Patent Application
20230257758
The contents of the electronic sequence listing (081906-1252964_SL.txt; Size: 610,655 bytes; and Date of Creation: Dec. 2, 2022) is herein incorporated by reference in its entirety.
In the soil, plants are constantly exposed to a microbe-rich environment that can be beneficial or detrimental to plant growth. When potentially compatible bacterial partners sense plant (host) signals, an extensive, multiple stage, chemical communication is established to develop a successful plant-microbe interaction (1, 2). By contrast, plants have unique defense mechanisms to fight pathogen infections, and the arms race between host plants and pathogens rapidly drives the coevolution of plant resistance genes and pathogen avirulence effectors (3, 4). The adaptation of plants to such environments involves shaping their microbiota through the action of root exudates (5). It was estimated that plants extrude up to 20% of their fixed carbon in exchange for benefits such as acquisition of phosphorus and nitrogen, defense against biotic and abiotic stresses (6, 7).
The best-characterized example of symbiosis between plant and bacteria is the association of legumes and nitrogen fixation rhizobia, with the characteristic formation of root nodules. The nodule is the main organ for nitrogen fixation and its formation requires common symbiotic pathways (1, 2). In the soil, Rhizobia sense the host chemical signals (for example, flavonoids) and further activate the expression of nod genes through the nodD-flavonoids interaction. Nod gene-encoded lipochitooligosaccharides (LCDs) can be recognized by the LysM receptor kinase, located at the plasma membrane of the legume root, and calcium spiking can be triggered in the nucleus. The calcium signal is decoded by Ca2+/CaM-dependent protein kinases (CCaMK) and the phosphorylation of the transcription factor CYCLOPS. A set of other transcription factors is then activated for the regulation of the curling of the host's root hairs and the growth of an infection thread, leading to the development of nodules (2, 8).
The legume-rhizobium symbiosis has a very strict specificity, such that each legume can interact with only a specific group of rhizobia and vice versa (9). This narrowed host range restricts the application of rhizobia to other important non-leguminous crops such as rice, wheat, or corn. On the other hand, non-leguminous crops may form mutualistic relationships with other plant growth promoting bacteria (PGPB) and benefit from their partners for their nitrogen needs. Nitrogen derived from air (Ndfa), estimated by 15N enrichment experiments, showed that biological nitrogen fixation (BNF) can contribute between 1.5˜21.0% of the total nitrogen requirement of rice, depending on the genotypes (10). Interestingly, the common symbiotic pathway seems to not be required for such interactions, at least for the case of Azoarcus sp.-rice interactions (11). How such mutualistic relationships are established or regulated remain to be investigated.
Biofilms are essential for optimal colonization of host plant and contribute to nitrogen fixation. Biofilms are often seeded by “aggregates” that are embedded in a self-produced matrix of extracellular polymeric substances (EPS) containing polysaccharides, proteins, lipids, and extracellular DNA (12). The matrix provides shelter and nutrients for the bacteria, and it contributes to tolerance/resistance toward antimicrobial compounds. In addition, biofilms enable effective interactions by chemical communication (quorum sensing) to remodel the soil bacterial community dynamically, making biofilms one of the most successful modes of life on earth (13). In some cases, biofilm formation is indispensable for a successful bacterial colonization. For example, the Gluconacetobacter diazotrophicus mutant MGD, which is defective in polysaccharide production, cannot form biofilm (does not produce EPS) and cannot attach to plant root surfaces nor colonize endophytically the roots (14).
The formation of the EPS matrix of biofilms also generates heterogeneity, including the establishment of stable gradients of nutrients, pH, and redox conditions. More importantly, because of the decreased oxygen diffusion across bacterial biofilms, free-living nitrogen-fixing bacteria (Azospirillum brasilense, Pseudomonas stutzeri, etc) are able to fix nitrogen under natural aerobic conditions (15), since the bacterial nitrogenase is protected from oxygen-induced damage due to the low oxygen concentration at the bacterial surface.
Flavonoids are a group of metabolites associated with cell signaling pathways, responses to microorganisms, and, in general, are correlated with the response of plants to oxidants. Flavonoids consist of benzene rings connected by a short carbon chain (3-4 carbons). Flavonoids comprise six major subtypes, including chalcones, flavones, isoflavonoids, flavanones, anthoxanthins, and anthocyanins (often responsible for the red/violet color of certain plant organs).
There is a need for new methods for developing crop plants with increased ability to fix atmospheric nitrogen, e.g., to allow them to grow under reduced inorganic nitrogen conditions. The present disclosure satisfies this need and provides other advantages as well.
The present disclosure provides methods and compositions for increasing the ability of plants to assimilate atmospheric nitrogen, in particular by modifying the plants such that they produce increased levels of flavones. The flavones can be exuded by the roots of the plant, inducing increased biofilm formation and N-fixation by bacteria in the soil.
In one aspect, the present disclosure provides a method of increasing the ability of a crop plant to assimilate atmospheric nitrogen, the method comprising modifying the expression of a gene involved in flavone biosynthesis or degradation in one or more cells of the plant such that the plant produces an increased amount of one or more flavones, wherein the one or more flavones are exuded from the plant's roots.
In some embodiments of the method, the one or more flavones induces biofilm formation in N-fixing bacteria present in the soil in proximity to the plant's roots. In some embodiments, the biofilm formation leads to an increase in the ability of the bacteria to fix atmospheric nitrogen, and wherein the fixed atmospheric nitrogen is assimilated by the plant. In some embodiments, the at least one of the one or more flavones are glycosylated. In some embodiments, the one or more flavones comprise apigenin, apigenin-7-glucoside, or luteolin.
In some embodiments, the expression of the gene in the one or more cells of the plant is modified by editing an endogenous copy of the gene. In some such embodiments, the endogenous copy of the gene is modified by introducing into one or more cells of the plant a guide RNA targeting the gene and an RNA-guided nuclease. In some embodiments, the method further comprises introducing into the one or more cells a donor template comprising sequences homologous to the genomic region surrounding the target site of the guide RNA, wherein the RNA-guided nuclease cleaves the DNA at the target site and the DNA is repaired using the donor template. In some embodiments, the RNA-guided nuclease is Cas9 or Cpf1.
In some embodiments, the endogenous copy of the gene is modified so as to reduce or eliminate its expression. In some such embodiments, the endogenous copy of the gene is deleted. In some embodiments, the gene is CYP 75B3 or CYP 75B4, or a homolog or ortholog thereof. In some embodiments, the gene comprises a nucleotide sequence that is substantially identical (sharing at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity) to any one of SEQ ID NOS: 2, 4, 6 or 8, or encodes a polypeptide comprising an amino acid sequence that is substantially identical (sharing at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity) to any one of SEQ ID NOS: 1, 3, 5, 7, or 14-120.
In some embodiments, the guide RNA comprises a target sequence that is substantially identical (e.g., comprising 0, 1, 2, or 3 mismatches) to any one of SEQ ID NOS: 11-13. In some embodiments, the guide RNA comprises a target sequence that is substantially identical (e.g., comprising 0, 1, 2, or 3 mismatches) to a sequence within SEQ ID NO: 9 or SEQ ID NO:10.
In some embodiments, the endogenous copy of the gene is modified so as to increase its expression. In some such embodiments, the endogenous copy of the gene is modified by replacing the endogenous promoter with a heterologous promoter. In some embodiments, the heterologous promoter is an inducible promoter. In some embodiments, the heterologous promoter is a constitutive promoter. In some embodiments, the heterologous promoter is a tissue-specific promoter. In some embodiments, the heterologous promoter is a root-specific promoter. In some embodiments, the gene is CYP 93G1 or a homolog or ortholog thereof. In some embodiments, the gene encodes a polypeptide comprising an amino acid sequence that is substantially identical (sharing at least about 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity) to any one of SEQ ID NOS: 121-145.
In some embodiments, the method further comprises generating a stable plant line from the one or more cells of the plant. In some embodiments, the crop plant is a grain crop. In some embodiments, the grain crop is rice. In some embodiments, the crop plant is selected from the group consisting of corn, wheat, rice, soy, cotton, canola, and sugarcane.
In another aspect, the present disclosure provides a genetically modified crop plant produced using the method of any one of the herein-described methods.
In another aspect, the present disclosure provides a genetically modified plant comprising: i) a mutation or deletion in a CYP75B3 or CYP75B4 gene, or homolog or ortholog thereof, that causes a reduced amount of CYP75B3 or CYP75B4 enzyme and/or enzymatic activity compared to a wild-type plant without the mutation or deletion in the CYP75B3 or CYP75B4 gene; or ii) an expression cassette comprising a polynucleotide encoding a CYP 93G1 gene, or a homolog or ortholog thereof, operably linked to a promoter, such that the plant comprises an increased amount of CYP93G1 enzyme and/or enzymatic activity compared to a wild-type plant without the expression cassette; wherein the genetically modified crop plant produces an increased amount of one or more flavones as compared to a wild-type plant that is not genetically modified, wherein the one or more flavones are exuded from the genetically modified crop plant's roots.
In some embodiments, the plant is selected from the group consisting of corn, wheat, rice, soy, cotton, canola, and sugarcane.
In another aspect, the present disclosure provides a method of increasing the assimilation of atmospheric nitrogen in a grain crop plant grown under reduced inorganic nitrogen conditions, the method comprising: providing a genetically modified crop plant in which the expression of a gene involved in flavone biosynthesis or degradation has been modified in one or more cells such that the roots of the plant exude increased amounts of one or more flavones as compared to a wild-type plant; and growing the plant in soil comprising an amount of inorganic nitrogen that is lower than a standard or recommended amount for the crop plant.
In some embodiments of the method, the crop plant is rice, and the amount of inorganic nitrogen in the soil is less than 50 ppm. In some such embodiments, the amount of inorganic nitrogen in the soil is about 25 ppm. In some embodiments, the genetically modified plant is any of the herein-described plants. In some embodiments, N2-fixing bacteria in the soil in which the genetically modified plant is grown show greater biofilm formation than control N2-fixing bacteria in soil in which a wild-type plant is grown. In some embodiments, N2-fixing bacteria in the soil in which the genetically modified plant is grown show greater adherence to the root surface and/or inside the root tissue of the plant than control N2-fixing bacteria in soil in which a wild-type plant is grown. In some embodiments, the crop plant is a grain crop, and wherein the number of tillers, tassels, or spikes in the genetically modified plant grown in the soil comprising the reduced amount of inorganic nitrogen is at least 30% greater than in a wild-type plant grown in equivalent soil. In some embodiments, the number of grain or seed-bearing organs and/or the seed yield in the genetically modified plant grown in the soil comprising the reduced amount of inorganic nitrogen is at least 30% greater than in a wild-type plant grown in equivalent soil. In some embodiments, the genetically modified plant grown in the soil comprising the reduced amount of inorganic nitrogen assimilates at least twice the amount of atmospheric nitrogen than the amount assimilated by a wild-type plant grown in equivalent soil.
The present disclosure provides methods for generating and using genetically modified plants to induce biofilm formation in N-fixing bacteria, increasing their ability to fix atmospheric nitrogen that is then assimilated by the plants, and thereby allowing them to grow efficiently under reduced inorganic nitrogen conditions. The disclosure is based on the surprising discovery that increasing the production of flavones such as apigenin in the roots of the plants allows for the enhanced growth of the plants under such reduced nitrogen conditions. Without being bound by the following theory, it is believed that the flavones produced by the present plants are secreted into the soil and enhance biofilm formation by N-fixing bacteria in the soil. It is believed that the increased biofilm formation allows the enhanced interaction of the plant roots with the N-fixing bacteria, allowing nitrogen uptake by the plant and efficient growth even in the presence of reduced inorganic nitrogen in the soil.
As used herein, the following terms have the meanings ascribed to them unless specified otherwise.
The terms “a,” “an,” or “the” as used herein not only include aspects with one member, but also include aspects with more than one member. For instance, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a cell” includes a plurality of such cells and reference to “the agent” includes reference to one or more agents known to those skilled in the art, and so forth.
The terms “about” and “approximately” as used herein shall generally mean an acceptable degree of error for the quantity measured given the nature or precision of the measurements. Typically, exemplary degrees of error are within 20 percent (%), preferably within 10%, and more preferably within 5% of a given value or range of values. Any reference to “about X” specifically indicates at least the values X, 0.8X, 0.81X, 0.82X, 0.83X, 0.84X, 0.85X, 0.86X, 0.87X, 0.88X, 0.89X, 0.9X, 0.91X, 0.92X, 0.93X, 0.94X, 0.95X, 0.96X, 0.97X, 0.98X, 0.99X, 1.01X, 1.02X, 1.03X, 1.04X, 1.05X, 1.06X, 1.07X, 1.08X, 1.09X, 1.1X, 1.11X, 1.12X, 1.13X, 1.14X, 1.15X, 1.16X, 1.17X, 1.18X, 1.19X, and 1.2X. Thus, “about X” is intended to teach and provide written description support for a claim limitation of, e.g., “0.98X.”
The “CRISPR-Cas” system refers to a class of bacterial systems for defense against foreign nucleic acids. CRISPR-Cas systems are found in a wide range of eubacterial and archaeal organisms. CRISPR-Cas systems fall into two classes with six types, I, II, III, IV, V, and VI as well as many sub-types, with Class 1 including types I and III CRISPR systems, and Class 2 including types II, IV, V and VI; Class 1 subtypes include subtypes I-A to I-F, for example. See, e.g., Fonfara et al., Nature 532, 7600 (2016); Zetsche et al., Cell 163, 759-771 (2015); Adli et al. (2018). Endogenous CRISPR-Cas systems include a CRISPR locus containing repeat clusters separated by non-repeating spacer sequences that correspond to sequences from viruses and other mobile genetic elements, and Cas proteins that carry out multiple functions including spacer acquisition, RNA processing from the CRISPR locus, target identification, and cleavage. In class 1 systems these activities are effected by multiple Cas proteins, with Cas3 providing the endonuclease activity, whereas in class 2 systems they are all carried out by a single Cas, Cas9. Endogenous systems function with two RNAs transcribed from the CRISPR locus: crRNA, which includes the spacer sequences and which determines the target specificity of the system, and the transactivating tracrRNA. Exogenous systems, however, can function which a single chimeric guide RNA that incorporates both the crRNA and tracrRNA components. In addition, modified systems have been developed with entirely or partially catalytically inactive Cas proteins that are still capable of, e.g., specifically binding to nucleic acid targets as directed by the guide RNA, but which lack endonuclease activity entirely, or which only cleave a single strand, and which are thus useful for, e.g., nucleic acid labeling purposes or for enhanced targeting specificity. Any of these endogenous or exogenous CRISPR-Cas system, of any class, type, or subtype, or with any type of modification, can be utilized in the present methods. In particular, “Cas” proteins can be any member of the Cas protein family, including, inter alia, Cas3, Cas5, Cas6, Cas7, Cas8, Cas9, Cas10, Cas12 (including Cas12a, or Cpf1), Cas13, Cse1, Cse2, Csy1, Csy2, Csy3, GSU0054, Csm2, Cmr5, Csx11, Csx10, Csf1, Csn2, Cas4, C2c1, C2c3, C2c2, and others. In particular embodiments, Cas proteins with endonuclease activity are used, e.g., Cas3, Cas9, or Cas12a (Cpf1).
“Flavones” are a class of molecules in the flavonoid family comprising a backbone of 2-phenylchromen-4-one. Any flavone produced by a grain crop plant used in the invention is encompassed by the term, including derivatives such as glycosylated forms of the flavones. Flavones of the invention include, but are not limited to, apigenin, luteolin, tricin, chrysoeriaol, apigenin-5-O-glucoside, apigenin-7-O-glucoside, luteolin-5-O-glucoside, or luteolin-7-O-glucoside.
“CYP75B3” and “CYP75B4” refer to genes, and homologs, orthologs, variants, derivatives, and fragments thereof, that encode the flavonoid 3′-monooxygenase CYP75B3 and CYP75B4 enzymes, which catalyze, e.g., the 3′ hydroxylation of the flavonoid B-ring to the 3′,4′-hydroxylated state, the 3′ hydroxylation of apigenin to form luteolin, the conversion of naringenin to eriodictyol, the conversion of kaempferol to quercetin, and other reactions. See, e.g., UniProt Refs Q7G602 and Q8LM92, the entire disclosures of which are herein incorporated by reference.
“CYP93G1” refers to a gene, and homologs, orthologs, variants, derivatives, and fragments thereof, that encodes cytochrome P450 93G1, an enzyme that functions as a flavone synthase II (FNSII) that catalyzes the direct conversion of flavanones to flavones. See, e.g., UniProt Ref Q0JFI2, the entire disclosure of which is herein incorporated by reference.
The term “nucleic acid sequence encoding a polypeptide” refers to a segment of DNA, which in some embodiments may be a gene or a portion thereof, that is involved in producing a polypeptide chain (e.g., an RNA-guided nuclease such as Cas9). A gene will generally include regions preceding and following the coding region (leader and trailer) involved in the transcription/translation of the gene product and the regulation of the transcription/translation. A gene can also include intervening sequences (introns) between individual coding segments (exons). Leaders, trailers, and introns can include regulatory elements that are necessary during the transcription and the translation of a gene (e.g., promoters, terminators, translational regulatory sequences such as ribosome binding sites and internal ribosome entry sites, enhancers, silencers, insulators, boundary elements, replication origins, matrix attachment sites and locus control regions, etc.). A “gene product” can refer to either mRNA or other RNA (e.g. sgRNA) or protein expressed from a particular gene.
The terms “expression” and “expressed” refer to the production of a transcriptional and/or translational product, e.g., of a nucleic acid sequence encoding a protein (e.g., a guide RNA or RNA-guided nuclease). In some embodiments, the term refers to the production of a transcriptional and/or translational product encoded by a gene (e.g., a gene encoding a protein) or a portion thereof. The level of expression of a DNA molecule in a cell may be assessed on the basis of either the amount of corresponding mRNA that is present within the cell or the amount of protein encoded by that DNA produced by the cell.
The term “recombinant” when used with reference, e.g., to a polynucleotide, protein, vector, or cell, indicates that the polynucleotide, protein, vector, or cell has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. For example, recombinant polynucleotides contain nucleic acid sequences that are not found within the native (non-recombinant) form of the polynucleotide.
As used herein, the terms “polynucleotide,” “nucleic acid,” and “nucleotide,” refer to deoxyribonucleic acids (DNA) or ribonucleic acids (RNA) and polymers thereof. The term includes, but is not limited to, single-, double-, or multi-stranded DNA or RNA, genomic DNA, cDNA, and DNA-RNA hybrids, as well as other polymers comprising purine and/or pyrimidine bases or other natural, chemically modified, biochemically modified, non-natural, synthetic, or derivatized nucleotide bases. Unless specifically limited, the term encompasses nucleic acids containing known analogs of natural nucleotides that have similar binding properties as the reference nucleic acid. Unless otherwise indicated, a particular nucleic acid sequence also implicitly encompasses conservatively modified variants thereof (e.g., degenerate codon substitutions), homologs, and complementary sequences as well as the sequence explicitly indicated. Specifically, degenerate codon substitutions may be achieved by generating sequences in which the third position of one or more selected (or all) codons is substituted with mixed-base and/or deoxyinosine residues (Batzer et al., Nucleic Acid Res. 19:5081 (1991); Ohtsuka et al., J. Biol. Chem. 260:2605-2608 (1985); and Rossolini et al., Mol. Cell. Probes 8:91-98 (1994)).
The terms “vector” and “expression vector” refer to a nucleic acid construct, e.g., plasmid or viral vector, generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid sequence (e.g., a guide RNA and/or RNA-guided nuclease) in a cell. In some embodiments, a vector includes a polynucleotide to be transcribed, operably linked to a promoter, e.g., a constitutive or inducible promoter. Other elements that may be present in a vector include those that enhance transcription (e.g., enhancers), those that terminate transcription (e.g., terminators), those that confer certain binding affinity or antigenicity to a protein (e.g., recombinant protein) produced from the vector, and those that enable replication of the vector and its packaging (e.g., into a viral particle). In some embodiments, the vector is a viral vector (i.e., a viral genome or a portion thereof).
The terms “polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues. All three terms apply to amino acid polymers in which one or more amino acid residues are an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers. As used herein, the terms encompass amino acid chains of any length, including full-length proteins, wherein the amino acid residues are linked by covalent peptide bonds.
The present methods can be used to modify any plant, including monocots and dicots, grains, trees, and vegetable crops, in order to increase its ability to interact with nitrogen-fixing bacteria in the soil. In particular embodiments, the plant is a crop species such as corn, wheat, rice, soy, cotton, canola, or sugarcane. In particular embodiments, the crop plant is a grain crop. Crops that can be used include, but are not limited to, cereals, oilseeds, pulses, hays, and others. A non-limiting list of cereals that can be used includes rice (e.g., Oryza, Zizani spp.), wheat (e.g., Triticum aestivum), barley (e.g., Hordeum vulgare), oat (e.g., Avena sativa), rye (e.g., Secale cereal), triticale (e.g., Triticosecale spp.), corn (e.g., Zea mays), sorghum Sorghum spp., millet (e.g., Digitaria, Echinochloa, Eleusine, Panicum, Setaria, Pennisetum, spp.), canary seed (e.g., Phalaris canariensis), teff (e.g., Eragrostis abyssinica), and Job's Tears (e.g., Coix lacryma-jobi). In particular embodiments, the plant is rice, e.g., Oryza sativa. A non-limiting list of oilseeds includes soybeans (e.g., Glycine spp.), peanuts (e.g., Arachis hypogaea), canola and mustard (e.g., Brassica spp., Brassica napus), sunflower, (e.g., Helianthus annuus), safflower (e.g., Carthamus spp., and flax (e.g., Linum spp.). A non-limiting list of pulses include pinto beans (e.g., Phaseolus vulgaris), lima beans (e.g., Phaseolus lunatus), mungo beans (e.g., Phaseolus mung), adzuki beans (e.g., Phaseolus angularis), chickpeas (e.g., Cicer arietinum), field, green and yellow peas (e.g., Pisum spp.), lentils (e.g., Lens spp.), fava beans (e.g., Vicia faba), and others including Dolichos, Cajanus, Vigna, Pachyrhizus, Tetragonolobus, spp. A non-limiting list of hay and pasture plants includes grasses such as Meadow Foxtail (e.g., Alopecurus pratensis), Brome (e.g., Bromus spp.), Orchard Grass (e.g., Dactylis glomerata), Fescue (e.g., Festuca spp.), rye grass (e.g., Lolium spp.), reed canary grass (e.g., Phalaris arundinacea), Kentucky blue grass (e.g., Poa pratensis), Timothy (e.g., Phleum pretense), and redtop (e.g., Agropyron spp.), as well as legumes such as alfalfa and yellow trefoil (e.g., Medicago spp., Medicago sativa), clovers (Trifolium spp.), birdsgoot trefoil (e.g., Lotus corniculatus), and vetch (e.g., Vicia spp.). Other plants that can used includes buckwheat, tobacco, hemp, sugar beets, and amaranth. In some embodiments, the plant is a shrub such as cotton (e.g., Gossypium hirsutum, Gossypium barbadense.) In some embodiments, the plant is a grass such as sugarcane (e.g., Saccharum officinarum). A non-limiting list of plants that can be used is shown, e.g., in Tables 1 and 2.
In some embodiments, the plant is a tree. Any tree can be modified using the present methods, including angiosperms and gymnosperms. A non-limiting list of trees includes, e.g., cycads, ginkgo, conifers (e.g., araucarias, cedars, cypresses, Douglas firs, firs, hemlocks, junipers, larches, pines, podocarps, redwoods, spruces, yews), monocotyledonous trees (e.g., palms, agaves, aloes, dracaenas, screw pines, yuccas) and dicotyledons (e.g., birches, elms, hollies, magnolias, maples, oaks, poplars, ashes, and willows). In a particular embodiment, the tree is a poplar (e.g., cottonwood, aspen, balsam poplar), e.g., Populus alba, Populus grandidentata, Populus tremula, Populus tremuloides, Populus deltoids, Populus fremontii, Populus nigra, Populus angustifolia, Populus balsamifera, Populus trichocarpa, or Populus heterophylla.
In some embodiments, the plant is a vegetable. Vegetables that can be used include, but are not limited to, Arugula (Eruca sativa), Beet (Beta vulgaris vulgaris), Bok choy (Brassica rapa), Broccoli (Brassica oleracea), Brussels sprouts (Brassica oleracea), Cabbage (Brassica oleracea), Celery (Apium graveolens), Chicory (Cichorium intybus), Chinese mallow (Malva verticillata), Garland Chrysanthemum (Chrysanthemum coronarium), Collard greens (Brassica oleracea), Common purslane (Portulaca oleracea), Corn salad (Valerianella locusta), Cress (Lepidium sativum), Dandelion (Taraxacum officinale), Dill (Anethum graveolens), Endive (Cichorium endivia), Grape (Vitis), Greater plantain (Plantago major), Kale (Brassica oleracea), Lamb's lettuce (Valerianella locusta), Land cress (Barbarea verna), Lettuce (Lactuca sativa), Mustard (Sinapis alba), Napa cabbage (Brassica rapa), New Zealand Spinach (Tetragonia tetragonioides), Pea (Pisum sativum), Poke (Phytolacca Americana), Radicchio (Cichorium intybus), Sorrel (Rumex acetosa), Sour cabbage (Brassica oleracea), Spinach (Spinacia oleracea), Summer purslane (Portulaca oleracea), Swiss chard (Beta vulgaris cicla), Turnip greens (Brassica rapa), Watercress (Nasturtium officinale), Water spinach (Ipomoea aquatic), and Yarrow (Achillea millefolium). Also included are fruits and flowers such as gourds, squashes, Pumpkins, Avocado, Bell pepper, Cucumber, Eggplant, Sweet pepper, Tomato, Vanilla, Zucchini, Artichoke, Broccoli, Caper, and Cauliflower.
In the present methods, the plants are modified to increase the production of one or more flavones, in particular in the roots of the plant. Any flavone that increases biofilm formation in facultative N2-fixing bacteria can be used. In some embodiments, the flavones increased in the plants include apigenin, luteolin, tricin, chrysoeriaol, apigenin-5-O-glucoside, apigenin-7-O-glucoside, luteolin-5-O-glucoside, or luteolin-7-O-glucoside, or combinations thereof. In particular embodiments, the flavone increased in the plant is apigenin, apigenin-5-O-glucoside, or apigenin-7-O-glucoside.
It will be appreciated that, in addition to flavones, other plant molecules can be identified using the herein-described assays that have biofilm-inducing activity, and plants can be generated that produce elevated levels of the molecules. For example, heterooctacyclic compounds, anthraquinones, or other flavonoids can be used. Methods to increase the production of such non-flavone molecules, as described herein for flavones, can be carried out in combination with, or in place of, the present methods to increase the production of flavones, with the effects of the molecules on biofilm formation and/or atmospheric nitrogen fixation assessed, e.g., using any of the methods for detecting and/or quantifying biofilm formation or nitrogen fixation described herein.
In particular embodiments, the modification of the plants involves the upregulation or downregulation of one or more genes encoding enzymes involved in flavone biosynthesis or degradation. The enzymes can be any enzyme that affects the production or degradation of one or more flavones. Some such enzymes, in rice and other plants, are indicated, for example, in
In some embodiments, a flavone synthase (e.g., a flavone synthase I or flavone synthase II such as CYP 93G1 (CYP93G1) in rice, or an equivalent flavone synthase, e.g., another CYP 93 or CYP 93G enzyme, or a homolog or ortholog thereof, in another plant species) is upregulated so as to increase the synthesis of, e.g., apigenin from naringenin (see, e.g., Lam et al. (2014) Plant Physiol. 165(3):1315-1327; Du et al. (2009) J. Exper. Bot. 61(4):983-994; Du et al. (2016) PlosOne doi.org/10.1371/journalpone.0165020; the entire disclosure of each of which is herein incorporated by reference in its entirety). CYP93G1 sequences can be found, e.g., at NCBI accession nos. AK100972.1 and UniProt Q0JFI2, and additional information, including information useful for identifying homologs in other species, can be found, e.g., at the Plant Metabolic Network (PMN, plantcyc.org) entry for CYP93G1. In addition, sequences of suitable CYP93G1 enzymes in diverse species are presented herein as SEQ ID NOS: 121-145.
Such enzymes can be upregulated in any of a number of ways, as described in more detail elsewhere herein. For example, the enzymes can be upregulated by introducing a transgene into the plant encoding any of the herein-described CYP93G1 enzymes, or homologs or orthologs thereof, or derivatives, variants, analogs, or fragments of any of the enzymes, homologs, or orthologs. In some embodiments, a transgene is introduced that encodes any one of SEQ ID NOS:121-145 or a fragment of any one of SEQ ID NOS:121-145, or encodes a polypeptide having at least about 50%, 55%, 60%. 65%. 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% or more identity to any one of SEQ ID NOS:121-145 or a fragment of any one of SEQ ID NOS:121-145, or any of the genes listed in Table 2. As described in more detail herein, the transgene can be introduced using any of a number of suitable methods, including, e.g., CRISPR-mediated genetic modification. In particular embodiments, the transgene is introduced as an expression cassette, e.g., a coding sequence as described herein, operably linked to a promoter, e.g., a constitutive, inducible, or organ/tissue-specific promoter. A non-limiting list of suitable promoters includes promoters from, e.g., CaMV 35S, Ubi-1, CAM19, MMV, SVBV, nos, ocs, Act1, HSP18.2, Rd29, adh, rbcS-3A, Chn48, PvSR2, cgmt1, HVADhn45, PtDr102, CaPrx, R2329, R2184, OsNAC6, PPP, Zmglp1, PnGLP, PDX1, and others. In particular embodiments, a root-specific promoter is used, including, but not limited to, promoters from TobRB7, rolD, SIREO, CaPrx, 0503g01700, 0502g37190, EgTIP2, ET304, and others.
In some embodiments, an enzyme, or gene encoding an enzyme, that converts a flavone to another flavone is inhibited. For example, in particular embodiments, apigenin levels are increased by inhibiting a hydroxylase such as CYP 75B3 (or CYP75B3) and/or CYP 75B4 (or CYP75B4) in rice, or an equivalent enzyme, e.g., homolog or ortholog, in another species, which are involved in the conversion of, e.g., apigenin to luteolin (see, e.g., Lam et al. (2019) New Phyt. doi.org/10.1111/nph.15795; Shih et al. (2008) Planta 228:1043-1054; Lam et al. (2015) Plant. Phys. 175:1527-1536; Park et al. (2016) Int. J. Mol. Sci. 17:e1549; the entire disclosure of each of which is herein incorporated by reference in its entirety). The enzymes can be inhibited in any of a number of ways. In some embodiments, the enzymes are inhibited by generating transgenic plants: i) with a deletion or mutation in the CYP75B3/B4 gene that causes decreased or abolished expression of the enzyme; ii) that express an inhibitor of CYP75B3/B4 gene expression (e.g., siRNA, miRNA), or iii) that express an inhibitor of CYP75B3/B4 enzymatic activity (e.g., peptide inhibitor, antibody). In some embodiments, the enzymes are inhibited through the application of an inhibitor, e.g., small molecule inhibitor, to the plants.
The sequence of an exemplary CYP75B3 from Oryza sativa Japonica can be found, e.g., at NCBI accession no. AK064736 and UniProt Q7G602, and additional information, including for identifying homologs in other species can be found, e.g., at the Plant Metabolic Network (PMN) entry for CYP75B3. The sequence of an exemplary CYP75B4 from Oryza sativa Japonica can be found, e.g., at NCBI accession nos. AK070442 and UniProt Q8LM92, and additional information, including information useful for identifying homologs in other species, can be found, e.g., at the Plant Metabolic Network (PMN, plantcyc.org) entry for CYP75B4. Suitable amino acid sequences for CYP75B3/B4 from Oryza sativa japonica and indica are also shown as SEQ ID NOS: 1, 3, 5, 7, and suitable nucleotide sequences are also shown as SEQ ID NOS: 2, 4, 6, and 8. Exemplary amino acid sequences for orthologs in other species are shown, e.g., as SEQ ID NOS: 14-120. Any polypeptide from any plant species comprising at least about 50%, 55%, 60%. 65%. 70%. 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more identity to any one of SEQ ID NOS:1, 3, 5, 7, 14-120, or a fragment thereof, or any polynucleotide from any plant species comprising at least about 50%, 55%, 60%. 65%. 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, or more identity to SEQ ID NO:2, 4, 6, or 8, or a fragment thereof, or encoding any one of SEQ ID NOS:1, 3, 5, 7, 14-120, or a fragment thereof, can be used (e.g., targeted for inhibition) in the present methods, as can any of the orthologs listed in Table 1.
In particular methods, the gene or encoded protein is inhibited using a CRISPR-Cas system, e.g., by introducing a guide RNA targeting the gene of interest (e.g., a CYP75B3/B4 gene), a Cas enzyme such as Cas9 or Cpf1, and a homologous template, in order to inactivate the gene by deleting or mutating it. For example, a CYP75B3 and/or CYP75B4 gene can be targeted by using a guide RNA with a target sequence falling within the genomic locus encoding the enzyme. For example, the guide RNA can have a target sequence comprising any of the sequences, or fragments thereof, shown in
In some embodiments, a CYP75B3 and/or CYP75B4 gene is targeted using a guide RNA with a target sequence located within a genomic sequence shown as SEQ ID NO: 9 or SEQ ID NO:10, located within a genomic sequence corresponding to any of the Gene ID numbers shown in Table 1, or comprising at least about 50%, 55%, 60%. 65%. 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99% to any subsequence within SEQ ID NOS: 9 or SEQ ID NO:10 or any of the genomic sequences corresponding to any of the Gene ID numbers shown in Table 1.
A non-limiting list of orthologs from various species, any of which can be inhibited using any of the herein-described methods, can be found, e.g., in the website: bioinformatics.psb.ugent.be/plaza/versions/plaza_v4_5_monocots/gene_families/view/ORTH O04x5M002123, the entire contents of which are herein incorporated by reference. This website provides, e.g., sequence and other genetic information about 119 genes in the ORTHO04x5M002123 family in 32 spermatophyte species, any of which can be inhibited using the present methods. In particular, a non-limiting list of exemplary orthologs that can be inhibited in the present methods is shown in Table 1.
Oryza sativa ssp. indica
Oryza sativa ssp. indica
Oryza sativa ssp. japonica
Oryza sativa ssp. japonica
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Zea mays B73
Zea mays B73
Zea mays B73
Zea mays B104
Zea mays B104
Zea mays B104
Zea mays B104
Zea mays PH207
Zea mays PH207
Zea mays PH207
Triticum turgidum
Triticum turgidum
Triticum turgidum
Triticum turgidum
Triticum turgidum
Triticum turgidum
Triticum turgidum
Setaria italica
Setaria italica
Cenchrus americanus
Cenchrus americanus
Sorghum bicolor
Sorghum bicolor
Sorghum bicolor
Sorghum bicolor
Sorghum bicolor
Brachypodium distachyon
Brachypodium distachyon
Brachypodium distachyon
Brachypodium distachyon
Hordeum vulgare
Gossypium raimondii (the putative
Gossypium hirsutum and
Gossypium barbadense.)
Gossypium raimondii
Gossypium raimondii
Gossypium raimondii
Gossypium raimondii
Gossypium hirsutum(90% of the
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium barbadense(5% of the
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Brassica napus cultivar Darmor_v5
Brassica napus cultivar Darmor_v5
Brassica napus cultivar ZS11
Brassica napus cultivar ZS11
Brassica napus cultivar Gangan
Brassica napus cultivar Gangan
Brassica napus cultivar Quinta
Brassica napus cultivar Quinta
Brassica napus cultivar Shengli
Brassica napus cultivar Shengli
Brassica napus cultivar Tapidor
Brassica napus cultivar Tapidor
Brassica napus cultivar Westar
Brassica napus cultivar Westar
Brassica napus cultivar Zheyou7
Brassica napus cultivar Zheyou7
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum officinarum
Saccharum officinarum
Saccharum officinarum
Saccharum officinarum
Glycine max
Glycine max
Glycine max
Glycine max
Glycine max
Oryza sativa ssp. japonica
Oryza sativa ssp. indica
Brachypodium distachyon
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum turgidum
Triticum turgidum
Setaria italica
Cenchrus americanus
Cenchrus americanus
Sorghum bicolor
Sorghum bicolor
Zea mays B104
Zea mays B104
Zea mays B104
Zea mays B104
Zea mays PH207
Zea mays PH207
Zea mays PH207
Zea mays PH207
Zea mays PH207
Zea mays B73
Zea mays B73
Zea mays B73
In some embodiments, the level of glycosylation of one or more flavones is modified by upregulating or downregulating an enzyme such as a UDP-dependent glycosyltransferase (UGT) such as UGT 707A2-A5 or UGT 706D1-E1 (see, e.g., Peng et al. (2017) Nature Comm. 8: 1975; the entire disclosure of which is herein incorporated by reference), e.g., OsUGT707A2 in rice, or an equivalent enzyme in another species. Sequence and other information about OsUGT707A2, including information useful for identifying homologs in other species, can be found, e.g., at the Rice Genome Annotation Project (rice.plantbiology.msu.edu) entry for LOC/Os07g32060. Sequence and other information about OsUGT706D1, including information useful for identifying homologs in other species, can be found, e.g., at the Rice Genome Annotation Project (rice.plantbiology.msu.edu) entry for LOC/Os01g53460.
It will be appreciated that more than one modification in gene expression, or an alteration in enzyme activity or stability, can be made in a single plant, e.g., upregulating a flavone synthase (such as CYP 93G1) to increase the level of multiple flavones and simultaneously inhibiting an enzyme (such as CYP 73B3 or CYP 73B4) to increase the level of a specific flavone such as apigenin, and/or modulating the expression of a glycosyltransferase to alter the glycosylation of one or more flavones.
The expression of the genes can be modified in any of a number of ways. For example, to increase the level of expression of a gene, the endogenous promoter can be replaced with a heterologous promoter capable of overexpressing the gene. The heterologous promoter can be inducible or constitutive, and can be ubiquitous or tissue specific (e.g., expressed particularly in the roots). Any promoter capable of driving overexpression of the gene in plant cells can be used, e.g., a CaMV35S promoter, an Act1 promoter, an Adh1 promoter, a ScBV promoter, or a Ubi1 promoter. Examples of inducible promoters that can be used include, but are not limited to, EST (induced by estrogen) and DEX (induced by dexamethasone). In some embodiments, instead of modifying the endogenous gene, a transgene is introduced comprising a coding sequence for the gene, operably linked to a promoter. In some embodiments, the expression of a gene is inhibited or silenced, e.g., by disrupting or deleting an endogenous copy of the gene. In some embodiments, an inhibitor of the enzyme or its expression is expressed, e.g., by RNAi, e.g., siRNA, miRNA, peptide inhibitors, antibody inhibitors, etc.
It will be appreciated that the inhibition of genes involved in flavone biosynthesis or degradation, e.g., CYP73B3 or CYP73B4, can be achieved not only by deleting or otherwise silencing the gene through, e.g., CRISPR-mediated genomic editing or through expression of an inhibitor such as RNAi, but also by other standard means, e.g., through the application of molecules to the plants that inhibit the enzymatic activity or decrease the stability of the enzymes, e.g., the products of CYP73B3 and/or CYP73B4, or that decrease the stability or translation of mRNA transcribed from the genes.
In typical embodiments, the plants are genetically modified using an RNA-guided nuclease, e.g. endonuclease. In particular embodiments, a CRISPR-Cas system is used to modify one or more target genes involved in the synthesis or degradation of one or more flavones. Other methods can also be used, e.g. transcription activator-like effector nucleases (TALENs), zinc-finger nucleases (ZFNs), and others. Any type of genetic modification can be performed, including insertions of one or more sequences into the genome (e.g., to introduce a transgene or regulatory element), deletions of one or more sequences in the genome (e.g., to inactivate an gene), replacement of one or more sequences in the genome (e.g., to replace an endogenous promoter with a heterologous promoter), and alteration of one or more nucleotides in the genome (e.g., to modify the regulation and/or the expression level of a gene).
In particular embodiments of the disclosure, a CRISPR-Cas system is used, e.g., Type II CRISPR-Cas system. The CRISPR-Cas system includes a guide RNA, e.g., sgRNA, that targets the genomic sequence to be altered, and a nuclease that interacts with the guide RNA and cleaves or binds to the targeted genomic sequence. The guide RNA can take any form, including as a single guide RNA, or sgRNA (e.g., a single RNA comprising both crRNA and tracrRNA elements) or as separate crRNA and tracrRNA elements. Standard methods can be used for the design of suitable guide RNAs, e.g., sgRNAs, e.g., as described in Cui et al. (2018) Interdisc. Sci.: Comp. Life Sci. 10(2):455-465; Bauer et al. (2018) Front. Pharmacol: 12 Jul. 2018, doi.org/10.3389/fphar.2018.00749; Mohr et al. (2016) FEBS J., doi.org/10.1111/febs.13777, the entire disclosures of which are herein incorporated by reference.
Any CRISPR nuclease can be used in the present methods, including, but not limited to, Cas9, Cas12a/Cpf1, or Cas3, and the nuclease can be from any source, e.g., Streptococcus pyogenes (e.g. SpCas9), Staphylococcus aureus (SaCas9), Streptococcus thermophiles (StCas9), Neisseria meningitides (NmCas9), Francisella novicida (FnCas9), and Campylobacter jejuni (CjCas9). The guide RNA and nuclease can be used in various ways to effect genomic modifications in the cells. For example, two guide RNAs can be used that flank an undesired gene or genomic sequence, and cleavage of the two target sites leads to the deletion of the gene or genomic sequence. In some embodiments, a guide RNA targeting a gene or genomic sequence of interest is used, and the cleavage of the gene or genomic sequence of interest and subsequent repair by the cell leads to the generation of an insertion, deletion, or mutation of nucleotides at the site of cleavage. In some embodiments, one or more additional polynucleotides are introduced into the cells together with the guide RNA and nuclease, e.g., a donor template comprising regions sharing homology to the targeted genomic sequence (e.g., homology to both sides of the guide RNA target site), with sequences present between the homologous regions effecting a deletion, insertion, or alteration of the genomic sequence via homologous recombination. In particular embodiments, the guide RNA used comprises a target sequence that is substantially identical (e.g., with 0, 1, 2, or 3 mismatches) to any one of SEQ ID NOS:11-13, or that falls within any of the genomic sequences shown as SEQ ID NOS: 9-10 or as listed in Table 1 or Table 2.
In particular embodiments, one or more polynucleotides are introduced into cells of the plant encoding a guide RNA and encoding the RNA-guided nuclease, e.g., Cas9. For example, a vector, e.g., a viral vector, plasmid vector, or Agrobacterium vector, encoding one or more guide RNAs and an RNA-guided nuclease is introduced into plant cells, e.g., by transfection, wherein the one or more guide RNAs and the RNA-guided nuclease are expressed in the cells. In some embodiments, one or more guide RNAs are preassembled with RNA-guided nucleases as ribonucleoproteins (RNPs), and the assembled ribonucleoproteins are introduced into plant cells.
The elements of the CRISPR-Cas system can be introduced in any of a number of ways. In some embodiments, the elements are introduced using polyethylene glycol (PEG), e.g., polyethylene glycol-calcium (PEG-Cat). In some embodiments, the elements are introduced using electroporation. Other suitable methods include microinjection, DEAE-dextran treatment, lipofection, nanoparticle-mediated transfection, protein transduction domain-mediated transfection, and biolistic bombardment. Methods for introducing RNA-guided nucleases into plant cells to effect genetic modifications that can be used include those disclosed in, e.g., Toda et al. (2019) Nature Plants 5(4):363-368; Osakabe et al. (2018) Nat Protoc 13(12):2844-2863; Soda et al. (2018) Plant Physiol Biochem 131:2-11; WO2017061806A1; Mishra et al. (2018) Frontiers Plant Sci. 19, doi.org/10.3389/fpls.2018.03161; the entire disclosures of which are herein incorporated by reference.
Using the present methods, plant lines can be generated (e.g., generated from transfected cells or protoplasts) comprising the genetic modification and producing one or more flavones at higher levels than in wild-type plants. For example, plant lines can be generated by introducing guide RNA, an RNA-guided nuclease, and optionally a template DNA into isolated plant cells or protoplasts, and generating plants from the cells using standard methods.
Any of a number of assays can be used to assess plants generated using the present methods, as well as to assess candidate plant molecules (e.g., other flavones) for their ability to upregulate biofilm production and assimilation of N2-fixing bacteria. For example, to confirm that the plants are exuding increased levels of the one or more flavones, root exudates from the plants can be isolated and the quantities and identities of the flavones determined, e.g., using mass spectrometry. In addition, the exudates (or other candidate biofilm-inducing molecules) can be incubated with N2-fixing bacteria, e.g., Glucanoacetobacter diazotrophicus, and the biofilm produced by the bacteria assessed. The biofilm can be quantified, e.g., by incubating the exudate (or candidate molecule or molecules) and bacteria in the wells of a microtiter plate, removing the cultures from the plate, washing the wells, adding a solution of crystal violet, rinsing and drying the plate, and then adding ethanol and measuring absorbance at, e.g., 540 nm. See, e.g. Example 1 and www.jove.com/video/2437/microtiter-dish-biofilm-formation-assay, the entire disclosure of which is herein incorporated by reference.
The activity of the exudate or of candidate molecules can also be assessed in vivo, e.g., by using transgenic N2-fixing bacteria such as Glucanoacetobacter diazotrophicus that constitutively express a label such as mCherry. The bacteria can also express labeled components of biofilms, e.g., in bacteria transformed with gumDpro::GFP. The double labeling in such bacteria allows the visualization of the bacteria and, independently, the development of biofilm in the presence or absence of the exudate or candidate molecule.
The N2-fixing activity of the bacteria can be assessed, e.g., using an acetylene reduction assay (ARA), in which bacteria are cultured in the presence of acetylene gas, and the conversion of acetylene to ethylene measured by, e.g., gas chromatography.
As noted above, the present assays can be used both to assess the presence and biofilm-inducing activity of flavones in plant exudates, as well as to assess the relative biofilm-inducing activities of different flavones or other molecules. For example, the assays can be used to determine which flavones or other molecules, or combinations of flavones and/or other molecules, have the greatest biofilm-inducing activity. The identification of such molecules or combinations of molecules can guide the selection of plant gene or genes to be upregulated or downregulated using the present methods.
The genetically modified plants themselves can also be assessed in any of a number of ways. For example, plants can be grown in the presence of fluorescently labeled N2-fixing bacteria, and the adherence of the bacteria to the plant root hairs, either attached to the root surface or present inside the plant tissues, can be determined. The plants can also be assessed by determining the number of tillers and/or the seed yield. In some embodiments, the assimilation of N2 fixed by bacteria in the soil is assessed by, e.g., growing the plants in the presence of 15N2 gas, and then measuring the level of 15N assimilated in the plant leaves, e.g., using Mass spectroscopy.
In some embodiments, plants generated using the present methods show an increase in the amount of one or more flavones exuded of at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or more as compared to the amount exuded in a wild-type plant. In some embodiments, plants generated using the present methods show an increase of at least 5%, 10%, 15%, 20%, 25%, 30%, 40%, 50%, 60%, or more in the number of tillers/tassels/spikes and/or in the seed yield as compared to in wild-type plants. In some embodiments, plants generated using the present methods, or exudates from said plants, induce an increase of at least about 0.1 (i.e., an increase of about 10%), 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1-fold, 2-fold, 3-fold, 4-fold, or more, in biofilm formation in Glucanoacetobacter diazotrophicus or other N2-fixing bacteria as compared to wild-type plants, or exudates from wild-type plants. In some embodiments, plants generated using the present methods induce an increase of at least about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1-fold, 2-fold, 3-fold, 4-fold, or more, of nitrogen assimilation when grown under low nitrogen conditions as compared to wild-type plants.
Because of the increased assimilation of N2-fixing bacteria by the plants as enabled by the present methods, the present plants can assimilate sufficient nitrogen to produce high yields even when inorganic nitrogen levels in the soil are low. As used herein, “reduced” or “low” or “minimal” inorganic “nitrogen conditions” or “nitrogen levels” refers to conditions in which the level of inorganic nitrogen, e.g., the level resulting from the introduction of fertilizer, is lower than the level that would normally be used for the crop plant, or which is recommended for the crop plant. For example, for rice plants, a level of inorganic nitrogen of less than 50 ppm can be used, e.g. about 25 ppm. In some embodiments, the level of inorganic nitrogen is at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, or 80% lower than the normal or recommended level.
In another aspect, kits are provided herein. In some embodiments, the kit comprises one or more element for producing genetically modified grain crop plants according to the present invention. The kit can comprise, e.g., one or more elements described herein for practicing the present methods, e.g., a guide RNA, an RNA-guided nuclease, a polynucleotide encoding an RNA-guided nuclease, a CRISPR-Cas RNP, culture medium, transfection reagents, etc.
Kits of the present invention can be packaged in a way that allows for safe or convenient storage or use (e.g., in a box or other container having a lid). Typically, kits of the present invention include one or more containers, each container storing a particular kit component such as a reagent, and so on. The choice of container will depend on the particular form of its contents, e.g., a kit component that is in liquid form, powder form, etc. Furthermore, containers can be made of materials that are designed to maximize the shelf-life of the kit components. As a non-limiting example, kit components that are light-sensitive can be stored in containers that are opaque.
In some embodiments, the kit contains one or more containers or devices, e.g. petri dish, flask, syringe, for practicing the present methods. In yet other embodiments, the kit further comprises instructions for use, e.g., containing directions (i.e., protocols) for the practice of the methods of this invention (e.g., instructions for using the kit for generating and using plants with increased flavone production). While the instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include addresses to internet sites that provide such instructional materials.
The present invention will be described in greater detail by way of specific examples. The following examples are offered for illustrative purposes only, and are not intended to limit the invention in any manner. Those of skill in the art will readily recognize a variety of noncritical parameters which can be changed or modified to yield essentially the same results.
We hypothesized that under low Nitrogen soil content conditions, the induction of biofilm formation in N2-fixing bacteria by plant metabolites will decrease the Oxygen concentration in the vicinity of the bacterial cell, eliminating the inhibition of bacterial Nitrogenase by Oxygen and thereby the increasing bacterial atmospheric N2 fixation activity. As a consequence, the soil N-fertilization required to attain agricultural yield production of non-leguminous crops will decrease. This not only will reduce the costs associated with the fertilization of agricultural lands, but will also significantly contribute to reducing the environmental burden generated by nitrates leaching into water aquifers, with a concomitant increase in nitrate concentrations and negative consequences for human health (15).
Our strategy is based on the following steps: (1) Screen the effects of different compounds on their ability to promote the formation of biofilms in N2-fixing bacteria; (2) Identify plant metabolites—secreted by the plant roots—that increase —N2-fixing bacteria biofilm production; and (3) Manipulate plant metabolic pathways (for example, via CRISPR/Cas9-mediated silencing) to increase the production (and secretion by the plant roots) of the metabolites identified.
We also hypothesized that these compounds that selectively induce biofilm formation will also benefit overall plant fitness in the soil and rhizosphere, thereby contributing to an efficient mutualistic relationship with the host plants.
To assess the effect(s) of different chemicals on biofilm formation in N2-fixing bacteria, we used a published protocol (www.jove.com/video/2437/microtiter-dish-biofilm-formation-assay). Basically, bacteria were grown in a 96-well plate in a rich-nutrient medium at 28° C. The compound to be tested was added and the culture was grown overnight. Plant exudates and 2 μl of the compound were added to the well and the bacteria grown for 3 days under shaking (200 rpm). After 3 days, the planktonic bacterial cultures were discarded and the wells were thoroughly washed with water. A solution of 1% of crystal violet was added to each well of the plate and the plate shaken for 10-15 min at 200 rpm. The plates are rinsed 3-4 times with water (by submerging the plants in a tub of water), shaken vigorously and blotted on a stack of paper towels (to eliminate excess of cells and dye), the microliter plate was placed upside down and air dried. To quantify the amount of biofilm that adhered to the well walls, 200 μl of ethanol were added to each well, the plates shacked at 200 rpm, at 28° C. for 10-15 min. The absorbance of the solution was measured at 540 nm, using ethanol as a blank (
Flavonoids secreted by soybean roots have been shown to play roles in attracting rhizobia and in inducing the expression of rhizobial nod genes. In order to assess whether flavonoids could play some role in the induction of biofilm formation in N2-fixing bacteria, we screened a chemical library comprised of 500 flavonoid derivatives of different origin (bacteria, plant and animal) (TimTec, Tampa, Fla., USA). Using the protocol described above, we tested biofilm synthesis using Glucanoacetobacter diazotrophicus as a representative of N2-fixing bacteria. Several compounds enhanced biofilm production (
Characterization of Some Compounds Inducing Biofilm Formation in G. diazotrophicus.
In order to assess structure-function of the different compounds, we performed a hierarchical clustering of the 20 compounds (chosen per their ability to induce biofilm formation in Glucanoacetobacter and other bacteria. To obtain the clustering we used Workbench Tools, an online service useful for the analysis and clustering of small molecules by structural similarities and physicochemical properties (ChemMine.ucr.edu/tools) (
Our results indicated clustering among common moieties, particularly among heterooctacyclic compounds (e.g., Staurosporine) and flavonols (e.g., luteolin, apigenin) and anthraquinones (e.g. 2H03 and 4G03—Papaverine). (
Flavonoids perform several functions; pigments producing colors, inhibitors of cell cycle and also chemical messengers. Secretion of flavonoids was shown to aid symbiotic relationships between rhizobia and plants. Some flavonoids are associated with the response of plants to plant diseases. A representation of the different biosynthetic pathways in rice is shown in
In order to assess the effect of compounds representing different group of flavonoids, we evaluated the formation of biofilm in Gluconacetobacter diazotrophicus exposed for 3 days to root exudates from Oryza sativa supplemented with Naringenin or Eriodictyol or Luteolin or Quercetin or Myricetin or AHL (Acyl Homoserine Lactone), a well-known compound shown to mediate interaction of bacteria and plant roots. Only luteolin induced a significant increase in biofilm production in Glucanoacetobacter (
The effects of luteolin on the induction of biofilm production was tested in a number of N2-fixing bacteria (
Flavones are a class of flavonoids synthesized directly from flavanones (i.e., Naringenin) (
We investigated whether the increased flavone-induced bacterial biofilm production (elicited by the addition of the flavones Naringenin, Apigenin or Apigenin-7-Glucoside) increased bacteria N2-fixation. Also, we tested whether the plant took up the nitrogen assimilated by the bacteria. It should be noted that we used Apigenin instead of Luteolin for 2 reasons: a) Apigenin induced a larger biofilm production than Luteolin (
To assess the effects of the flavones on bacteria N2 fixation, we used the acetylene reduction assay (ARA), where gas acetylene is added, and the resulting ethylene is measured by Gas Chromatography. The Bacterium was grown in tubes with Kitaake rice root exudates and 100 μM, shaken for 3 days at 28° C. Ten % of the air in the tube was replaced by acetylene, the cells incubated for 4 days and ethylene was measured by gas chromatography (
Microscopic observation of the rice root hairs showed extensive adherence of the bacteria (labelled with a fluorescence marker) to the biofilm (
Our results showed that flavones and their glucoside derivatives induced biofilm formation in the N2-fixing bacteria. The development of a biofilm, with its low permeability to Oxygen, provides a protection to the bacterial Nitrogenase from oxidative damage, thus allowing N2-fixation by the free-living bacteria. Our hypothesis is that it is possible to increase N-assimilation in crop plants, if the plants can produce more flavones (which will be extruded to the soil by the roots). Interestingly, the larger effect of the flavone-glycoside derivatives on bacterial biofilm formation, would make feasible to alter the flavones (for example, Apigenin) biosynthetic pathway (including its glucosylation). An analysis of the flavone-derived metabolites in rice (and in most crops) (see
We generated CRISPR/Cas9 constructs, transformed rice plants and obtained plant lines with decreased expression of cyp75B3 and cyp75B4 (
Root extracts and root exudates, obtained from cyp75b3/cyp75b4 (Os10g17260/Os10g16974) CRISPR/Cas9 knockout plants, increased biofilm production in Glucanoacetobacter diazotrophicus suspension (
Kitaake wild-type and Crispr #87 and Crispr #104 silenced lines were grown in the greenhouse at standard growth conditions, the plants were fertilized, but the Nitrogen levels were kept at only 30% of the concentration recommended (25 ppm N). Notably, the silenced plants were somewhat shorter (
Plants were grown to maturity and seeds were harvested, dried and weighed. The silenced plants displayed a 40% yield increase as compared to the wild type plants grown at the same conditions (
Our results suggest the generation of Nitrogen-fixation in rice and other grain crops. The strategy involves the silencing of pathways associated with the catabolism of flavones (Apigenin, Luteolin, etc.). This strategy induced the accumulation of these metabolites inside the plant and the exudation of the flavones from the roots into the soil, where they activated the biofilm synthesis in the N2-fixing bacteria. If plants are grown under minimal (deficient) inorganic N-conditions, the biofilm synthesis in the bacteria facilitates their N2-fixation. The colonization of the plant roots by the N2-fixing bacteria and its concomitant N2-fixation will allow the reduction of agronomical operational costs (by reducing N-input) and also will provide an important tool to reduce nitrate contamination of groundwater, reducing its leaching into the water supplies.
Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, one of skill in the art will appreciate that certain changes and modifications may be practiced within the scope of the appended claims. In addition, each reference provided herein is incorporated by reference in its entirety to the same extent as if each reference was individually incorporated by reference.
Oryza sativa ssp. Indica (OsR498G1018420100.01)
Oryza sativa ssp. Indica (OsR498G1018420100.01)
Oryza sativa ssp. Indica (OsR498G1018427100.01)
Oryza sativa ssp. Indica (OsR498G1018427100.01)
Oryza sativa ssp. Japonica (LOC_Os10g16974)
Oryza sativa ssp. Japonica (LOC_Os10g16974)
Oryza sativa ssp. Japonica (LOC_Os10g17260)
Oryza sativa ssp. Japonica
Oryza sativa ssp. indica
Oryza sativa ssp. indica
Oryza sativa ssp. japonica
Oryza sativa ssp. japonica
Triticum aestivum
MDHSLLLLLASLAAVAVAAVWHLRSHGRRTKLPLPPGPRGWPVLGNLPQLGAMPH
HTMAALARQHGPLFRLRFGSVEVVVTASAKVARSFLRAHDTNFSDRPPTSGAEHLA
YNYQDLVFAPYGARWCALRKLCALHLFSARALDALRTIRQDEARLMVTHLLSSSSP
AGVAVNLCAINVRATNALARAAIGGRMFGDGVGEGAREFKDMVVELMQLAGVLNI
GDFVPALRWLDPQGVVAKMKRLHRRYDRMMDGFISERGQHAGEMEGNDLLSVML
ATIRWQSPADAGEEDGIKFTEIDIKALLLNLFTAGTDTTSSTVEWALAELIRDPCILKQ
LQHELDGVETFRLHPATPLSLPRVAAEDCEVDGYHVSKGTTLIMNVWAIARDPASW
GPDPLEFRPVRFLPGGLHESADVKGGDYELIPFGAGRRICAGLGWGLRMVTLMTATL
VHAFDWSLVDGTMPEKLNMEEAYGQTLQRAVPLVVQPVPRLLSSAYTV*
Triticum aestivum
MDHDLLLLLLASLVAVVAATVWHLRGHGSGARKPKLPLPPGPRGWPVLGNLPQLG
DKPHHTMAALARHHGPLFRLRFGSAEVVVAASAKVAGSFLRAHDANFSDRPPNSGA
EHVAYNYQDLVFAPYGARWRALRKLCAQHLFSARALDALRQVRQDEARLMVTRLL
SSSDSPAGLAVGQEANVCATNALALAAVGRRVFGDGVGEGAREFKDMVVELMQLA
GVFNIGDFVPALRWLDPQGVVGKMKRLHRRYDLMMDGFISERGDRADGDGNDLLS
VMLGMMRQSPPAAGEEDGIKFNETDIKALLLNLFTAGTDTTSSTVEWALAELIRHPD
VLKKLQHELDDVVGNGHLVTETDLPQLTFLAAVIKETFRLHPSTPLSLPRVAAEDCE
VDGYRIPKDTTLLVNVWAIARDPASWGDDVLEFRPTRFLPGGLHESVDVKGGDYELI
PFGAGRRICAGLSWGLRMVTLMTATLVHAFDWTLVDGMTPEKLDMEEAYGLTLQR
AVPLMVQPVPRLLPSAYTM*
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum aestivum
MEIPLPLLLSTFAISVTICYVILFFRADMGRAPLPPGPRGWPVLGNLPQLGGKTHKTLH
EMARLYGPMLRLRFGSSLVVVAGSADVAKLFLRTHDAKFSSRPPNSGGEHMAYNY
QDVVFAPYGPRWRAMRKVCAVNLFSARALDDLRAFREWEAALMVRCLADAAAAG
MAVALGKAANVCTTNALSRATVGLRVFATAGSELGAEEFNEIVLKLIEVGGVLNVG
DFVPALRWLDPQGVVAKMKKLHRRFDDMMNRIIAERRAGAFATTASEEGGKDLIGL
LLAMVQEDKSLTGAEENKITDTEVKALILNLFVAGTDTTSITVEWAMAELIRHPDIM
KQAQEELDAIVGRERLVSESDLPRLTFLSAIIKETFRLHPSTPLSLPRMTTEECEVAGY
CIPKGTELLVNVWGIARDPALWPDPLEFRPARFLPGGSHADVDVKGGDFGLIPFGAG
PRLLPSAYQIA*
Triticum aestivum
MHSTCMQNLFVAGTDTTLIMVEWAMAELIRHPDTLKQAQEELDTIVGRERLISESHL
PRLTFLSAVIKDTFRLHPSTPLLLLRMATEECETAGYRIPKGTELLVNVWGIAHDPAL
WPDSLEFRPAWFLPGGSHADVDVKGGDFGLIPFGAGRRICAGLSRGIRMVAVTTATL
VHSFNWELPAGQTPDMEGTFSLLLQLAVPLMVHPVPRLLPSAYQIA*
Triticum aestivum
Triticum aestivum
Triticum aestivum
Zea mays B73
Zea mays B73
Zea mays B73
Zea mays B104
Zea mays B104
Zea mays B104
Zea mays B104
Zea mays PH207
Zea mays PH207
Zea mays PH207
Triticum turgidum
MNVWAIARDPASWGPDPLEFRPVRFLPGGLHESADVKGGDYELIPFGAGRRICAGLG
WGLRMVTLMTATLVHAFDWSLVDGTTPEKLNMEEAYGQTLQRAVPLVVQPVPRLL
SSAYTV*
Triticum turgidum
Triticum turgidum
Triticum turgidum
Triticum turgidum
Triticum turgidum
Triticum turgidum
Setaria italica
Setaria italica
Cenchrus americanus
Cenchrus americanus
Sorghum bicolor
Sorghum bicolor
Sorghum bicolor
Sorghum bicolor
Sorghum bicolor
Brachypodium distachyon
Brachypodium distachyon
Brachypodium distachyon
Brachypodium distachyon
Hordeum vulgare
Gossypium raimondii (the putative contributor of the D subgenome to the
Gossypium raimondii
Gossypium raimondii
Gossypium raimondii
Gossypium raimondii
Gossypium hirsutum (90% of the world's cotton production)
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium hirsutum
Gossypium barbadense (5% of the world's cotton production)
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Gossypium barbadense
Brassica napus cultivar Darmor_v5
Brassica napus cultivar Darmor_v5
Brassica napus cultivar ZS11
Brassica napus cultivar ZS11
Brassica napus cultivar Gangan
Brassica napus cultivar Gangan
Brassica napus cultivar Quinta
Brassica napus cultivar Quinta
Brassica napus cultivar Shengli
Brassica napus cultivar Shengli
Brassica napus cultivar Tapidor
Brassica napus cultivar Tapidor
Brassica napus cultivar Westar
Brassica napus cultivar Westar
Brassica napus cultivar Zheyou7
Brassica napus cultivar Zheyou7
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum hybrid cultivar R570
Saccharum officinarum
Saccharum officinarum
Saccharum officinarum
Saccharum officinarum
Glycine max
Glycine max
Glycine max
Glycine max
Glycine max
Oryza sativa ssp. japonica
Oryza sativa ssp. indica
Brachypodium distachyon
Triticum aestivum
Triticum aestivum
Triticum aestivum
Triticum turgidum
Triticum turgidum
Setaria italica
Cenchrus americanus
Cenchrus americanus
Sorghum bicolor
Sorghum bicolor
Zea mays B104
Zea mays B104
Zea mays B104
Zea mays B104
Zea mays PH207
Zea mays PH207
Zea mays PH207
Zea mays PH207
Zea mays B73
Zea mays B73
Zea mays B73
This application is a US National Phase application Under 371 of PCT/US2021/041482 filed Jul. 13, 2021, which claims priority to U.S. Provisional Patent Application No. 63/051,267, filed Jul. 13, 2020, each of which is incorporated herein by reference in its entirety.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/US2021/041482 | 7/13/2021 | WO |
| Number | Date | Country | |
|---|---|---|---|
| 63051267 | Jul 2020 | US |
