This invention relates to the field of biological medicine, and in particular to a pharmaceutical composition containing insulin-like growth factor-2 and use thereof.
Macrophages are specialized immune cells distributed in all parts of the body. They remove the senescence cells, certain cells that cannot be recognized as their own, cell debris and so on through phagocytosis. As the professional antigen presenting cells, macrophages initiate the immune responses of unsensitized T cells and trigger the inflammatory response. However, inflammatory cytokines expressed by macrophages such as TNFα and IL-1 also play important roles in the pathogenesis of many autoimmune diseases. Removal of pathogenic macrophages has been shown to significantly inhibit autoimmune encephalomyelitis and inflammatory bowel diseases. In addition to their pro-inflammatory properties, macrophages can be regulated by different circumstances factors into cells with immunosuppressive effect, such as macrophages marked by expressing IL-1β , Arginase I, etc, as well as macrophages with immunosuppressive function which are formed by different immune stimuli in the evolution process of monocytes to macrophages, thereby directly or indirectly regulating the body's immune response. It has been reported that spermidine treated macrophages are able to powerfully treat autoimmune diseases, indicating that macrophages with immunosuppressive effect have significant therapeutic effects in autoimmune diseases.
Currently, there is limited understanding on the application of macrophages to treat autoimmune diseases. New therapeutic strategies employing the plasticity of macrophages for autoimmune diseases are urgently need in the art.
The present invention provides a composition containing insulin-like growth factor-2 and the uses thereof.
The first aspect of the invention provides a use of insulin-like growth factor-2 (IGF-2) to prepare a composition (including a chemical preparation and a pharmaceutical composition) to (i) increase PD-L1 expression in macrophage and/or (ii) inhibit IL-1β expression in macrophage.
In another preferred embodiment, the IGF-2 includes full length IGF-2 and an active fragment of IGF-2.
In another preferred embodiment, the active fragment of IGF-2 is an active fragment having amino acids from position 25 to position 91 of IGF-2.
In another preferred embodiment, the active fragment of IGF-2 is the amino acid sequence of position 25 to position 91 of IGF-2.
In another preferred embodiment, the IGF-2 is from human and non-human mammals.
In another preferred embodiment, the amino acid sequence of the IGF-2 is shown in SEQ ID NO.:1.
In another preferred embodiment, the pharmaceutical composition is also used for one or more of the purposes selected from the group consisting of:
(a) promoting oxidative phosphorylation metabolic pathway in macrophage;
(b) promoting differentiation of regulatory T cell;
(c) inhibiting differentiation of Th1 cell and/or Th17 cell; and
(d) treating autoimmune disease.
In another preferred embodiment, the autoimmune disease is selected from the group consisting of multiple sclerosis, inflammatory bowel disease, autoimmune encephalomyelitis, autoimmune hepatitis, systemic lupus erythematosus, rheumatoid arthritis, insulin resistance, diabetes, liver cirrhosis or a combination thereof.
In another preferred embodiment, the insulin resistance or the diabetes is obesity-induced insulin resistance or obesity-induced diabetes.
In another preferred embodiment, the pharmaceutical composition comprises (a) IGF-2; and (b) a pharmaceutically acceptable carrier.
In another preferred embodiment, the pharmaceutical composition comprises 0.001-99 wt %, preferred 0.1-90 wt %, and more preferred 1-80% IGF-2, based on the total weight of the pharmaceutical composition.
In another preferred embodiment, the pharmaceutical composition comprises macrophage scavenger, and the scavenger is a formulation for removing macrophage or inhibiting macrophage migration.
In another preferred embodiment, the pharmaceutical composition comprises agonist of PD-L1.
In another preferred embodiment, the pharmaceutical composition is liquid or lyophilized formulation.
In another preferred embodiment, the pharmaceutical composition is an injection formulation.
The second aspect of the invention provides a use of macrophage treated with insulin-like growth factor-2 (IGF-2) for preparing a pharmaceutical composition for one or more of the purposes selected from the group consisting of:
(b) promoting differentiation of regulatory T cell;
(c) inhibiting differentiation of Th1 cell and/or Th17 cell; and
(d) treating autoimmune disease.
In another preferred embodiment, macrophage is cultured in the presence of IGF-2 to obtain the macrophage treated with the IGF-2.
The third aspect of the invention provides a pharmaceutical composition comprising (a) IGF-2 or the active fragment thereof (such as active fragment having amino acids from position 25 to position 91), (b) optionally, macrophage scavenger, (c) optionally, PD-L1 promoter, and (d) a pharmaceutically acceptable carrier.
In another preferred embodiment, at least one of the components (b) and (c) is present.
In another preferred embodiment, the macrophage scavenger is an agent for removing macrophage or inhibiting macrophage migration.
In another preferred embodiment, the formulation of the pharmaceutical composition is an injection formulation, sustained release formulation or topical formulation.
In another preferred embodiment, the pharmaceutical composition is used for one or more of the purposes selected from the group consisting of:
(a) promoting PD-L1 expression in macrophage;
(b) inhibiting IL-1β expression in macrophage;
(c) promoting differentiation of regulatory T cell;
(d) inhibiting differentiation of Th1 cell and/or Th17 cell; and
(e) treating autoimmune disease.
In another preferred embodiment, the pharmaceutical composition comprises macrophage scavenger which depletes macrophage or suppresses macrophage migration.
In another preferred embodiment, the macrophage scavenger is selected from the group consisting of: CCR2 inhibitor (to inhibit macrophage migration), clodronate disodium liposome (to remove macrophage) and a combination thereof.
In another preferred embodiment, if the pharmaceutical composition comprises component (a), component (b) and component (c), the mass ratio of component (a): component (b): component (c) is (1-100): (1-100): (1-100).
In another preferred embodiment, if the pharmaceutical composition comprises component (a) and component (b), the mass ratio of component (a): component (b) is (1-100): (1-100).
In another preferred embodiment, if the pharmaceutical composition comprises component (a) and component (c), the mass ratio of component (a): component (c) is (1-100): (1-100).
In another preferred embodiment, the ratio (mg: mg) of IGF-2 active fragment having amino acids from position 25 to position 91 to macrophage scavenger ranges from 1:100 to 100:1, preferably, from 1:20 to 20:1.
In another preferred embodiment, the total content of IGF-2 active fragment having amino acids from position 25 to position 91 and macrophage scavenger is 1 to 99 wt % of the pharmaceutical composition, preferably, 5 to 90wt % of the total pharmaceutical composition.
The fourth aspect of the invention provides a pharmaceutical composition comprising (a1) IGF-2 inhibitor, (b1) optionally, macrophage agonist, (c1) optionally, PD-L1 inhibitor, and (d1) a pharmaceutically acceptable carrier.
In another preferred embodiment, at least one of the components (b1) and (c1) is present.
In another preferred embodiment, the PD-L1 inhibitor includes PD-L1 antibodies.
In another preferred embodiment, if the pharmaceutical composition comprises component (a1), component (b1) and component (c1), the mass ratio of component (a1): component (b1): component (c1) is (1-100): (1-100): (1-100).
In another preferred embodiment, if the pharmaceutical composition comprises component (a1) and component (b1), the mass ratio of component (a1): component (b1) is (1-100): (1-100).
In another preferred embodiment, if the pharmaceutical composition comprises component (a1) and component (c1), the mass ratio of component (a1): component (c1) is (1-100): (1-100).
The fifth aspect of the invention provides a macrophage pre-treated with IGF-2.
In another preferred embodiment, in the macrophage, the PD-L1 expression is up-regulated and/or (ii) the IL-1β expression is down-regulated.
In another preferred embodiment, the up-regulation referred to that the ratio of PD-L1 expression quantity in treated macrophage (M1) to PD-L1 expression quantity in untreated macrophage (M0) M1/M0 is ≥1.5, preferably, M1/M0≥2.0, more preferably, M 1/M0≥3.0. In another preferred embodiment, the down-regulation referred to that the ratio of IL-1β expression quantity in untreated macrophage (N0) to IL-1β expression quantity in treated macrophage (N1) N0/N1 is ≥1.5, preferably, N0/N1≥2.0, more preferably, N0/N1≥3.0.
In another preferred embodiment, the treatment includes exposing macrophage to IGF-2 or IGF-2 active fragment for a period of time (such as 0.1-24 hours).
The sixth aspect of the invention provides a pharmaceutical composition for regulating T cell differentiation, which comprises IGF-2 treated macrophage and a pharmaceutically acceptable carrier.
In another preferred embodiment, the regulating T cell differentiation referred to (b) promoting differentiation of regulatory T cell; and/or (c) inhibiting differentiation of Th1 and/or Th17 cell.
In another preferred embodiment, the pharmaceutical composition is used for treating autoimmune disease.
The seventh aspect of the invention provides a non-therapeutic method for (i) promoting PD-L1 expression and/or (ii) inhibiting IL-1β expression in macrophage, which comprises the following steps:
(a) culturing macrophage in the presence of IGF-2 to (i) enhance PD-L1 expression and/or (ii) inhibit IL-1β expression.
In another preferred embodiment, the concentration of IGF-2 is 1 ng/ml-100 μg/ml, preferably, 3 ng/ml-1 μg/ml, and more preferably, 5 ng/ml-50 ng/ml.
The eighth aspect of the invention provides a polypeptide with a sequence of position 25 to position 91 of SEQ ID NO.: 1.
The ninth aspect of the invention provides a method for (i) enhancing PD-L1 expression and/or (ii) inhibiting IL-1β expression, which comprises the following steps:
(a) administrating IGF-2 to a subject in need.
In another preferred embodiment, the subject includes human and nonhuman mammal.
In another preferred embodiment, the dose of IGF-2 administered is 1 ng-1 mg/kg, preferably, 100 ng-100μg/kg, and more preferably, 1-10 μg/kg.
In another preferred embodiment, the method further comprises the steps of:
(b) applying macrophage scavenger, which is an agent for removing macrophage or inhibiting macrophage migration, to a subject in need.
In another preferred embodiment, the dose and frequency of macrophage scavenger are administered in a conventional manner.
In another preferred embodiment, the administration includes administrating simultaneously or successively.
The tenth aspect of the invention provides a medicine kit, which contains:
(i) a first container, which contains an active ingredient (a) IGF-2 or a medicine containing the active ingredient (a);
(ii) a second container, which contains an active ingredients (b) macrophage scavenger or a medicine containing the active ingredient (b), wherein the macrophage scavenger is an agent for removing macrophage or inhibiting macrophage migration, and
(iii) a specification describing the combined administration of the active ingredient (a) and the active ingredient (b) for treating an autoimmune disease.
In another preferred embodiment, the medicine in the first container or the second container is a formulation containing one single active ingredient (a) or a formulation containing one single active ingredient (b).
The eleventh aspect of the invention provides a use of the pharmaceutical composition in the third aspect and the medicine kit in the tenth aspect in preparation of a medicine for treating an autoimmune disease.
It should be understood that in the present invention, the technical features specifically described above and below (such as the Examples) can be combined with each other, thereby constituting a new or preferred technical solution, which needs not be described one by one, due to space limitations.
IGF-2 applied in the reference and description of
After extensive and thorough studies, the inventors have firstly established a pharmaceutical composition containing insulin-like growth factor-2 and use thereof. This invention provides the use of IGF-2 and its active fragment for preparing a pharmaceutical composition. The pharmaceutical composition can be used for (i) enhancing PD-L1 expression and/or (ii) inhibiting IL-1β expression in macrophages. The invention also provides a pharmaceutical composition containing insulin-like growth factor-2 as an active ingredient.
Specifically, in the invention, it is found that both insulin-like growth factor-2 (IGF-2) and the active fragment having amino acids from position 25 to position 91 of IGF-2 (IGF25-91) show significant therapeutic effects in the treatment of animal models of multiple sclerosis and colitis (experimental autoimmune encephalomyelitis and DSS-induced inflammatory bowel diseases), and can significantly inhibit the progression of the disease and the tissue damage and inflammatory infiltration in corresponding site. More importantly, IGF25-91 indirectly upregulates regulatory T cells (Treg) by inducing macrophages with low IL-1 expression and high PD-L1 expression, thereby promoting the recovery of autoimmune diseases. IGF25-91 mainly promotes the reprogramming of macrophages into macrophages with immunosuppressive function by affecting the aerobic glycolysis and oxidative phosphorylation pathways of macrophages, and such macrophages treated with IGF25-91 have a very significant effect on the treatment of autoimmune diseases. Based on the therapeutic effect of IGF25-91 on autoimmune diseases, the present invention clarifies the regulatory mechanism of IGF25-91 on macrophages, and it is found that IGF25-91 induces the application potential of macrophages with immunosuppressive function in the treatment of autoimmune diseases, thus forming a new technique for macrophage immunotherapy.
Insulin-Like Growth Factor-2
Insulin-like growth factor-2 (IGF-2) is a growth factor mainly synthesized in the liver and is abundantly present in the blood. IGF-2 has anti-apoptosis, growth regulation, insulin-like and mitotic functions. IGF-2 precursor protein, which is translated from mRNA, consists of 180 amino acids, as shown in the sequence SEQ ID NO.: 1 (mgipmgksmlvlltflafascciaayrpset lcggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletycatpakserdvstpptvlpdnfprypvgkffqydtwkqst qrlrrglpallrarrghvlakeleafreakrhrplialptqdpahggappemasnrk); The active form produced after modification after translation consists of 67 amino acids, as shown in the sequence SEQ ID NO.: 2 (ayrpseticggelvdtlqfvcgdrgfyfsrpasrvsrrsrgiveeccfrscdlalletycatpakse). The tertiary structure of IGF-2 is composed of three α-helixes and two β-sheets as shown in
At present, it is generally believed that IGF-2 has an important role in embryo development and can promote embryo development and organ formation. It has also been reported to be linked to memory and reproduction, and studies in genetically deficient mice have shown that lack of insulin-like growth factor-2 signaling can lead to poor brain development.
The present invention has found that administration of IGF-2 or active fragment having the amino acids sequence from position 25 to position 91 of IGF-2 (IGF25-91) alone can effectively treat experimental autoimmune encephalomyelitis or inflammatory bowel disease, which are two autoimmune diseases. In the lesion site, such as the spinal cord or colon of the diseased mice, the proportion of regulatory T cells in the IGF25-91 treatment group was significantly increased, and the proportions of TH1 and TH17 cells were significantly decreased.
However, when the in vitro T cell differentiation system was used to verify the effect of IGF25-91 on T cell differentiation, it was found that IGF25-91 could not directly affect the efficiency of T cell differentiation into Th1, Th17 and Treg. These studies suggest that IGF25-91 has an indirect effect on the proportion change of T cell subsets. Significant changes in the macrophage phenotype were also observed when insulin-like growth factor-2 was used to treat autoimmune diseases. It was found in the study that the expression of IL-1β in macrophages at the injury site of mice treated with IGF25-91 was significantly decreased, while the expression of PD-L1 was significantly increased, suggesting that IGF25-91 played a role in inhibiting autoimmune diseases through promoting the proportion of macrophages with anti-inflammatory effects.
It is found in the study that IGF25-91 does not directly induce the expression of anti-inflammatory genes in macrophages. However, the bone marrow or enterocoelia derived mature macrophages treated with IGF25-91 exhibit significantly decrease of IL-1β expression and significantly increase of PD-L1 expression in response to lipopolysaccharide stimulation. Macrophages play an important role in the occurrence and development of autoimmune diseases. A series of studies have shown that macrophages can exert strong proinflammatory ability under the stimulation of inflammatory factors such as interferon and lipopolysaccharide, which aggravate the process of autoimmune diseases. Studies have shown that insulin-like growth factor-2 alters the response of macrophages to inflammatory factors, and macrophages overexpress the anti-inflammatory molecule PD-L1 under the condition of proinflammatory stimulation. Therefore, the treatment of autoimmune diseases by IGF25-91 is likely to be achieved by reprogramming macrophages.
In order to clarify the role of macrophages treated with IGF25-91 in regulating Treg, macrophages induced by IGF25-91 were co-cultured with T cells after LPS pre-stimulation. It was found that macrophages treated with IGF25-91 could significantly promote the differentiation of Treg, and the promotion depended on the high expression of PD-L1. Further, the studies showed that macrophages treated with IGF25-91 could also be directly used to treat autoreactive encephalomyelitis and inflammatory bowel disease. During the treatment process, the infusion of these macrophages also promoted the increase of Treg proportion in mice.
In order to further explain how IGF25-91 affects the expression of PD-L1 in macrophages, a detailed comparison was made between macrophages treated with IGF25-91 and control cells. It was found that macrophages treated with IGF25-91 can significantly change the status of glucose metabolism pathway of macrophages, making them more apt to oxidative phosphorylation metabolic pathway. When blocking macrophages mitochondrial oxidative phosphorylation, the high expression of PD-L1 and the ability to promote Treg differentiation induced by insulin-like growth factor −2 in macrophages also disappeared. These studies illustrate that IGF25-91 endows macrophages with the ability of promoting Treg generation and treating autoimmune diseases by changing the metabolism tendencies of macrophages.
In conclusion, IGF25-91 plays a therapeutic role in multiple sclerosis and inflammatory bowel disease by inducing immunosuppressive macrophages and up-regulating regulatory T cells. Macrophages treated with IGF25-91 may play a therapeutic role in autoimmune diseases. In addition, the targeted regulation of aerobic glycolysis and oxidative phosphorylation in macrophages can induce the production of immunosuppressant macrophages and play a role in the treatment of various autoimmune diseases.
Pharmaceutical Composition and Instructions
This invention provides a pharmaceutical composition for (i) promoting PD-L1 expression and/or (ii) inhibiting IL-1β expression in macrophages. It contains a safe and effective dose of IGF-2 (or its active fragments) or contains IGF-2 treated macrophages.
The pharmaceutical composition of the invention can be used for (i) promoting PD-L1 expression and/or (ii) inhibiting IL-1β expression in macrophages. The pharmaceutical composition can be used together with other autoimmune diseases therapies.
The pharmaceutical composition of the invention can also contain macrophage scavenger which is an agent for removing macrophages or inhibiting macrophage migration. Experiments showed that the combination therapy of IGF-225-91 and macrophage scavenger played a more optimized role in the treatment of inflammatory diseases by reprogramming macrophages with immunosuppressive function.
The invention also provides a medicine kit comprising:
(i) a first container which contains an active ingredient (a) IGF-2 or a medicine containing the active ingredient (a);
(ii) a second container which contains an active ingredients (b) macrophage scavenger or a medicine containing the active ingredient (b), wherein the macrophage scavenger is agent for removing macrophage or inhibiting macrophage migration, and
(iii) an specification describing a combined administration of the active ingredient (a) and the active ingredient (b) for treating autoimmune diseases.
The pharmaceutical composition of the invention contains a safe and effective dose of IGF-2 and a pharmaceutically acceptable carrier. The carrier includes (not limited to): saline, buffer solution, glucose, water, glycerin, alcohol, powder and the combination thereof. The formulation of the medicine should be compatible with the method of administration.
The pharmaceutical composition of the invention can be prepared in the form of an injection, for example, by a conventional method using saline or an aqueous solution containing glucose and other adjuvants. Pharmaceutical compositions such as tablets and capsules may be prepared by conventional methods. Pharmaceutical composition such as injection, solution, tablet and capsule should be manufactured under sterile conditions. The pharmaceutical composition of the invention can also be made into powder for atomizing inhalation. The dose of the active ingredient is an effective dose, such as about 1 μg/kg-50 mg/kg, about 5 μg/kg-10 mg/kg, about 10 μg/kg-5 mg/kg of body weight per day. The pharmaceutical composition can be administered together with other therapies.
The pharmaceutical composition of the invention can be administered to a subject (such as human and non-human mammal) in routine manner. The representative way for administration includes (but not limit to): oral administration, injection and aerosol inhalation.
The pharmaceutical composition should be administered to a mammal in a safe and effective dose. The safe and effective dose is usually at least 10 μg/kg of body weight and no more than 50 mg/kg of body weight under most conditions. The preferred dose should range from 10 μg/kg to 20 mg/kg of body weight. The exact dose should be determined according to the administration route and the patient health conditions which are all within the expertise of a skilled physician.
The Main Advantages of the Present Invention Includes:
(a) IGF-2 and the active fragment thereof (from position 25 to position 91) can (i) promote PD-L1 expression and/or (ii) inhibit IL-1β expression in macrophages.
(b) Macrophages treated with IGF-2 or the active fragment thereof can promote Treg differentiation and inhibit Th1 cell and/or Th17 cell differentiation so as to treat autoimmune diseases.
(c) Combination therapy of IGF-2 or active fragment thereof with macrophage scavenger can be used for treating autoimmune diseases.
The present invention will be further illustrated below with reference to the specific examples. It should be understood that these examples are only to illustrate the invention but not to limit the scope of the invention. For the experimental methods in the following examples the specific conditions of which are not specifically indicated, they are performed under routine conditions, or as instructed by the manufacturers, unless otherwise specified. Unless indicated otherwise, parts and percentage are weight parts and weight percentage.
Materials and Methods
Establishment and Treatment of Experimental Autoreactive Encephalomyelitis EAE Model
(1) Preparation Before Experiment
Preparation of complete freund's adjuvant: heat inactivated mycobacterium tuberculosis (purchased from sigma) was added into incomplete freund's adjuvant until the final concentration reached 5 mg/ml, and the solution were thoroughly mixed before use.
Emulsification of antigen: Two glass syringes were connected through a three-way tube, an equal volume of antigen solution (300 μg MOG in 100 μL PBS) and 100 μL of complete Freund's adjuvant were added into the syringes, and the bubbles in the syringes were removed and the syringes were pushed back and forth to obtain an emulsion. After about 500 pushes, the push resistance would gradually increase indicating the ingredients were fully mixed into an emulsified state.
Preparation of pertussis toxin (PT) solution: pertussis toxin was dissolve in PBS at a working concentration of 1 ng/μL and 200 μL per mouse was injected through the tail vein.
(2) Establishment and Treatment of EAE Model
On day 0, 200 μL of the emulsified antigen was subcutaneously injected into the back of C57BL/6 mice (purchased from the Slack Shanghai Laboratory Animal Center of the Chinese Academy of Sciences) for antigen immunization, and 100 μL was injected into each side of the chest corresponding to the back. Meanwhile, 200 μL/mouse of PT was injected through the tail vein.
On day 2, 200 μL/mouse of PT was injected again through the tail vein.
From the ninth day, insulin-like growth factor 2 was used for treatment via intraperitoneal injection at a dose of 5 ng/mouse everyday. The saline treated group served as a positive control.
When macrophages were used for treatment, 5×106 macrophages were injected intraperitoneally on Day 9, 11, and 13, respectively, and clinical scores were recorded daily.
(3) Clinical Scoring of EAE
0: clinically normal; 0.5: tail drooping at the tip; 1: whole tail paralysis; 2: hind legs weakness; 3: one hind limb paralysis; 4. both hind limbs paralysis; 5: died.
2. Extraction of Lymphocytes from Spinal Cord
The spinal cord was removed from EAE mice and washed with PBS. The spinal cord was mechanically ground on a 70 μm pore size cell screen to obtain a single cell suspension. The obtained cell suspension was centrifuged, and the cells were resuspended in 30% percoll, and an equal volume of 70% percoll solution was gently added to the bottom. Centrifugation was carried out at 2000 rpm for 20 minutes at room temperature under zero acceleration. After centrifugation, cells were aspirated from the liquid junction layer of high-low density and washed twice with PBS to obtain lymphocytes.
3. In Vitro Proliferation Experiment of Splenocytes
After the EAE mice were sacrificed, the spleen of the mice was removed and a single cell suspension was obtained. The splenocytes were plated in a U-bottom 96-well plate at a number of 3-5×105 per well, and MOG was added to 20 ug/ml.
After incubation at 37° C. for 72 hours in an incubator, H3 labeled thymidine was added. After 6 hours, the well plate was freeze-thawed repeatedly and then vacuum-adsorbed onto a special filter. The scintillation solution was added and then detected on the machine.
4. Establishment and Treatment of Inflammatory Bowel Disease IBD Model
Dextran sodium sulfate (DSS) was formulated into a solution at a mass to volume ratio of 2.5:100, filtered with a 22 μm strainer to ensure sterility, and sealed with a parafilm.
8-10 weeks aged C57/BL6 female mice (purchased from Slack Shanghai Laboratory Animal Center of the Chinese Academy of Sciences) were selected and used. Dextran sodium sulfate solution was used to replace the drinking water to induce the model. The mice weight and feces were observed every day. The dextran sulfate sodium solution was changed or added every other day.
From the day of model induction, insulin-like growth factor-2 was injected intraperitoneally at a dose of 50 ng/mouse everyday. The saline treated group served as a positive control.
When macrophages were used for treatment, 5×107 macrophages were injected intraperitoneally on Day 1, 3, and 5, respectively, and the change of body weight was recorded daily.
5. Extraction of Lymphocyte from Colon Tissue
The colon was removed from the IBD mice, the feces were removed and washed with PBS. Then the colon was cut into 2 cm sections and rinsed twice in HBSS (1 mM DTT and 5 mM EDTA) under conditions of 250 rpm for 20 min at 37° C. The washed colon tissue was cut as much as possible with scissors and added into HBSS containing DNAase I, dispase and type VIII collegenase under the conditions of 250 rpm for 30 min at 37° C. The obtained cell suspension was centrifuged, and the cells were resuspended in 40% percoll, and an equal volume of 80% percoll solution was gently added to the bottom. Centrifugation was carried out at 2000 rpm for 20 minutes at room temperature under zero acceleration. After centrifugation, cells were aspirated from the liquid junction layer of high-low density and washed twice with PBS to obtain lymphocytes.
6. Hippocampal Test
Cells were implanted on the hippocampal test plate at a density of 1×105 cells per well. XF culture was supplemented with 10 mM glucose, 2 mM glutamine and 2 mM pyruvate to prepare a test medium. The cells were washed twice with the test medium before testing on the machine. Metabolic inhibitors were prepared using test medium: 1 μM oligomycin, 0.75 μM FCCP, 100 μM rotenone and 1 μM Mantimycin. The consumption rate of oxygen and the concentration of extracellular hydrogen ion at basic status and under drug stimulation conditions were measured. The instrument used was Extracellular flux analyzer.
7. Preparation and Treatment of Macrophages
The preparation process of bone marrow derived macrophages was as follows: mouse bone marrow was blown out with 1 ml syringe. After being full dispersed, the cells were centrifuged according to the condition of 400 g for 5 min. The supernatant was discarded, the cells were blown into single cell suspension, and the cells were laid on an uncoated culture dish in DMEM/F12 completely medium (containing 10% FBS, 20% L929 supernatant, 100 U/ml Penicillin, 100 U/ml Streptomycin, 2 mm L—Glutamine). At the fourth day of culture, 5 ml solution was added, and the cells were further cultured for 6 days, and mature macrophages could be obtained. IGF-2 stimulation was added on Day 1, 3 and 5, respectively.
The preparation process of peritoneal derived macrophages was as follows: 2 ml of 4% thioglycollate solution was intraperitoneally injected into 8-12 weeks aged C57BL/6 mice, cytokines or PBS were intraperitoneally injected daily every day. On the third day, mice were sacrificed. Macrophages in abdominal cavity were blown out by using a 10 ml syringe with 10 ml volume of PBS. After centrifugation, the cells were scattered to form a single cell suspension, and were then inoculated in an uncoated cell dish or a 6-well plate, for following experiments.
8. Co-Culture System of Macrophages and Naïve T Cells
Macrophages derived from mature bone marrow or peritoneal were stimulated with LPS for 24 hours. The stimulation solution was aspirated and cells were washed with PBS for three times to fully remove the residual LPS. Then, the macrophages (2.5×105) and selected CD4+CD62L+ T cells (1×106) were laid on a 96-well plate. After 72 hours of co-culture, the cells were blown out for flow cytometry staining and analysis.
9. Establish Obesity Modeling by High-Fat Diet Induction
C57/BL6 mice (purchased from slake Shanghai experimental animal center of Chinese academy of sciences) were fed with a high-fat diet for 20 weeks, starting from the 5th week.
10. Glucose Tolerance Test
The mice were starved overnight, and 1 g glucose/kg body weight was intraperitoneally injected. At different time points, a drop of tail venous blood of each mouse was siphoned into the blood glucose test paper, and blood glucose was measured with a blood glucose meter.
11. Insulin Tolerance Test
The mice were starved overnight for about 16 hours, and 0.75U insulin/kg body weight was intraperitoneally injected. At different time points, a drop of tail venous blood of each mouse was siphoned into the blood glucose test paper, and blood glucose was measured with a blood glucose meter, and accurate timing was conducted with a timer.
IGF25-91 can Treat Experimental Autoimmune Encephalomyelitis (EAE) Depending on its Regulation of Gene Expression in Macrophages
When treated with IGF25-91 in mice induced EAE, it was observed that IGF25-91 effectively alleviated the pathogenesis and severity of EAE, which was manifested by decreased clinical score, decreased number of infiltrating mononuclear cells in the spinal cord, and decreased proliferation of MOG-specific T cells in EAE mice (
When flow cytometry instrument was used to analyze immune cells in EAE mice, it was also found that although the use of IGF25-91 did not affect the percentage of macrophages in the spinal cord and spleen in EAE disease mice (
Macrophages Treated with IGF25-91 can Promote the Production of Treg and Treat EAE
In order to further study the effect of IGF25-91 on macrophages, two classical methods were used to prepare macrophages for research. One was inducing peritoneal macrophages with thioglycollate, and the other was differentiating macrophages using bone marrow cells stimulated by L929 cell culture supernatant. It was found that after receiving IGF25-91 treatment during the differentiation of macrophages, there was no significant change in the expression of co-stimulating molecules (CD80, CD86, MHC I, MHC II), TNF-α, IL-6, and TGF-β in peritoneal macrophages or bone marrow derived macrophages (
In order to further validate the immune regulation ability of macrophages treated with IGF25-91, the treated macrophages (including bone marrow derived macrophages and peritoneal derived macrophages) were used in the treatment of EAE. The results showed that macrophages pretreated with IGF25-91 could effectively alleviate the clinical scores of EAE, and promote the proportion of Treg in the spleen of EAE mice (
IGF25-91 Affected Gene Expression of Macrophages through Elevating Oxidative Phosphorylation Metabolic Pathway
To investigate the regulatory mechanism of IGF25-91 on macrophages, the properties of IGF25-91 pre-treated macrophages and control macrophages were compared and it was found that both glucose consumption and lactate accumulation were decreased in IGF25-91 pre-treated macrophages (
In order to confirm that the metabolic state of oxidative phosphorylation was the basis for the high expression of PD-L1 in macrophages and the promotion of Treg differentiation, oligomycin (an inhibitor of oxidative phosphorylation process) was used. It was found that once the oxidative phosphorylation was blocked, the high expression of PD-L1 in macrophages and the ability to promote the differentiation of Treg caused by IGF25-91 disappeared (
IGF25-91 and IGF25-91 Pre-Treated Macrophages are Effective in Treating Inflammatory Bowel Diseases (IBD).
To further validate the therapeutic effects of IGF25-91 on autoimmune diseases and the regulation of macrophages, IGF25-91 was used to treat IBD, an autoimmune disease dominated by the innate immune system. After treatment with IGF25-91, the weight loss of IBD mice was alleviated, colon injury and infiltration of monocytes in the colon were significantly reduced (
IGF25-91 and Macrophage Scavenger are more Effective in Treating Inflammatory Diseases
IGF25-91 can significantly inhibit inflammatory diseases, such as the above-mentioned multiple sclerosis and inflammatory bowel diseases. Moreover, this effect is closely related to the IGF25-91 regulation on macrophages which are reprogrammed into macrophages with immunosuppressive function, thus inhibiting over-strong inflammatory response. However, when inflammatory disease occurs, systemic and local inflammation is often accompanied by a large amount of proinflammatory macrophage infiltration, and the macrophage infiltration in inflammatory site often depends on an influx of peripheral monocytes and its evolution into proinflammatory macrophages. Therefore, we investigated whether a combination of clearance of resident proinflammatory macrophages and the reprogramming function of IGF25-91 on macrophages can optimize the treatment of inflammatory disease. On the 9th, 11th, and 13th day of EAE induction, mice in different experimental groups received IGF25-91, Clodronate liposome (for removing macrophage) or a combined injection of IGF25-91 and Clodronate liposome. The progress of EAE in mice was observed. It was found that single injection of IGF25-91 and Clodronate liposome could significantly inhibit the progress of EAE and had an effective therapeutic effect compared with the control group. More importantly, a combined injection of IGF25-91 and Clodronate liposome had a more significant therapeutic effect on EAE compared with other groups (
IGF25-91 Pre-Treated Macrophages can be Used to Treat Obesity-Induced Insulin Resistance.
Mice were fed with high fat diet for 20 weeks and then injected with PBS, macrophages (5×106) or IGF25-91 pre-treated macrophages (5×106). Two weeks after the treatment, glucose tolerance test and insulin tolerance test were conducted, and glucose changes in each group were detected. The results showed that IGF25-91 pre-treated macrophages could significant improve the ability of glucose tolerance in the insulin resistance mice (
All references mentioned in the present invention are incorporated herein by reference, as each of them is individually cited herein by reference. Further, it should be understood that, after reading the above contents, the skilled person can make various modifications or amendments to the present invention. All these equivalents also fall into the scope defined by the pending claims of the subject application.
Number | Date | Country | Kind |
---|---|---|---|
201611073977.1 | Nov 2016 | CN | national |
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/CN2017/113341 | 11/28/2017 | WO | 00 |