Patent Application
20220289864
This application includes an electronically submitted sequence listing in .txt format. The .txt file contains a sequence listing entitled “536CON_SequenceListing_ST25.txt” created on May 13, 2022 and is 188,267 bytes in size. The sequence listing contained in this .txt file is part of the specification and is hereby incorporated by reference herein in its entirety.
The present disclosure relates to a pharmaceutical composition including a human hyaluronidase PH20 variant having enhanced enzymatic activity and thermal stability and one or more drugs, and a method of treating a disease using the same.
The pharmaceutical composition according to the present disclosure may preferably be used for subcutaneous injection.
Drugs which should be administered in a high dose or in multiple doses, especially antibody drugs and the like, are generally administered via intravenous injection, and such injection takes about 90 minutes or longer, an additional preparation procedure should be accompanied for intravenous injection, thus both a patient, doctors and medical staff are inconvenienced, and additional costs are incurred. In contrast, subcutaneous injection has the advantage of enabling immediate administration, but the absorption rate is relatively low compared to intravenous injection, and when the injection amount is 3-5 mL or more, it may cause swelling and pain at the injection site, as absorption occurs slowly. As For this reason, subcutaneous injection of protein therapeutic agents is usually limited to solution injection of a small amount of 2 mL or less. However, upon subcutaneous administration (or subcutaneous injection) of hyaluronidase along with a therapeutic drug, hyaluronic acid distributed in the extracellular matrix is hydrolyzed by the action of hyaluronidase, and thus the viscosity of the subcutaneous area is reduced and the permeability of a substance is increased, and therefore, a high dose or multiple doses of a medicine can easily be delivered into the body.
There are six types of hyaluronidase genes in humans: Hyal1, Hyal2, Hyal3, Hyal4, HyalPS1, and PH20/SPAM1. Hyal1 and Hyal2 are expressed in most tissues, and PH20/SPAM1 (hereinafter, referred to as PH20) is expressed in the sperm cell membrane and the acrosomal membrane. HyalPS1 is not expressed because it is a pseudogene. PH20 is an enzyme (EC 3.2.1.35) that cleaves β-1,4 bonds between N-acetylglucosamine and glucuronic acid, which are sugars constituting hyaluronic acid. Human hyaluronidase PH20 has an optimal pH of 5.5, but exhibits some activity even at a pH of 7-8, whereas other human hyaluronidases, including Hyal1, have an optimal pH of 3-4 and have very weak activity at a pH of 7-8. The pH of subcutaneous areas in a human is about 7.4, which is substantially neutral, and thus, among various types of hyaluronidases, PH20 is widely applied in clinical use. Examples of the clinical use of PH20 include subcutaneous injection of an antibody therapeutic agent, use as an eye relaxant and an anesthetic additive in ophthalmic surgery, use in increase the access of an anticancer therapeutic agent to the tumor cells by hydrolyzing hyaluronic acid in the extracellular matrix of tumor cells, and use in promoting the resorption of body fluids and blood, which are excessively present in tissue.
Meanwhile, currently commercially available PH20 is in a form extracted from the testes of cattle or sheep. Examples thereof include Amphadase® (bovine hyaluronidase) and Vitrase® (sheep hyaluronidase).
Bovine testicular hyaluronidase (BTH) is obtained by removing a signal peptide and 56 amino acids on the C-terminus from bovine wild-type PH20 during post-translational modification. BTH is also a glycoprotein, and has a mannose content of 5% and a glucosamine content of 2.2%, based on the total constitution thereof including amino acids (Borders and Raftery, 1968). When animal-derived hyaluronidase is repeatedly administered to the human body at a high dose, a neutralizing antibody can be produced, and other animal-derived biomaterials contained as impurities in addition to PH20 may cause an allergic reaction. In particular, the use of PH20 extracted from cattle is limited due to concern over mad cow disease. In order to overcome these problems, studies on recombinant human PH20 proteins have been conducted.
Recombinant human PH20 proteins have been reported to be expressed in yeast (P. pastoris), DS-2 insect cells, animal cells, and the like (Chen et al., 2016, Hofinger et al., 2007). The recombinant PH20 proteins produced in insect cells and yeast differ from human PH20 in terms of the pattern of N-glycosylation during post-translational modification.
Among hyaluronidases, the protein structures of Hyal1 (PDB ID: 2PE4) (Chao et al., 2007) and bee venom hyaluronidase (PDB ID: 1FCQ, 1FCU, 1FCV) have been identified. Hyal1 is composed of two domains, a catalytic domain and an EGF-like domain, and the catalytic domain is in the form of (β/α)8, in which an alpha helix and a beta-strand, which characterize the secondary structure of the protein, are each repeated eight times (Chao et al., 2007). The EGF-like domain is completely conserved in variants in which the C-terminus of Hyal1 is spliced differently. The amino acid sequences of Hyal1 and PH20 are 35.1% identical, and the protein tertiary structure of PH20 has not yet been found.
In a structural/functional relationship study of human PH20, the C-terminal region of PH20 was found to be important for protein expression and enzymatic activity, and in particular, it has been reported that termination of the C-terminus with amino acids 477-483 is important for enzymatic expression and activity (Frost, 2007). The activity of full-length PH20 (amino acids 1-509) or a pH20 variant having a C-terminus truncated at position 467 was merely 10% or less of that of a pH20 variant having a C-terminus truncated at one site among positions 477 to 483 (Frost, 2007). Halozyme Therapeutics developed rHuPH20 (amino acids 36-482), which is a recombinant protein in which the C-terminus of mature PH20 was cleaved at Y482 (Bookbinder et al., 2006; Frost, 2007).
Meanwhile, although research is ongoing to develop various therapeutic drugs in the form of subcutaneous injections using human PH20, the problem of low stability of human PH20 itself still remains unsolved.
Against this technical background, the inventors of the present disclosure confirmed that human PH20 variants, including one or more amino acid residue substitutions in an alpha-helix 8 region (S347 to C381) and a linker region (A333 to R346) between alpha-helix 7 and alpha-helix 8 in the amino acid sequence of wild-type hyaluronidase PH20, and in which some of amino acids located at the N-terminus and/or the C-terminus of PH20 are cleaved, had very high enzymatic activity and thermal stability, and thus filed a patent application therefor (PCT/KR 2019/009215).
The inventors of the present application also confirmed that the PH20 variants according to the present disclosure may be applied to pharmaceutical compositions or formulations including drugs, e.g., antibody drugs, particularly high-dose anti-HER2 antibodies or immune checkpoint antibodies, and accordingly, pharmaceutical compositions and formulations according to the present disclosure including PH20 variants along with drugs such as anti-HER2 antibodies or immune checkpoint antibodies can be used for subcutaneous injection, and the activities of drugs such as antibody drugs and the PH20 variants are very stable and can be maintained for a long time, thus completing the present disclosure.
Therefore, the present disclosure has been made in view of the above problems, and it is an object of the present disclosure to provide a novel pharmaceutical composition including a PH20 variant having enhanced enzymatic activity and thermal stability and a drug, wherein the thermal stability and activity of the drug and the PH20 variant can be maintained for a long time, particularly a pharmaceutical composition that can be used for subcutaneous injection.
It is another object of the present disclosure to provide a method of treating a disease including administering the pharmaceutical composition according to the present disclosure to a subject in need of treatment.
In accordance with the present disclosure, the above and other objects can be accomplished by the provision of a pharmaceutical composition including (a) a drug and (b) a PH20 variant.
The PH20 variant included in the pharmaceutical composition according to the present disclosure may include one or more amino acid residue substitutions selected from the group consisting of S343E, M345T, K349E, L353A, L354I, N356E, and I361T in wild-type human PH20 having an amino acid sequence of SEQ ID NO: 1, and may further include amino acid residue substitution(s) in one or more regions selected from an alpha-helix 8 region (S347 to C381) and/or a linker region (A333 to R346) between alpha-helix 7 and alpha-helix 8, wherein some amino acid residues located at an N-terminus and/or a C-terminus are selectively cleaved.
The pharmaceutical composition according to the present disclosure may further include one or more selected from pharmaceutically acceptable additives, particularly a buffer, a stabilizer, and a surfactant.
The pharmaceutical composition according to the present disclosure may be used in the form of an injection formulation for subcutaneous injection.
The above and other objects, features and other advantages of the present disclosure will be more clearly understood from the following detailed description taken in conjunction with the accompanying drawings, in which:
Unless defined otherwise, all technical and scientific terms used herein have the same meanings as those generally understood by one of ordinary skill in the art to which the invention pertains. In general, the nomenclature used herein is well known and commonly used in the art.
An embodiment of the present disclosure relates to a pharmaceutical composition including (a) a drug and (b) a PH20 variant, and the pharmaceutical composition according to the present disclosure may be used for the prevention or treatment of a disease, and is preferably used for subcutaneous injection.
The human PH20 variant included in the pharmaceutical composition according to the present disclosure has some amino acid residue substitutions in the region corresponding to an alpha-helix region and/or a linker region thereof, preferably an alpha-helix 8 region (S347 to C381) and/or a linker region (A333 to R346) between alpha-helix 7 and alpha-helix 8, more preferably an amino acid region among T341 to N363, and most preferably T341 to I361, L342 to I361, S343 to I361, I344 to I361, M345 to I361, or M345 to N363, in the amino acid sequence of wild-type PH20 (having the amino acid sequence of SEQ ID NO: 1), preferably mature wild-type PH20 (having the sequence consisting of L36 to S490 in the amino acid sequence of SEQ ID NO: 1).
In the present disclosure, “mature wild-type PH20” refers to a protein comprising amino acid residues L36 to S490 of SEQ ID NO: 1, which lack M1 to T35, which form a signal peptide, and A491 to L509, which are not related to the substantial function of PH20, in the amino acid sequence of wild-type PH20 having the sequence of SEQ ID NO: 1.
Specifically, the PH20 variant or fragment thereof included in the pharmaceutical composition according to the present disclosure includes one or more mutations, preferably amino acid residue substitutions selected from the group consisting of S343E, M345T, K349E, L353A, L354I, N356E, and I361T, and most preferably one or more amino acid residue substitutions selected from the group consisting of L354I and N356E, in wild-type PH20 having the sequence of SEQ ID NO: 1.
In the present disclosure, the term “PH20 variant” is intended to include mutation of some amino acid residues, preferably substitution of amino acid residues in the sequence of wild-type human PH20, as well as the deletion of some amino acid residues at the N-terminus and/or the C-terminus together with such substitution of amino acid residues, and is used with substantially the same meaning as the expression “PH20 variant or a fragment thereof.”
The inventors of the present disclosure have verified novel PH20 variants or fragments thereof with increased enzymatic activity and thermal stability compared to wild-type PH20 can be provided through previous studies, based on experimental results in which, enzymatic activity and a protein aggregation temperature (Tagg) at a neutral pH are increased, when the amino acid sequences of an alpha-helix 8 region and a linker region between alpha-helix 7 and alpha-helix 8 of human PH20 are partially substituted with the amino acid sequences of an alpha-helix 8 region and a linker region between alpha-helix 7 and alpha-helix 8 of Hyal1 with high hydrophilicity.
Accordingly, the PH20 variant included in the pharmaceutical composition according to the present disclosure includes one or more amino acid residue substitutions selected from the group consisting of S343E, M345T, K349E, L353A, L354I, N356E, and I361T, preferably one or more amino acid residue substitutions selected from the group consisting of L354I and N356E, in the amino acid sequence of wild-type PH20 (having the amino acid sequence of SEQ ID NO: 1), preferably mature wild-type PH20 (having a sequence consisting of L36 to S490 in the amino acid sequence of SEQ ID NO: 1),
in which one or more amino acid residues in the region corresponding to an alpha-helix region and/or a linker region thereof, preferably in an alpha-helix 8 region (S347 to C381) and/or a linker region (A333 to R346) between alpha-helix 7 and alpha-helix 8, more preferably in an amino acid region corresponding to T341 to N363, T341 to I361, L342 to I361, S343 to I361, I344 to I361, M345 to I361, or M345 to N363, are substituted.
Particularly, in the PH20 variant included in the pharmaceutical composition according to the present disclosure, the alpha-helix 8 region (S347 to C381) and/or the linker region (A333 to R346) of alpha-helix 7 and alpha-helix 8 of wild-type PH20, preferably mature wild-type PH20, may be substituted with some amino acid residues in the amino acid sequence of a corresponding region of Hyal1 having the sequence of SEQ ID NO: 51 (see Tables 2 and 3), but the present disclosure is not limited thereto.
More specifically, the PH20 variant or fragment thereof included in the pharmaceutical composition according to the present disclosure preferably includes an amino acid residue substitution of L354I and/or N356E in the amino acid sequence of wild-type PH20, preferably mature wild-type PH20,
and preferably further includes an amino acid residue substitution at one or more positions selected from T341 to N363, particularly at one or more positions selected from the group consisting of T341, L342, S343, I344, M345, S347, M348, K349, L352, L353, D355, E359, 1361, and N363, but the present disclosure is not limited thereto, and
more preferably, further includes one or more amino acid residue substitutions selected from the group consisting of T341S, L342W, S343E, I344N, M345T, S347T, M348K, K349E, L352Q, L353A, D355K, E359D, I361T, and N363G, but the present disclosure is not limited thereto.
Preferably, the PH20 variant or fragment thereof included in the pharmaceutical composition according to the present disclosure may include an amino acid residue substitution selected from M345T, S347T, M348K, K349E, L352Q, L353A, L354I, D355K, N356E, E359D, and I361T,
and may further include one or more amino acid residue substitutions selected from the group consisting of T341S, L342W, S343E, I344N, and N363G, but the present disclosure is not limited thereto.
More preferably, the PH20 variant or fragment thereof included in the pharmaceutical composition according to the present disclosure may include, but is not limited to, any one substitution selected from the following groups:
(a) T341S, L342W, S343E, I344N, M345T, S347T, M348K, K349E, L352Q, L353A, L354I, D355K, N356E, E359D, and I361T;
(b) L342W, S343E, I344N, M345T, S347T, M348K, K349E, L352Q, L353A, L354I, D355K, N356E, E359D, and I361T;
(c) M345T, S347T, M348K, K349E, L352Q, L353A, L354I, D355K, N356E, E359D, and I361T;
(d) M345T, S347T, M348K, K349E, L352Q, L353A, L354I, D355K, N356E, E359D, I361T, and N363G;
(e) I344N, M345T, S347T, M348K, K349E, L352Q, L353A, L354I, D355K, N356E, E359D, and I361T; and
(f) S343E, I344N, M345T, S347T, M348K, K349E, L352Q, L353A, L354I, D355K, N356E, E359D, and I361T.
In the present disclosure, an expression, which is described by one-letter amino acid residue code together with numbers, such as “S347”, means the amino acid residue at the corresponding position in the amino acid sequence of SEQ ID NO: 1.
For example, “S347” means that the amino acid residue at position 347 in the amino acid sequence of SEQ ID NO: 1 is serine. In addition, “S347T” means that serine at position 347 of SEQ ID NO: 1 is substituted for threonine.
The PH20 variant included in the pharmaceutical composition according to the present disclosure is interpreted as including variants in which the amino acid residue at a specific amino acid residue position is conservatively substituted.
As used herein, the term “conservative substitution” refers to modifications of a PH20 variant that involves the substitution of one or more amino acids with amino acids having similar biochemical properties that do not cause loss of the biological or biochemical function of the corresponding PH20 variant.
A “conservative amino acid substitution” is one in which the amino acid residue is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined and are well known in the art. These families include amino acids with basic side chains (e.g., lysine, arginine, and histidine), amino acids with acidic side chains (e.g., aspartic acid and glutamic acid), amino acids with uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, and cysteine), amino acids with nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, and tryptophan), amino acids with beta-branched side chains (e.g., threonine, valine, and isoleucine), and amino acids with aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, and histidine).
It is anticipated that the PH20 variant included in the pharmaceutical composition according to the present disclosure will still retain the activity thereof despite having conservative amino acid substitutions.
In addition, the PH20 variant or fragment thereof included in the pharmaceutical composition according to the present disclosure is interpreted as including PH20 variants or fragments thereof having substantially the same function and/or effect as those/that of the PH20 variant or the fragment thereof according to the present disclosure, and having an amino acid sequence homology of at least 80% or 85%, preferably at least 90%, more preferably at least 95%, and most preferably at least 99% with the PH20 variant or fragment thereof according to the present disclosure.
The PH20 variants according to the present disclosure have increased expression levels in animal cells and an increased protein refolding rate, thereby having increased thermal stability compared to mature wild-type PH20. Furthermore, the enzymatic activity of the PH20 variants exceeded or was similar to that of mature wild-type PH20 despite the increase in thermal stability.
Meanwhile, it is known that, when some amino acids at the C-terminus, such as S490, of mature wild-type PH20 are additionally cleaved, the enzymatic activity is reduced, but the PH20 variants according to the present disclosure showed increased thermal stability and increased or similar enzymatic activities compared to mature wild-type PH20 even though the C-terminus of mature wild-type PH20 has an additionally cleaved sequence. In addition, the PH20 variants maintained enzymatic activities thereof when up to five amino acid residues were cleaved from the N-terminal amino acids, which indicates that residues starting from P41 of the N-terminus played an important role in protein expression and enzymatic activity.
Accordingly, the PH20 variant included in the pharmaceutical composition according to the present disclosure includes some amino acid residue substitutions in the alpha-helix 8 region (S347 to C381) and/or the linker region (A333 to R346) between alpha-helix 7 and alpha-helix 8 of wild-type PH20, and further includes some amino acid residue deletions at the C-terminus and/or the N-terminus, but the present disclosure is not limited thereto.
In one embodiment, the PH20 variant included in the pharmaceutical composition according to the present disclosure may include some amino acid residue deletions at the N-terminus resulting from cleavage before an amino acid residue selected from the group consisting of M1 to P42 at the N-terminus of the amino acid sequence of SEQ ID NO: 1, preferably before an amino acid residue L36, N37, F38, R39, A40, P41, or P42, and/or some amino acid residue deletions at the C-terminus resulting from cleavage after an amino acid residue selected from the group consisting of V455 to W509 at the C-terminus, preferably after an amino acid residue selected from the group consisting of V455 to S490, and most preferably, after an amino acid reside V455, C458, D461, C464, I465, D466, A467, F468, K470, P471, P472, M473, E474, T475, E476, P478, 1480, Y482, A484, P486, T488, or S490.
The expression “cleavage before L36, N37, F38, R39, A40, P41, or P42 at the N-terminus” means, respectively, that all amino acid residues from M1 to T35 immediately before L36, all amino acid residues from M1 to L36 immediately before N37, all amino acid residues from M1 to N37 immediately before F38, all amino acid residues from M1 to F38 immediately before R39, all amino acid residues from M1 to R39 immediately before A40, all amino acid residues from M1 to A40 immediately before P41, or all amino acid residues from M1 to P41 immediately before P42 in the amino acid sequence of SEQ ID NO: 1 are cleaved and removed. The expression “cleavage before M1 at the N-terminus of SEQ ID NO: 1” means that no cleavage occurs at the N-terminus.
In addition, the expression “cleavage after V455, C458, D461, C464, I465, D466, A467, F468, K470, P471, P472, M473, E474, T475, E476, P478, 1480, Y482, A484, P486, T488, or S490 of the C-terminus” means cleavage and removal of the amino acid residue following the V455, C458, D461, C464, 1465, D466, A467, F468, K470, P472, M473, E474, T475, E476, P478, 1480, Y482, A484, P486, T488, or S490, respectively, in the sequence of SEQ ID NO: 1. For example, cleavage after S490 means cleavage between S490 and A491.
Preferably, the human PH20 variant included in the pharmaceutical composition according to the present disclosure may have an amino acid sequence selected from the group consisting of the amino acid sequences of SEQ ID NOS: 5 to 50, more preferably the amino acid sequence of SEQ ID NO: 44, but the present disclosure is not limited thereto. In PH20 variants constructed in specific embodiments according to the present disclosure, the sequences of substituted or cleaved amino acids are shown in Table 4 below.
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
FRGPLLPNR
PFLWAWNAPSEFCLGKFDEPLDMSLF
IKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVCI
FRGPLLPNRPFTTV
WNAPSEFCLGKFDEPLDMSLF
IKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVCI
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
KE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVCIR
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
QAIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGV
IKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVCI
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
AIKE
YMDTTLNPYIINVTLAAKMCSQVLCQEQGVC
Meanwhile, previous studies reported that the enzymatic activity of wild-type PH20 changes depending on the cleavage positions of amino acid residues located at the C-terminus. In the present disclosure, however, a specific alpha helix forming the secondary structure of PH20 was substituted with the alpha helix of other human hyaluronidase, thereby constructing PH20 variants having higher stability than wild-type PH20, and in these variants, the interaction between the substituted alpha-helix domain and other secondary structures of PH20 shows a pattern different from that of wild-type PH20, so that the variants have a certain level of enzymatic activity or higher, regardless of the cleavage position at the C-terminus.
In addition, in the present disclosure, attempts were made to increase the expression of a recombinant PH20 protein by using the signal peptide of other proteins exhibiting high protein expression levels in animal cells, instead of the original signal peptide of human PH20.
Therefore, in another embodiment, the PH20 variant included in the pharmaceutical composition according to the present disclosure may include, at the N-terminus thereof, a signal peptide derived from human hyaluronidase-1 (Hyal1), a human growth hormone, or human serum albumin, instead of a signal peptide of wild-type PH20, which consists of M1 to T35, and preferably may include, as shown in Table 5, a human-growth-hormone-derived signal peptide having the amino acid sequence of MATGSRTSLLLAFGLLCLPWLQEGSA according to SEQ ID NO: 2, a human serum albumin-derived signal peptide having the amino acid sequence of MKWVTFISLLFLFSSAYS according to SEQ ID NO: 3, or a human Hyal1-derived signal peptide having the amino acid sequence of MAAHLLPICALFLTLLDMAQG according to SEQ ID NO: 4, but the present disclosure is not limited thereto.
Among the PH20 variants included in the pharmaceutical composition according to the present disclosure, a variant having a 6×His-tag attached to the C-terminus was named HM, and a variant without the 6×His-tag was named HP. In addition, mature wild-type PH20 (L36-S490) with a 6×His-tag attached to the C-terminus thereof was named WT, and mature wild-type PH20 (L36 to Y482) without the 6×His-tag and in which the C-terminus is cleaved after Y482 was named HW2.
HP46 (SEQ ID NO: 44) is a human PH20 variant obtained by modeling a protein structure using Hyal1 (PDB ID: 2PE4) (Chao et al., 2007), which is human hyaluronidase, with a known protein tertiary structure, and then substituting the amino acid sequence of amino acids of alpha-helix 8 and the linker region between alpha-helix 7 and alpha-helix 8 with the amino acid sequence of Hyal1, and subjecting the N-terminal to cleavage at F38 and subjecting the C-terminus to cleavage after F468. In particular, alpha-helix 8 is located outside the protein tertiary structure of PH20 and has less interaction with neighboring alpha helices or beta-strands than other alpha helices. In general, enzymatic activity and thermal stability have a trade-off relationship therebetween, and thus the higher the thermal stability of a protein, the lower the enzymatic activity, whereas, when the enzymatic activity is increased due to an improvement in the flexibility of the protein structure, the thermal stability tends to be reduced. However, the specific activity of HP46, measured by Turbidimetric assay at a pH of 7.0, was about 46 units/μg, which was evaluated to be about two times that of wild-type PH20, which was about 23 units/μg.
The thermal stability of a protein may be evaluated based on a melting temperature Tm, at which 50% of the protein tertiary structure is denatured, and on an aggregation temperature Tagg, at which aggregation between proteins occurs. In general, the aggregation temperature of a protein tends to be lower than the melting temperature thereof. The alpha-helix 8 of Hyal1 exhibits greater hydrophilicity than the alpha-helix 8 of PH20. The substituted alpha-helix 8 of Hyal1 increases the protein surface hydrophilicity of HP46, thereby causing the effect of delaying aggregation between proteins that occurs due to hydrophobic interactions, and thus the aggregation temperature is 51° C., which is observed to be an increase of 4.5° C. compared to the aggregation temperature of wild-type PH20, which is 46.5° C.
HP46 is a variant in which amino acid residues in the alpha-helix 8 and the linker region between alpha-helix 7 and alpha-helix 8 are substituted, wherein T341 is substituted with serine. When amino acid residue 341 is threonine, the enzyme activity is similar to that of wild-type PH20, but upon substitution with serine, the enzyme activity is increased about 2-fold, and it was confirmed that, even in a substrate gel assay, the resultant variant hydrolyzed hyaluronic acid 5 to 6 times more than wild-type PH20. Substrate gel assay involves protein denaturation and refolding processes, which means that the protein tertiary structure refolding and restoration of HP46 are enhanced compared to wild-type PH20.
The amount of the PH20 variant in the pharmaceutical composition according to the present disclosure is at least 50 units/mL, preferably in the range of 100 units/mL to 20,000 units/mL, more preferably in the range of about 150 units/mL to about 18,000 units/mL, still more preferably in the range of 1,000 units/mL to 16,000 units/mL, and most preferably in the range of 1,500 units/mL to 12,000 units/mL.
Examples of the drug included in the pharmaceutical composition according to the present disclosure include, but are not limited to, protein drugs, antibody drugs, small molecules, aptamers, RNAi, antisenses, and cellular therapeutic agents such as chimeric antigen receptor (CAR)-T or CAR-natural killer (NK), and it is possible to use not only currently commercially available drugs but also drugs in clinical trials or under development.
As the drug, a protein drug or an antibody drug may preferably be used.
The “protein drug” included in the pharmaceutical composition according to the present disclosure is a drug that consists of amino acids, and thus exhibits the effect of treating or preventing a disease through the activity of a protein, is a drug consisting of a protein other than the antibody drug, and may be selected from the group consisting of a cytokine, a therapeutic enzyme, a hormone, a soluble receptor and a fusion protein thereof, insulin or an analogue thereof, bone morphogenetic protein (BMP), erythropoietin, and a serum-derived protein, but the present disclosure is not limited thereto.
The cytokine included in the pharmaceutical composition according to the present disclosure may be selected from the group consisting of interferon, interleukin, colony-stimulating factor (CSF), tumor necrosis factor (TNF), and tissue growth factor (TGF), but the present disclosure is not limited thereto.
The therapeutic enzyme may include, but is not limited to, β-glucocerebrosidase and agalsidase β.
The soluble receptor included in the pharmaceutical composition according to the present disclosure is an extracellular domain of the receptor, and the fusion protein thereof is a protein in which the Fc region or the like of an antibody is fused to the soluble receptor. The soluble receptor is a soluble form of a receptor to which a disease-related ligand binds, and examples thereof include a form in which an Fc region is fused to the TNF-α soluble receptor (e.g., a product containing the ingredient etanercept and forms similar thereto), a form in which an Fc region is fused to the VEGF soluble receptor (a product containing the ingredient alefacept and forms similar thereto), a form in which an Fc region is fused to CTLA-4 (e.g., a product containing the ingredient abatacept or belatacept and forms similar thereto), a form in which an Fc region is fused to the interleukin 1 soluble receptor (e.g., a product containing the ingredient rilonacept and forms similar thereto), and a form in which an Fc region is fused to the LFA3 soluble receptor (e.g., a product containing the ingredient alefacept and forms similar thereto), but the present disclosure is not limited thereto.
The hormone included in the pharmaceutical composition according to the present disclosure refers to a hormone injected into the body or an analog thereof for the treatment or prevention of diseases caused by hormone deficiency and the like, and examples thereof include, but are not limited to, human growth hormone, estrogen, and progesterone.
The serum-derived protein included in the pharmaceutical composition according to the present disclosure is a protein present in plasma, and includes both proteins extracted from plasma and produced recombinant proteins, and examples thereof may include, but are not limited to, fibrinogen, von Willebrand factor, albumin, thrombin, factor II (FII), factor V (FV), factor VII (FVII), factor IX (FIX), factor X (FX), and factor XI (FXI).
The antibody drug included in the pharmaceutical composition according to the present disclosure may be a monoclonal antibody drug or a polyclonal antibody drug.
The monoclonal antibody drug according to the present disclosure is a protein containing a monoclonal antibody and a monoclonal antibody fragment that are capable of specifically binding to an antigen related to a specific disease. The monoclonal antibody also includes a bispecific antibody, and the protein containing a monoclonal antibody or fragment thereof conceptually includes an antibody-drug conjugate (ADC).
Examples of the antigen related to a specific disease include 4-1BB, integrin, amyloid beta, angiopoietin (angiopoietin 1 or 2), angiopoietin analog 3, B-cell-activating factor (BAFF), B7-H3, complement 5, CCR4, CD3, CD4, CD6, CD11a, CD19, CD20, CD22, CD30, CD33, CD38, CD52, CD62, CD79b, CD80, CGRP, Claudin-18, complement factor D, CTLA4, DLL3, EGF receptor, hemophilia factor, Fc receptor, FGF23, folate receptor, GD2, GM-CSF, HER2, HER3, interferon receptor, interferon gamma, IgE, IGF-1 receptor, interleukin 1, interleukin 2 receptor, interleukin 4 receptor, interleukin 5, interleukin 5 receptor, interleukin 6, interleukin 6 receptor, interleukin 7, interleukin 12/23, interleukin 13, interleukin 17A, interleukin 17 receptor A, interleukin 31 receptor, interleukin 36 receptor, LAG3, LFA3, NGF, PVSK9, PD-1, PD-L1, RANK-L, SLAMF7, tissue factor, TNF, VEGF, VEGF receptor, and von Willebrand factor (vWF), but the present disclosure is not limited thereto.
The followings are, but are not limited to, proteins including monoclonal antibodies or monoclonal antibody fragments against the antigens related to a specific disease:
utomilumab as an anti-4-1BB antibody;
natalizumab, etrolizumab, vedolizumab, and bimagrumab as antibodies against integrin;
bapineuzumab, crenezumab, solanezumab, aducanumab, and gantenerumab as antibodies against amyloid beta;
antibodies against angiopoietin such as AMG780 against angiopoietin 1 and 2, MEDI 3617 and nesvacumab against angiopoietin 2, and vanucizumab which is a bispecific antibody against angiopoietin 2 and VEGF;
evinacumab as an antibody against angiopoietin analog 3;
tabalumab, lanalumab, and belimumab as antibodies against B-cell-activating factor (BAFF);
omburtamab as an antibody against B7-H3;
ravulizumab and eculizumab as antibodies against complement 5;
mogamulizumab as an antibody against CCR4;
otelixizumab, teplizumab, and muromonab as antibodies against CD3, tebentafusp as a bispecific antibody against GP100 and CD3, blinatumomab as a bispecific antibody against CD19 and CD3, and REGN1979 as a bispecific antibody against CD20 and CD3;
ibalizumab and zanolimumab as antibodies against CD4;
itolizumab as an antibody against CD6;
efalizumab as an antibody against CD11a;
inebilizumab, tafasitamab, and loncastuximab tesirine which is an ADC, as antibodies against CD19;
ocrelizumab, ublituximab, obinutuzumab, ofatumumab, rituximab, tositumomab, and ibritumomab tiuxetan which is an ADC, as antibodies against CD20;
epratuzumab, inotuzumab ozogamicin which is an ADC, and moxetumomab pasudotox as antibodies against CD22;
brentuximab vedotin as an ADC against CD30;
vadastuximab talirine and gemtuzumab ozogamicin as ADCs against CD33;
daratumumab and isatuximab as antibodies against CD38;
alemtuzumab as an antibody against CD52;
crizanlizumab as an antibody against CD62;
polaruzumab vedotin as an ADC against CD79b;
galiximab as an antibody against CD80;
eptinezumab, fremanezumab, galcanezumab, and erenumab as antibodies against CGRP;
zolbetuximab as an antibody against Claudin-18;
lampalizumab as an antibody against complement factor D;
tremelimumab, zalifrelimab, and ipilimumab as antibodies against CTLA4;
rovalpituzumab tesirine as an ADC against DLL3;
cetuximab, depatuxizumab, zalutumumab, necitumumab, and panitumumab as antibodies against the EGF receptor;
emicizumab as a bispecific antibody against coagulation factor IX and factor X, which are hemophilia factors;
nipocalimab and rozanolixizumab as antibodies against the Fc receptor;
burosumab as an antibody against FGF23;
farletuzumab as an antibody against the folate receptor and mirvetuximab soravtansine as an ADC against the folate receptor;
dinutuximab and naxitamab as antibodies against GD2;
otilimab as an antibody against GM-CSF;
margetuximab, pertuzumab, and trastuzumab as antibodies against HER2, and trastuzumab deruxtecan, trastuzumab emtansine, and trastuzumab duocarmazine as ADCs against HER2;
patritumab as an antibody against HER3;
anifrolumab as an antibody against interferon receptor;
emapalumab as an antibody against interferon gamma;
ligelizumab and omalizumab as antibodies against IgE;
dalotuzumab, figitumumab, and teprotumumab as antibodies against the IGF-1 receptor;
gebokizumab and canakinumab as antibodies against interleukin 1;
daclizumab and basiliximab as antibodies against the interleukin 2 receptor;
dupilumab as an antibody against the interleukin 4 receptor;
mepolizumab and reslizumab as antibodies against interleukin 5;
benralizumab as an antibody against the interleukin 5 receptor;
clazakizumab, olokizumab, sirukumab, and siltuximab as antibodies against interleukin 6;
sarilumab, satralizumab, tocilizumab, and REGN88 as antibodies against the interleukin 6 receptor;
secukinumab as an antibody against interleukin 7;
ustekinumab and briakinumab as antibodies against interleukin 12/23;
lebrikizumab and tralokinumab as antibodies against interleukin 13;
ixekizumab and bimekizumab as antibodies against interleukin 17A;
brodalumab as an antibody against interleukin 17 receptor A;
brazikumab, guselkumab, risankizumab, tildrakizumab, and mirikizumab as antibodies against interleukin 23;
nemolizumab as an antibody against the interleukin 31 receptor;
spesolimab as an antibody against the interleukin 36 receptor;
relatlimab as an antibody against LAG3;
narsoplimab as an antibody against NASP2;
fasinumab and tanezumab as antibodies against NGF;
alirocumab, evolocumab, and bococizumab as antibodies against PVSK9;
lambrolizumab, balstilimab, camrelizumab, cemiplimab, dostarlimab, prolgolimab, shintilimab, spartalizumab, tislelizumab, pembrolizumab, and nivolumab as antibodies against PD-1;
atezolizumab, avelumab, envafolimab, and durvalumab as antibodies against PD-L1, and bintrafusp alpha as a bispecific antibody against TGF beta and PD-L1;
denosumab as an antibody against RANK-L;
elotuzumab as an antibody against SLAMF7;
concizumab and marstacimab as antibodies against tissue factor;
antibodies against TNF, particularly TNFα, including infliximab, adalimumab, golimumab, the antibody fragment certolizumab pegol, and ozoralizumab which is a bispecific antibody against TNF and albumin;
antibodies against VEGF, including brolucizumab, ranibizumab, bevacizumab, and faricimab which is a bispecific antibody against VEGF and Ang2;
ramucirumab as an antibody against the VEGF receptor; and
caplacizumab as an antibody against vWF.
Meanwhile, the overexpression of human epidermal growth factor receptor 2 (HER2), which promotes cell division, is observed in about 20-25% of breast cancer patients, and HER2-over-expressed breast cancer progresses quickly, is aggressive, and has a low response to chemotherapy compared to HER2-low-expressed breast cancer, and thus the prognosis thereof is unfavorable. Trastuzumab, which is a monoclonal antibody drug targeting HER2, specifically binds to HER2 on the surfaces of HER2-overexpressing cancer cells to inhibit the signal transduction of cell replication and proliferation, thereby slowing tumor progression. Trastuzumab was approved by the United States Food and Drug Administration (FDA) in 1998 for the treatment of breast cancer in the United States, and in 2003 by the Korea Food and Drug Administration (KFDA). Since then, the efficacy of trastuzumab was also recognized in HER2-overexpressing gastric cancer, and thus has been used as a therapeutic agent for gastric cancer.
A Roche's Herceptin intravenous injection formulation (commercial name: Herceptin) consists of 440 mg of trastuzumab as a main ingredient, and lyophilized trastuzumab is mixed with physiological saline and injected into a vein. On the other hand, a subcutaneous injection formulation of trastuzumab (commercial name: Herceptin SC) is a 5 mL liquid formulation, and contains 600 mg (120 mg/mL) of trastuzumab as a main ingredient, and includes, as additives, 20 mM histidine (pH 5.5), 210 mM trehalose, 10 mM methionine, 0.04% polysorbate 20, and 10,000 units of rHuPH20 (2,000 Units/mL, 0.004%, 40 μg/mL).
The shelf life of Herceptin subcutaneous injection formulations is 21 months. The intravenous injection formulation of trastuzumab is in a lyophilized form and has a shelf life of 30 months, but the subcutaneous injection formulation of trastuzumab is in a liquid state and has a short shelf life of 21 months. For this reason, it can be estimated that the stability of one or more of trastuzumab and recombinant human hyaluronidase PH20 in liquid formulations is limited.
In this context, in the present disclosure, in view of the characteristics of the PH20 variant according to the present disclosure, in which, compared to wild-type human hyaluronidase PH20 and recombinant human PH20 available from Halozyme, the PH20 variant not only has increased enzymatic activity, but also has a high measured protein aggregation temperature, thus exhibiting enhanced thermal stability, the shelf life of the subcutaneous injection formulation is set to a long-term period, preferably 21 months or longer.
The content of the antibody drug in the pharmaceutical composition according to the present disclosure may be in the range of 5 mg/mL to 500 mg/mL, preferably 20 mg/mL to 200 mg/mL, more preferably 100 mg/mL to 150 mg/mL, and most preferably 120±18 mg/mL, for example, about 110 mg/mL, about 120 mg/mL, or about 130 mg/mL.
The polyclonal antibody included in the pharmaceutical composition according to the present disclosure is preferably a serum antibody extracted from serum such as immune globulin, but is not limited thereto.
In the case of a small-molecule compound, any drug that requires a rapid effect for prevention or treatment may be used without limitation. For example, morphine-based painkillers may be used (Thomas et al., 2009). In addition, when used as a therapeutic agent for tissue necrosis caused by anticancer drugs, the small-molecule compound may be used alone or in combination with antidote drugs such as Vinca alkaloids and Taxanes (Kreidieh et al., 2016).
The pharmaceutical composition according to the present disclosure may further include one or more selected from the group consisting of a buffer, a stabilizer, and a surfactant.
The buffer included in the composition according to the present disclosure may be used without limitation, as long as it enables realization of a pH of 4 to 8, preferably 5 to 7, and the buffer is preferably one or more selected from the group consisting of malate, formate, citrate, acetate, propionate, pyridine, piperazine, cacodylate, succinate, 2-(N-morpholino)ethanesulfonic acid (MES), histidine, Tris, bis-Tris, phosphate, ethanolamine, carbonate, piperazine-N,N′-bis(2-ethanesulfonic acid) (PIPES), imidazole, BIS-TRIS propane, N,N-bis(2-hydroxyethyl)-2-aminoethanesulfonic acid (BES), 3-(N-morpholino) propanesulfonic acid) (MOPS), hydroxyethyl piperazine ethane sulfonic acid (HEPES), pyrophosphate, and triethanolamine, more preferably a histidine buffer, e.g., L-histidine/HCl, but is not limited thereto.
The concentration of the buffer may be in the range of 0.001 mM to 200 mM, preferably 1 mM to 50 mM, more preferably 5 mM to 40 mM, and most preferably 10 mM to 30 mM.
Stabilizers in the composition according to the present disclosure may be used without limitation, as long as they are commonly used in the art for the purpose of stabilizing proteins, and preferably, the stabilizers may be, for example, one or more selected from the group consisting of carbohydrates, sugars or hydrates thereof, sugar alcohols or hydrates thereof, and amino acids.
Carbohydrates, sugars, or sugar alcohols used as the stabilizer may be one or more selected from the group consisting of trehalose or hydrates thereof, sucrose, saccharin, glycerol, erythritol, threitol, xylitol, arabitol, ribitol, mannitol, sorbitol, galactitol, fucitol, iditol, inositol, volemitol, isomalt, maltitol, polyglycitol, cyclodextrin, hydroxylpropyl cyclodextrin, and glucose, but is not limited thereto.
The amino acid may be one or more selected from the group consisting of glutamine, glutamic acid, glycine, lysine, lysilysine, leucine, methionine, valine, serine, selenomethionine, citrulline, arginine, asparagine, aspartic acid, ornithine, isoleucine, taurine, theanine, threonine, tryptophan, tyrosine, phenylalanine, proline, pyrrolysine, histidine, and alanine, but is not limited thereto.
The concentration of the sugars or sugar alcohols used as a stabilizer in the pharmaceutical composition according to the present disclosure may be in the range of 0.001 mM to 500 mM, preferably 100 mM to 300 mM, more preferably 150 mM to 250 mM, and most preferably 180 mM to 230 mM, and particularly, may be about 210 mM.
In addition, the concentration of amino acids used as a stabilizer in the pharmaceutical composition according to the present disclosure may be in the range of 1 mM to 100 mM, preferably 3 mM to 30 mM, more preferably 5 mM to 25 mM, and most preferably 7 mM to 20 mM, and specifically, may be in the range of 8 mM to 15 mM.
The composition according to the invention may further include a surfactant.
Preferably, the surfactant may be a non-ionic surfactant such as polyoxyethylene-sorbitan fatty acid ester (polysorbate or Tween), polyethylene-polypropylene glycol, polyoxyethylene-stearate, polyoxyethylene alkyl ethers, e.g., polyoxyethylene monolauryl ether, alkylphenyl polyoxyethylene ether [Triton-X], and a polyoxyethylene-polyoxypropylene copolymer [Poloxamer and Pluronic], and sodium dodecyl sulfate (SDS), but is not limited thereto.
More preferably, polysorbate may be used. The polysorbate may be polysorbate 20 or polysorbate 80, but is not limited thereto.
The concentration of the nonionic surfactant in the pharmaceutical composition according to the present disclosure may be in the range of 0.0000001% (w/v) to 0.5% % (w/v), preferably 0.000001% (w/v) to 0.4% (w/v), more preferably 0.00001% (w/v) to 0.3% (w/v), and most preferably 0.001% (w/v) to 0.2% (w/v).
In one embodiment, the pharmaceutical composition according to the present disclosure may include 50-350 mg/mL of an antibody, for example, an anti-HER2 antibody or an immune checkpoint antibody, histidine buffer providing a pH of 5.5±2.0, 10-400 mM α,α-trehalose, 1-50 mM methionine, and 0.0000001% (w/v) to 0.5% (w/v) of polysorbate.
In a more specific embodiment, the pharmaceutical composition according to the present disclosure may include 120 mg/mL of an anti-HER2 antibody or an immune checkpoint antibody, 20 mM histidine buffer that provides a pH of 5.5±2.0, 210 mM α,α-trehalose, 10 mM methionine, and 2,000 units/mL of a PH20 variant, and may further include 0.005% (w/v) to 0.1% (w/v) polysorbate.
The pharmaceutical composition according to the present disclosure may be administered via intravenous injection, subcutaneous injection, intramuscular injection, intraperitoneal injection, endothelial administration, topical administration, intranasal administration, intrapulmonary administration, intrarectal administration, and the like, and subcutaneous administration is preferably performed via subcutaneous injection, and it is more preferable to use the pharmaceutical composition as an injection formulation for subcutaneous injection.
Therefore, another embodiment of the present disclosure provides a formulation including the pharmaceutical composition according to the present disclosure, preferably an injection formulation for subcutaneous injection.
The injection formulation for subcutaneous injection may be provided in a ready-to-inject form without an additional dilution process, and may be provided after being contained in a pre-filled syringe, a glass ampoule, or a plastic container.
The present disclosure also relates to a method of treating a disease using the pharmaceutical composition or formulation according to the present disclosure.
The disease that can be treated using the pharmaceutical composition or formulation according to the present disclosure is not particularly limited, and there is no limitation thereto, as long as it is a disease that can be treated with a drug used in combination with the PH20 variant according to the present disclosure.
The disease that can be treated using the pharmaceutical composition or formulation according to the present disclosure may be cancer or an autoimmune disease, but is not limited thereto.
The cancer or carcinoma treatable with the pharmaceutical composition or formulation according to the present disclosure is not particularly limited, and includes both solid cancers and blood cancers. Examples of such cancers include skin cancer such as melanoma, liver cancer, hepatocellular carcinoma, gastric cancer, breast cancer, lung cancer, ovarian cancer, bronchial cancer, nasopharyngeal cancer, laryngeal cancer, pancreatic cancer, bladder cancer, colorectal cancer, colon cancer, cervical cancer, brain cancer, prostate cancer, bone cancer, thyroid cancer, parathyroid cancer, kidney cancer, esophageal cancer, biliary tract cancer, testicular cancer, rectal cancer, head and neck cancer, cervical cancer, ureteral cancer, osteosarcoma, neuroblastoma, fibrosarcoma, rhabdomyosarcoma, astrocytoma, neuroblastoma, and glioma, but is not limited thereto. Preferably, the cancer that can be treated using the pharmaceutical composition or formulation of the present disclosure may be selected from the group consisting of gastric cancer, colorectal cancer, breast cancer, lung cancer, and kidney cancer, but is not limited thereto.
Autoimmune diseases treatable with the pharmaceutical composition or formulation according to the present disclosure include rheumatoid arthritis, asthma, psoriasis, multiple sclerosis, allergic rhinitis, Crohn's disease, ulcerative colitis, systemic erythematous lupus, type I diabetes, inflammatory bowel disease (IBD), and atopic dermatitis, but is not limited thereto.
The present disclosure also provides a method of treating a disease including administering the pharmaceutical composition or formulation according to the present disclosure to a subject in need of treatment, and the present disclosure further provides the use of the pharmaceutical composition or formulation according to the present disclosure for the treatment of a disease.
Unless otherwise defined herein, the technical terms and scientific terms used in the present disclosure have meanings generally understood by those of ordinary skill in the art. In addition, repeated descriptions of the same technical configuration and operation as those of the related art will be omitted.
Hereinafter, the present disclosure will be described in further detail with reference to the following examples. These examples are provided for illustrative purposes only, and it will be obvious to those of ordinary skill in the art that these examples should not be construed as limiting the scope of the present disclosure.
Four trastuzumab subcutaneous injection formulations were prepared as shown in Table 6. Formulations 1 to 4 commonly contain 120 mg/mL of trastuzumab and consist of 20 mM histidine/histidine-HCl (pH 5.5), 210 mM trehalose, 10 mM methionine, and a PH20 variant. The difference among formulations 1-4 is the concentration of a nonionic surfactant, wherein formulation 1: 0% polysorbate 20, formulation 2: 0.005% polysorbate 20, formulation 3: 0.04% polysorbate 20, and formulation 4: 0.1% polysorbate 20.
Formulations 1 to 4 were left for 14 days at 45° C., and changes in protein concentration were analyzed using a spectrophotometer manufactured by Beckman. Each sample was diluted with distilled water so that the concentration of the sample was 0.4 mg/mL, and then absorbance at 280 nm of the protein was measured using a spectrophotometer. In a stability test under harsh conditions, i.e., at 45° C. for 14 days, there was no significant change in protein concentration of formulations 1 to 4. However, the activity of hyaluronidase was rapidly reduced at 45° C., and thus, in the present example, enzymatic activity was not measured (see
For size-exclusion chromatography analysis, an HPLC system available from Shimadzu Prominence and a TSK-gel G3000SWXL (7.8×300 mm, 5 μm) and a TSK guard column (6.0×4.0 mm, 7 μm) were used. As a mobile phase, 0.2 M potassium phosphate (pH 6.2) containing 0.25 M potassium chloride was used. Analysis was performed for 35 minutes by applying an isocratic separation mode at a flow rate of 0.5 mL/min. The sample was diluted with an analytical solvent so that the final concentration was 10 mg/mL, and after injecting 20 μL into the HPLC column, absorbance at 280 nm of the column eluate was recorded. The monomer ratio of trastuzumab in the HPLC chromatogram was calculated and graphed.
When size-exclusion chromatography analysis was performed in a stability test under harsh conditions, i.e., at 45° C. for 14 days, formulations 1 to 4 showed similar change patterns. The major changes were increases in high-molecular-weight (HMW) and low-molecular-weight (LMW) degradation products and a decrease in monomer content (about 1.5%), and there was no significant difference according to formulation. In conclusion, as a result of performing size-exclusion chromatography analysis in a stability test under harsh conditions, i.e., at 45° C., there was no significant difference in stability profile between the formulations according to the concentration of polysorbate 20 (0-0.1% (w/v)) (see
Dynamic light scattering (DLS) is used to analyze the denaturation properties of proteins attributable to heat. In the present experiment, a change in the size of a protein molecule according to the temperature change was measured and used for the purpose of calculating the protein aggregation temperature. For DLS analysis, a Zetasizer-nano-ZS instrument available from Malvern, and a quartz cuvette (ZEN2112) were used. In the analysis process, the temperature was increased from 25° C. to 85° C. at intervals of 1° C., and the sample was diluted to 1 mg/mL using each formulation buffer, and then 150 μL of the sample was added to the cuvette for analysis.
The aggregation temperature in formulation 1, not containing polysorbate 20, was 74° C., and the aggregation temperature in formulations 2 to 4 was 76° C. (see
For WCX chromatography analysis, a HPLC system available from Shimadzu Prominence, and as columns, a TSKgel CM-STAT column (4.6×100 mm, 7 μm), a TSKgel guard gel CMSTAT (3.2 mm i.d.×1.5 cm), and the like were used. Mobile phase A is 10 mM sodium phosphate (pH 7.5) and mobile phase B is 10 mM sodium phosphate (pH 7.2) containing 0.1 M NaCl. Analysis was carried out for 55 minutes with a linear concentration gradient of 0-30% mobile phase B at a flow rate of 0.8 mL/min. The sample was diluted with mobile phase A so that the final concentration was 1.0 mg/mL, 80 μL of the sample was injected into HPLC, and then absorbance of a column eluate at 280 nm was recorded. The monomer ratio of trastuzumab in the HPLC chromatogram was calculated and graphed.
Formulations 1 to 4 showed similar change patterns when WCX analysis was performed in a stability test under harsh conditions, i.e., at 45° C. for 14 days. Specific changes include an increase in the relative content of acidic variants (approximately 30% change for 14 days), a decrease in the main peak relative content (approximately 44% change for 14 days), and an increase in the relative content of basic variants (approximately 15% change for 14 days), and there was no significant difference according to formulation. In conclusion, in the WCX analysis in a stability test under harsh conditions, i.e., at 45° C., protein stability according to polysorbate 20 (0-0.1%) was similar (see
Three types of trastuzumab subcutaneous injection formulations were prepared as described in Table 7. Formulations 5 to 7 commonly include 120 mg/mL of trastuzumab, 20 mM histidine/histidine-HCl (pH 5.5), 210 mM trehalose, 10 mM methionine, and HP46. The difference among formulations 5-7 is the ingredient of stabilizer 3: formulation 5: 0.04% polysorbate 20, formulation 6: 50 mm Lys-Lys, and formulation 3: glycine.
Formulations 5 to 7 were left for 14 days at 45° C., and changes in protein concentration were analyzed using a spectrophotometer manufactured by Beckman. Each sample was diluted with distilled water so that the concentration of the sample was 0.4 mg/mL, and then absorbance of the protein at 280 nm was measured using a spectrophotometer. In a stability test under harsh conditions, i.e., at 45° C. for 14 days, there was no significant change in protein concentration of formulations 5 to 7. However, the activity of hyaluronidase was rapidly reduced at 45° C., and thus, in the present example, enzymatic activity was not measured (see
For size-exclusion chromatography analysis, an HPLC system available from Shimadzu Prominence and as columns, a TSK-gel G3000SWXL (7.8×300 mm, 5 μm) and a TSK guard column (6.0×4.0 mm, 7 μm) were used. As a mobile phase, 0.2 M potassium phosphate (pH 6.2) containing 0.25 M potassium chloride was used. An isocratic separation mode was applied at a flow rate of 0.5 mL/min for 35 minutes. The sample was diluted with an analytical solvent so that the final concentration was 10 mg/mL, and after injecting 20 μL of the sample into the HPLC column, absorbance at 280 nm was measured. The monomer ratio of trastuzumab in the HPLC chromatogram was calculated and graphed.
When size-exclusion chromatography analysis was performed in a stability test under harsh conditions, i.e., at 45° C. for 14 days, formulations 5 to 7 showed similar change patterns. The major changes were increases in high-molecular-weight (HMW) and low-molecular-weight (LMW) impurities and a decrease in monomer content (about 1.5%), and there was no significant difference according to formulation. In conclusion, as a result of performing size-exclusion chromatography analysis in a stability test under harsh conditions, i.e., at 45° C., similar protein stability was shown in 0.04% polysorbate 20, 50 mM Lys-Lys, and 50 mM glycine formulations (see
For WCX chromatography analysis, a HPLC system available from Shimadzu Prominence, and as columns, a TSKgel CM-STAT (4.6×100 mm, 7 μm), a TSKgel guard gel CMSTAT (3.2 mm i.d.×1.5 cm), and the like were used. Mobile phase A is 10 mM sodium phosphate (pH 7.5) and mobile phase B is 10 mM sodium phosphate (pH 7.2) containing 0.1 M NaCl. Analysis was performed for 55 minutes by applying a separation mode of a linear concentration gradient of 0-30% at a flow rate of 0.8 mL/min n. The sample was diluted with mobile phase A so that the final concentration was 1.0 mg/mL, 80 μL of the sample was injected into HPLC, and then absorbance at 280 nm was recorded. The monomer ratio of trastuzumab in the HPLC chromatogram was calculated and graphed.
Formulations 5 to 7 showed similar change patterns when WCX analysis was performed in a stability test under harsh conditions, i.e., at 45° C. for 14 days. Specific changes include an increase in the relative content of acidic variants (approximately 30% change for 14 days), a decrease in the main peak relative content (approximately 44% change for 14 days), and an increase in the relative content of basic variants (approximately 15% change for 14 days), and there was no significant difference according to formulation. In conclusion, as a result of performing WCX analysis in a stability test under harsh conditions, i.e., at 45° C., similar protein stability was shown in 0.04% polysorbate 20, 50 mM Lys-Lys, and 50 mM glycine formulations (see
To evaluate the stability of HP46 in subcutaneous injection formulations of trastuzumab, trastuzumab (120 mg/mL) and PH20 (2000 units/mL) were mixed. At this time, the buffer used contained 20 mM Histidine (pH 5.5), 210 mM trehalose, 10 mM methionine, and 0.04% polysorbate 20. The enzymatic activity of a control sample was measured on day 0, and the experimental samples were left at 40° C. or 45° C. for 1 day, and then the enzymatic activity of each sample was measured.
Each of a Herceptin subcutaneous injection formulation, trastuzumab+HW2, and trastuzumab+HP46 was left at 40° C. for 1 day, and then the activity of hyaluronidase was measured, and as a result, the respective cases exhibited activity of 51%, 47%, and 94%, which indicates that HP46 had the greatest thermal stability at 40° C. (see
Three trastuzumab subcutaneous injection formulations were prepared as shown in Table 8. Formulations 8 to 10 commonly contain 120 mg/mL of trastuzumab, 20 mM histidine/histidine-HCl (pH 5.5), 210 mM trehalose, 10 mM methionine, and a PH20 variant. The difference among formulations 8-10 is the concentration of a nonionic surfactant, wherein formulation 8: 0% polysorbate 20, formulation 9: 0.005% polysorbate 20, and formulation 10: 0.04% polysorbate 20.
Formulations 8 to 10 were left for 14 days at 40° C., and changes in protein concentration were analyzed using a spectrophotometer manufactured by Beckman. Each sample was diluted with distilled water so that the concentration of the sample was 0.4 mg/mL, and then absorbance at 280 nm of the protein was measured using a spectrophotometer. In a stability test under harsh conditions, i.e. at 40° C. for 14 days, there was no significant change in protein concentration of formulations 8 to 10.
For size-exclusion chromatography analysis, an HPLC system available from Shimadzu Prominence and as columns, a TSK-gel G3000SWXL (7.8×300 mm, 5 μm) and a TSK guard column (6.0×4.0 mm, 7 μm) were used. As a mobile phase, 0.2 M potassium phosphate (pH 6.2) containing 0.25 M potassium chloride was used. Analysis was performed for 35 minutes by applying an isocratic separation mode at a flow rate of 0.5 mL/min. The sample was diluted with an analytical solvent so that the final concentration was 10 mg/mL, and after injecting 20 μL of the sample into the HPLC column, absorbance at 280 nm was measured. The monomer ratio of trastuzumab in the HPLC chromatogram was calculated and graphed.
When size-exclusion chromatography analysis was performed in a stability test under harsh conditions, i.e., at 40° C. for 14 days, formulations 8 to 10 showed similar change patterns. The major changes were increases in high-molecular-weight (HMW) and low-molecular-weight (LMW) degradation products and a decrease in monomer content (about less than 1.0%), and there was no significant difference according to formulation. In conclusion, as a result of performing size-exclusion chromatography analysis in a stability test under harsh conditions, i.e., at 40° C., there was no significant difference in stability profile between the formulations according to the concentration (0-0.04%) of polysorbate 20 (see
Dynamic light scattering (DLS) is used to analyze the denaturation properties of proteins attributable to heat in the protein drug field. In the present experiment, a change in the size of a protein molecule according to the temperature change was measured and used for the purpose of calculating the protein aggregation temperature. For DLS analysis, a Zetasizer-nano-ZS instrument available from Malvern, and a quartz cuvette (ZEN2112) were used. In the analysis process, the temperature was increased from 25° C. to 85° C. at intervals of 1° C., and the sample was diluted to 1 mg/mL using each formulation buffer, and then 150 μL of the sample was added to the cuvette for analysis.
The aggregation temperature in formulation 8, not containing polysorbate 20, was 78.3° C., formulation 9 exhibited an aggregation temperature of 77.3° C., and formulation 10 exhibited an aggregation temperature of 77.7° C. In Example 13, no change in monomer ratio of the protein was shown despite not containing polysorbate 20, and as a result of comparing the case of not containing polysorbate 20 with the case of containing polysorbate 20, it was confirmed that there was no difference in aggregation between proteins. These results indicate that a minimum amount of polysorbate 20 is not necessarily required for subcutaneous injection formulations of trastuzumab (see
For WCX chromatography analysis, a HPLC system available from Shimadzu Prominence, and as columns, a TSKgel CM-STAT column (4.6×100 mm, 7 μm), a TSKgel guard gel CMSTAT (3.2 mm i.d.×1.5 cm), and the like were used. Mobile phase A is 10 mM sodium phosphate (pH 7.5) and mobile phase B is 10 mM sodium phosphate (pH 7.2) containing 0.1 M NaCl. Analysis was carried out for 55 minutes with a linear concentration gradient of 0-30% mobile phase B at a flow rate of 0.8 mL/min. The sample was diluted with mobile phase A so that the final concentration was 1.0 mg/mL, 80 μL of the sample was injected into HPLC, and then absorbance of a column eluate at 280 nm was recorded. The monomer ratio of trastuzumab in the HPLC chromatogram was calculated and graphed.
Formulations 8 to 10 showed similar change patterns when WCX analysis was performed in a stability test under harsh conditions, i.e., at 40° C. for 14 days. Specific changes include an increase in the relative content of acidic variants (approximately 10% change for 14 days), a decrease in the main peak relative content (approximately 40% change for 14 days), and an increase in the relative content of basic variants (approximately 300% change for 14 days), and there was no significant difference according to formulation. In conclusion, in the WCX analysis in a stability test under harsh conditions, i.e., at 40° C., protein stability according to polysorbate 20 (0-0.04%) was similar (see
Turbidimetric assay for measuring enzymatic activity is a method of measuring, by absorbance, the degree to which an aggregate is formed by binding of residual hyaluronic acid to acidified albumin (BSA), and when hyaluronic acid is hydrolyzed by PH20, the extent of binding to albumin is reduced, resulting in reduced absorbance. BTH (Sigma) as a standardized product was diluted to 1 unit/mL, 2 units/mL, 5 units/mL, 7.5 units/mL, 10 units/mL, 15 units/mL, 20 units/mL, 30 units/mL, 50 units/mL, and 60 unit/mL and prepared in each tube. Purified PH20 variant samples were diluted with enzyme diluent buffer (20 mM Tris.HCl, pH 7.0, 77 mM NaCl, 0.01% (w/v) bovine serum albumin) to 100×, 300×, 600×, 1200×, and 2400× and prepared in each tube. In fresh tubes, the hyaluronidase solution, having a concentration of 3 mg/mL, was diluted 10-fold to a concentration of 0.3 mg/mL so that the volume of each tube became 180 μL. 60 μL of the sample containing hyaluronidase was added to the diluted hyaluronic acid solution and mixed therewith, and allowed to react at 37° C. for 45 minutes. After the reaction was completed, 50 μL of the reacted enzyme and 250 μL of an acidic albumin solution were added to each well of a 96-well plate and shaken for 10 minutes, and then absorbance at 600 nm was measured using a spectrophotometer.
As a result of performing activity analysis in a stability test under harsh conditions, that is, at 40° C. for 14 days, it was confirmed that the higher the concentration of polysorbate 20, the greater the reduction in activity over time (see
Three trastuzumab subcutaneous injection formulations were prepared as shown in Table 9. Formulations 11 to 13 commonly contain 120 mg/mL of trastuzumab, 20 mM histidine/histidine-HCl (pH 5.5), 210 mM trehalose, 10 mM methionine, and a PH20 variant. The difference among formulations 11-13 is the concentration of a nonionic surfactant, wherein formulation 11: 0% polysorbate 80, formulation 12: 0.005% polysorbate 80, and formulation 13: 0.04% polysorbate 80.
When size-exclusion chromatography analysis was performed in a stability test under harsh conditions, i.e. at 40° C. for 14 days, formulations 11 to 13 showed similar change patterns. The major changes were increases in high-molecular-weight (HMW) and low-molecular-weight (LMW) degradation products and a decrease in monomer content (about less than 1.0%), and there was no significant difference according to formulation. In conclusion, as a result of performing size-exclusion chromatography analysis in a stability test under harsh conditions, i.e. at 40° C., there was no significant difference in stability profile between the formulations according to the concentration (0-0.04%) of polysorbate 80 (see
For WCX chromatography analysis, a HPLC system available from Shimadzu Prominence and as columns, a TSKgel CM-STAT column (4.6×100 mm, 7 μm), a TSKgel guard gel CMSTAT (3.2 mm i.d.×1.5 cm), and the like were used. Mobile phase A is 10 mM sodium phosphate (pH 7.5) and mobile phase B is 10 mM sodium phosphate (pH 7.2) containing 0.1 M NaCl. Analysis was carried out for 55 minutes with a linear concentration gradient of 0-30% mobile phase B at a flow rate of 0.8 mL/min. The sample was diluted with mobile phase A so that the final concentration was 1.0 mg/mL, 80 μL of the sample was injected into HPLC, and then absorbance of a column eluate at 280 nm was recorded. The monomer ratio of trastuzumab in the HPLC chromatogram was calculated and graphed.
Formulations 11 to 13 showed similar change patterns when WCX analysis was performed in a stability test under harsh conditions, i.e. at 40° C. for 14 days. Specific changes include an increase in the relative content of acidic variants (approximately 10% change for 14 days), a decrease in the main peak relative content (approximately 40% change for 14 days), and an increase in the relative content of basic variants (approximately 300% change for 14 days), and there was no significant difference according to formulation. In conclusion, in the WCX analysis in a stability test under harsh conditions, i.e. at 40° C., protein stability according to polysorbate 80 (0-0.04%) was similar (see
Turbidimetric assay for measuring enzymatic activity is a method of measuring, by absorbance, the degree to which an aggregate is formed by binding of residual hyaluronic acid to acidified albumin (BSA), and when hyaluronic acid is hydrolyzed by PH20, the extent of binding to albumin is reduced, resulting in reduced absorbance. BTH (Sigma) as a standardized product was diluted to 1 unit/mL, 2 units/mL, 5 units/mL, 7.5 units/mL, 10 units/mL, 15 units/mL, 20 units/mL, 30 units/mL, 50 units/mL, and 60 unit/mL and prepared in each tube. Purified protein samples were diluted with enzyme diluent buffer (20 mM Tris.HCl, pH 7.0, 77 mM NaCl, 0.01% (w/v) bovine serum albumin) to 100×, 300×, 600×, 1200×, and 2400× and prepared in each tube. In fresh tubes, the hyaluronidase solution, having a concentration of 3 mg/mL, was diluted 10-fold to a concentration of 0.3 mg/mL so that the volume of each tube became 180 μL. 60 μL of the sample containing hyaluronidase was added to the diluted hyaluronic acid solution, mixed therewith, and allowed to react at 37° C. for 45 minutes. After the reaction was completed, 50 μL of the reacted enzyme and 250 μL of an acidic albumin solution were added to each well of a 96-well plate and shaken for 10 minutes, and then absorbance at 600 nm was measured using a spectrophotometer.
As a result of performing activity analysis in a stability test under harsh conditions, that is, at 40° C. for 14 days, it was confirmed that the higher the concentration of polysorbate 80, the greater the reduction in activity over time (see
Three types of rituximab formulations were prepared as described in Table 10. Formulations 14 to 16 commonly include 120 mg/mL of rituximab, 20 mM histidine/histidine-HCl (pH 5.5), 210 mM trehalose, 10 mM methionine, and a PH20 variant. The difference among formulations 14-16 is the concentration of a non-ionic surfactant: formulation 14: 0% polysorbate 80, formulation 15: 0.005% polysorbate 80, and formulation 16: 0.06% polysorbate 80.
When size-exclusion chromatography analysis was performed in a stability test under harsh conditions, i.e. at 40° C. for 7 days, formulations 14 to 16 showed similar change patterns. The major changes were increases in high-molecular-weight (HMW) and low-molecular-weight (LMW) degradation products and a decrease in monomer content (less than about 1.0%), and there was no significant difference according to formulation. In conclusion, as a result of performing size-exclusion chromatography analysis in a stability test under harsh conditions, i.e. at 40° C., there was no significant difference in stability profile between the formulations according to the concentration (0-0.06%) of polysorbate 80 (see
Turbidimetric assay for measuring enzymatic activity is a method of measuring, by absorbance, the degree to which an aggregate is formed by binding of residual hyaluronic acid to acidified albumin (BSA), and when hyaluronic acid is hydrolyzed by PH20, the extent of binding to albumin is reduced, resulting in reduced absorbance. BTH (Sigma) as a standardized product was diluted to 1 unit/mL, 2 units/mL, 5 units/mL, 7.5 units/mL, 10 units/mL, 15 units/mL, 20 units/mL, 30 units/mL, 50 units/mL, and 60 unit/mL and prepared in each tube. Purified protein samples were diluted with enzyme diluent buffer (20 mM Tris.HCl, pH 7.0, 77 mM NaCl, 0.01% (w/v) bovine serum albumin) to 100×, 300×, 600×, 1200×, and 2400× and prepared in each tube. In fresh tubes, the hyaluronidase solution, having a concentration of 3 mg/mL, was diluted 10-fold to a concentration of 0.3 mg/mL so that the volume of each tube became 180 μL. 60 μL of the sample containing hyaluronidase was added to the diluted hyaluronic acid solution, mixed therewith, and allowed to react at 37° C. for 45 minutes. After the reaction was completed, 50 μL of the reacted enzyme and 250 μL of an acidic albumin solution were added to each well of a 96-well plate and shaken for 10 minutes, and then absorbance at 600 nm was measured using a spectrophotometer.
As a result of performing activity analysis in a stability test under harsh conditions, that is, at 40° C. for 7 days, it was confirmed that the higher the concentration of polysorbate 80, the greater the reduction in activity over time (see
Two types of commercially available rituximab formulations were prepared as described in Table 11. Formulation 17 is a commercially available buffer for subcutaneous injection formulations, and formulation 18 is a commercially available buffer for intravenous injection formulations. Formulations 17 and 18 contain a PH20 variant and rituximab at 120 mg/mL and 100 mg/mL, respectively, but do not contain polysorbate 80 unlike formulations of commercially available products.
Turbidimetric assay for measuring enzymatic activity is a method of measuring, by absorbance, the degree to which an aggregate is formed by binding of residual hyaluronic acid to acidified albumin (BSA), and when hyaluronic acid is hydrolyzed by PH20, the extent of binding to albumin is reduced, resulting in reduced absorbance. BTH (Sigma) as a standardized product was diluted to 1 unit/mL, 2 units/mL, 5 units/mL, 7.5 units/mL, 10 units/mL, 15 units/mL, 20 units/mL, 30 units/mL, 50 units/mL, and 60 unit/mL and prepared in each tube. Purified protein samples were diluted with enzyme diluent buffer (20 mM Tris.HCl, pH 7.0, 77 mM NaCl, 0.01% (w/v) bovine serum albumin) to 100×, 300×, 600×, 1200×, and 2400× and prepared in each tube. In fresh tubes, the hyaluronidase solution, having a concentration of 3 mg/mL, was diluted 10-fold to a concentration of 0.3 mg/mL so that the volume of each tube became 180 μL. 60 μL of the sample containing hyaluronidase was added to the diluted hyaluronic acid solution, mixed therewith, and allowed to react at 37° C. for 45 minutes. After the reaction was completed, 50 μL of the reacted enzyme and 250 μL of an acidic albumin solution were added to each well of a 96-well plate and shaken for 10 minutes, and then absorbance at 600 nm was measured using a spectrophotometer.
As a result of performing activity analysis in a stability test under harsh conditions, that is, at 40° C. for 6 days, it was confirmed that high activity was maintained even in the formulations not containing polysorbate 80, and particularly, formulation 18 maintained high activity (see
Four types of pembrolizumab formulations were prepared as described in Table 12. Formulations 19, 20, and 21 commonly include 25 mg/mL of pembrolizumab, 10 mM histidine (pH 5.5), 7% sucrose, 10 mM methionine, and a PH20 variant. The difference among formulations 19-21 is the concentration of a non-ionic surfactant: formulation 19: 0% polysorbate 80, formulation 20: 0.005% polysorbate 80, and formulation 21: 0.02% polysorbate 80. Formulation 22 contains 25 mg/mL of pembrolizumab and consists of 10 mM histidine (pH 5.5), 210 mM trehalose, 10 mM methionine, 0.02% polysorbate 80, and a PH20 variant.
Formulations 19, 20, 21, and 22 were left for 7 days at 40° C., and changes in protein concentration were analyzed using a spectrophotometer manufactured by Beckman. Each sample was diluted with distilled water so that the concentration of the sample was 0.4 mg/mL, and then absorbance of the protein at 280 nm was measured using a spectrophotometer.
In a stability test under harsh conditions, i.e. at 40° C. for 7 days, there was no significant change in protein concentration of formulations 19 to 22.
For size-exclusion chromatography analysis, an HPLC system available from Shimadzu Prominence and as columns, a TSK-gel G3000SWXL (7.8×300 mm, 5 μm) and a TSK guard column (6.0×4.0 mm, 7 μm) were used. As a mobile phase, 0.2 M potassium phosphate (pH 6.2) containing 0.25 M potassium chloride was used. Analysis was performed for 35 minutes by applying an isocratic separation mode at a flow rate of 0.5 mL/min. The sample was diluted with an analytical solvent so that the final concentration was 10 mg/mL, and after injecting 20 μL of the sample into the HPLC column, absorbance of the column eluate at 280 nm was measured. The monomer ratio of pembrolizumab in the HPLC chromatogram was calculated and graphed.
When size-exclusion chromatography analysis was performed in a stability test under harsh conditions, i.e., at 40° C. for 7 days, formulations 19, 20, 21, and 22 showed similar change patterns. There was no significant difference according to formulation in the change patterns of high-molecular-weight (HMW) and low-molecular-weight (LMW) degradation products. In conclusion, as a result of performing size-exclusion chromatography analysis in a stability test under harsh conditions, i.e., at 40° C., formulations 19, 20, 21, and 22 did not show any significant difference, and there was also no difference according to the type of sugar (see
A turbidimetric assay for measuring enzymatic activity is a method of measuring, by absorbance, the extent to which an aggregate is formed by binding of residual hyaluronic acid to acidified albumin (BSA), and when hyaluronic acid is hydrolyzed by PH20, the extent of binding to albumin is reduced, resulting in reduced absorbance. BTH (Sigma) as a standardized product was diluted to 1 unit/mL, 2 units/mL, 5 units/mL, 7.5 units/mL, 10 units/mL, 15 units/mL, 20 units/mL, 30 units/mL, 50 units/mL, and 60 unit/mL and prepared in each tube. Purified protein samples were diluted with enzyme diluent buffer (20 mM Tris.HCl, pH 7.0, 77 mM NaCl, 0.01% (w/v) bovine serum albumin) to 100×, 300×, 600×, 1200×, and 2400× and prepared in each tube. In fresh tubes, the hyaluronidase solution, having a concentration of 3 mg/mL, was diluted 10-fold to a concentration of 0.3 mg/mL so that the volume of each tube became 180 μL. 60 μL of the sample containing the enzyme was added to the diluted hyaluronic acid solution, mixed therewith, and allowed to react at 37° C. for 45 minutes. After the reaction was completed, 50 μL of the reacted enzyme and 250 μL of an acidic albumin solution were added to each well of a 96-well plate and shaken for 10 minutes, and then absorbance at 600 nm was measured using a spectrophotometer.
As a result of performing activity analysis in a stability test under harsh conditions, i.e., at 40° C. for 7 days, it was confirmed that as the concentration of polysorbate 80 increased, the reduction in activity over time was somewhat large. It was also confirmed that, when the same amount of polysorbate 80 was included, the reduction in activity was smaller in a trehalose-containing formulation than in a sucrose-containing formulation (see
For an experiment for confirming the pH-activity profiles of HP46 and wild-type HW2, a microturbidimetric assay method was used. A hyaluronic acid buffer for dissolving hyaluronic acid as a substrate and an enzyme buffer for diluting the enzyme were prepared for each pH.
A total of three 96-well plates were prepared for a reaction between the enzyme and the substrate and designated as A, B, and C, and an experiment was carried out.
A hyaluronic acid buffer at a pH of 4.0, 4.5, or 5.0 was prepared using 20 mM acetic acid and 70 mM NaCl, and a hyaluronic acid solution at a pH of 5.5, 6.0, 6.5, 7.0, or 8.0 was prepared using 20 mM sodium phosphate and 70 mM NaCl. 20 mg of hyaluronic acid was dissolved in 10 mL of each of the prepared hyaluronic acid buffers to prepare a final hyaluronic acid substrate solution, which was then diluted with each hyaluronic acid buffer prepared according to pH to prepare 500 μL of the resultant solution to a concentration of 0.1 mg/mL, 0.25 mg/mL, 0.45 mg/mL, or 0.7 mg/mL, and 100 μL of each solution was dispensed into each well of the 96-well plate designated as A. The hyaluronic acid buffers, diluted and prepared according to concentration, were used as calibration curves for measuring the concentration of hyaluronic acid.
An enzyme buffer at a pH of 4.0, 4.5, or 5.0 was prepared using 20 mM acetic acid, 0.01% (w/v) BSA, and 70 mM NaCl, and an enzyme buffer at a pH of 5.5, 6.0, 6.5, 7.0, or 8.0 was prepared using 20 mM sodium phosphate, 0.01% (w/v) BSA, and 70 mM NaCl.
HP46 and wild-type HW2 enzymes were diluted with the enzyme buffer prepared according to pH to 10 units/mL, and 50 μL of the resultant solution was dispensed into each well of the 96-well plate designated as B.
50 μL of the sample was transferred from each well of the 96-well plate designated as A to each well of the 96-well plate designated as B, followed by allowing a reaction to occur in a 37° C. shaking incubator for 45 minutes. 15 minutes before the reaction was completed, 200 μL of an acidic albumin solution was dispensed into each well of the 96-well plate designated as C and prepared, and when the enzymatic substrate reaction was completed, 40 μL of the sample was transferred from each well of the 96-well plate designated as B to each well of the 96-well plate designated as C, followed by allowing a reaction to occur for 20 minutes. After 20 minutes, absorbance at 600 nm was measured, and the amount of hyaluronic acid remaining after the enzymatic substrate reaction was calculated, and the active profiles of the enzymes according to pH were completed (see
To examine whether a subcutaneous injection formulation of trastuzumab and HP46 exhibits the same pharmacokinetic properties as those of a Herceptin subcutaneous injection formulation, an experiment was conducted using 9-week-old Sprague-Dawley rats. The dose of administered Herceptin and trastuzumab was 18 mg/kg of rat body weight, the amount of rHuPH20 included in the Herceptin subcutaneous injection formulation was 100 U, and the amount of HP46 was also 100 U. In the pharmacokinetic test, trastuzumab and HP46 showed the same Area Under the Curve (AUC) as that of the Herceptin subcutaneous injection formulation (see
A pharmaceutical composition according to the present disclosure can be used for subcutaneous injection and is also very stable, and the activity of PH20 variants along with a drug, preferably an antibody drug or the like, can be maintained for a long time. Thus, the pharmaceutical composition can contribute to a reduction not only in the cost of producing subcutaneous injection formulations but also in medical costs, and is very effective in terms of convenience of patients.
Although the preferred embodiments of the present disclosure have been disclosed for Illustrative purposes, those skilled in the art will appreciate that various modifications, additions and substitutions are possible, without departing from the scope and spirit of the invention as disclosed in the accompanying claims.
| Number | Date | Country | Kind |
|---|---|---|---|
| 10-2019-0033880 | Mar 2019 | KR | national |
This is a continuation under 35 U.S.C. § 1.20 of U.S. patent application Ser. No. 17/052,952 filed Nov. 4, 2020, which in turn is U.S. national phase under the provisions of 35 U.S.C. § 371 of International Patent Application No. PCT/KR2020/003975 filed Mar. 24, 2020, which in turn claims priority under 35 U.S.C. § 119 of Korean Patent Application No. 10-2019-0033880 filed. Mar. 25, 2019. The disclosures of all such applications are hereby incorporated herein by reference in their respective entireties, for all purposes.
| Number | Date | Country | |
|---|---|---|---|
| Parent | 17052952 | Nov 2020 | US |
| Child | 17744575 | US |
