg-Gln-Ala-Pro-Gly-Lys-Gly-Leu-Glu-Trp-Val-Ser-Y1-Ile-Ser-Z1-A1-Gly-B1-C1-Thr-Tyr-Tyr-Ala-Asp-Ser-Val-Lys-Gly-Arg-Phe-Thr-Ile-Ser-Arg-Asp-Asn-Ser-Lys-Asn-Thr-Leu-Tyr-Leu-Gln-Met-Asn-Ser-Leu-Arg-Ala-Glu-Asp-Thr-Ala-Val-Tyr-Tyr-Cys-Gly-Lys-Glu-Pro- Phe-D1-Tyr-Asp-Tyr-Trp-Gly-Gln-Gly-Thr-Leu-Val-Thr-Val-Ser-Ser (SEQ ID NO: 1282); and where X1 is Thr or Pro; Y1 is Ala or Ser; Z1 is Arg or Gly; A1 is Arg, Ser, Asn, Gln, Gly, His, or Leu; B1 is Tyr, Phe, Trp, or Gly; C1 is Ser or Gly; and D1 is Arg, Met, or Pro.
Also provided is an antibody polypeptide where the antibody polypeptide is selected from the lineage group of BMS3h-198, where the first variable domain comprises the sequence Glu-Val-Gln-Leu-Leu-Glu-Ser-Gly-Gly-Gly-Leu-Val-Gln-Pro-Gly-Gly-Ser-Leu-Arg-Leu-Ser-Cys-Ala-Ala-Ser-Gly-Phe-Thr-Phe-Ala-Gly-Try-Glu-X1-Trp-Trp-Y1-Arg-Gln-Ala-Pro-Gly-Lys-Gly-Leu-Glu-Arg-Val-Ser-Ala-Ile-Ser-Gly-Ser-Gly-Gly-Ser-Thr-Tyr-Tyr-Ala-Asp-Ser-Val-Lys-Gly-Arg-Phe-Thr-Ile-Ser-Arg-Asp-Z1-A1-Lys-Asn-Thr-Leu-Tyr-Leu-Gln-Met-Asn-Ser-Leu-Arg-Ala-Glu-Asp-Thr-Ala-Val-Tyr-B1-Cys-Ala-C1-D1-Pro-Tyr-Ser-E1-Asp-Tyr-F1-G1-H1-Gly-Thr-Leu-Val-Thr-Val-Ser-Ser (SEQ ID NO: 1283); and where X1 is Met or Leu; Y1 is Val or Phe; Z1 is Asp or Asn; A1 is Ser or Thr; B1 is Tyr or His; C1 is Lys or Arg; D1 is Asp or Glu; E1 is Tyr or Phe; F1 is Trp or Arg; G1 is Gly or Arg; and H1 is Gln or His.
Further provided is an antibody polypeptide where the antibody polypeptide is a domain antibody (dAb).
Further provided is an antibody polypeptide where the variable domain is fused to an Fc domain.
Further provided is an antibody polypeptide where the antibody polypeptide further comprises a second variable domain that specifically binds a second antigen, where the second antigen is an antigen other than human CD40.
Also provided is an antibody polypeptide where the second antigen is a cluster of differentiation (CD) molecule or a Major Histocompatibility Complex (MHC) Class II molecule.
Also provided is an antibody polypeptide where the second antigen is serum albumin (SA).
Provided is a nucleic acid encoding the antibody polypeptide disclosed herein.
Also provided is a vector comprising the nucleic acid disclosed herein.
Also provided is a host cell comprising the vector disclosed herein.
Provided is a pharmaceutical composition comprising a therapeutically-effective amount of the antibody polypeptide disclosed herein and a pharmaceutically acceptable carrier. Also provided is a pharmaceutical composition further comprising an immunosuppressive/immunomodulatory and/or anti-inflammatory agent.
Provided is a method of treating an immune disease in a patient in need of such treatment, comprising administering to the patient a therapeutically effective amount of the pharmaceutical composition disclosed herein. Also provided is a method where the pharmaceutical composition is administered in combination with an immunosuppressive/immunomodulatory and/or anti-inflammatory agent.
Provided is a method of treating an immune disease where the immune disease is an autoimmune disease or a graft-related disease. Further provided is a method of treating an immune disease where the immune disease is selected from the group consisting of selected from the group consisting of Addison's disease, allergies, ankylosing spondylitis, asthma, atherosclerosis, autoimmune diseases of the ear, autoimmune diseases of the eye, autoimmune hepatitis, autoimmune parotitis, colitis, coronary heart disease, Crohn's disease, diabetes, including Type 1 and/or Type 2 diabetes, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barre syndrome, Hashimoto's disease, hemolytic anemia, idiopathic thrombocytopenic purpura, inflammatory bowel disease, immune response to recombinant drug products, systemic lupus erythematosus, male infertility, multiple sclerosis, myasthenia gravis, pemphigus, psoriasis, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, spondyloarthropathies, thyroiditis, transplant rejection, vasculitis, AIDS, atopic allergy, bronchial asthma, eczema, leprosy, schizophrenia, inherited depression, transplantation of tissues and organs, chronic fatigue syndrome, Alzheimer's disease, Parkinson's disease, myocardial infarction, stroke, autism, epilepsy, Arthus's phenomenon, anaphylaxis, alcohol addiction, and drug addiction.
Also provided is a method of targeting CD40 using a first variable domain that specifically binds an epitope of human CD40 comprising the amino acid sequence of SEQ ID NO: 1, where the antibody polypeptide competes with the binding of domain antibody (dAb) BMS3h-56-269 (SEQ ID NO:417).
Provided is the use in medicine of an antibody polypeptide comprising a first variable domain that specifically binds an epitope of human CD40 comprising the amino acid sequence of SEQ ID NO: 1, wherein the antibody polypeptide competes with the binding of domain antibody (dAb) BMS3h-56-201 (SEQ ID NO: 9), or a pharmaceutically acceptable salt thereof.
Provided is the use of an antibody polypeptide comprising a first variable domain that specifically binds an epitope of human CD40 comprising the amino acid sequence of SEQ ID NO: 1, wherein the antibody polypeptide competes with the binding of domain antibody (dAb) BMS3h-56-201 (SEQ ID NO: 9), or a pharmaceutically acceptable salt thereof, in the preparation of a medicament for treatment of an immune disease. In some embodiments, the pharmaceutical composition is administered in combination with an immunosuppressive/immunomodulatory and/or anti-inflammatory agent. In further embodiments, the immune disease is an autoimmune disease or a graft-related disease. In yet further embodiments, the immune disease is selected from the group consisting of selected from the group consisting of Addison's disease, allergies, ankylosing spondylitis, asthma, atherosclerosis, autoimmune diseases of the ear, autoimmune diseases of the eye, autoimmune hepatitis, autoimmune parotitis, colitis, coronary heart disease, Crohn's disease, diabetes, including Type 1 and/or Type 2 diabetes, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barre syndrome, Hashimoto's disease, hemolytic anemia, idiopathic thrombocytopenic purpura, inflammatory bowel disease, immune response to recombinant drug products, systemic lupus erythematosus, male infertility, multiple sclerosis, myasthenia gravis, pemphigus, psoriasis, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, spondyloarthropathies, thyroiditis, transplant rejection, vasculitis, AIDS, atopic allergy, bronchial asthma, eczema, leprosy, schizophrenia, inherited depression, transplantation of tissues and organs, chronic fatigue syndrome, Alzheimer's disease, Parkinson's disease, myocardial infarction, stroke, autism, epilepsy, Arthus's phenomenon, anaphylaxis, alcohol addiction, and drug addiction.
Provided is an antibody polypeptide comprising a first variable domain that specifically binds an epitope of human CD40 comprising the amino acid sequence of SEQ ID NO: 1, wherein the antibody polypeptide competes with the binding of domain antibody (dAb) BMS3h-56-201 (SEQ ID NO: 9), or a pharmaceutically acceptable salt thereof, for use in the preparation of a medicament for treatment of an immune disease. The medicament can, for example, be administered in combination with an immunosuppressive/immunomodulatory and/or anti-inflammatory agent. The immune disease can be, for example, an autoimmune disease or a graft-related disease. The immune disease can also be selected from the group consisting of selected from the group consisting of Addison's disease, allergies, ankylosing spondylitis, asthma, atherosclerosis, autoimmune diseases of the ear, autoimmune diseases of the eye, autoimmune hepatitis, autoimmune parotitis, colitis, coronary heart disease, Crohn's disease, diabetes, including Type 1 and/or Type 2 diabetes, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barre syndrome, Hashimoto's disease, hemolytic anemia, idiopathic thrombocytopenic purpura, inflammatory bowel disease, immune response to recombinant drug products, systemic lupus erythematosus, male infertility, multiple sclerosis, myasthenia gravis, pemphigus, psoriasis, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, spondyloarthropathies, thyroiditis, transplant rejection, vasculitis, AIDS, atopic allergy, bronchial asthma, eczema, leprosy, schizophrenia, inherited depression, transplantation of tissues and organs, chronic fatigue syndrome, Alzheimer's disease, Parkinson's disease, myocardial infarction, stroke, autism, epilepsy. Arthus's phenomenon, anaphylaxis, alcohol addiction, and drug addiction.
Antibody polypeptides that specifically bind to human CD40 are provided. The antibody polypeptides do not exhibit CD40 agonist activity, and the antibody polypeptides are useful in the treatment of diseases involving CD40 activation, such as autoimmune diseases. The antibody polypeptides may be selected using a primary screen that utilizes cell binding assays, followed by one or more rounds of error-prone or degenerate oligonucleotide-directed affinity maturation. As a result, a genus of antibody polypeptides that specifically bind a single CD40 epitope are provided.
A “lineage” is a set of related antibody polypeptides that were prepared from a common precursor by error-prone or degenerate oligonucleotide-directed affinity maturation, as disclosed in the examples below, and that are expected to bind the same CD40 epitope. The nomenclature of the antibody polypeptides is used to designate the various lineages. The nomenclature “BMS3h-56,” for example, refers to antibody polypeptides of lineage 56, which were raised against human CD40. “Lineage BMS3h-56” antibody polypeptides include BMS3h-56-1 through BMS3h-56-33, and BMS3h-56-202 through BMS3h-56-288.
Accordingly, in one aspect, an antibody polypeptide comprises a variable domain that specifically binds human CD40, where the antibody polypeptide competes with the binding of any one of the domain antibodies (dAbs) listed in TABLE 3. For example, the dAb may belong to a lineage selected from the group consisting of BMS3h-37, BMS3h-38, BMS3h-41, BMS3h-43, BMS3h-56, BMS3h-131, BMS3h-198, and BMS3h-202, such as the dAb BMS3h-56-5, BMS3h-56-201, or BMS3h-56-258, for instance. In another aspect, an antibody polypeptide specifically binds the same human CD40 epitope as any one of the dAbs listed in TABLE 3. For example, the antibody polypeptide may comprise a variable domain that specifically binds the same human CD40 epitope as the dAb BMS3h-56-5, BMS3h-56-201, or BMS3h-56-258, for instance. As disclosed below, the human CD40 epitope may comprise amino acid residue Trp109 of SEQ ID NO: 1, for example.
The antibody polypeptides may be domain antibodies containing a single variable domain. The antibody polypeptides also may comprise additional domains, such as an Fc domain. For instance, the antibody polypeptide may comprise a second variable domain that specifically binds human serum albumin (HSA). Such dual specific antibody polypeptides may have an increased half-life, for example.
In the Sequence Listing, SEQ ID NO: 1 is the amino acid sequence of human CD40; SEQ ID NO: 2 is the amino acid sequence of Macaca fascicularis CD40. The amino acid sequence of the domain antibody BMS3h-56-5 is SEQ ID NO: 321.
As used herein, “specific binding” refers to the binding of an antigen by an antibody polypeptide with a dissociation constant (Kd) of about 11.1M or lower as measured, for example, by surface plasmon resonance. Suitable assay systems include the BIAcore™ surface plasmon resonance system and BIAcore™ kinetic evaluation software (e.g., version 2.1). The affinity or Kd for a specific binding interaction may be about 500 nM or lower or about 300 nM or lower.
The term “about” will be understood by persons of ordinary skill in the art and will vary to some extent on the context in which it is used. Generally, about encompasses a range of values that are plus/minus 10% of a referenced value.
In accordance with this detailed description, the following abbreviations and definitions apply. It must be noted that as used herein, the singular forms “a”, “an”, and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “an antibody” includes a plurality of such antibodies and reference to “the dosage” includes reference to one or more dosages and equivalents thereof known to those skilled in the art, and so forth.
1. CD40 and CD40 Activities
Antibody polypeptides are provided that bind human CD40. CD40 is also known as B-cell surface antigen CD40, Bp50, CD40L receptor, CDw40, CDW40, MGC9013, p50, TNFRSF5, and Tumor necrosis factor receptor superfamily member 5. Relevant structural information for human CD40 can be found, for example, at UniProt Accession Numbers P25942, Q9BYU0, and Q53GN5. “Human CD40” refers to the CD40 comprising the following amino acid sequence:
CD40 also has been sequenced in Mus musculus, Sus scrofa, Bos taunts, Gallus gallus, Canis familiaris, Macaca fascicularis (cynomolgus monkey), Ovis aries, Equus caballus, and Rattus norvegicus.
Binding of the present antibody polypeptides to CD40 antagonizes CD40 activity. “CD40 activities” include, but are not limited to, T cell activation (e.g., induction of T cell proliferation or cytokine secretion), macrophage activation (e.g., the induction of reactive oxygen species and nitric oxide in the macrophage), and B cell activation (e.g., B cell proliferation, antibody isotype switching, or differentiation to plasma cells). CD40 activities can be mediated by interaction with other molecules. “CD40 activities” include the functional interaction between CD40 and the following molecules, which are identified by their Uniprot Accession Number is parentheses:
CALR (P27797);
ERP44 (Q9BS26);
FBL (P22087);
POLR2H (P52434);
RFC5 (P40937);
SGK1 (000141);
SLC30A7 (Q8NEW0);
SLC39A7 (Q92504);
TRAF2 (Q5T1L5);
TRAF3 (Q13114);
TRAF6 (Q9Y4K3);
TXN (Q5T937);
UGGT1 (Q9NYU2); and
USP15 (Q9Y4E8).
For example, a CD40 “activity” includes an interaction with TRAF2. CD40/TRAF2 interaction activates NF-κB and JNK. See Davies et al., Mol. Cell Biol. 25: 9806-19 (2005). This CD40 activity thus can be determined by CD40-dependent cellular NF-κB and JNK activation, relative to a reference.
As used herein, the terms “activate,” “activates,” and “activated” refer to an increase in a given measurable CD40 activity by at least 10% relative to a reference, for example, at least 10%, 25%, 50%, 75%, or even 100%, or more. A CD40 activity is “antagonized” if the activity is reduced by at least 10%, and in an exemplary embodiment, at least about 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 97%, or even 100% (i.e., no detectable activity), relative to the absence of the antagonist. For example, an antibody polypeptide may antagonize some or all CD40 activity, while not activating CD40. In one embodiment, the antibody polypeptide does not activate B cell proliferation. In another embodiment, the antibody polypeptide does not activate cytokine secretion by T cells, where the cytokine is at least one cytokine selected from the group consisting of IL-2, IL-6, IL-10, IL-13, TNF-α, IFN-γ.
2. The CD40 Epitope
X-ray crystallography of a complex between human CD40 (SEQ ID NO: 1) and the dAb BMS3h-56-5 (SEQ ID NO: 321) was used to reveal an epitope recognized by the antibody polypeptides of the disclosure. Structural models of CD40 and BMS3h-56-5 were fitted to electron density data to yield seven models or versions of the CD40/BMS3h-56-5 complex, which come from three crystallographically independent complexes in one crystal form and four crystallographically independent complexes in a second crystal form. The versions have real space correlation coefficients of about 0.92 for main-chain atoms and 0.80 for side-chain atoms. The CD40 molecule has a certain amount of flexibility in the seven versions, but the overall nature of the CD40/BMS3h-56-5 interaction is retained in all versions. The versions differ in the interaction between the CD40 residue Trp109 and BMS3h-56-5 Trp103 (Kabat Numbering, see below). BMS3h-56-5 Trp103 forms an edge-to-face interaction with CD40 Trp109 in one version, while forming a displaced stacking (i.e., face-to-face) interaction in other versions.
The shape complementarity statistic, Sc, for the seven versions ranges from 0.70-0.77, which shows a higher degree of shape complementarity than for typical antibody/antigen complexes. For example, these values compare to ranges of 0.71-0.76 for four protease/protein inhibitor complexes, 0.70-0.74 for five oligomeric interfaces, and 0.64-0.68 for six antibody/antigen complexes. See Lawrence et al., “Shape Complementarity at Protein/Protein Interfaces,” J. Mol. Biol. 234: 946-950 (1993).
A model of the human CD40/BMS3H-56-5 complex is shown in
As used herein, the term “in contact” refers to an interatomic distance whose maximum is determined by an atom type distance dependency as defined by Sheriff et al., J. Mol. Biol. 197: 273-296 (1987) and Sheriff, Immunomethods 3: 191-196 (1993).
As used herein, the term “buried” refers to a residue that has a least one atom with surface area defined by the program MS (Connolly, J. Appl. Crystallogr. 16: 548-558 (1983)), a probe sphere of 1.7 Å, and atom type dependent Van der Waals radii as defined by Sheriff, Immunomethods 3: 191-196 (1993).
BMS3h-56-5, like the other dAbs listed in TABLE 3, was prepared by a screening and affinity maturation method described in more detail below, using human CD40 as the antigen. It is expected that dAbs created by affinity maturation from a common precursor dAb will bind the same human CD40 epitope. Competition studies described below, for example, indicate that dAbs generated from a common precursor dAb by affinity maturation compete for binding with each other to human CD40. The same competition studies, however, show that the dAbs do not compete with at least the Chi220 or G28-5 antibodies.
3. Antibody Polypeptides
The antibody polypeptides comprise a variable domain. In one embodiment, the antibody polypeptides are in the form of a dAb that contains a single variable domain. Antibody polypeptides may be full-length anti-CD40 immunoglobulin molecules comprising two heavy (H) chains and two light (L) chains interconnected by disulfide bonds. In this embodiment, the amino terminal portion of each chain includes a variable domain (VL or VH) of about 100-110 amino acids primarily responsible for antigen recognition via the complementarity determining regions (CDRs) contained therein. The carboxy-terminal “half” of each heavy chain defines a constant region (Fc) primarily responsible for effector function.
Antibody polypeptides also may be “fragments” comprising a portion of the full-length anti-CD40 immunoglobulin molecule that comprises a variable domain that specifically binds CD40. Thus, the term “antibody polypeptides” includes an antigen-binding heavy chain, light chain, heavy chain-light chain dimer, Fab fragment, F(ab′)2 fragment, Fv fragment, single chain Fv (scFv), and dAb, for example. The term “antibody polypeptides” thus includes polypeptides made by recombinant engineering and expression, as well as monoclonal antibodies produced by natural recombination and secretion by hybridoma cell clones.
Light chains are classified as kappa (κ) or lambda (λ), and are characterized by a particular constant region, CL, as known in the art. Heavy chains are classified as γ, μ, α, δ, or ε, and define the isotype of an antibody as IgG, IgM, IgA, IgD, or IgE, respectively. The heavy chain constant region is comprised of three domains (CH1, CH2, and CH3) for IgG, IgD, and IgA; and four domains (CH1, CH2, CH3, and CH4) for IgM and IgE. Anti-CD40 antibodies may have a heavy chain constant region selected from any of the immunoglobulin classes (IgA, IgD, IgG, IgM, and IgE).
Each light chain variable domain (VL) and heavy chain variable domain (VH) is composed of three CDRs and four framework regions (FRs), arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The three CDRs of the light chain are referred to as “LCDR1, LCDR2, and LCDR3” and the three CDRs of the heavy chain are referred to as “HCDR1, HCDR2, and HCDR3.”
As used herein, the term “Fc domain” refers to the constant region antibody sequences comprising CH2 and CH3 constant domains as delimited according to Kabat et al., Sequences of Immunological Interest, 5th ed., U.S. Dept. Health & Human Services, Washington, D.C. (1991). The Fc region may be derived from an IgG1 or an IgG4 Fc region, for example. A variable domain may be fused to an Fc domain. In this case, the carboxyl terminus of the variable domain (either a VL or VH domain, including dAbs) may be linked or fused to the amino terminus of the Fc CH2 domain. Alternatively, the carboxyl terminus of the variable domain may be linked or fused to the amino terminus of a CH1 domain, which itself is fused to the Fc CH2 domain. The protein may comprise the hinge region between the CH1 and CH2 domains in whole or in part.
The CDRs contain most of the residues that form specific interactions with the antigen. As shown in
A “domain antibody” (dAb) comprises a single variable (VL or VH) domain that is capable of specifically and monovalently binding an antigen, such as CD40. For example, a dAb may have a VHH structure, characteristic of a camelid dAb. A “VH domain” as used herein is meant to include a VHH structure. In another embodiment, the VH domains of the present invention (including all features and combination of features presented as embodiments herein) are other than VHH domains, dAbs may form homo- or heterodimers in solution. Bivalent anti-CD40 antibodies are believed to exhibit agonist activity because of the ability to cross-link bound CD40 molecules on the cell surface. While not limited by any particular theory, it is believed that monovalent dAbs do not activate CD40, because the dAbs do not cross-link CD40.
As used herein, the term “variable domain” refers to immunoglobulin variable domains defined by Kabat et al., Sequences of Immunological Interest, 5th ed., U.S. Dept. Health & Human Services, Washington, D.C. (1991). The numbering and positioning of CDR amino acid residues within the variable domains is in accordance with the well-known Kabat numbering convention. For example, the Kabat numbering for BMS3h-56-5 (SEQ ID NO: 321) is compared in TABLE 2 to the same sequence numbered sequentially. In the Kabat numbering, BMS3h-56-5 has insertion residues 52A, 82A, 82B, 82C, and is missing residue 100. In both numbering systems, the Ser and Thr at the N-terminus that are part of the expression construct are given negative numbers.
The term “human,” when applied to antibody polypeptides, means that the antibody polypeptide has a sequence, e.g., FR and/or CH domains, derived from a human immunoglobulin. A sequence is “derived from” a human immunoglobulin coding sequence when the sequence is either: (a) isolated from a human individual or from a cell or cell line from a human individual; (b) isolated from a library of cloned human antibody gene sequences or of human antibody variable domain sequences; or (c) diversified by mutation and selection from one or more of the polypeptides above. An “isolated” compound as used herein means that the compound is removed from at least one component with which the compound is naturally associated with in nature.
Antibody polypeptides can be administered to human patients while largely avoiding the anti-antibody immune response often provoked by the administration of antibodies from other species, e.g., mouse. For example, murine antibodies can be “humanized” by grafting murine CDRs onto a human variable domain FR, according to procedures well known in the art. Human antibodies as disclosed herein, however, can be produced without the need for genetic manipulation of a murine antibody sequence.
Variable domains may comprise one or more framework regions (FR) with the same amino acid sequence as a corresponding framework region encoded by a human germline antibody gene segment. For example, a domain antibody may comprise the V11 germline gene segments DP47, DP45, or DP38, the Vκ germline gene segment DPK9, the JH segment JH4b, or the Jκ segment Jκ1.
Changes may be made to antibody polypeptide sequences while retaining the ability to bind CD40 specifically. Specifically, the antibody polypeptides (e.g., a dAb) may comprise a variant variable domain that retains the function of specifically binding the same CD40 epitope as the dAb BMS3h-56-5. See TABLE 1. That is, the variant variable domain may bind a human CD40 epitope comprising at least one of Trp109, Leu121, His122, Ser124, Ser156, Ala157, Phe158, Glu159, and His162 of SEQ ID NO: 1. In one embodiment, the variant variable domain epitope may comprise Trp109, Leu121, His122, Ser124, Ser156, Ala157, Phe158, Glu159, and His162. Alternatively, the variant variable domain may specifically bind a CD40 epitope comprising CD40 residue Trp109. In yet another embodiment, the variant variable domain may compete with BMS3h-56-5 for specific binding to CD40. Error-prone affinity maturation, as disclosed in the examples below, provides one exemplary method for making and identifying antibody polypeptides with variant sequences that specifically bind the same CD40 epitope.
For example, a variant variable domain may differ from one of the variable domains listed in TABLE 3 by up to 10 amino acids or any integral value between, where the variant variable domain specifically binds CD40. Alternatively, the variant variable domain may have at least 90% sequence identity (e.g., at least 92%, 95%, or 98% sequence identity) relative to a sequence listed in the present Sequence Listing. Non-identical amino acid residues or amino acids that differ between two sequences may represent amino acid substitutions, additions, or deletions. Residues that differ between two sequences appear as non-identical positions, when the two sequences are aligned by any appropriate amino acid sequence alignment algorithm, such as BLAST.
It is provided that amino acid substitutions may be made to individual FR regions, such that one or more FR comprises up to two amino acid differences relative to the amino acid sequence of the corresponding FR encoded by a human germline antibody gene segment. It is further provided that the variant variable domain may contain one or two amino acid substitutions in one or more CDR. Representative variable domains that specifically bind CD40 are listed in TABLE 3.
ClustalW2 alignments between representative variable domains of antibody polypeptides from lineages BMS3h-56, BMS3h-37, BMS3h-38, and BMS3h-198 are shown in
The information regarding the boundaries of the VL or VH domains of heavy and light chain genes may be used to design PCR primers to amplify the variable domain from a cloned heavy or light chain coding sequence encoding an antibody polypeptide known to bind CD40. The amplified variable domain may be inserted into a suitable expression vector, e.g., pHEN-1 (Hoogenboom et al. (1991) Nucleic Acids Res. 19:4133-4137) and expressed, either alone or as a fusion with another polypeptide sequence, using techniques well known in the art. Based on the disclosed amino acid and polynucleotide sequences, the fusion protein can be produced and purified using only ordinary skill in any suitable mammalian host cell line, such as CHO, 293, COS, NSO, and the like, followed by purification using one or a combination of methods, including protein A affinity chromatography, ion exchange, reverse phase techniques, or the like.
In one aspect, the antibody polypeptide is a “dual specific” antibody polypeptide comprising a first variable domain that specifically binds human CD40 comprising the amino acid sequence of SEQ ID NO: 1. Dual specific antibody polypeptides comprise a second variable domain that specifically binds a second antigen that is other than human CD40.
In another embodiment, the second antigen may be a cell surface molecule of an immune effector cell or a soluble molecule such as a cytokine, for example. Binding of the dual specificity antibody polypeptide could be used to antagonize CD40 and antagonize a biological activity of the second antigen. Cell surface molecules of immune effector cells include the cluster of differentiation (CD) molecules. Representative CD markers are listed on the Internet at hypertext transfer protocol en.wikipedia.org/wiki/List_of_human_clusters_of_differentiation (last modified on Feb. 22, 2012). Cell surface molecules of immune effector cells also include Major Histocompatibility Complex (MHC) Class II molecules. Antibodies against these cell surface molecules are known in the art and can be used a source of a variable domain to construct a dual specific antibody polypeptide.
In one embodiment, antibody polypeptides of a dual specific ligand may be linked by an “amino acid linker” or “linker.” For example, a dAb may be fused to the N-terminus of an amino acid linker, and another dAb may be fused to the C-terminus of the linker. Although amino acid linkers can be any length and consist of any combination of amino acids, the linker length may be relatively short (e.g., five or fewer amino acids) to reduce interactions between the linked domains. The amino acid composition of the linker also may be adjusted to reduce the number of amino acids with bulky side chains or amino acids likely to introduce secondary structure. Suitable amino acid linkers include, but are not limited to, those up to 3, 4, 5, 6, 7, 10, 15, 20, or 25 amino acids in length. Representative amino acid linker sequences include (GGGGS)n (SEQ ID NO: 4), where n may be any integer between 1 and 5. Other suitable linker sequences may be selected from the group consisting of AST (SEQ ID NO: 5), TVAAPS (SEQ ID NO: 6), TVA (SEQ ID NO: 7), and ASTSGPS (SEQ ID NO: 8).
The binding of the second antigen can increase the in vivo half-life of the antibody polypeptide. For example, the second variable domain of the dual specific antibody polypeptide may specifically bind serum albumin (SA), e.g., human serum albumin (HSA). The antibody polypeptide formatted to bind HSA can have an increased in vivo t-α (“alpha half-life”) or t-β (“beta half-life”) half-life relative to the same unformatted antibody polypeptide. The t-α and t-β half-lives measure how quickly a substance is distributed in and eliminated from the body. The linkage to HSA may be accomplished by fusion of the antibody polypeptide with a second variable domain capable of specifically binding HSA, for example. Anti-human serum albumin antibodies are well-known in the art. See, e.g., Abcam®, Human Serum Albumin antibodies ab10241, ab2406, and ab8940, available on the Internet at hypertext transfer protocol www.abcam.com/index.html, or GenWay, ALB antibody, available on the Internet at hypertext transfer protocol www.genwaybio.com. Variable domains that specifically bind HSA can be obtained from any of these antibodies, and then fused to an antibody polypeptide of the disclosure using recombinant techniques that are well known in the art.
Alternatively, the linking of the antibody polypeptide to HSA can be accomplished by directly fusing the antibody polypeptide sequence to an HSA coding sequence using techniques well known to the skilled artisan. The HSA coding sequences can be obtained by PCR using primers derived from the cDNA sequence available at GenBank Accession No. NM000477, for example.
In one embodiment, the tα-half-life of the HSA-linked domain antibody composition is increased by 10% or more. In another embodiment, the tα-half-life of the HSA-linked domain antibody composition is in the range of 0.25 hours to 6 hours. In another embodiment, the tβ-half-life of the HSA-linked domain antibody composition is increased by 10% or more. In another embodiment, the tβ-half-life of the HSA-linked domain antibody composition is in the range of 12 to 48 hours.
In another embodiment, an antibody polypeptide may be formatted to increase its in vivo half-life by PEGylation. In one embodiment, the PEG is covalently linked. In another embodiment, the PEG is linked to the antibody polypeptide at a cysteine or lysine residue. In yet another embodiment, the PEG-linked antibody polypeptide has a hydrodynamic size of at least 24 kD. In yet another embodiment, the total PEG size is from 20 to 60 kD, inclusive. In yet another embodiment, the PEG-linked domain antibody has a hydrodynamic size of at least 200 kD.
PEGylation can be achieved using several PEG attachment moieties including, but not limited to N-hydroxylsuccinimide active ester, succinimidyl propionate, maleimide, vinyl sulfone, or thiol. A PEG polymer can be linked to an antibody polypeptide at either a predetermined position, or can be randomly linked to the domain antibody molecule. PEGylation can also be mediated through a peptide linker attached to a domain antibody. That is, the PEG moiety can be attached to a peptide linker fused to an antibody polypeptide, where the linker provides the site (e.g., a free cysteine or lysine) for PEG attachment. Methods of PEGylating antibodies are well known in the art, as disclosed in Chapman, et al., “PEGylated antibodies and antibody fragments for improved therapy: a review,” Adv. Drug Deliv. Rev. 54(4):531-45 (2002), for example.
Antibody polypeptides also may be designed to form a dimer, trimer, tetramer, or other multimer. Antibody polypeptides, e.g., dAbs, can be linked to form a multimer by several methods known in the art, including, but not limited to, expression of monomers as a fusion protein, linkage of two or more monomers via a peptide linker between monomers, or by chemically joining monomers after translation, either to each other directly, or through a linker by disulfide bonds, or by linkage to a di-, tri- or multivalent linking moiety (e.g., a multi-arm PEG). In one embodiment, the multimer can bind a single molecule of CD40.
4. Pharmaceutical Compositions and Methods of Treatment
A pharmaceutical composition comprises a therapeutically-effective amount of one or more antibody polypeptides and optionally a pharmaceutically acceptable carrier. Pharmaceutically acceptable carriers include, for example, water, saline, phosphate buffered saline, dextrose, glycerol, ethanol and the like, as well as combinations thereof. Pharmaceutically acceptable carriers can further comprise minor amounts of auxiliary substances, such as wetting or emulsifying agents, preservatives, or buffers that enhance the shelf-life or effectiveness of the fusion protein. The compositions can be formulated to provide quick, sustained, or delayed release of the active ingredient(s) after administration. Suitable pharmaceutical compositions and processes for preparing them are well known in the art. See, e.g., Remington, T
The pharmaceutical composition further may comprise an immuno-suppressive/immunomodulatory and/or anti-inflammatory agent. A method of treating an immune disease in a patient in need of such treatment may comprise administering to the patient a therapeutically effective amount of the pharmaceutical composition. Antagonizing CD40-mediated T cell activation could inhibit undesired T cell responses occurring during autoimmunity, transplant rejection, or allergic responses, for example. Inhibiting CD40-mediated T cell activation could moderate the progression and/or severity of these diseases.
As used herein, a “patient” means an animal, e.g. mammal, including humans. The patient may be diagnosed with an immune disease. “Treatment” or “treat” or “treating” refers to the process involving alleviating the progression or severity of a symptom, disorder, condition, or disease. An “immune disease” refers to any disease associated with the development of an immune reaction in an individual, including a cellular and/or a humoral immune reaction. Examples of immune diseases include, but are not limited to, inflammation, allergy, autoimmune disease, or graft-related disease. The autoimmune disease may be selected from the group consisting of systemic lupus erythematosus, multiple sclerosis, rheumatoid arthritis, diabetes, psoriasis, scleroderma, atherosclerosis, inflammatory bowel disease, and ulcerative colitis.
Diseases that can be treated by administering the pharmaceutical composition may be selected from the group consisting of Addison's disease, allergies, ankylosing spondylitis, asthma, atherosclerosis, autoimmune diseases of the ear, autoimmune diseases of the eye, autoimmune hepatitis, autoimmune parotitis, colitis, coronary heart disease, Crohn's disease, diabetes, including Type 1 and/or Type 2 diabetes, epididymitis, glomerulonephritis, Graves' disease, Guillain-Barre syndrome, Hashimoto's disease, hemolytic anemia, idiopathic thrombocytopenic purpura, inflammatory bowel disease, immune response to recombinant drug products (e.g., Factor VII in hemophiliacs), systemic lupus erythematosus, male infertility, multiple sclerosis, myasthenia gravis, pemphigus, psoriasis, rheumatic fever, rheumatoid arthritis, sarcoidosis, scleroderma, Sjogren's syndrome, spondyloarthropathies, thyroiditis, transplant rejection, and vasculitis. Autoimmune-mediated conditions include, but are not limited to, conditions in which the tissue affected is the primary target, and in some cases, the secondary target. Such conditions include, but are not limited to, AIDS, atopic allergy, bronchial asthma, eczema, leprosy, schizophrenia, inherited depression, transplantation of tissues and organs, chronic fatigue syndrome, Alzheimer's disease, Parkinson's disease, myocardial infarction, stroke, autism, epilepsy, Arthus' phenomenon, anaphylaxis, alcohol addiction, and drug addiction.
The pharmaceutical composition may be administered alone or in combination therapy, (i.e., simultaneously or sequentially) with an immunosuppressive/immunomodulatory and/or anti-inflammatory agent. Different immune diseases can require use of specific auxiliary compounds useful for treating immune diseases, which can be determined on a patient-to-patient basis. For example, the pharmaceutical composition may be administered in combination with one or more suitable adjuvants, e.g., cytokines (IL-10 and IL-13, for example) or other immune stimulators, e.g., chemokines, tumor-associated antigens, and peptides. Suitable adjuvants are known in the art.
Any suitable method or route can be used to administer the antibody polypeptide or the pharmaceutical composition. Routes of administration include, for example, oral, intravenous, intraperitoneal, subcutaneous, or intramuscular administration. A therapeutically effective dose of administered antibody polypeptide(s) depends on numerous factors, including, for example, the type and severity of the immune disease being treated, the use of combination therapy, the route of administration of the antibody polypeptide(s) or pharmaceutical composition, and the weight of the patient. A non-limiting range for a therapeutically effective amount of a domain antibody is 0.1-20 mg/kg, and in an aspect, 1-10 mg/kg, relative to the body weight of the patient. The dose of antibody polypeptide(s) can be further guided by the amount of antibody polypeptide(s) required for CD40 antagonism in in vitro and/or in vivo models of disease states. Representative models are described below and in the examples.
5. In Vitro and In Vivo Models
The ability of antibody polypeptides of the disclosure to antagonize CD40 can be tested in one of several available in vitro or in vivo model systems. Appropriate animal and cell model systems are described below. Further cell assay systems are described in the examples.
5.1. Inflammatory Bowel Disease (IBD) Models:
IBD is a multifactorial immune disorder of uncertain etiology. Several mouse models of mucosal inflammation that resemble IBD have provided insight into the mechanisms governing both normal and pathological mucosal immune function. IBD models include using the mucosal immunity and inflammation system of De Winter et al., Am. J. Physiol. 276: G1317-1321 (1999). In one aspect, the injection into immunodeficient mice of a subset of CD4(+) T lymphocytes, the CD4(+)CD45RBhigh cells, leads to inflammation of the intestine. Pathogenesis is due in part to the secretion of proinflammatory cytokines. The induction of colitis can be prevented by co-transfer of another CD4(+) subpopulation, the CD4(+)CD45RBlow T cells. This population behaves analogously to the CD4(+)CD45RBhigh population in terms of the acquisition of activation markers and homing to the host intestine. However, their lymphokine profile when activated is different, and anti-inflammatory cytokines secreted and/or induced by CD4(+)CD45RBlow T cells prevent colitis. De Winter et al. provide a description of the adoptive transfer model and the factors that promote and prevent colitis pathogenesis.
5.2. Spontaneous Arthritis Models:
A model of organ-specific disease provoked by systemic autoimmunity is provided by Kouskoff et al., Cell 87: 811-822 (1996). Rheumatoid arthritis (RA) is a chronic joint disease characterized by leukocyte invasion and synoviocyte activation followed by cartilage and bone destruction. Kouskoff et al. disclose a spontaneous mouse model of RA, generated by crossing a T cell receptor (TCR) transgenic line with the NOD strain. All offspring develop a joint disease highly reminiscent of RA in man. The trigger for the murine disorder is chance recognition of a NOD-derived major histocompatibility complex (MHC) class II molecule by the transgenic TCR; progression to arthritis involves CD4+T, B, and probably myeloid cells.
5.3. Collagen Induced Arthritis (CIA) Model:
A mouse model of collagen-induced arthritis is provided by Brand et al., Methods Mol. Med. 102: 295-312 (2004). Collagen-induced arthritis (CIA) is an autoimmune disease that can be elicited in susceptible strains of rodents (rat and mouse) and non-human primates by immunization with type II collagen (CII), the major constituent protein of articular cartilage. After immunization, the animals develop an autoimmune polyarthritis that shares several clinical and histological features with RA. Susceptibility to CIA in rodents is linked to the class II molecules of the major histocompatibility complex (MHC), and the immune response to CII is characterized by both the stimulation of collagen-specific T cells and the production of high titers of antibody specific for both the immunogen (heterologous CII) and the autoantigen (mouse CII). Histologically, murine CIA is characterized by an intense synovitis that corresponds with the clinical onset of arthritis. This experimental data is useful evaluating CIA because of the pathological similarities between CIA and RA.
5.4. Antigen Induced T Cell Proliferation In Vivo Model:
The use of adoptive transfer of T cell receptor (TCR)-transgenic T cells provides an in vivo model for antigen-induced T-cell proliferation. Pape et al., Immunol. Rev. 156: 67-78 (1997) discloses adoptive transfer of TCR-transgenic T cells uniformly expressing an identifiable TCR of a known peptide/MHC specificity. The model can be used to monitor the in vivo behavior of antigen-specific T cells. Naive T cells are initially activated within T-cell zones of secondary lymphoid tissue to proliferate in a B7-dependent manner. If adjuvants or inflammatory cytokines are present during this period, enhanced numbers of T cells accumulate, migrate into B-cell-rich follicles, and acquire the capacity to produce IFN-γ and help B cells produce IgG2a. If inflammation is effectively antagonized, most of the initially activated antigen-specific T cells disappear without entering the follicles, and the survivors are poor producers of IL-2 and IFN-γ.
TABLE 3 lists representative anti-human CD40 variable domain amino acid sequences useful for the antibody polypeptides of the disclosure. TABLE 4 discloses representative nucleic acids that encode the variable domain sequences listed in TABLE 3. As is well known in the art, multiple codons can encode the same amino acid. Nucleic acids encoding a protein sequence thus include nucleic acids having codon degeneracy. The antibody polypeptides disclosed in TABLE 3 specifically bind CD40 and were made using the reiterative initial/primary screening and affinity maturation methodologies described in the examples that follow.
The following example describes the generation of a series of anti-human CD40 variable domains, designated BMS3h-1 through BMS3h-225. Following recombinant expression of a repertoire of single immunoglobulin variable domains on the surface of phage, selection is performed by contacting the phage repertoire with immobilized target antigen, washing to remove unbound phage, and propagating the bound phage. This process frequently referred to as “panning.” It is applicable to the screening of single immunoglobulin variable domains, as well as other antibody fragments that can be expressed on a display library, e.g., scFv, Fab, and Fab′. Alternatively, phage may be pre-selected for the expression of properly folded member variants by panning against an immobilized generic ligand (e.g., protein A or protein L) that is only bound by folded members. This has the advantage of reducing the proportion of non-functional members, thereby increasing the proportion of members likely to bind a target antigen. Pre-selection with generic ligands is taught in WO 99/20749, for example. The screening of phage antibody libraries is generally described, for example, by Harrison et al., Meth. Enzymol. 267: 83-109 (1996).
Screening is commonly performed using purified antigen immobilized on a solid support, for example, plastic tubes or wells, or on a chromatography matrix, for example Sepharose™ (Pharmacia). Screening or selection can also be performed on complex antigens, such as the surface of cells (Marks et al., BioTechnology 11: 1145 (1993); de Kruif et al., Proc. Natl. Acad. Sci. USA 92: 3938 (1995)). Another alternative involves selection by binding biotinylated antigen in solution, followed by capture on streptavidin-coated beads.
Clones BMS3h-1 to BMS3h-69:
Three rounds of selections using decreasing concentrations of antigen (100 nM at round 1; 10 nM at round 2; 1 nM at round 3) were performed in parallel against both biotinylated human CD40 monomer (supplied by BMS, 1.5 moles biotin/mole CD40) and biotinylated human CD40-Ig (supplied by BMS, 3.3 moles biotin/mole CD40-Ig). Phage from the naïve 4G and 6G Domantis dAb libraries were combined as follows before initiating selections:
1) 4G+6G VH CDR3 lengths between 7-9 amino acids.
2) 4G+6G VH CDR3 lengths between 10-12 amino acids.
3) 4G+6G VH CDR3 lengths between 13-15 amino acids.
4) 4G VK
5) 6G VK
Each round of selection involved adding the desired concentration of antigen to a mixture of 750 μl of phage from one of the nave library pools or subsequent selection output phage and 750 μl of PBS+2% Marvel (Phosphate Buffered Saline containing 2% (w/v) Marvel [Premier Foods, UK]) and incubating at room temperature for 1 hour by mixing end-over-end. The biotinylated antigen phage complex was then captured by adding 100 μl of resuspended Dynabeads® M-280 Streptavidin [Invitrogen, UK] and incubated for 5 minutes with mixing end-over-end at room temperature. The Dynabeads® were then recovered using a KingFisher™ magnetic separator [Thermo Fisher Scientific, UK] and washed 7×1 ml PBS+0.1% Tween 20 (PBS containing 0.1% (v/v) polyoxyethylenesorbitan monolaurate [Sigma-Aldrich, UK], PBST) followed by 1×1 ml PBS. Bound phage retained on the washed Dynabeads® were eluted by incubation with 500 μl of trypsin-PBS (50 μl of 10 mg/ml trypsin [Sigma-Aldrich, UK] dissolved in 50 mM Tris-HCl pH 7.4, 1 mM CaCl2 added to 450 μl PBS). The phage-containing solution was recovered and 250 μl used to infect 1.75 ml of logarithmic growth phase E. coli TG1 (at an OD600 of 0.4) for 30 minutes at 37° C. The E. coli TG1 phage infected culture was centrifuged at 11,600 g in a micro centrifuge for 1 minute. The resulting cell pellet was resuspended in 1 ml 2×TY (16 g Tryptone, 10 g Yeast Extract and 5 g NaCl in 1 liter, autoclaved for 15 minutes at 121° C.) and plated onto a 9 cm Petri dish containing TY supplemented with 15 μg/ml tetracycline. The plates were incubated overnight at 37° C. Then 2 ml of 2×TY supplemented with 15% glycerol was added to each plate, and the cells were loosened with a glass spreader and mixed thoroughly. Fifty microliters of the scraped bacteria were used to inoculate 50 ml of 2×TY supplemented with 15 μg/ml tetracycline and grown overnight at 37° C. with shaking at 250 rpm. The overnight culture was centrifuged at 3,300 g for 15 min to pellet the bacteria. To precipitate phage, 10 ml PEG/NaCl (20% Polyethylene glycol 8000, 2.5 M NaCl) was added to 40 ml supernatant. The phage/PEG solution was mixed and left on ice for 1 h, then spun at 3,300 g for 30 min at 4° C., and the supernatant discarded. The pellet was resuspended in 2 ml PBS and spun at 11,600 g for 10 min in a micro centrifuge to remove the remaining bacterial debris. The resultant supernatant containing phage was then used for the next round of selection against the appropriate biotinylated CD40 antigen.
Monoclonal phage ELISAs were carried out following selection rounds 2 and 3. All washes were performed using 3 washes of 250 μl PBST followed by 3 washes of 250 μl PBS. The plates were coated overnight at 4° C. with 50 μl/well of 1 μg/ml NeutrAvidin (Thermo Scientific, UK) in 0.2 M carbonate-bicarbonate buffer, pH 9.4. The plates were washed and then blocked with 2% MPBS (2% w/v Marvel skimmed milk powder [Premier Foods] in PBS) for 1 hour at room temperature. The plates were then washed and incubated with 50 μl/well of 0.7 biotinylated human CD40 in 2% MPBS. The plates were washed, and phage supernatants were added to an equal volume of 2% MPBS. The plates were then incubated for 1 hour at room temperature. The plates were washed and bound phage detected with anti-M13-HRP conjugate (GE Healthcare, UK) diluted 1:5000 in 2% MPBS and incubated for 1 hour at room temperature. The plates were washed, and the ELISA was developed using SureBlue™ 1-Component TMB MicroWell Peroxidase solution (KPL Inc, USA). Specific phage were identified by comparison to plates coated with NeutrAvidin but without biotinylated CD40. A MidiPrep was used to isolate dAb V-genes from pDOM4 (Domantis) round 2 and round 3 outputs and cloned into pDOM5 (Domantis). pDOM4, disclosed in WO 2007/085815, is a derivative of the Fd phage vector in which the gene III signal peptide sequence is replaced with the yeast glycolipid anchored surface protein (GAS) signal peptide (WO 2005/093074). pDOM4 also contains a c-myc tag between the leader sequence and gene III, which puts the gene III back in frame.
Binding dAbs were identified as follows. Ninety-six individual colonies (in pDOM5) were picked from each output into 200 μL Terrific Broth containing OnEx Autoinduction media (Novagen, UK) overnight at 37° C. with shaking at 250 rpm in Costar™ 96 Well Cell Culture Clusters (Corning Incorporated, USA). The cultures were centrifuged to pellet the cells, and the supernatants were assayed by antigen binding ELISA for CD40 binding dAbs. MaxiSorp™ 96 well immunoplates (Nunc, USA) were coated overnight at 4° C. with 50 μl/well of 1 μg/ml NeutrAvidin in 0.2 M carbonate-bicarbonate buffer, pH 9.4. All washes were as described for the phage ELISA. The plates were blocked for 1 hour at room temperature with 200 μl of PBS containing 1% Tween 20. The plate was then washed and incubated with 50 μl/well of 0.7 μg/ml biotinylated human CD40 in 0.1% PBST. The clarified dAb-containing culture supernatant was added to the ELISA plate with an equal volume of 0.1% PBST. The plates were incubated for 1 hour at room temperature and then washed. Bound dAb was detected using a two step process: firstly 9E10 (anti-myc IgG, Sigma-Aldrich, UK) diluted 1:2000 in 0.1% PBST was added for 1 hour at room temperature then washed, followed by anti-mouse Fc-HRP (Sigma-Aldrich, UK) diluted 1:2000 in 0.1% PBST for 1 hour at room temperature. The plates were washed, and the ELISA was developed using SureBlue® 1-Component TMB MicroWell Peroxidase solution (KPL Inc, USA). The color was allowed to develop, and the colorimetric reaction was stopped by the addition of an equal volume of 1 M HCl. The ELISA plate was read at 450 nm. Specific phage were identified by comparison to plates coated with NeutrAvidin but without biotinylated CD40.
Clones specific for CD40 were tested in either the bead- or ELISA-based receptor-binding assay (RBA) to assess for inhibition of CD40 ligand binding. Domain antibodies that showed inhibition in the RBA were tested in the B-cell proliferation assay and then in a variety of other in vitro cell assays. These assays are described in greater detail below.
BMS3h-106 to -225:
BMS3h-106 to -225 were isolated from selections against biotinylated CD40 or biotinylated CD40-Fc as described for BMS3h-1 to BMS3h-69, but with the following modifications. Phage from the naïve 4G and 6G libraries were combined as follows before initiating selections:
6) 4G VH CDR3 lengths between 7-9 amino acids.
7) 4G VH CDR3 lengths between 10-12 amino acids.
8) 4G VH CDR3 lengths between 13-15 amino acids.
9) 6G VH CDR3 lengths between 7-9 amino acids.
10) 6G VH CDR3 lengths between 10-12 amino acids.
11) 6G VH CDR3 lengths between 13-15 amino acids.
12) 4G VK
13) 6G VK
Round one was performed at an antigen concentration of 160 nM for CD40-Fc and 100 nM for CD40. Output titres were in the range 2.0×104 to 9.0×107 TU/ml (functional viral titre).
For round two, enriched phage from round one were combined in pairs before using in selections:
1) 4G+6G VH CDR3 lengths between 7-9 amino acids (pools 1+4 from round 1).
2) 4G+6G VH CDR3 lengths between 10-12 amino acids (pools 2+5 from round 1).
3) 4G+6G VH CDR3 lengths between 13-15 amino acids (pools 3+6 from round 1).
4) 4G+6G VK (pools 7+8 from round 1)
Selections were performed at an antigen concentration of 100 nM, and the antigen-phage complexes were captured using M-280 tosyl-activated Dynabeads® (Invitrogen) that had been coupled with NeutrAvidin (Thermo Fisher Scientific, UK). Output titres were in the range 6.5×107 to 7.5×108 TU/ml.
Round three was performed at an antigen concentration of 20 nM and, in the case of the CD40-Fc selections, in the presence of 6.7 μM free human Fc tail (BMS). Output titres were in the range 4.3×107 to 1.6×109 TU/ml.
Round four was performed as described for round two but at an antigen concentration of 2 nM and in the presence and absence of 500-fold excess unlabelled CD40-Fc. The addition of this competitor was made after the initial one hour incubation of the phage with the biotinylated antigen, and the mixture was then incubated overnight, as before. This competition step was included with the aim of enhancing selection of dAbs with a slower off-rate. Output titres were in the range 1.8×107 to 4.4×107 without competition and 1.8×106 to 2.3×107 TU/ml with competition.
To monitor the progress of the selections, monoclonal phage ELISAs were carried out following rounds 2 and 3. These were performed as described for BMS3h-1 to BMS3h-69. Binding dAbs were identified as described for BMS3h-1 to BMS3h-69 except that, in the case of the VK library screening, protein L was included at a final concentration of 0.8 μg/ml. Addition of protein L increased the signal strength by cross-linking the dAbs.
BMS3h-70 to -105:
BMS3h-70 to -105 were isolated from selections against antigen that had been passively adsorbed to immunotubes. Phage from the naïve 4G and 6G Domantis dAb libraries were combined as follows before initiating selections:
1) 4G VH CDR3 lengths between 7-9 amino acids.
2) 4G VH CDR3 lengths between 10-12 amino acids.
3) 4G VH CDR3 lengths between 13-15 amino acids.
4) 6G VH CDR3 lengths between 7-9 amino acids.
5) 6G VH CDR3 lengths between 10-12 amino acids.
6) 6G VH CDR3 lengths between 13-15 amino acids.
7) 4G VK
8) 6G VK
For the first round of selection, 1 ml of 10 μg/ml human CD40-Fc fusion (BMS) in 0.2 M carbonate-bicarbonate buffer, pH 9.4, was added to a Nuns MaxiSorp™ immunotube and then incubated overnight at 4° C. with rolling. The tube was then emptied and washed three times with phosphate buffered saline (PBS). The tube was then blocked by filling to the brim with MPBS and incubating for 1 h at room temperature. The tube was then emptied and washed three times with PBS. Library phage in 4 ml MPBS Were added to the tube and incubated for 1 hour with rotation end-over-end at room temperature.
The tube was emptied and washed 10 times with PBST (PBS with 0.1% (v/v) Tween 20). Bound phage retained on the washed tube were eluted by incubation with 500 μl of trypsin-PBS (50 μl of 10 mg/ml trypsin [Sigma-Aldrich, UK] dissolved in 50 mM Tris-HCl pH 7.4, 1 mM CaCl2 added to 450 μl PBS) with rotation end-over-end for 10 min at room temperature. The phage-containing solution was recovered, and 250 μl were used to infect 1.75 ml of logarithmic growth phase E. coli TG1 (at an OD600 of 0.4) for 30 minutes at 37° C. The E. coli TG1 phage infected culture was centrifuged at 11,600 g in a microcentrifuge for 1 min, and the resulting cell pellet was re-suspended in 1 ml 2×TY (16 g Tryptone, 10 g Yeast Extract, and 5 g NaCl in 1 liter. The suspension was autoclaved for 15 minutes at 121° C.) and plated onto a 9 cm Petri dish containing LB agar supplemented with 15 μg/ml tetracycline. The plates were incubated overnight at 37° C. Two milliliters of 2×TY supplemented with 15% glycerol was then added to each plate, and the cells were loosened with a glass spreader and mixed thoroughly.
Fifty microliters of the scraped bacteria were used to inoculate 50 ml of 2×TY supplemented with 15 μg/ml tetracycline and grown overnight at 37° C. with shaking at 250 rpm. The overnight culture was centrifuged at 3,300 g for 15 min to pellet the bacteria. To precipitate phage, 10 ml PEG/NaCl (20% Polyethylene glycol 8000, 2.5 M NaCl) was added to 40 ml supernatant. The phage/PEG solution was mixed and left on ice for 1 h. The solution was then spun at 3,300 g for 30 min at 4° C., and the supernatant was discarded. The pellet was re-suspended in 2 ml PBS and spun at 11,600 g for 10 min in a micro centrifuge to remove the remaining bacterial debris. The resultant supernatant containing phage was then used for the next round of selection against CD40-Fc antigen. Output titres from round one were in the range 7.5×104 to 1.5×107 TU/ml (transforming units per ml).
A second round of selection was performed using enriched phage recovered from the first round of selection. This was performed exactly as described above and the output titres were in the range 2.5×107 to 1.2×108 TU/ml.
A third round of selection was performed using enriched phage recovered from the second round of selection. These were performed as described above but with an antigen concentration of 1 μg/ml. Output titres were in the range 5.1×107 to 7.5×108 TU/ml.
To monitor the progress of the selections, monoclonal phage ELISAs were carried out following rounds 2 and 3. A sample of individual colonies were picked into 200 μl. 2×TY supplemented with 15 μg/ml tetracycline and incubated overnight at 37° C. with shaking at 250 rpm in Costar® 96 Well Cell Culture Clusters (Corning Incorporated, USA). The cultures were centrifuged to pellet the cells, and the supernatants were assayed by antigen binding ELISA for CD40-binding phage dAbs. All washes were performed using 3 washes of 250 μl PBST followed by 3 washes of 250 μl PBS MaxiSorp™ 96 well immunoplates (Nunc, USA) were coated overnight at 4° C. with 50 μl/well of 0.5 μg/ml CD40-Fc (BMS) in 0.2 M carbonate-bicarbonate buffer, pH 9.4. The plates were washed and then blocked with 250 μl of 2% MPBS for 1 hour at room temperature. The plates were washed, and phage supernatants were added to an equal volume of 2% MPBS and incubated for 1 hour at room temperature. The plates were washed, and bound phage were detected with anti-M13-HRP conjugate (GE Healthcare, UK) diluted 1:5000 in 2% MPBS and incubated for 1 hour at room temperature. The plates were washed, and the ELISA was developed using SureBlue™ 1-Component TMB Micro ell Peroxidase solution (KPL Inc, USA). Specific phage dAbs were identified by comparison to plates coated with free Fc.
The dAb genes from each of the above rounds two and three selection outputs were sub-cloned, as a pool, into soluble expression vector pDOM5 in E. coli strain HB2151. This vector allowed expression of free dAb with a c-myc tag (Roche Diagnostics GmbH) in E. coli and secretion to the supernatant.
CD40-binding dAbs from passive selections were identified as follows. Ninety-six individual colonies (in pDOM5) were picked from each output into 200 μL Terrific Broth containing OnEx Autoinduction media (Novagen, UK) overnight at 37° C. with shaking at 250 rpm in Costar® 96 Well Cell Culture Clusters (Corning incorporated, USA). The cultures were centrifuged to pellet the cells, and the supernatants were assayed by antigen binding ELISA for CD40 binding dAbs. MaxiSorp™ 96 well immunoplates (Nunc, USA) were coated overnight at 4° C. with 50 μl/well of 0.5 μg/ml CD40-Fc (BMS) in 0.2 M carbonate-bicarbonate buffer, pH 9.4. All washes were as described for the phage ELISA. The plates were blocked for 1 hour at room temperature with 250 μl of PBS containing 1% Tween 20 (PBST). The clarified dAb-containing culture supernatant was added to the ELISA plate with an equal volume of 0.1% PBST. The plates were incubated for 1 hour at room temperature and then washed. Bound dAb was detected using a two step process: firstly biotinylated 9E10 (anti-myc IgG, Sigma-Aldrich, UK) diluted 1:2000 in 0.1% PBST was added for 1 hour at room temperature then washed, followed by streptavidin-HRP (Bender MedSystems, Austria) diluted 1:5000 in 0.1% PBST for 1 hour at room temperature. The plates were washed and the ELISA developed using SureBlue™ 1-Component TMB. Specific dAbs were identified by comparison to plates coated with free Fc.
Clones specific for CD40 were tested in either the bead- or ELISA-based receptor-binding assay (RBA) to assess for inhibition of CD40 ligand binding. The potency measurements obtained from the RBA are given in Table 5 (Primary Screening effort). Domain antibodies that showed inhibition in the RBA were tested in the B-cell proliferation assay and then in a variety of other in vitro cell assays.
BMS3h-210 to -225
BMS3h-210 to -225 were isolated from selections against whole cells. Phage from the naïve 4G and 6G Domantis dAb libraries were combined as follows before initiating selections:
1) 4G+6G VH CDR3 lengths between 7-9 amino acids.
2) 4G+6G VH CDR3 lengths between 10-12 amino acids.
3) 4G+6G VH CDR3 lengths between 13-15 amino acids.
4) 4G and 6G VK
For round one a DG44 CHO cell line stably transfected with cell-surface expressed human CD40 (supplied by BMS) was used as antigen. Prior to selection against these cells, the library pools outlined above were incubated with non-transfected CHO cells to deplete them of phage displaying dAbs specific for cell surface antigens other than CD40. Both types of cells were harvested by incubation with Versene (Invitrogen) before assessing for viability. Six million viable non-transfected CHO cells were re-suspended in 4 ml PBS with 2% (w/v) BSA (PBS/BSA) and rotated end-over-end at 4° C. for 1 hour to block. All subsequent steps were performed at 4° C. unless otherwise noted. The cells were centrifuged at 185 g for 5 min and the supernatant, containing the depleted library phage, transferred to a fresh tube. To this were added 6×106 viable CHO-CD40 cells in 1 ml PBS/BSA and the mixture was rotated for 1 hour. The cells were then washed five times by centrifuging at 185 g for 5 min and re-suspending in 10 ml PBS/BSA. After the final wash, the cells were pelleted as previously and were then re-suspended in 0.5 ml of 1 mg/ml trypsin type XIII from bovine pancreas (Sigma Aldrich, UK) in PBS supplemented with 5 mM Tris-HCl pH 7.4, 0.1 mM CaCl2 and transferred to a microcentrifuge tube. The cells were rotated at room temperature for 10 min before centrifuging at 16000 g for 5 min. Eluted phage in the supernatant were used to infect E. coli and the output phage titres were determined to be between 5.1×103 and 2.7×106 TU/ml (transforming units per ml).
A second round of selection was performed using enriched phage recovered from the first round of selection. These were performed as above but without the initial depletion (de-selection) step and using RAMOS human B cells (ATCC) instead of CHO-CD40. Output titres were in the range 2.3×105 to 7.5×103 TU/ml.
A third round of selection was performed as for the second round. Output titres were in the range 1.9×108 to 3.5×108 TU/ml.
The dAb genes from each of the above rounds two and three selection outputs were sub-cloned, as a pool, into soluble expression vector pDOM5 in E. coli strain HB2151. This vector allowed expression of free dAb with a c-myc tag in E. coli and secretion to the supernatant.
Clones specific for CD40 were tested in either the CHO cell receptor-binding assay (RBA) to assess for inhibition of CD40 ligand binding. Domain antibodies that showed inhibition in the RBA were tested in the B-cell proliferation assay and then in a variety of other in vitro cell assays.
Affinity Maturation by Error-Prone PCR
Error-prone phage libraries were constructed for 13 BMS3h dAbs that showed neutralization activity in the B-cell proliferation assay described below in Example 6 (See TABLE 17). This was performed by using Mutazyme II polymerase (part of the GeneMorph II kit from Agilent Technologies) to randomly introduce errors into the dAb gene during amplification by polymerase chain reaction (PCR). The mutated dAb genes were cloned as a genetic fusion with the fd phage gene III protein under the control of the GAS 1 leader sequence in pDOM4 vector, which contained all the fd genes necessary to generate infective phage particles. These libraries were approximately 1×108 CFU (colony forming units) in size, with an error-rate of 2-5 amino acids per dAb gene.
Phage generated from these libraries were subjected to three rounds of selection against soluble biotinylated human CD40. The first round of phage selection was performed by premixing the phage library with 2% MPBS (phosphate buffered saline supplemented with 2% (w/v) Marvel dried skimmed milk powder) and adding biotinylated human CD40 (BMS) to a final concentration of 20 nM in a final volume of 1 ml. The mixture was incubated for at least one hour at room temperature with mixing end-over-end. The antigen-phage complexes were then captured using 50 μl of M-280 streptavidin Dynabeads® (Invitrogen) and washed 7 times with 1 ml PBST followed by a single wash in 1 ml PBS. The washed phage were eluted from the antigen/bead complex by incubating with 0.5 ml of 1 mg/ml trypsin type XIII from bovine pancreas (Sigma Aldrich, UK) in PBS supplemented with 5 mM Tris-HCl pH 7.4, 0.1 mM CaCl2. Eluted phage were used to infect E. coli and the output phage titres were determined to be between 2×105 and 9×107 TU/ml (transforming units per ml).
A second round of selection was performed using enriched phage recovered from the first round of selection, with a final concentration of 2 nM biotinylated CD40 followed by capture using streptavidin beads as described above. Output titres were in the range 3×104 to 5×106 TU/ml.
A third round of selection using 2 nM biotinylated CD40 followed by capture using streptavidin beads was performed. The eluted phage titres were in the range 8×104 to 4×106 TU/ml.
BIAcore™ Screening
The dAb genes from each of the above round three selection outputs were sub-dozed, as a pool, into soluble expression vector pDOM13 (Domantis) in E. coli HB2151. The pDOM13 vector is also known as pDOM33 and is disclosed in WO/2008/149143. This vector allowed expression of free dAb in E. coli and secretion to the supernatant. Forty-seven individual colonies were picked from each of the outputs and expressed in 200 μl Terrific Broth (TB) containing Novagen Overnight Express Autoinduction media (Merck Chemicals, UK) overnight at 37° C. with shaking at 250 rpm in Costar® 96 Well Cell Culture Clusters (Corning Incorporated, USA). In the same plate, a single well was inoculated with E. coli expressing the appropriate parental (wild-type) dAb. The cultures were centrifuged to pellet the cells and the supernatants screened on a BIAcore™ 3000 instrument (GE Healthcare) for improvements in “off-rate” (i.e. dissociation rate constant, kd) compared to parental dAb.
Approximately 1600 response units (RU) of biotinylated human CD40 (BMS) were immobilized on one flow-cell of a streptavidin (SA) BIAcore™ chip. A second flow cell without any ligand immobilized served as a reference flow-cell for inline referencing. Each dAb supernatant to be analyzed was diluted 1:3 in HBS-EP buffer (0.01 M HEPES pH 7.4 with 0.15 M NaCl, 3 mM EDTA and 0.005% v/v Surfactant P20, GE Healthcare). Ten microliters of each dAb supernatant were injected, using the instrument's KINJECT function, across the CD40-immobilized and reference flow-cells in series, with inline subtraction of the signal from the reference cell. The experiment was performed at 25° C. and with a flow rate of 10 μl/min of HBS-EP. After each injection had been completed, the dAb was allowed to dissociate from the ligand in buffer for 120 s before regeneration with a 5 μl injection of 10 mM glycine pH 2.0. BIAevaluation 4.1 software (GE Healthcare) was used to subtract the reference flow-cell trace from each analyte trace. The same software was used to perform an approximate fit of a 1:1 (Langmuir) kinetic model to the dissociation phase of the analyte traces. This model yielded approximate dissociation rate constants (“off-rate” or kd) for each clone and allowed relative comparisons to be made with the wild type dAb.
Clones with improved off-rates were identified for all lineages except BMS3h-129 and -197. Clones with improved off-rates were tested in either the bead- or ELISA-based receptor-binding assay (RBA) to assess for improved potency as described above. The potency measurements obtained from the RBA are given in the Tables labeled “Error-Prone-Matured Clones.” Clones that were more potent in the RBA were subsequently tested in a B-cell proliferation assay to assess for enhanced biological potency and these measurements obtained are given in TABLE 17. Domain antibodies that had improved potency in the B-cell proliferation assay were also tested in a variety of other in vitro cell assays.
Affinity Maturation by Triplet Scanning Diversification
Five improved-potency dAbs isolated from the error-prone maturation, BMS3h-37-2, -38-2, -56-2, -193-25 and -217-23, were chosen to be further affinity matured by triplet scanning diversification. Phage libraries were constructed based on these parents as described above for the error-prone libraries except that, instead of using error-prone PCR, a series of overlapping degenerate triplet oligonucleotides were used to diversify the complementarity determining (CDR) regions of each dAb. For each dAb to be affinity matured, oligonucleotides containing NNS codon triplets (see Arkin et al. (1992) Proc. Nat'l Acad. Sci. USA 89:7811-7815) were used to make a number of libraries for each CDR by slicing by overlap extension (SOE) PCR. The triplets diversified by the oligonucleotides for a given CDR overlapped by two codons, resulting in two to four libraries per CDR. The amino acid residues diversified in the BMS3h-37-2 libraries were at positions 30, 31, 32, 33, 35, 50, 52, 53, 55, 56, 95, 96, 97, and 98 (Kabat numbering). The residues diversified in the BMS3h-38-2 libraries were as for 37-2, but with the addition of position 100. The residues diversified in the BMS3h-56-2 libraries were as for 37-2, but with the addition of positions 100 and 101. The residues diversified in the BMS3h-193-25 and -217-23 libraries were at positions 27, 28, 30, 31, 32, 34, 49, 50, 51, 53, 89, 91, 92, 93, 94, and 96.
Phage generated from these libraries were pooled by CDR and selections performed as described above, except that, for BMS3h-37-2, -38-2, -56-2 and -193-25, the concentrations of antigen used were 10, 1 and 0.1 nM for rounds one, two and three, respectively. For BMS3h-217-23 the concentrations of antigen used were 20, 2 and 0.2 nM for rounds one, two and three, respectively. For BMS3h-193-25, which is cross-reactive for cynomolgus CD40, selections were also performed against cyno CD40 in parallel. Additionally, selection rounds two and three were performed in the presence and absence of 100- or 1000-fold excess unlabelled CD40, respectively. The addition of this competitor was made after the initial one hour incubation of the phage with the biotinylated antigen and the mixture was then incubated, as before, for a further hour. This competition step was included with the aim of enhancing selection of dAbs with a slower off-rate. Round one titres were in the range 1.4×106 to 1.4×109. Titres in round 2 were 1.3×105 to 4.0×108 without competition and 8.6×104 to 1.3×108 with competition. Titres in round 3 were 1.2×105 to 1.9×108 without competition and 6.0×105 to 1.2×108 with competition.
These selection outputs were sub-cloned and screened as described for the error-prone affinity maturation. Clones with improved off-rates were identified for all lineages except BMS3h-193-25. Clones with improved off-rates were tested in the ELISA receptor-binding assay (RBA) to assess for improved potency. The potency measurements obtained from the RBA are given in the Tables labeled “Further-Matured Clones.” Clones that were more potent in the RBA were subsequently tested in a B-cell proliferation assay to assess for enhanced biological potency and these measurements obtained are given in TABLE 17. Domain antibodies that had improved potency in the B-cell proliferation assay were also tested in a variety of other in vitro cell assays.
Several in vitro receptor binding assays (RBA) were used to determined CD40 affinity of the anti-human CD40 variable domain amino acid sequences generated in Example 1. Three RBA formats were used: (1) a bead RBA, (2) an ELISA RBA, and (3) a CHO cell RBA.
Bead RBA:
Phosphate buffered saline (PBS) washed Sphero streptavidin polystyrene particles (Saxon Europe, UK) were coated with 0.5 μg/ml biotinylated human IZ-CD40L (BMS). After coating, biotinylated CD40L particles were washed in PBS and diluted 1:10 in 0.1% (w/v) bovine serum albumin (BSA) (Sigma-Aldrich, UK) in PBS assay buffer. In a 384-well clear bottom, black walled plate (Applied Biosystems) a dilution range of purified dAb, 0.25 μg/ml human CD40 (BMS, CY24FEB06-01), 1 in 5000 mouse anti-human IgG (Fc) mAb clone GG-7 (Sigma-Aldrich, UK), 0.25 μg/ml goat anti-mouse ALEXA Fluor® 647 (Invitrogen, Molecular probes, UK) and the biotinylated CD40L polystyrene particles were combined equally and allowed to incubate at room temperature for 6 hours in the absence of light. Following incubation, competitive binding of dAb vs. human CD40 to biotinylated CD40L particles was assessed using relative fluorescence with the AB8200 cellular detection mechanism (Applied Biosystems).
ELISA RBA:
Clear walled High Bind, 384-well plates (Corning, UK) were coated with 25 μl of 1 μg/ml Neutravidin in 0.2 M carbonate-bicarbonate buffer, pH 9.4 overnight at 4° C. The following day, assay plates were washed with 0.1% (v/v) Tween PBS buffer, blocked with 1% (w/v) BSA in PBS for 1 hour at room temperature and washed again. Following removal of excess washing buffer, 25 μl 1 μg/ml of biotinylated human IZ-CD40L (BMS) was incubated with the assay plates for 1 hour at room temperature. Simultaneously, a dilution range of purified dAb and 1 μg/ml of human CD40 (BMS, CY24FEB06-01) were complexed in a 1:1 ratio, Following washing of the assay plate, the dAb:human CD40 complex was incubated in the assay plate at room temperature for 2 hours with gentle agitation. Competitive binding of dAb vs. human CD40 to biotinylated CD40L was detected with sequential incubations of 1 in 5000 mouse anti-human IgG (Fc) mAb clone GG-7 (Sigma-Aldrich, UK) followed by 1 in 10,000 horse radish peroxidase (HRP) conjugated goat anti-mouse IgG (Fc) secondary detection antibody (Sigma-Aldrich, UK). Absorbance signal was measured using a SpectraMax® M5e plate reader (Molecular Devices) at 450 nm following neutralization with 1 M HCl solution.
Cell Assays: CD40 CHO Cell RBA:
Stably transfected human CD40 expressing CHO-DG44 cells or native CHO-DG44 cells (both BMS) were detached from cell culture flasks using Versene (Invitrogen). Forty thousand cells per well were seeded into 96-well High Bind, black walled, clear bottom plates (Corning, UK) in 0.1% (w/v) BSA PBS assay buffer with a dilution range of dAb, 0.25 μg/ml of biotinylated human IZ-CD40L (BMS), and 0.25 μg/ml of streptavidin ALEXA Fluor® 647 (Invitrogen, Molecular probes, UK). The mixture was incubated in the absence of light for 6 hours. Following incubation, competitive binding of dAb vs. human CD40 CHO cells to soluble biotinylated IZ-CD40L was assessed using relative fluorescence with the AB8200 cellular detection mechanism (Applied Biosystems).
TABLES 5-7 respectively show the results from a primary screening effort (“naïve clones”) and subsequent rounds of affinity maturation (“error-prone matured clones” and “further-matured clones”) for the tested anti-human CD40 dAbs.
The binding kinetics were determined for anti-human CD40 dAbs identified in the primary screening effort (“naïve clones”) and subsequent rounds of affinity maturation (“error-prone matured clones”). The methods used directly measure the affinity of the dAbs for CD40.
A BIAcore™ 3000 instrument (GE Healthcare) was used to analyze the binding kinetics of CD40-specific dAbs to CD40. Approximately 600 response units (RU) of biotinylated human CD40 (BMS) were immobilized on one flow-cell of a streptavidin (SA) BIAcore™ chip. A second flow cell without any ligand immobilized served as a reference flow-cell for inline referencing. An appropriate doubling dilution series of each dAb to be analyzed was prepared in HBS-EP buffer (0.01 M HEPES pH 7.4 with 0.15 M NaCl, 3 mM EDTA and 0.005% v/v Surfactant P20, GE Healthcare). One hundred and eighty microliters of each dAb were injected in duplicate using the instrument's KINJECT function. Each dAb was injected across the CD40-immobilised and reference flow-cells in series with inline subtraction of the signal from the reference cell. The experiment was performed at 25° C. and a flow rate of 30 μl/min of HBS-EP. After each injection had been completed, the dAb was allowed to dissociate from the ligand in buffer for 300 s before regeneration with a 10 μl injection of 10 mM glycine pH 2.0. A reference injection of HBS-EP buffer blank (containing no analyte) was also injected under the same conditions, to serve as a second reference for subtraction from each analyte trace. BIAevaluation 4.1 software (GE Healthcare) was used to subtract both the reference flow-cell trace and the buffer blank trace from each analyte trace. The same software was used to perform a simultaneous, global fit of a 1:1 (Langmuir) kinetic model to the association and dissociation phases of the analyte dilution series traces. This model yielded association and dissociation rate constants (ka and kd, respectively) and the equilibrium dissociation constant (KD) of the interaction; these are detailed in TABLES 8 and 9.
Anti-human CD40 dAbs identified in the primary screening effort (“naïve clones”) and subsequent rounds of affinity maturation (“error-prone matured clones” and “further-matured clones”) were further characterized by analysis of biophysical parameters. To measure the relative stability of the dAbs, their melting point was determined by differential scanning calorimetry (DSC). dAbs with a higher melting temperature are more stable. To determine whether the dAbs form multimeric aggregates in solution, the dAbs were assayed by size exclusion chromatography/multiangle laser light scattering (SEC-MALLS). The results are shown in TABLES 10-12.
A BIAcore™ 3000 instrument (GE Healthcare) was used to analyze whether CD40-specific dAbs bound the same CD40 epitope. Approximately 600 response units (RU) of biotinylated human CD40 (BMS) were immobilized on one flow-cell of a streptavidin (SA) BIAcore™ chip. A second flow-cell without any ligand immobilized served as a reference flow-cell for inline referencing. An appropriate dilution of each dAb or Fab to be analyzed was prepared in HBS-EP buffer (0.01 M HEPES pH 7.4 with 0.15 M NaCl, 3 mM EDTA and 0.005% v/v Surfactant P20, GE Healthcare). The dilution chosen was one which when injected as described below resulted in >80% of the maximum possible bound RU for the particular inhibitor, typically 1-10 μM. Next, a mixture of the same dAb or Fab as above (at the same final concentration) was prepared with a second dAb or Fab to be analyzed for competition. The COINJECT function of the instrument was used to inject 60 μl of the single-inhibitor dilution across the CD40-immobilized and reference flow-cells in series, followed immediately by a 60 μl injection of the two-inhibitor mixture. Inline subtraction of the signal from the reference cell was performed by the instrument's control software. The experiment was performed at 25° C. and a flow rate of 30 μl/min of HBS-EP. After each co-injection had been completed, the inhibitors were allowed to dissociate from the ligand in buffer for 60 s before regeneration with a 10 μl injection of 10 mM glycine pH 2.0. The maximum RU obtained for the second injection (the mixture of the two inhibitors) was noted and expressed as a percentage of the RU obtained for the same inhibitor when injected alone.
If the second inhibitor retained at least 100% of the RU usually bound when it was injected alone, then this implied that the two inhibitors bind to discrete epitopes. If less than 100% binding of the second inhibitor was observed, then this was indicative of competition between the two inhibitors for binding to CD40. There are several possible reasons for this competition: the two inhibitors may bind to the same or overlapping epitopes, there may be steric inhibition of binding, or binding of the first inhibitor may induce a conformational change in the antigen that prevents or reduces binding of the second inhibitor.
An example clone from each lineage (except BMS3h-217) was tested for competition with other dAbs in overlapping groups. All the dAbs tested appear to compete with each other for binding to CD40, as shown in TABLES 13 and 14. This data suggests that all antibody polypeptides selected from the group consisting of lineage BMS3h-37, BMS3h-38, BMS3h-41, BMS3h-43, BMS3h-56, BMS3h-131, BMS3h-198, and BMS3h-202 should compete with the binding of a dAb from any of these lineages to human CD40.
Similarly, various dAbs were tested for competition with Chi220 Fab′, as shown in TABLES 15 and 16. In this case, all the dAbs do not compete with Chi220 Fab′, except BMS3h-217, which shows competition. BMS3h-56-5 and BMS3h-193-12 dAbs bound with at least 100% of single dAb RU in the presence of bound Chi220 or G28-5 Fab′, suggesting that the Fab's bind a different epitope(s) than the dAbs. Chi220 Fab′ showed a reduction of bound RU in the presence G28-5. The same result was observed in the opposite order of binding. This suggests that G28-5 Fab′ binds the same epitope as Chi220 Fab′.
Anti-human CD40 dAbs were assayed functionally for their ability to antagonize CD40 activities. The CD40 activities tested were B cell proliferation and cytokine production by hCD40L-driven activation of primary human monocyte-derived dendritic cells (DCs). Unless otherwise noted, all assays were performed in RPMI media supplemented with 10% fetal calf serum (FCS). The results using the various assays are shown in TABLE 17.
Soluble IZ-hCD40L-Driven Primary Human B Cell Proliferation:
1×105 tonsillar human B cells were incubated with 0.6 μg/ml of IZ-hCD40L along with varying titrations of antibody polypeptide in a final volume of 200 Owen in a 96-well round bottom plate. The plates were incubated at 37° C. for 72 hours, then thymidine (3H; 0.5 μci/well) was added for 6 hours. B cell proliferation was quantified based on thymidine incorporation.
CHO-hCD40L-Driven Primary Human B Cell Proliferation:
CHO cells were transfected with human CD40L to generate a stable cell line expressing high levels of CD40L on the cell surface. CHO-CD40L cells were irradiated at 10,000 Rads before incubation with human B cells. 1×105 tonsillar human B cells were incubated with 1×103 CHO-CD40L cells (1:100 ratio of CHO-CD40L: human B cells) along with varying titrations of antibody polypeptide in a final volume of 200 μl/well in a 96-well round bottom plate. The plates were incubated at 37° C. for 72 hours following which 3H-thymidine (0.5 μci/well) was added for 6 hours. B cell proliferation was quantified based on thymidine incorporation.
Soluble IZ-hCD40L-Driven Cyno Splenic Human B Cell Proliferation:
1×105 cyno splenic B cells were incubated with 0.5 μg/ml of IZ-hCD40L along with varying titrations of antibody polypeptide in a final volume of 200 μl/well in a 96-well round bottom plate. The plates were incubated at 37° C. for 72 hours following which 3H-thymidine (0.5 μci/well) was added for 6 hours. B cell proliferation was quantified based on thymidine incorporation.
Primary T Cell-Driven Human B Cell Proliferation:
T cells were isolated from human peripheral blood mononuclear cells (PBMC) and enriched using sheep red blood cell (SRBC) rosetting. Human tonsillar B cells were isolated by homogenizing tonsil tissue to a single-cell suspension. Leukocytes were obtained by ficoll separation, then B cells were negatively selected busing SRBC resetting and enriched by discarding the rosetted cells.
Enriched human T cells were cultured with PM-LCLs (an EBV-transformed B cell line; irradiated at 10,000 Rads) at a 5:1 ratio (T:LCL) for 6 days at 37° C. to generate a population of allogeneic T cells. At day 6, the expanded T cells were isolated and irradiated at 3000 Rads, and then cultured (5×104 T cells/well) with primary human tonsillar B cells (1×105 B cells/well) at a 1:2 ratio in 96-well flat bottom plated coated with anti-CD3 mAb (OKT3). Varying titrations of antibody polypeptides were added to each well; the final volume in each well was 200 μl. Test plates were incubated at 37° C. for 3 days. Human B cell proliferation was determined via the addition of 3H-thymidine (0.5 μci/well) to the cultures for the last 18 hours.
CHO-hCD40L-Driven Activation of Primary Human Monocyte-Derived Dendritic Cells (DCs):
Human PBMCs were enriched for monocytes by depleting T cells via SRBC rosetting. The monocyte-enriched PBMCs were cultured with 10 ng/ml GM-CSF and 5 ng/ml IL-4 in 6-well plates for 6 days at 37° C. The cultured plates were replenished with fresh media (with GM-CSF and IL-4) on days 2 and 5. The immature dendritic cells (DCs) were used in cell assays on day 6. 8×104 immature DCs were cultured with 4×103 CHO-hCD40L cells (irradiated at 10,000 Rads) along with varying titrations of antibody polypeptides in a 96-well flat bottom plate. After 24 hours, supernatants were harvested and tested for the presence of various cytokines (IL-12. TNF, IL-23). DC activation was determined by the levels of cytokine production.
Dual specific dAbs that specifically bind CD40 and human serum albumin (HSA) or cynomolgus serum albumin (CSA) were constructed and tested for activity in cell-based assays. The albumin-specific dAbs are called “AlbudAbs.” In this example, AlbudAb fusions comprise a BMS3h dAb that binds CD40 and another domain antibody, DOM7h, that recognizes HSA. The two dAbs are fused in frame to the amino and carboxyl termini of an amino acid linker to form an inline fusion (ILF) polypeptide. The ILF polypeptide is expressed recombinantly as a single fusion protein. RBAs demonstrating activity of the AlbudAb ILFs are described below, and the results are shown in TABLE 18. TABLE 19 summarizes the linker sequences used in the tested AlbudAb ILFs. Kinetic binding data determined by a BIAcore™ assay are shown in TABLE 20.
Human CD40 CHO Cell ELISA for the Detection of dAbs in a Supernatant:
Stably transfected human CD40 expressing CHO-DG44 cells or native CHO-DG44 cells (both BMS) were detached from cell culture flasks using 0.25% trypsin EDTA, and 100,000 cells per well were seeded in growth media into 96 well tissue culture treated plates (NUNC). The cells were allowed to adhere overnight in a humidified atmosphere at 37° C., 5% CO2. On the day of assay, the cell sheet was washed with PBS prior to being fixed with 2% paraformaldehyde (Sigma-Aldrich) for 20 minutes. Following fixing, the cell sheet was washed again in PBS prior to a 1 hr blocking step with 15% fetal bovine serum (FBS, PAA) in PBS. Plates were washed once more prior to addition of 100 μl/well of dAb supernatant and incubated for 2 h at room temperature. Following incubation of dAb supernatants with cells, the plates were washed and dAb binding was detected with incubation of horse radish peroxidase (HRP) conjugate anti-protein A or L, depending on whether dAbs are VH or VL domains. Absorbance signal was measured using a SpectraMax® M5e plate reader (Molecular Devices) at 450 nm following neutralization with 1 M HCl.
ICAM-1 Up-Regulation Cell Assay:
Stably transfected human CD40L expressing COS cells were detached from cell culture flasks using Versene (invitrogen). 20,000 cells per well were seeded into 96 well Highbind, black walled, clear bottom plates (Corning, UK) in assay buffer (RPMI 1640 without phenol red (Sigma-Aldrich, UK)+1% penicillin/streptomycin+10% FBS Gold (both PAA Laboratories, UK). The cells were left to adhere overnight in a humidified atmosphere at 37° C. with 5% CO2. The following day, exhausted assay buffer containing non attached cells was replenished with 100 μl of fresh assay buffer. To this, 20,000 RAMOS cells/well were added in assay buffer in addition to a dilution range of dAb. The assay plate was returned to a humidified atmosphere at 37° C. with 5% CO2 for a further 24 hours. For negative control wells, no RAMOS cells were added. The ability of dAb to inhibit the up-regulation of ICAM-1 on the cell surface of RAMOS cells in response to exposure to CD40L on the cell surface of COS cells was assessed by addition of 0.5 μg/ml mouse anti human ICAM-1 antibody (R&D systems) and 0.2 μg/ml goat anti mouse ALEXA Fluor® 647 (Invitrogen, Molecular probes, UK). Following a 3 hour incubation period in the absence of light, relative fluorescence was detected as measured by the AB8200 cellular detection platform (Applied Biosystems).
Analysis of Inline Fusion (ILF) Kinetics of Binding to Serum Albumin:
A BIAcore™ 3000 instrument (GE Healthcare) was used to analyze the binding kinetics of anti-CD40-AlbudAb ILFs to human and cynomolgus serum albumin. Approximately 400 response units (RU) of human serum albumin (HSA) or cynomolgus serum albumin (CSA) were immobilized on a flow-cell of a CM5 BIAcore™ chip using an Amine Coupling Kit (GE Healthcare). A second flow cell without any ligand immobilized served as a reference flow-cell for inline referencing. An appropriate doubling dilution series of each dAb to be analyzed was prepared in HBS-EP buffer (0.01 M HEPES pH 7.4 with 0.15 M NaCl, 3 mM EDTA and 0.005% v/v Surfactant P20, GE Healthcare). Two hundred microliters of each ILF were injected in duplicate using the instrument's KINJECT function. The injections were made across the serum albumin-immobilized and reference flow-cells in series, with inline subtraction of the signal from the reference cell. The experiment was performed at 25° C. and a flow rate of 40 μl/min of HBS-EP. After each injection had been completed, the dAb was allowed to dissociate from the ligand in buffer for 120 s before regeneration with a 10 μl injection of 10 mM glycine pH 2.0. A reference injection of HBS-EP buffer blank (containing no analyte) was also injected under the same conditions to serve as a second reference for subtraction from each analyte trace. BIAevaluation 4.1 software (GE Healthcare) was used to subtract both the reference flow-cell trace and the buffer blank trace from each analyte trace. The same software was used to perform a simultaneous, global fit of a 1:1 (Langmuir) kinetic model to the association and dissociation phases of the analyte dilution series traces. This model yielded association and dissociation rate constants (ka and kd, respectively) and the equilibrium dissociation constant (KD) of the interaction. The parameter values are shown in TABLE 20.
TABLE 21 lists amino acid sequences of representative AlbudAb ILFs that can specifically bind CD40 and HSA or CSA. The designation of each ILF identifies the particular linker sequence: “GxS” means the linker has “x” residues of glycine followed by serine, and “(GxS)y” means the linker has y repeating units of GxS. TABLE 22 discloses representative nucleic acids that encode the ILF sequences listed in TABLE 21. As is known in the art, multiple codons can encode the same amino acid. Nucleic acids encoding a protein sequence thus include nucleic acids having codon degeneracy.
The methods disclosed herein to generate antibody polypeptides that specifically bind human CD40 may be used to generate antibody polypeptides that specifically bind CD40 of other species. For example, anti-cynomolgus (anti-cyno) CD40 antibody polypeptides can be produced using the presently disclosed methods. The anti-cynoCD40 antibody polypeptides can be generated using the same scheme of initial/primary screening and affinity maturation as anti-human CD40 dAbs, for example. Methods for obtaining anti-cynoCD40 dAbs are disclosed, and representative examples of anti-cynoCD40 dAbs are provided in TABLE 23 below.
ELISA RBA:
Clear walled Highbind, 384 well plates (Corning, UK) were coated with 25 μl of 1 μg/ml neutravidin in carbonate buffer overnight at 4° C. The following day, assay plates were washed with 0.1% Tween PBS buffer, blocked with 1% BSA in PBS for 1 hour at room temperature, and washed again. Following removal of excess washing buffer, 25 μl of 1 μg/ml of biotinylated human IZ-CD40L (BMS, 1.2 mg/ml stock concentration) was incubated with the assay plates for 1 hour at room temperature. Simultaneously, a dilution range of purified dAb and 1 μg/ml of cynoCD40 (BMS) were complexed in a 1:1 ratio. Following washing of the assay plate, the dAb:cyno CD40 complex was incubated in the assay plate at room temperature for 2 hours with gentle agitation. Competitive binding of dAb vs. cynoCD40 to biotinylated CD40L was detected with horse radish peroxidase (HRP) conjugated anti human (Fc) secondary antibody (Sigma-Aldrich, UK). Absorbance signal was measured using a Spectromax M5e plate reader (Molecular Devices) at 450 nm following neutralization with 1M HCl.
cynoCD40 CHO Cell RBA Using AB8200 FMAT:
Stably transfected cynoCD40-expressing CHO-DG44 cells or native CHO-DG44 cells (BMS) were detached from cell culture flasks using Versene (Invitrogen). 40,000 cells per well were seeded into 96 well Highbind, black walled, clear bottom plates (Corning, UK) in 0.1% BSA PBS assay buffer with a dilution range of dAb, 0.25 μg/ml of biotinylated human IZ-CD40L (BMS, 1.2 mg/ml stock concentration), and 0.25 μg/ml of streptavidin Alexa Fluor® 647 (Invitrogen, Molecular probes, UK). The mixture vas incubated in the absence of light for 6 hours. Following incubation, competitive binding of dAb vs. cynoCD40 CHO cells to soluble biotinylated IZ-CD40L was assessed using relative fluorescence as measured by the AB8200 cellular detection platform (Applied Biosystems).
CHO-hCD40L-Driven Primary Human B Cell Proliferation:
CHO cells (ATCC) were transfected with human CD40L to generate a stable cell line expressing high levels of CD40L on the cell surface. CHO-CD40L cells were irradiated at 10,000 Rads before incubation with human B cells. 1×105 tonsillar human B cells were incubated with 1×103 CHO-CD40L cells (1:100 ratio of CHO-CD40L: human B cells) along with varying titration of dAb or monoclonal antibody in a final volume of 200 μl/well in a 96-well round bottom plate. The plates were incubated at 37° C. for 72 hours, following which thymidine (3H; 0.5 μci/well) was added for 6 hours. B cell proliferation was quantified based on thymidine incorporation. All assays, unless otherwise noted, were performed in RPMI media supplemented with 10% fetal calf serum (FCS).
Soluble IZ-hCD40L-Driven Cyno Splenic B Cell Proliferation:
1×105 B cells isolated from cynomolgous monkey spleens were incubated with 0.5 μg/ml of IZ-hCD40L along with varying titration of dAb or mAb in a final volume of 200 μl/well in a 96-well round bottom plate. The plates were incubated at 37° C. for 72 hours, following which 3H-thymidine (μci/well) was added for 6 hours. B cell proliferation was quantified based on thymidine incorporation. All assays, unless otherwise noted, were performed in RPMI media supplemented with 10% fetal calf serum (FCS).
CynoCD40 has a Leu109 residue instead of a Trp109, as in human CD40. The amino acid sequence of Macaca fascicularis CD40 is reproduced below:
Anti-human CD40 dAbs were tested for cross reactivity to B cells in cynomolgus monkey, rhesus macaque and chimpanzee blood, and lymphocytes from marmoset blood using flow cytometric methods. The procedures detailed below summarize methods used for CD40 dAb detection over multiple experiments. The results, shown in TABLE 24, suggest that anti-human CD40 dAbs do not bind cynoCD40. This is consistent with the evidence disclosed above (see
Methods:
PEGylated anti-human CD40 dAbs (BMS3h-56-5C-40L and BMS3h38-2C-P40Br) or a biotin-conjugated dAb (BMS3h38-2-biotin) were incubated with human and primate blood samples on a rotator for 1 hour at 37° C. 100 μl from each blood sample was aliquoted to 12×75 mm tubes and washed 3 times with FACS buffer (0.5% FBS/PBS/0.1% sodium azide). Tubes were centrifuged for 5 minutes at 1500 rpm, and supernatants were decanted between washes. Following the washes, tubes were placed on ice and incubated with human IgG for 5 minutes to block non-specific binding via Fc receptors.
For PEGylated dAb detection, anti-PEG antibodies (clone CH-2074. Silver Lake Research or clone 2-2, Open Biosystems) were added to tubes and incubated for 30 minutes. Samples were washed once in FACS buffer, then incubated with an APC-labeled CD20 antibody (clone 2H7, BD Biosciences) and PE labeled-anti-mouse IgG (Fcγ1 specific; Calbiochem) for an additional 30 minutes on ice.
For biotin-conjugated dAb detection, PE-labeled streptavidin (Invitrogen) and APC-labeled CD20 antibody (clone 2H7, BD Biosciences) were added to tubes and incubated 30 minutes at room temperature.
Additionally, to measure CD40 levels on human and primate blood, an aliquot of each blood sample was incubated with an APC-labeled CD20 antibody (clone 2H7, BD Biosciences) and a PE-labeled anti-human CD40 antibody that cross reacts with primate species (clone 5C3, BD Biosciences) for 30 minutes at room temperature.
To lyse red blood cells and fix white blood cells following detection antibody incubation, FACS Lysing Solution (BD Biosciences) was added to all tubes, and samples were incubated for 15 minutes at room temperature. Samples were centrifuged and resuspended in FACS Lysing Solution, and analyzed by flow cytometry on a BD FACSCanto™, gating on CD20+ B cells for analysis. For marmoset samples, the CD20 antibody was not cross reactive; therefore analysis was performed on all lymphocytes as identified by forward and side scatter properties (size).
Results:
Binding of PEGylated and biotinylated anti-human CD40 dAbs was tested in human and primate blood samples according to the method above. Anti-human CD40 dAb binding to CD20+ B cells in human blood samples was detected. In contrast, the binding of PEGylated and biotinylated CD40 dAbs was not detected on CD20+ B cells in cynomolgus, rhesus, or chimp blood samples or on lymphocytes in marmoset blood samples. Results for BMS3h-38-2C-P40Br dAb are shown in
Two different crystal forms were analyzed during the structure determination of the human CD40 (SEQ ID NO: 1)/BMS3h-56-5 (SEQ ID NO: 321) complex. Data were collected from a crystal of the CD40/BMS3h56-5 complex, flash-cooled to and maintained at 100 K, and mounted on a Rigaku AFC-9 goniometer. The X-ray source was a Rigaku FR-E using a copper target with MicroMax™ confocal optics and a Saturn 92 detector. Data were collected at extremely high redundancy to enhance the sulfur anomalous diffraction signal in the hopes of using that signal to phase the data. Data were processed with HKL2000 (HKL Research; Otwinowski et al., In Methods Enzymol. Macromolecular Crystallography part A, Carter et al., eds., vol. 276, p. 307-326, Academic Press, Inc., New York, N.Y. (1997)). Data collection statistics for this crystal are summarized below and in Table 24:
Space Group: I222;
Unit Cell: a=156.6 Å; b=158.3 Å; c=200.7 Å;
Mosaicity 0.59-0.84; Rejected observations: 1028; 0.06%.
A second crystal form was collected from a crystal flash-cooled to 100 K and mounted on a Rayonix MX-225 detector at the Canadian Light Source beamline CMCF1 (08-ID-1) and the wavelength was 0.9793 Å. These data were collected by Shamrock Structures (R. Walter and G. Ranieri) and were processed with HKL2000. Data collection statistics for this crystal are summarized below and in Table 25:
Space Group: C2;
Unit Cell: a=199.3 Å; b=48.7 Å; c=138.8 Å; β=118.2°;
Mosaicity 0.62-0.71; Rejected observations: 70; 0.08%.
Molecular Replacement Models:
The model of the dAb, BMS3h-56-5, was derived from PDB ID 2VYR chain E residues 1-124 with sequential residues corresponding to CDRs 31-35. 50-57, and 99-111 removed by SPLIT_PDB (which corresponds to Kabat numbering 31-35, 50-56, and 95-100G) and then run through MUTATE and finally renumbered by RENUMBER. MUTATE changes non-identical residues to the minimum identical, i.e., normally Ala or Gly, but, for example Tyr→Phe and Phe→Tyr would result in Phe. It does not build any atoms, although for Thr→Val, Val→Thr, Cys→Ser, and Ser→Cys, it will substitute the appropriate atom name, but not change the position. RENUMBER changed the numbering to Kabat numbering (Kabat et al., Sequences of Immunological Interest, 5th ed., U.S. Dept. Health & Human Services, Washington, D.C. (1991)), which is a standard numbering system for antibodies that makes description of CDRs and framework residues straight-forward.
A CD40 model was constructed from PDB IDs 1JMA (chain B), 1NCF (chain A), 1TNR (chain R), 2HEV (chain R), 2HEY (chains R, T), and 2UWI (chains A, B) using phenix.ensembler (University of Cambridge, UK) to create an ensemble of structures. The N-termini (residues 24-78) plus a six residue segment (residues 95-100) of these molecules were superimposable with an acceptable root mean square distance for Ca atoms, and that was used as a model for the N-terminal region of CD40.
Molecular Replacement Methods:
The program PHASER (McCoy et al., J. Appl. Crystallogr. 40: 658-674 (2007)) was used for molecular replacement. The translation function Z-score (TFZ) and the increase in the log-likelihood gain were monitored to decide whether real solutions had been found. TFZ scores of 8 and above generally represent a solution. Lesser TFZ scores accompanied by substantial increases (>50) in the log-likelihood gain also are acceptable indicators.
Model Building, Density Modification, and Crystallographic Refinement Methods:
Model-building tools for molecular graphics included the COOT program (Emsley et al., Acta Crystallogr Sect. D 60: 2126-2132 (2004); Emsley et al., “Features and Development of Coot,” Acta Crystallogr Sect. D 66: 486-501 (2010)). Density modification using non-crystallographic symmetry map averaging was performed using known density modification programs and other programs to calculate the Eulerian angles and translations between molecules. Refinement was run using autoBUSTER (GlobalPhasing, Ltd.: Bricogne et al., Acta Crystallogr. Sect. D 60: 2210-2221 (2004); Tronrud et al., Acta Crystallogr. Sect. A 43: 489-501 (1987)).
Domain Antibody Numbering System:
The residue numbering system for the domain antibody follows that of Kabat.
The Kabat numbering is compared to straight sequential numbering below for BMS3h-56-5:
In Kabat numbering BMS3h-56-5 has insertion residues 52A, 82A, 82B, 82C and is missing residue 100. In both numbering systems the Ser and Thr at the N-terminus that are part of the expression construct are given negative numbers.
Determination of the Structure of CD40/BMS3h-56-5 Complex:
PHASER was able to locate four BMS3h-56-5 dAb molecules in the I222 crystal form and three BMS3h-56-5 dAb molecules in the C2 crystal form. In the I222 crystal form the TFZ scores ranged from 7.6 to 41.0, and the increase in the log-likelihood gain ranged from 77 to 446. These solutions for the BMS3h-56-5 dAb molecules formed helical columns of dAb molecules through the I222 crystal that were separated from other columns by large channels. In the C2 crystal the TFZ scores ranged from 7.7 to 16.5, and the increase in the log-likelihood gain ranged from 110 to 150. The packing of the dAbs in this crystal form was not repetitive or symmetric.
Using the ensemble model for the CD40 N-terminal domain, four molecules of the N-terminal domain of CD40 could be placed in the I222 crystal form with TFZ scores ranging from 5.7 to 8.5, and the increase in the log-likelihood gain ranged from 83 to 389. The four N-terminal domains of CD40 in the I222 crystal form formed a clump equally centered between four columns of dAb molecules. However, they did not touch the BMS3h-56-5 dAb molecules. In the C2 crystal form three molecules of the N-terminal domain of CD40 could be placed with TFZ scores ranging from 5.8 to 12.1, and the increase in the log-likelihood gain ranged from 100 to 198. In this crystal form, the N-terminal domains also did not contact the BMS3h-56-5 dAb molecules.
In the I222 crystal form, the N-terminal domain of the CD40 from the CD40/Chi220 Fab complex and the N-terminal domain from 2UWI were superimposed on the CD40 N-terminal domain. The ability to associate the N-terminal with a particular BMS3h-56-5 dAb allowed the use of non-crystallographic symmetry (NCS) map averaging. The starting correlation coefficients for NCS averaging gave off-diagonal values of 0.71-0.81. The final off-diagonal values were 0.88-0.92. The electron density close to the N-terminal region was clear, and a path could be traced for CDR3 of the BMS3h-56-5 dAb. Residues 82-94 and 101-121 from the CD40/Chi220 Fab′ complex were superimposed on the corresponding residues on 2UWI and then COOT was used to improve the fit manually. This position for the second domain (residues 82-94 and 101-121) of CD40 was then transformed onto the other three N-terminal domains.
A cycle of refinement was run with R-free decreasing from 0.437 to 0.380 and R-work from 0.447 to 0.381 with improvement in root mean square bond and angle deviations from ideal. The resulting electron density map showed that residue 109 had a side chain that was consistent with Trp and that density existed for at least some residues in the C-terminal 70 residues of CD40.
Since CD40 has little secondary structure, fitting the C-terminal ˜70 residues to the electron proved difficult, so the Research Collaboratory for Structural Bioinformatics Protein Data Base was searched for a suitable model to help guide chain tracing. The top two hits with 16 out of 44 identities and 24 out of 44 matches were 2AW2 and 1JMA, which have the same sequence:
CSPGFGVKQIATGVSDTICEPCPVGFESNVSSAFEKCHPWTSCE
CSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCD
Identical residues are noted with the appropriate single letter code on the consensus line and similar residues are noted on the consensus line as asterisks. This was the same stretch of residues as for residues 41-84 of the N-terminal domain of CD40:
CQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD
CSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCE
Identical residues are noted with the appropriate single letter code on the consensus line and similar residues are noted on the consensus line as asterisks.
Matching Disulfide Bonds:
Comparison of Disulfide Linkages in Residues 41-84 and 125-168 of CD40
Residues in brackets fall outside of the residue ranges in the sequence repeat.
With the 1JMA/2AW2 model as a guide, the COOT program was used to fit one of the CD40 chains. This fitted model was then superimposed on one of the other three CD40 chains. However, it appeared that the position of this new stretch of residues was differently oriented in the other two CD40 chains, and they were not fitted at this time. A cycle of refinement was run with R-free decreasing from 0.393 to 0.366 and R-work from 0.400 to 0.349 with considerable improvement in root mean square bond and angle deviations from ideal.
The BMS3h-56-5 dAb from one of the molecules in the I222 crystal form was superimposed on each of the three dAbs in the C2 crystal form. That transformation matrix was used to orient the second and C-terminal domains of the I222 crystal form. The model was rebuilt using the COOT program. A cycle of refinement was run with R-free decreasing from 0.361 to 0.334 and R-work from 0.375 to 0.306 with improved root mean square bond and angle deviations from ideal. The resulting electron density map provided guidance for placing many more CD40 residues. Another cycle of refinement was run with R-free decreasing from 0.302 to 0.287 and R-work from 0.299 to 0.270 with improved root mean square bond and angle deviations from ideal
Conventional model building and refinement then were used to complete the structure determination. Several more rounds of optimization led to a final refinement with the following statistics: R-free 0.260, R-work 0.228, root mean square bonds 0.010 Å, root mean square angles 1.4°. The real space correlation coefficients are 0.92 for main-chain atoms and 0.80 for side-chain atoms. The final model had 13 water molecules.
Using the model of the C-terminal domain from the C2 crystal form as a guide, the CD40 models in I222 crystal form were further refined. Several more cycles of model building using the COOT program and refinement with the autoBUSTER program led to the following statistics: R-free 0.323, R-work 0.292, root mean square bonds 0.011 Å, root mean square angles 1.5°. The real space correlation coefficients are 0.91 for main-chain atoms and 0.80 for side-chain atoms. The model contained no water molecules.
Overall Structure of the CD40/BMS3h-56-5 Complex:
One BMS3h-56-5 dAb binds to one CD40 molecule. As shown in
The I222 crystal form contains four crystallographically independent CD40/BMS3h-56-5 complexes, and the C2 crystal for contains three crystallographically independent CD40/BMS3h-56-5 complexes. The CD40 molecule has a certain amount of flexibility, and the domains are arrayed differently in the seven unique versions of the complex, but the overall nature of the interaction is retained in all cases.
BMS3h-56-5 dAb Epitope Residues:
The minimal CD40 epitope for BMS3h-56-5 is defined as CD40 residues containing at least one atom in van der Waals or hydrogen-bond contact with a BMS3h-56-5 atom. The minimal epitope in all the complexes contains the following CD40 residues with reference to SEQ ID NO: 1: Trp109, Leu121, His122, Ser124, Ser156, Ala157, Phe158, Glu159, and His162. The following additional residues are in van der Waals or hydrogen-bond contact in some complexes: Pro85, Asn86, Leu87, Gly88, Glu106, Glu107, Gly108, His110, Thr112, Cys119, Val120, Gln133, Ile134, Ala135, Thr136, Ser155, Lys160.
A maximal CD40 epitope is defined as residues containing atoms that are buried by a 1.7 Å probe sphere. These residues include all the residues above, plus Val154 in all complexes. In some complexes, additional buried residues are: Ser118, Arg123, Thr141, Phe151, Asp153, Cys161, and Pro163.
A depiction of the surface of BMS3h-56-5 with contacting residues is shown in
Depending on the crystallographically independent complex, 660-740 Å2 of CD40 surface area is buried with between 16-21 contacting residues represented at a finer level with contacting 46-67 atoms. For BMS3h-56-5, 660-780 Å2 of surface area is buried with contacting 14-17 residues represented at a finer level with contacting 48-62 atoms. These contacts yield 3-7 hydrogen bonds and 111-142 van der Waals interactions, depending on the crystallographically independent complex.
To identify dAb binding epitopes on CD40, dAb binding was tested against seven CD40-Fc fusion proteins containing specific amino acid residue substitutions at residues 76, 109, or 121. These CD40-Fc fusion proteins include wild type human CD40 (wt-hCD40), wild type cynomolgus monkey CD40 (wt-cCD40), and five mutant human CD40 proteins (M1-M5) with specific amino acid residues mutated to the corresponding residue from the sequence of cynomolgus monkey CD40 (M1, M2, M4, M5) or chimpanzee CD40 (M3). The amino acid substitutions are listed in Table 26.
The sequence of the wild type human CD40 extracellular domain (1-193) is from REFSEQ:accession NM_001250.3. Cynomolgous and mutant constructs were generated using site-directed mutagenesis of the wild type sequence at the positions shown in Table 26. The extracellular domains were fused with a thrombin-cleavable linker DPGGGGGRLVPRGFGTGDP (SEQ ID NO: 1273), which was fused with human IgG1 Fc. The proteins were expressed in HEK-293-6E cells transfected with TIG-pYD7-GATE Durocher expression vectors. The supernatants were harvested after five days. Each CD40 protein was purified from conditioned media using protein A fast flow chromatography. The column was washed with PBS (20 mM sodium phosphate, 0.15 M NaCl, pH 7.2) and then eluted using 80 mM sodium acetate, pH 3, into ⅕th volume of 1 M Tris-HCl, pH 8. The eluate was run on a Superdex-200 column in PBS.
Representative dAb's from the 3h217, 3h37, 3h38, and 3h56 lineages were assayed for their binding to CD40-Fc fusion proteins listed in Table 26. Assays were performed on a BioRad ProteOn XPR36 SPR instrument. The SPR surfaces were prepared by immobilizing 8 μg/ml anti-human IgG(Fc) antibody (Biacore/GE Healthcare) in 10 mM sodium acetate pH 4.5 on a BioRad GLC sensor chip using standard ethyl(dimethylaminopropyl) carbodiimide (EDC)/N-hydroxysuccinimide (NHS) chemistry, with ethanolamine blocking. The running buffer for immobilization and kinetic binding analysis was 10 mM sodium phosphate, 130 mM sodium chloride, 0.05% tween 20, pH 7.1. CD40-Fc fusion proteins at concentrations of 20 μg/ml were captured in the vertical orientation on these surfaces via the Fc tail, and reference surfaces lacking CD40-Fc proteins were used for reference subtraction. Kinetic experiments were performed by flowing 405, 135, 45, 15, and 5 nM dAb analytes in the horizontal orientation over the captured CD40-Fc surfaces at 25° C., using a 240 s association time, and a 420 s dissociation time, at a flow rate of 30 μl/min. The surfaces were regenerated in both horizontal and vertical orientations with 30 s pulses of 3 M MgCl2 followed by running buffer at 60 μl/min. Sensogram data was double-referenced and then fitted to a 1:1 Langmuir model using BioRad ProteOn Manager V.2.1.0.38 software, to determine the association rate constant (ka), the dissociation rate constant (kd), and the equilibrium dissociation constant (KD).
All dAbs of the 3h-37, 3h-38, and 3h-56 lineages were found to bind with high affinity (KD<10−8 M) to CD40-Fc fusion proteins containing the human CD40 residues W109 and L121, but binding was significantly reduced or undetectable to CD40-Fc fusion proteins with the corresponding residues from cynomolgus monkey CD40 (L109, P121) or chimpanzee CD40 (R109). This indicates that dAbs from each of the 3h37, 3h38-, and 3h56-lineages bind specifically to an epitope that includes residues 109 and 121 of human CD40. In contrast, all tested members of the 3h-217 lineage bound with similar affinity to all CD40-Fc fusion proteins tested, indicating that the members of the 3h-217 lineage bind to a site on CD40 which does not include residues 76, 109, or 121. Therefore, the 3h-217 lineage binds to a different epitope than the 3h-37, 3h-38, and 3h-56 lineages. Table 27 summarizes KD values determined for dAb binding to CD40-Fc fusion proteins using SPR on a ProteOn XPR36 instrument. An “X” in Table 27 means that no evidence for binding was found under these conditions.
Table 28 shows the association rate constant (ka), dissociation rate constant (kd), and equilibrium dissociation constant (KD) determined for dAb binding to CD40-Fc fusion proteins using SPR on a ProteOn XPR36 instrument. An “X” in Table 28 means that no evidence for binding was found under these conditions.
Antibody polypeptides comprising dAbs can be constructed in various configurations, as disclosed herein. In this example, various dAbs were fused with a Fc domain to generate Fc fusion polypeptides of anti-human CD40 variable domain constructs such as 3h37-202, 3h37-235, 3h37-258, and 3h37-202.
In one representative example, the dAb BMS3h-56-269 (SEQ ID NO: 417) was fused with a modified IgG1 (IgG1*) Fc domain (SEQ ID NO: 1284). In the dAb-IgG1* Fc domain fusion polypeptide, the C-terminus of dAb BMS3h-56-269 was fused to a linker tripeptide having the sequence Ala-Ser-Thr, which in turn was fused with the IgG1* Fc domain (SEQ ID NO: 1284). The IgG1* Fc domain contained the modification C5S, referring to the numbering of positions in SEQ ID NO: 1284. C5 of the IgG1 Fc domain normally forms a disulfide bond with a Cys residue in the light chain of an IgG molecule. The IgG1* Fc domain also contained C11S and C14S mutations to eliminate interchain disulfide bonds in the IgG1 hinge region. Finally, the IgG1* Fc domain contained a P23S mutation to lower Fc domain effector function. The dAb-IgG1* Fc fusion polypeptide has the following sequence, where the Ala-Ser-Thr linker is in bold font and the modifications to the Fc domain are in bold italics:
The dAb-IgG1* Fc fusion polypeptide depicted in SEQ ID NO: 1286 is a monomer having a calculated molecular weight of 39,127 Da. It can form a dimer having a calculated molecular weight of 78,254 Da.
dAb BMS3h-56-269 (SEQ ID NO: 417) alternatively was fused with a human IgG4 Fc domain (SEQ ID NO: 1285). The C-terminus of dAb BMS3h-56-269 was again fused to the Ala-Ser-Thr linker, which was fused with the IgG4 Fc domain (SEQ ID NO: 1285). The IgG4 Fc domain contained the modification S10P, referring to the numbering of positions in SEQ ID NO: 1285. The BMS3h-56-269-IgG4 Fc fusion polypeptide has the following sequence, where the Ala-Ser-Thr linker is in bold font and the S10P modification is in bold italics:
The BMS3h-56-269-IgG4 Fc fusion polypeptide depicted in SEQ ID NO: 1287 is a monomer having a calculated molecular weight of 38,867 Da. It can form a dimer having a calculated molecular weight of 77,734 Da.
The sequences of BMS3h-56-269 (SEQ ID NO: 417), BMS3h-56-269-IgG1* Fc fusion polypeptide (SEQ ID NO: 1286), and BMS3h-56-269-IgG4 Fc fusion polypeptide (SEQ ID NO: 1287) are aligned below, where the start of the Fc domain is marked by an arrow:
The Fc fusion polypeptides were expressed using the cell culture methods disclosed in Example 11. The column was washed with PBS (20 mM sodium phosphate, 0.15 M NaCl, pH 7.2) and then eluted using 80 mM sodium acetate, pH 3, into ⅕th volume of 1 M Tris-HCl, pH 8. The eluate was run on a Superdex-200 column in PBS.
Anti-human CD40 Fc Fusion Polypeptides were assayed functionally for their ability to antagonize CD40 activities. The CD40 activities tested were B cell proliferation and cytokine production by hCD40L-driven activation of primary human monocyte-derived dendritic cells (DCs). B cell proliferation and cytokine production were measured using the assays disclosed in Example 6. Unless otherwise noted, all assays were performed in RPMI media supplemented with 10% fetal calf serum (FCS). The dAb-Fc domain fusion polypeptides exhibited potent inhibition (i.e., antagonism) of CD40-dependent activation. There were no agonistic properties noted among any of the humanCD40-specific dAb-Fc domain fusion polypeptides. The results using the various assays are shown in TABLE 29. 3h56-269-IgG4 was assayed for its binding to immobilized human-CD40 using the assays disclosed in Example 11. For 3h56-269-IgG4, the apparent avidity influenced Kd value for binding immobilized human-CD40 is measured at 30 pM at 25 C and 40 pM at 37 C.
Although the present embodiments have been described in detail with reference to examples above, it is understood that various modifications can be made without departing from the spirit of these embodiments, and would be readily known to the skilled artisan.
This application is a divisional of U.S. application Ser. No. 14/112,049, filed Dec. 18, 2013, now U.S. Pat. No. 9,475,879, which is the National Stage of International Application No. PCT/US2012/034519, filed Apr. 20, 2012, and claims the benefit of U.S. Provisional Application No. 61/477,904, filed Apr. 21, 2011, the entire contents of which are herein incorporated by reference.
| Number | Name | Date | Kind |
|---|---|---|---|
| 5182368 | Ledbetter et al. | Jan 1993 | A |
| 5247069 | Ledbetter et al. | Sep 1993 | A |
| 5674492 | Armitage et al. | Oct 1997 | A |
| 5677165 | de Boer et al. | Oct 1997 | A |
| 5786456 | Ledbetter et al. | Jul 1998 | A |
| 5849898 | Seed et al. | Dec 1998 | A |
| 5916560 | Larsen et al. | Jun 1999 | A |
| 6051228 | Aruffo et al. | Apr 2000 | A |
| 6056959 | de Boer et al. | May 2000 | A |
| 6376459 | Aruffo et al. | Apr 2002 | B1 |
| 8669352 | den Hartog et al. | Mar 2014 | B2 |
| 8828396 | Heusser et al. | Sep 2014 | B2 |
| 9475879 | Suri | Oct 2016 | B2 |
| 20060062784 | Grant et al. | Mar 2006 | A1 |
| 20060233797 | Gujrathi | Oct 2006 | A1 |
| 20070148163 | Takahashi et al. | Jun 2007 | A1 |
| 20130011405 | Long et al. | Jan 2013 | A1 |
| Number | Date | Country |
|---|---|---|
| 2012245309 | Feb 2016 | AU |
| 199900284 | Sep 1999 | CL |
| 200700768 | Nov 2007 | CL |
| 200701105 | Nov 2007 | CL |
| 200701335 | Jan 2008 | CL |
| 200901779 | Feb 2010 | CL |
| 201202737 | Feb 2013 | CL |
| 201301124 | Jul 2014 | CL |
| 1922316 | Feb 2007 | CN |
| 101061140 | Oct 2007 | CN |
| 1 707 627 | Oct 2006 | EP |
| 2255828 | Dec 2010 | EP |
| 2008-513425 | May 2008 | JP |
| 2009-022289 | Feb 2009 | JP |
| 2006-0130615 | Dec 2006 | KR |
| 10-2013-7030492 | May 2017 | KR |
| WO-9920749 | Apr 1999 | WO |
| WO-0228481 | Apr 2002 | WO |
| WO-2003040170 | May 2003 | WO |
| WO-2005044294 | May 2005 | WO |
| WO-2005093074 | Oct 2005 | WO |
| WO-2006030220 | Mar 2006 | WO |
| WO-2006073443 | Jul 2006 | WO |
| WO-2007085815 | Aug 2007 | WO |
| WO-2007124299 | Nov 2007 | WO |
| WO-2008149143 | Dec 2008 | WO |
| WO-2011123489 | Oct 2011 | WO |
| WO-2012145673 | Oct 2012 | WO |
| Entry |
|---|
| D'Angelo, Many Routes to an Antibody Heavy-Chain CDR3: Necessary, Yet Insufficient, for Specific Binding, Frontiers in Immunology vol. 9, Article 395 Mar. 2018; doi:10.3389/fimmun.2018.00395. (Year: 2018). |
| Peruvian Application No. 2381, Office Action dated Dec. 5, 2017 (with partial English translation/characterization). |
| Japanese Application No. 2017-000493, Office Action dated Jan. 18, 2018 (with partial English translation/characterization). |
| A.-C. Malmborg Hager, et al., “Affinity and Epitope Profiling of Mouse Anti-CD40 Monoclonal Antibodies,” Scandinavian Journal of Immunology, 2003, 57, pp. 517-524. |
| Y. Zhuang, et al., “A novel blocking monoclonal antibody recognizing a distinct epitope of human CD40 molecule,” Tissue Antigens, 2005, 65, pp. 81-87. |
| International Preliminary Report on Patentability dated Oct. 31, 2013 for PCT/US2012/034519 filed on Apr. 20, 2012. |
| Office Action dated Jul. 14, 2014 in New Zealand counterpart Patent Application No. 618025. |
| English translation of Office Action and Search Report dated Mar. 10, 2015 in Chinese counterpart Patent Application No. 201280030683.4. |
| English translation of Office Action dated Mar. 10, 2015 in Colombian counterpart Patent Application No. 13.261.140. |
| English translation of Office Action dated Apr. 28, 2015 in Korean counterpart Patent Application No. 10-2013-7030492. |
| “Study of HCD122 (Lucatumumab) and Bendamustine Combination Therapy in CD40+ Rituximab-Refractory Follicular Lymphoma,” Clinical Trials, Jan. 10, 2012 [online]. [retrieved on Jun. 30, 2015]. Retrieved from the Internet <URL:http://clinicaltrials.gov/show/NCT01275209>. |
| Adams, et al., “Development of a chimeric anti-CD40 monoclonal antibody that synergizes with LEA29Y to prolong islet allograft survival,” J. Immunol. 174: 542-50 (2005). |
| Arkin et al., “An algorithm for protein engineering: Simulations of recursive ensemble mutagenesis”, Proc. Nat'l Acad. Sci. USA 89:7811-7815 (1992). |
| Brand et al., “The Mouse Model of Collagen-Induced Arthritis”, in Methods Mol. Med., vol. 102, Humana Press Inc., Totowa New Jersey, pp. 295-312 (2004). |
| Blanc et al., “Refinement of severely incomplete structures with maximum likelihood in BUSTER-TNT”, Acta Cryst. D60: 2210-2221 (2004). |
| Chapman, et al., “PEGylated antibodies and antibody fragments for improved therapy: a review,” Adv. Drug Deily. Rev. 54(4):531-45 (2002). |
| Connolly, “Analytical Molecular Surface Calculation”, J. Appl. Crystallogr. 16: 548-558 (1983). |
| Davies et al., “TRAF6 is Required for TRAF2-Dependent CD40 Signal Transduction in Nonhemopoietic Cells”, Mol. Cell Biol. 25: 9806-19 (2005). |
| De Winter et al., “Mucosal immunity and inflammation. II. The yin and yang of T cells in intestinal inflammation: pathogenic and protective roles in a mouse colitis model”, Am. J. Physiol. 276: G1317-1321 (1999). |
| de Kruif et al., “Rapid selection of cell subpopulation-specific human monoclonal antibodies from a synthetic phage antibody library”, Proc. Natl. Acad. Sci. USA 92: 3938 (1995). |
| Emsley et al., “Coot: model-building tools for molecular graphics”, Acta Cryst. D60: 2126-2132 (2004). |
| Emsley et al., “Features and Development of Coot,” Acta Cryst. D66: 486-501 (2010). |
| Harrison et al., “Screening of Phage Antibody Libraries”, Meth. Enzymol. 267: 83-109 (1996). |
| Hoogenboom et al., “Multi-subunit proteins on the surface of filamentous phage: methodologies for displaying antibody (Fab) heavy and light chains”, Nucleic Acids Res. 19:4133-4137 (1991). |
| Kouskoff et al., “Organ-specific disease provoked by systemic autoimmunity”, Cell 87: 811-822 (1996). |
| Lawrence et al., “Shape Complementarity at Protein/Protein Interfaces,” J. Mol. Biol. 234: 946-950 (1993). |
| Marks et al., “Human antibody fragments specific for human blood group antigens from a phage display library”, BioTechnology 11: 1145-1149 (1993). |
| McCoy et al., “Phaser crystallographic software”, J. Appl. Crystallogr. 40: 658-674 (2007). |
| Pape et al., “Use of adoptive transfer of T-cell-antigen-receptor-transgenic T cell for the study of T-cell activation in vivo”, Immunol. Rev. 156: 67-78 (1997). |
| Sheriff et al., “Structure of myohemerythrin in the azidomet state at 1.7/1.3 A resolution”, J. Mol. Biol. 197: 273-296 (1987). |
| Sheriff, “Some methods for examining the interactions between two molecules”, Immunomethods 3: 191-196 (1993). |
| Tronrud et al., “An efficient general-purpose least-squares refinement program for macromolecular structures”, Acta Cryst. A43: 489-501 (1987). |
| Office Action dated Jun. 2, 2015 in Australian counterpart Patent Application No. 2009270726. |
| English translation of Office Action dated Jul. 29, 2015 in European counterpart Patent Application No. 12717027.2. |
| An et al., “Crystallographic and Mutational Analysis of the CD40-CD154 Complex and Its Implications for Receptor Activation”, The Journal of Biological Chemistry, vol. 286, No. 13, pp. 11226-11235 (Apr. 1, 2011). |
| English translation of Office Action dated May 29, 2015 in Eurasian counterpart Patent Application No. 201391564. |
| Qatari Patent Application No. QA/201310/00242_Office Action report dated Sep. 7, 2015 (with partial English translation/characterization). |
| Thailand Patent Application No. 1301006018_Office Action report dated Sep. 29, 2015 (with partial English translation/characterization). |
| Chinese counterpart Patent Application No. 201280030683.4, Office Action dated Nov. 16, 2015 (partial English translation/characterization). |
| Korean counterpart Patent Application No. 10-2013-7030492, Office Action dated Nov. 26, 2015 (with partial English translation/characterization). |
| New Zealand counterpart Patent Application No. 712771, Office Action dated Oct. 16, 2015. |
| Taiwanese Application No. 101114258, partial English translation/characterization of Office Action dated Nov. 24, 2015. |
| An et al., 2011, “Crystallographic and mutational analysis of the CD40-CD154 complex and its implications for receptor activation,” J Biol. Chem. 286(13):11226-35. |
| Japanese Application No. 2014-506589, Office Action dated Feb. 9, 2016 (with partial English translation). |
| Chilean Application No. 03043-2013, Office Action dated Mar. 27, 2016 (with partial English translation/characterization). |
| Eurasian Application No. 201391564, Office Action dated Apr. 26, 2016 (with partial English translation/characterization). |
| Australian Patent Application No. 2012245309 Office Action dated Jun. 2, 2015. |
| Chilean Patent Application No. 03043-2013 Opposition filed Oct. 10, 2014 (with partial English translation/characterization). |
| New Zealand Patent Application No. 618025 Office Action dated Sep. 4, 2015. |
| International Search Report dated Jun. 15, 2012 for PCT/US2012/034519 filed on Apr. 20, 2012. |
| Israeli Application No. 228720, Office Action dated Apr. 19, 2016 (with partial English translation/characterization). |
| Written Opinion of the International Searching Authority of PCT/US2012/034519 (dated Oct. 21, 2013). |
| Rudikoff et al., Proc. Natl. Acad. Sci. USA 79: 1979-1983 (1982). |
| Colman, Research in Immunology 145: 33-36 (1994). |
| Kussie et al., J. Immunol. 152: 146-152 (1994). |
| Chen et al., EMBO J., 14: 2784-2794 (1995). |
| Korean Application No. 10-2017-7011260, Office Action dated Aug. 15, 2017 (with partial English translation/characterization). |
| Australian Application No. 2016202672, Office Action dated Nov. 20, 2016. |
| Chilean Patent Application No. 03043-2013, Office Action dated Jul. 29, 2017 (with partial English translation/characterization). |
| Eurasian Application No. 201391564, Office Action dated Nov. 10, 2016 (partial English translation/characterization). |
| European Application No. 12717027.2, Office Action dated Feb. 8, 2017. |
| Israeli Application No. 228720, Office Action dated Apr. 6, 2017 (partial English translation/characterization). |
| Japanese Application No. 2014-506589, Office Action dated Sep. 6, 2016 (with partial English translation/characterization). |
| Korean Application No. 10-2013-7030492, Office Action dated Sep. 9, 2016 (with partial English translation/characterization). |
| Malaysian Application No. PI 2013003839, Office Action dated Sep. 30, 2016. |
| Mexican Application No. MX/a/2013/011966, Office Action with response deadline of Oct. 11, 2016 (partial English translation/characterization). |
| Mexican Application No. MX/a/2013/011966, Office Action with response deadline of Apr. 7, 2017 (partial English translation/characterization). |
| Mexican Application No. MX/a/2013/011966, Office Action with response deadline of Jul. 4, 2017 (partial English translation/characterization). |
| Philippine Application No. 1-2013-502013, Office Action dated Apr. 4, 2017. |
| Taiwanese Application No. 101114258, Office Action dated Apr. 29, 2016 (partial English translation/characterization). |
| Taiwanese Application No. 105121984, Search Report dated Jun. 5, 2017 (partial English translation/characterization). |
| Vietnamese Application No. 1-2013-03601, Office Action dated Dec. 5, 2016 (with partial English translation/characterization). |
| United Arab Emirates Application No. P1128/13, Search Report and Examination Report with response deadline of May 14, 2017. |
| European Application No. 18151812.7, Extended European Search Report dated Jun. 18, 2018. |
| Yamniuk et al., “Functional Antagonism of Human CD40 Achieved by Targeting a Unique Species-Specific Epitope,” J Mol Biol 428:2860-2879 (2016). |
| Eurasian Application No. 201391564, Office Action dated Aug. 2, 2017 (with partial English translation/characterization). |
| Mexican Application No. MX/a/2013/011966, Office Action with response deadline of Dec. 5, 2017 (partial English translation/characterization). |
| Canadian Application No. 2,833,743, Office Action dated Feb. 20, 2018. |
| Korean Application No. 10-2017-7011260, Office Action dated Feb. 25, 2018 (with partial English translation/characterization). |
| Indian Application No. 9863/DELNP/2013, Office Action dated Feb. 22, 2018 (with partial English translation/characterization). |
| Canadian Application No. 2,833,743, Office Action dated Mar. 19, 2019. |
| Brazilian Application No. BR112013026828-0, Pre-Examination Office Action dated Apr. 12, 2019 (with partial English translation/characterization). |
| Vonderheide et al., 2013, “Agonistic CD40 antibodies and cancer therapy,” Clin Cancer Res. 19(5): 1035-1043. |
| Jefferis, 2009, “Glycosylation as a strategy to improve antibody-based therapeutics,” Nature Rev Drug Discov. 8(3): 226-234. |
| Kasran, et al., “Safety and tolerability of antagonist anti-human CD40 Mab ch5D12 in patients with moderate to severe Crohn's disease,” Alimentary Pharmacology & Therapeutics, 2005, 22: 111-122. |
| Byrd JC et al., “Phase I study of the anti-CD40 humanized monoclonal antibody lucatumumab (HCD122) in relapsed chronic lymphocytic leukemia,” Leuk Lymphoma. Nov. 2012, 53(11):213642; (Author manuscript, PMCID PMC3808981, Oct. 28, 2013). |
| European Medicines Agency (EMEA). (2007) Guideline on Strategies to identify and mitigate risks for first-in-human clinical trials with investigational medicinal products. EMEA/CH MP/SWP/28367/07. |
| Winkler, et al., “Changing the Antigen Binding Specificity by Single Point Mutations of an Anti-p24 (HIV-1) Antibody,” The Journal of Immunology, 2000, vol. 165, No. 8, pp. 4505-4514. |
| Bai, et al., “A Guide to Rational Dosing of Monoclonal Antibodies,” Clinical Pharmacokinetics, 2012, vol. 51, No. 2, pp. 119-135. |
| Vonderheide RH et al., “Clinical activity and immune modulation in cancer patients treated with CP-870,893, a novel CD40 agonist monoclonal antibody,” J Clin Oncol. 2007, 25(7):876-83. |
| Walpole et al., “The weight of nations: an estimation of adult human mass,” BMC Public Health, 2012, 12:439. |
| Number | Date | Country | |
|---|---|---|---|
| 20170015754 A1 | Jan 2017 | US |
| Number | Date | Country | |
|---|---|---|---|
| 61477904 | Apr 2011 | US |
| Number | Date | Country | |
|---|---|---|---|
| Parent | 14112049 | US | |
| Child | 15259828 | US |
