POLYNUCLEOTIDES ENCODING COAGULATION FACTOR VIII

Information

  • Patent Application
  • 20200268666
  • Publication Number
    20200268666
  • Date Filed
    June 13, 2018
    6 years ago
  • Date Published
    August 27, 2020
    4 years ago
Abstract
The invention relates to mRNA therapy for the treatment of Hemophilia A. mRNAs for use in the invention, when administered in vivo, encode Factor VIII, isoforms thereof, functional fragments thereof, and fusion proteins comprising Factor VIII. mRNAs of the invention are preferably encapsulated in lipid nanoparticles (LNPs) to effect efficient delivery to cells and/or tissues in subjects, when administered thereto. mRNA therapies of the invention increase and/or restore deficient levels of Factor VIII expression and/or activity in subjects. mRNA therapies of the invention further decrease levels of toxic metabolites associated with deficient Factor VII I activity in subjects.
Description
BACKGROUND

Hemophilia is a bleeding disorder in which blood clotting is disturbed by a lack of certain plasma clotting factors. In particular Hemophilia A is caused by a deficiency in coagulation Factor VIII. Hemophilia A is characterized by spontaneous hemorrhage and excessive bleeding after trauma. Over time, the repeated bleeding into muscles and joints, which often begins in early childhood, results in hemophilic arthropathy and irreversible joint damage. This damage is progressive and can lead to severely limited mobility of joints, muscle atrophy and chronic pain.


Classic treatment of hemophilia is by replacement therapy targeting restoration of Factor VIII activity. Replacement therapy for treating hemophilia A involves restoration of Factor VIII activity to 1 to 5% of normal levels to prevent spontaneous bleeding. There are plasma-derived and recombinant Factor VIII products available to treat bleeding episodes on-demand or to prevent bleeding episodes from occurring by treating prophylactically. Based on the half-life of these products, treatment regimens require frequent intravenous administration. Such frequent administration is painful and inconvenient.


BRIEF SUMMARY

In certain aspects, the present disclosure relates to compositions and delivery formulations comprising a polynucleotide, e.g., a ribonucleic acid (RNA), e.g., a messenger RNA (mRNA), encoding coagulation Factor VIII and methods for treating Hemophilia A in a subject in need thereof by administering the same.


In some embodiments the Factor VIII polypeptide comprises a domain structure of A1-A2-B-A3-C1-C2. In some embodiments the Factor VIII polypeptide comprises a 19 consensus sites for N-linked glycosylation. In some embodiments the Factor VIII polypeptide comprises an 11-residue hydrophobic beta-sheet within the Factor VIII A1-domain. In some embodiments the hydrophobic beta-sheet comprises a single residue mutation, Phe309Ser. In some embodiments the Factor VIII polypeptide comprises a deletion of the majority of the B domain. In some embodiments the Factor VIII polypeptide comprises a full B domain deletion (BDD-FVIII). In some embodiments the Factor VIII polypeptide comprises a short B domain spacer comprising several N-linked oligosaccharides. In some embodiments the Factor VIII polypeptide comprises a Factor VIII polypeptide having a B domain deletion or truncation. In some embodiments the Factor VIII polypeptide having a B domain deletion comprises a truncated B domain having 1-8 consensus sites for N-linked oligosaccharides. In some embodiments the truncated B domain has 5, 6, 7, or 8 consensus sites for N-linked oligosaccharides. In some embodiments the Factor VIII polypeptide having a B domain deletion comprises an N-terminal portion of the B domain.


In some embodiments the ORF comprises a nucleic acid sequence selected from the group consisting of SEQ ID NOs. 127-135 and 166-169. In other embodiments the mRNA comprises a 5′ UTR of SEQ ID NO:125 or 126 and/or the mRNA comprises a 3′ UTR of SEQ ID NO:146.


In some embodiments all of the Us in the mRNA comprise 1-methylpseudouridines.


In some embodiments mRNA is formulated with a delivery agent comprising a lipid nanoparticle comprised of an ionizable lipid, a neutral lipid, a structural lipid and a PEG lipid. In other embodiments the delivery agent is an LNP comprised of an ionizable cationic lipid of:




embedded image


and a PEG lipid comprising Formula VI.


In other embodiments the delivery agent is an LNP comprised of an ionizable cationic lipid of:




embedded image


and an alternative lipid comprising oleic acid,.


In some embodiments the delivery agent is an LNP comprised of an ionizable cationic lipid of:




embedded image


an alternative lipid comprising oleic acid, a structural lipid comprising cholesterol, and a PEG lipid comprising a compound having Formula VI.


In some embodiments mRNA is formulated with a delivery agent comprising a lipid nanoparticle comprising: (i) Compound 18, (ii) Cholesterol, and (iii) PEG-DMG or Compound I; (i) Compound VI, (ii) Cholesterol, and (iii) PEG-DMG or Compound I; (i) Compound 18, (ii) DSPC or DOPE, (iii) Cholesterol, and (iv) PEG-DMG or Compound I; (i) Compound VI, (ii) DSPC or DOPE, (iii) Cholesterol, and (iv) PEG-DMG or Compound I; (i) Compound 18, (ii) Cholesterol, and (iii) Compound I; or (i) Compound 18, (ii) DSPC or DOPE, (iii) Cholesterol, and (iv) Compound I.


In some embodiments the Factor VIII polypeptide has an amino acid sequence having at least 80%, 85%, 90%, 95%, 98% or 100%, sequence identity to the amino acids selected from the group consisting of SEQ ID NOs. 147-165 and 171-173.


In some embodiments, the ORF has at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NOs: 1-3, 127-135 and 166-169.


In some embodiments, the Factor VIII polypeptide comprises an amino acid sequence at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to the polypeptide sequence of wild type Factor VIII (SEQ ID NO: 1 or 2), and wherein the Factor VIII polypeptide has Factor VIII activity.


In some embodiments, the Factor VIII polypeptide is a variant, derivative, or mutant having Factor VIII, i.e., bleeding prevention, activity.


In some embodiments, the polynucleotide is single stranded.


In some embodiments, the polynucleotide is double stranded.


In some embodiments, the polynucleotide is DNA.


In some embodiments, the polynucleotide is RNA.


In some embodiments, the polynucleotide is mRNA.


In some embodiments, the polynucleotide comprises at least one chemically modified nucleobase, sugar, backbone, or any combination thereof.


In some embodiments, the at least one chemically modified nucleobase is selected from the group consisting of pseudouracil (ψ), N1-methylpseudouracil (m1ψ), 2-thiouracil (s2U), 4′-thiouracil, 5-methylcytosine, 5-methyluracil, and any combination thereof.


In some embodiments, the at least one chemically modified nucleobase is 5-methoxyuracil.


In some embodiments, at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or 100% of the uracils are 5-methoxyuracils.


In some embodiments, the polynucleotide further comprises a miRNA binding site.


In some embodiments, the miRNA binding site comprises one or more nucleotide sequences selected from Table 4.


In some embodiments, the miRNA binding site binds to miR-142.


In some embodiments, the miRNA binding site binds to miR-142-3p or miR-142-5p.


In some embodiments, the miR-142 comprises SEQ ID NO: 79.


In some embodiments, the polynucleotide further comprises a 5′ UTR.


In some embodiments, the 5′ UTR comprises a nucleic acid sequence at least 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to a sequence selected from the group consisting of SEQ ID NOs:36-78.


In some embodiments, the polynucleotide further comprises a 3′ UTR.


In some embodiments, the 3′ UTR comprises a nucleic acid sequence at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to a sequence selected from the group consisting of SEQ ID NOs:112-122 and 146.


In some embodiments, the miRNA binding site is located within the 3′ UTR.


In some embodiments, the polynucleotide has a 5′ terminal cap selected from a Cap0, Cap1, ARCA, inosine, N1-methyl-guanosine, 2′-fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine, 2-amino-guanosine, LNA-guanosine, 2-azidoguanosine, Cap2, Cap4, 5′ methylG cap, or an analog thereof.


In some embodiments, the polynucleotide further comprises a poly-A region.


In some embodiments, the poly-A region is at least about 10, at least about 20, at least about 30, at least about 40, at least about 50, at least about 60, at least about 70, at least about 80, or at least about 90 nucleotides in length.


In some embodiments, the poly-A region has about 10 to about 200, about 20 to about 180, about 50 to about 160, about 70 to about 140, or about 80 to about 120 nucleotides in length.


In some embodiments, the polynucleotide encodes a Factor VIII polypeptide that is fused to one or more heterologous polypeptides.


In some embodiments, the one or more heterologous polypeptides increase a pharmacokinetic property of the Factor VIII polypeptide.


In some embodiments, the polynucleotide has:


(i) a longer plasma half-life;


(ii) increased expression of a Factor VIIIpolypeptide encoded by the ORF;


(iii) a lower frequency of arrested translation resulting in an expression fragment;


(iv) greater structural stability; or


(v) any combination thereof,


relative to a corresponding polynucleotide comprising SEQ ID NO: 3, 127-135, or 166-169.


In some embodiments, the polynucleotide comprises:


(i) a 5′-terminal cap;


(ii) a 5′-UTR;


(iii) an ORF encoding a Factor VIII polypeptide;


(iv) a 3′-UTR; and


(v) a poly-A region.


In some embodiments, the 3′-UTR comprises a miRNA binding site.


The present disclosure provides, in certain aspects, a method of producing a polynucleotide as described herein, the method comprising modifying an ORF encoding a Factor VIII polypeptide by substituting at least one uracil nucleobase with an adenine, guanine, or cytosine nucleobase, or by substituting at least one adenine, guanine, or cytosine nucleobase with a uracil nucleobase, wherein all the substitutions are synonymous substitutions.


In some embodiments, the method further comprises replacing at least about 90%, at least about 95%, at least about 99%, or about 100% of uracils with 5-methoxyuracils.


The present disclosure provides, in certain aspects, a composition comprising


a polynucleotide as described herein; and


a delivery agent.


In some embodiments, the delivery agent comprises a lipidoid, a liposome, a lipoplex, a lipid nanoparticle, a polymeric compound, a peptide, a protein, a cell, a nanoparticle mimic, a nanotube, or a conjugate.


In some embodiments, the delivery agent comprises a lipid nanoparticle.


In some embodiments, the lipid nanoparticle comprises a lipid selected from the group consisting of 3-(didodecylamino)-N1,N1,4-tridodecyl-1-piperazineethanamine (KL10),


N1-[2-(didodecylamino)ethyl]-N1,N4,N4-tridodecyl-1,4-piperazinediethanamine (KL22),


14,25-ditridecyl-15,18,21,24-tetraaza-octatriacontane (KL25),


1,2-dilinoleyloxy-N,N-dimethylaminopropane (DLin-DMA),


2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA),


heptatriaconta-6,9,28,31-tetraen-19-yl 4-(dimethylamino)butanoate (DLin-MC3-DMA),


2,2-dilinoleyl-4-(2-dimethylaminoethyl)[1,3]-dioxolane (DLin-KC2-DMA),


1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA), (13Z,165Z)-N,N-dimethyl-3-nonydocosa-13-16-dien-1-amine (L608),


2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yl oxy]propan-1-amine (Octyl-CLinDMA),


(2R)-2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA (2R)),


(2S)-2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA (2S)), and any combination thereof.


In some embodiments, the delivery agent comprises a compound having the Formula (I)




embedded image


or a salt or stereoisomer thereof, wherein


R1 is selected from the group consisting of C5-20 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;


R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;


R4 is selected from the group consisting of a C3-6 carbocycle, —(CH2)nQ, —(CH2)nCHQR,


—CHQR, —CQ(R)2, and unsubstituted C1-6 alkyl, where Q is selected from a carbocycle, heterocycle,


—OR, —O(CH2)nN(R)2, —C(O)OR, —OC(O)R, —CX3, —CX2H, —CXH2, —CN, —N(R)2, —C(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)C(O)N(R)2, —N(R)C(S)N(R)2, and —C(R)N(R)2C(O)OR, and each n is independently selected from 1, 2, 3, 4, and 5;


each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—,


—N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, −CH(OH)—, —P(O)(OR′)O—, —S(O)2—, an aryl group, and a heteroaryl group;


R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;


each R″ is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl;


each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl;


each Y is independently a C3-6 carbocycle;


each X is independently selected from the group consisting of F, Cl, Br, and I; and


m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13; and


provided when R4 is —(CH2)nQ, —(CH2)nCHQR, —CHQR, or —CQ(R)2, then (i) Q is not —N(R)2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2.


In some embodiments, the compound is of Formula (IA):




embedded image


or a salt or stereoisomer thereof, wherein


l is selected from 1, 2, 3, 4, and 5;


m is selected from 5, 6, 7, 8, and 9;


M1 is a bond or M′;


R4 is unsubstituted C1-3 alkyl, or —(CH2)nQ, in which n is 1, 2, 3, 4, or 5 and Q is OH, —NHC(S)N(R)2, or —NHC(O)N(R)2;


M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —P(O)(OR′)O—, an aryl group, and a heteroaryl group; and

    • R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl.


In some embodiments, m is 5, 7, or 9.


In some embodiments, the compound is of Formula (II):




embedded image


or a salt or stereoisomer thereof, wherein


l is selected from 1, 2, 3, 4, and 5;


M1 is a bond or M′;


R4 is unsubstituted C1-3 alkyl, or —(CH2)nQ, in which n is 2, 3, or 4 and Q is OH, —NHC(S)N(R)2, or —NHC(O)N(R)2;


M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —P(O)(OR′)O—, an aryl group, and a heteroaryl group; and

    • R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl.


In some embodiments, M1 is M′.


In some embodiments, M and M′ are independently —C(O)O— or —OC(O)—.


In some embodiments, l is 1, 3, or 5.


In some embodiments, the compound is of the Formula (IIa),




embedded image


or a salt or stereoisomer thereof.


In some embodiments, the compound is of the Formula (IIb),




embedded image


or a salt or stereoisomer thereof.


In some embodiments, the compound is of the Formula (IIc) or (IIe),




embedded image


or a salt or stereoisomer thereof.


In some embodiments, R4 is selected from —(CH2)nQ and —(CH2)nCHQR.


In some embodiments, the compound is of the Formula (IId),




embedded image


or a salt or stereoisomer thereof,


wherein R2 and R3 are independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl, n is selected from 2, 3, and 4, and R′, R″, R5, R6 and m are as defined above.


In some embodiments, R2 is C8 alkyl.


In some embodiments, R3 is C5 alkyl, C6 alkyl, C7 alkyl, C8 alkyl, or C9 alkyl.


In some embodiments, m is 5, 7, or 9.


In some embodiments, each R5 is H.


In some embodiments, each R6 is H.


In some embodiments, the composition is a nanoparticle composition.


In some embodiments, the delivery agent further comprises a phospholipid.


In some embodiments, the phospholipid is selected from the group consisting of


1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC),


1,2-dimyristoyl-sn-glycero-phosphocholine (DMPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC),


1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC),


1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC),


1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC),


1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC),


1-oleoyl-2-cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine (OChemsPC),


1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC),


1,2-dilinolenoyl-sn-glycero-3-phosphocholine, 1,2-diarachidonoyl-sn-glycero-3-phosphocholine,


1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine,


1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE),


1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16:0 PE),


1,2-distearoyl-sn-glycero-3-phosphoethanolamine,


1,2-dilinoleoyl-sn-glycero-3-phosphoethanolamine,


1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine,


1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine,


1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine,


1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt (DOPG), sphingomyelin, and any mixtures thereof.


In some embodiments, the delivery agent further comprises a structural lipid.


In some embodiments, the structural lipid is selected from the group consisting of cholesterol, fecosterol, sitosterol, ergosterol, campesterol, stigmasterol, brassicasterol, tomatidine, ursolic acid, alpha-tocopherol, and any mixtures thereof.


In some embodiments, the delivery agent further comprises a PEG lipid.


In some embodiments, the PEG lipid is selected from the group consisting of a PEG-modified phosphatidylethanolamine, a PEG-modified phosphatidic acid, a PEG-modified ceramide, a PEG-modified dialkylamine, a PEG-modified diacylglycerol, a PEG-modified dialkylglycerol, and any mixtures thereof.


In some embodiments, the delivery agent further comprises an ionizable lipid selected from the group consisting of 3-(didodecylamino)-N1,N1,4-tridodecyl-1-piperazineethanamine (KL10),


N1-[2-(didodecylamino)ethyl]-N1,N4,N4-tridodecyl-1,4-piperazinediethanamine (KL22),


14,25-ditridecyl-15,18,21,24-tetraaza-octatriacontane (KL25),


1,2-dilinoleyloxy-N,N-dimethylaminopropane (DLin-DMA),


2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA),


heptatriaconta-6,9,28,31-tetraen-19-yl 4-(dimethylamino)butanoate (DLin-MC3-DMA),


2,2-dilinoleyl-4-(2-dimethylaminoethyl)[1,3]-dioxolane (DLin-KC2-DMA),


1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA),


2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yl oxy]propan-1-amine (Octyl-CLinDMA),


(2R)-2-({8-[(3β)-cholest-5 -en-3 -yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA (2R)), and


(2S)-2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA (2S)).


In some embodiments, the delivery agent further comprises a phospholipid, a structural lipid, a PEG lipid, or any combination thereof.


In aspects, the present disclosure provides a polynucleotide comprising an open reading frame (ORF) encoding a Factor VIII polypeptide, wherein the uracil or thymine content of the ORF relative to the theoretical minimum uracil or thymine content of a nucleotide sequence encoding the Factor VIII polypeptide (% UTM or % TTM) is between about 125% and about 150%.


In some embodiments, the % UTM or % TTM is between about 100% and about 220%, about 134% and about 140%, about 134% and about 145%, about 130% and about 145%, about 120% and about 140%, about 124% and about 130%, about 130% and about 140%, about 114% and about 150%, or about 134% and about 148%.


In some embodiments, the uracil or thymine content of the ORF relative to the uracil or thymine content of the corresponding wild-type ORF (% UWT or % TWT) is less than 100%.


In some embodiments, the % UWT or % TWT is less than about 95%, less than about 90%, less than about 85%, less than about 80%, less than about 75%, or less than 74%.


In some embodiments, the % UWT or % TWT is between 68% and 74%.


In some embodiments, the uracil or thymine content in the ORF relative to the total nucleotide content in the ORF (% UTL or % TTL) is less than about 50%, less than about 40%, less than about 30%, or less than about 21%.


In some embodiments, the % UTL or % TTL is less than about 21%.


In some embodiments, the % UTL or % TTL is between about 14% and about 16%.


In some embodiments, the guanine content of the ORF with respect to the theoretical maximum guanine content of a nucleotide sequence encoding the Factor VIII polypeptide (% GTMX) is at least 71%, at least 72%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.


In some embodiments, the % GTMX is between about 72% and about 80%, between about 72% and about 79%, between about 73% and about 78%, or between about 74% and about 77%.


In some embodiments, the cytosine content of the ORF relative to the theoretical maximum cytosine content of a nucleotide sequence encoding the Factor VIII polypeptide (% CTMX) is at least 63%, at least 64%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or about 100%.


In some embodiments, the % CTMX is between about 65% and about 80%, between about 65% and about 79%, between about 65% and about 78%, or between about 72% and about 77%.


In some embodiments, the guanine and cytosine content (G/C) of the ORF relative to the theoretical maximum G/C content in a nucleotide sequence encoding the Factor VIII polypeptide (% G/CTMX) is at least about 81%, at least about 82%, at least about 85%, at least about 90%, at least about 95%, or about 100%.


In some embodiments, the % G/CTMX is between about 80% and about 100%, between about 85% and about 99%, between about 90% and about 97%, or between about 90% and about 93%.


In some embodiments, the G/C content in the ORF relative to the G/C content in the corresponding wild-type ORF (%G/CWT) is at least 102%, at least 103%, at least 104%, at least 105%, at least 106%, at least 107%, or at least about 110%.


In some embodiments, the average G/C content in the 3rd codon position in the ORF is at least 20%, at least 21%, at least 22%, at least 23%, or at least 24% higher than the average G/C content in the 3rd codon position in the corresponding wild-type ORF.


In some embodiments, the ORF further comprises at least one low-frequency codon.


In some embodiments, the composition is formulated for in vivo delivery.


In some embodiments, the composition is formulated for intramuscular, subcutaneous, or intradermal delivery.


The present disclosure provides, in certain aspects, a host cell comprising a polynucleotide as described herein.


In some embodiments, the host cell is a eukaryotic cell.


The present disclosure provides, in certain aspects, a vector comprising a polynucleotide as described herein.


The present disclosure provides, in certain aspects, a method of making a polynucleotide comprising enzymatically or chemically synthesizing a polynucleotide as described herein.


The present disclosure provides, in certain aspects, a polypeptide encoded by a polynucleotide as described herein, a composition as described herein, a host cell as described herein, or a vector as described herein or produced by a method as described herein.


The present disclosure provides, in certain aspects, a method of expressing in vivo an active Factor VIII polypeptide in a subject in need thereof comprising administering to the subject an effective amount of a polynucleotide as described herein, a composition as described herein, a host cell as described herein, or a vector as described herein.


The present disclosure provides, in certain aspects, a method of treating Hemophilia A in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a polynucleotide as described herein, a composition as described herein, a host cell as described herein, or a vector as described herein, wherein the administration alleviates the signs or symptoms of Hemophilia A in the subject.


The present disclosure provides, in certain aspects, a method to prevent or delay the onset of Hemophilia A signs or symptoms in a subject in need thereof comprising administering to the subject a prophylactically effective amount of a polynucleotide as described herein, a composition as described herein, a host cell as described herein, or a vector as described herein before Hemophilia A signs or symptoms manifest, wherein the administration prevents or delays the onset of Hemophilia A signs or symptoms in the subject.


The present disclosure provides, in certain aspects, a method to ameliorate the signs or symptoms of Hemophilia A in a subject in need thereof comprising administering to the subject a therapeutically effective amount of a polynucleotide as described herein, a composition as described herein, a host cell as described herein, or a vector as described herein before Hemophilia A or symptoms manifest, wherein the administration ameliorates Hemophilia A signs or symptoms in the subject.


Also provided herein are pharmaceutical compositions comprising a lipid nanoparticle encapsulated mRNA that comprises an open reading frame (ORF) encoding a Coagulation Factor VIII (Factor VIII) polypeptide, wherein the composition is suitable for administration to a human subject in need of treatment for Hemophilia A.


Further provided herein are pharmaceutical compositions comprising: (a) a mRNA that comprises (i) an open reading frame (ORF) encoding a Coagulation Factor VIII (Factor VIII) polypeptide, wherein the ORF comprises at least one chemically modified nucleobase, sugar, backbone, or any combination thereof, (ii) a patterned untranslated region (UTR), and (iii) a microRNA (miRNA) binding site; and (b) a delivery agent, wherein the pharmaceutical composition is suitable for administration to a human subject in need of treatment for Hemophilia A.


The present disclosure also provides pharmaceutical compositions comprising an mRNA comprising an open reading frame (ORF) encoding a Coagulation Factor VIII (Factor VIII) polypeptide, wherein the composition when administered to a subject in need of treatment for Hemophilia A is sufficient to improve clotting function by at least 10%, at least 20%, at least 30%, at least 40%, or at least 50%, as compared to clotting function in a reference subject untreated for Hemophilia A.


In some embodiments, an improvement of clotting function includes a reduction (e.g., a reduction of at least 10%, 20%, 30%, 40% or 50%) in the occurrence of and/or severity of bleeding in the subject in need of treatment for Hemophilia A.


The present disclosure further provides a method of expressing Factor VIII polypeptide in a human subject in need thereof comprising administering to the subject an effective amount of a pharmaceutical composition or a polynucleotide, e.g. an mRNA, described herein, wherein the pharmaceutical composition or polynucleotide is suitable for administrating as a single dose or as a plurality of single unit doses to the subject. The drug may be administered in a clinical setting, e.g., hospital or clinical site, in an IV infusion over a few hours. For instance, it may be administered as a bolus IV injection, or as a procedure carried out in a day for a patient in the clinic/hospital. The single dose may be followed up by subsequent treatments, at a certain frequency, every week, two weeks, three weeks, four weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, every month, two months, three months, four months, five months, six months, or every year.


Further , the present disclosure provides pharmaceutical compositions comprising an mRNA comprising an open reading frame (ORF) encoding a Coagulation Factor VIII (Factor VIII) polypeptide, wherein the composition when administered to a subject in need of treatment for Hemophilia A as a single intravenous dose is sufficient to improve the clotting rate by at least 10%, at least 20%, at least 30%, at least 40%, or at least 50%, as compared to the clotting rate in a subject untreated for Hemophilia A, for at least 24 hours, at least 48 hours, at least 72 hours, at least 96 hours, or at least 120 hours post-administration.


Pharmaceutical compositions, in some aspects, comprising an mRNA comprising an open reading frame (ORF) encoding a Coagulation Factor VIII (Factor VIII) polypeptide, wherein the composition when administered to a subject in need thereof as a single intravenous dose is sufficient to (i) maintain Factor VIII activity levels at a normal physiological level or a supraphysiological level for at least 24 hours, at least 48 hours, at least 72 hours, at least 96 hours, or at least 120 hours post-administration, and/or (ii) maintain Factor VIII activity levels at 50% or more of the normal Factor VIII activity level for at least 24 hours, at least 48 hours, at least 72 hours, or at least 96 hours post-administration.





BRIEF DESCRIPTION OF THE DRAWINGS


FIGS. 1A-1B show in vitro expression and activity of G8 mRNA constructs in CHO-K1 cells. FIG. 1A shows FVIII:C antigen ELISA versus IU/mL, and FIG. 1B shows FVIII activity versus IU/mL.



FIG. 2 shows the dose-dependent increase in expression and activity observed for F8 mRNA constructs in wild type CD1 mice.



FIGS. 3A-3B show short-term expression of human FVIII by delivering FVIII mRNA LNP in Hemophilia A mice. Both FIGS. 3A and 3B show time versus percentage of FVIII antigen.



FIGS. 4A-4C show expression of human FVIII by delivering FVIII mRNA LNP in Hemophilia A mice. Both FIGS. 4A and 4B show time versus percentage of FVIII activity. FIG. 4C shows time versus FVIII expression levels in plasma (percent of normal plasma).



FIG. 5 shows the development of F8 inhibitor.



FIG. 6 shows CLUSTAL multiple sequence alignment.



FIGS. 7A-D show gradual reduction in expression of human FVIII after repeated delivery of FVIII mRNA LNP in Hemophilia A mice due to induced FVIII inhibitor formation. FIGS. 7A-7C show time versus percentage of FVIII antigen. FIG. 7D shows time versus Bethesda units.



FIGS. 8A-8B show short-term expression of luciferase in liver by delivering luciferase mRNA LNP in wild-type mice. Both FIGS. 8A and 8B show time versus luciferase signal (BLI).



FIGS. 9A-9B shows the effects of consistent luciferase expression on liver function after repeated delivery of luciferase mRNA LNP in mice over five consecutive days . FIG. 9A shows time versus luciferase signal (BLI). FIG. 9B shows ALT (IU/L) and AST levels (IU/L).





DETAILED DESCRIPTION

The present disclosure provides mRNA therapeutics for the treatment of Hemophilia A. Hemophilia is a group of hereditary genetic disorders that impair the body's ability to control blood clotting or coagulation, which is used to stop bleeding when a blood vessel is broken. Hemophilia A (clotting factor VIII deficiency) is the most common form of the disorder, present in about 1 in 5,000-10,000 male births. Hemophilia B (factor IX deficiency) occurs in around 1 in about 20,000-34,000 male births. Like most recessive sex-linked, X chromosome disorders, hemophilia is more likely to occur in males than females. This is because females have two X chromosomes while males have only one, so the defective gene is guaranteed to manifest in any male who carries it.


The F8 gene, located on the X chromosome, encodes coagulation Factor VIII. Factor VIII is typically made by cells in the liver, and circulates in the bloodstream in an inactive form, bound to von Willebrand factor. Upon injury, Factor VIII is activated. The activated protein Factor VIIIa interacts with coagulation factor IX, leading to clotting. Mutations in the F8 gene cause hemophilia A. Over 2100 mutations in the gene have been identified, including point mutations, deletions, and insertion. One of the most common mutations includes inversion of intron 22, which leads to a severe type of HA. Mutations in F8 can lead to the production of an abnormally functioning Factor VIII protein or a reduced or absent amount of circulating Factor VIII protein, leading to the reduction of or absence of the ability to clot in response to injury.


Recombinant expression (eg, commercial rFVIII production or gene therapy applications) is commonly used for therapy. Although expression of rFactor VIII is useful, it is 2 to 3 orders of magnitude lower than that of other comparably sized proteins, likely due to inefficient expression of mRNA, misfolding of a significant portion of the primary translation product and retention within the endoplasmic reticulum (ER) through interaction with various ER chaperones including immunoglobulin-binding protein (BiP). Properly folded Factor VIII requires a facilitated transport mechanism for efficient transport from the ER to the Golgi via interaction with the mannose-binding lectin LMAN1/endoplasmic reticulum Golgi intermediate compartment protein of 53 kDa (ERGIC-53).


mRNA therapeutics are particularly well-suited for the treatment of Hemophilia A as the technology provides for the intracellular delivery of mRNA encoding Factor VIII followed by de novo synthesis of functional Factor VIII protein within target cells. After delivery of mRNA to the cells, the desired Factor VIII protein is expressed by the cells' own translational machinery, and hence, fully functional Factor VIII protein replaces the defective or missing protein and can participate in coagulation.


One challenge associated with delivering nucleic acid-based therapeutics (e.g., mRNA therapeutics) in vivo stems from the innate immune response that can occur when the body's immune system encounters foreign nucleic acids. Foreign mRNAs can activate the immune system via recognition through toll-like receptors (TLRs), in particular TLR7/8, which is activated by single-stranded RNA (ssRNA). In nonimmune cells, the recognition of foreign mRNA can occur through the retinoic acid-inducible gene I (RIG-I). Immune recognition of foreign mRNAs can result in unwanted cytokine effects including interleukin-1β (IL-1β) production, tumor necrosis factor-α (TNF-α) distribution and a strong type I interferon (type I IFN) response. The present disclosure features the incorporation of different modified nucleotides within therapeutic mRNAs to minimize the immune activation and optimize the translation efficiency of mRNA to protein. Particular embodiments provided herein feature a combination of nucleotide modification to reduce the innate immune response and sequence optimization, in particular, within the open reading frame (ORF) of therapeutic mRNAs encoding Factor VIII to enhance protein expression.


Bayer markets two drugs for the treatment of hemophilia A by replacing key coagulation protein factor VIII, Kovaltry and Kogenate. Kovaltry is a recombinant unmodified, full-length factor VIII compound, that can be dosed two or three times a week in adults and every other day in children. Kogenate is a daily treatment for Factor VIII. Both therapeutics are injection based treatments.


In contrast to the Bayer drugs, the products of the invention produces a long lasting product that may be administered as infrequently as every 5 to 7 days, providing a significant advantage to the patient. Additionally, constructs of the invention provided significant expression and enhanced therapeutic activity. As shown in FIGS. 3-4 the mRNA encoding a Factor VIII polypeptide having an F309S mutation resulted in 100% expression and activity as compared to a control (human normal pooled plasma was used as 100% antigen and activity standard). In FIGS. 3 and 4 the 100% line for activity is equal to about 1 U/ml, about 200 ng/ml. Only about 5-10% is needed for therapeutic efficacy. The results demonstrate the unexpected superior efficacy of the mRNA product relative to a recombinant Factor VIII product.


The data in FIG. 1 demonstrate that Factor VIII proteins can be expressed both in vitro and in vivo and that variants (i.e., the truncated versions) are even more active and stable than the full length constructs. The full length wild type Factor VIII is very large and challenging to make recombinantly. It is too large to be delivered in vivo as DNA for gene therapy. However, the full length protein can be produced and delivered in vivo using the mRNA of the invention. The mRNA constructs are also particularly useful for producing therapeutically enhanced modified and truncated versions of the Factor VIII.


The mRNA therapeutic technology of the present disclosure also features delivery of mRNA encoding Factor VIII via a lipid nanoparticle (LNP) delivery system. Lipid nanoparticles (LNPs) are an ideal platform for the safe and effective delivery of mRNAs to target cells. LNPs have the unique ability to deliver nucleic acids by a mechanism involving cellular uptake, intracellular transport and endosomal release or endosomal escape. Some embodiments provided herein feature novel ionizable lipid-based LNPs that have improved properties when administered in vivo. Without being bound in theory, it is believed that the novel ionizable lipid-based LNPs of the present disclosure have improved properties, for example, cellular uptake, intracellular transport and/or endosomal release or endosomal escape. LNPs administered by systemic route (e.g., intravenous (IV) administration), for example, in a first administration, can accelerate the clearance of subsequently injected LNPs, for example, in further administrations. This phenomenon is known as accelerated blood clearance (ABC) and is a key challenge, in particular, when replacing deficient proteins (e.g., Factor VIII) in a therapeutic context. This is because repeat administration of mRNA therapeutics is in most instances essential to maintain necessary levels of protein in target tissues in subjects (e.g., subjects suffering from Hemophilia A.) Repeat dosing challenges can be addressed on multiple levels. mRNA engineering and/or efficient delivery by LNPs can result in increased levels and or enhanced duration of protein (e.g., Factor VIII) being expressed following a first dose of administration, which in turn, can lengthen the time between first dose and subsequent dosing. It is known that the ABC phenomenon is, at least in part, transient in nature, with the immune responses underlying ABC resolving after sufficient time following systemic administration. As such, increasing the duration of protein expression and/or activity following systemic delivery of an mRNA therapeutic of the present disclosure in one aspect, combats the ABC phenomenon. Moreover, LNPs can be engineered to avoid immune sensing and/or recognition and can thus further avoid ABC upon subsequent or repeat dosing. Exemplary aspect of the present disclosure feature novel LNPs which have been engineered to have reduced ABC.


Factor VIII

Coagulation Factor VIII is encoded by the F8 gene located on the X chromosome. Once Factor VIII is synthesized in liver cells it is secreted into the blood and circulates in an inactive form. The inactive form is typically bound to von Willebrand factor, which stabilizes it. Following a triggering event such as an injury, Factor VIII is activated. The activated protein then interacts with coagulation Factor IX which proteolytically activates Factor X, triggering the coagulation pathway and leading to clotting.


Factor VIII shares an identical domain structure (A1-A2-B-A3-C1-C2) with factor V (FV), another coagulation cofactor. Although, Factor VIII and FV share approximately 40% amino acid identity within their A and C domains, the B domains of both cofactors share no amino acid homology. Factor VIII has 19 consensus sites for N-linked glycosylation. It has been demonstrated that the B-domain was not necessary for Factor VIII cofactor activity. Recombinantly produced B-domain deleted Factor VIII resulted in a 17-fold increase in mRNA levels over full-length wild-type Factor VIII and a concomitant increase in the amount of synthesized primary translation product. Additionally an 11-residue hydrophobic beta-sheet within the Factor VIII Al-domain was predicted to interact with BiP and mutation of a single residue, Phe309Ser, within this hydrophobic pocket increased Factor VIII secretion 3-fold and also reduced the ATP requirement for secretion.


Bioengineered forms of FVIII can be expressed that (1) produce increased mRNA and primary translation product levels by deletion of the majority of the B domain, (2) have improved secretion efficiency by using a targeted Al-domain mutation (Phe309Ser), and (3) exploit the LMAN1-facilitated ER-Golgi transport by retaining several N-linked oligosaccharides within a short B-domain spacer. An engineered Factor VIII having all of these features was demonstrated to have a 15- to 25-fold more efficient expression than full-length wild-type Factor VIII both in vitro in traditional heterologous expression systems as well as in vivo in a mouse model of hemophilia A.


The coding sequence (CDS) for wild type Factor VIII canonical mRNA sequence is described at the NCBI Reference Sequence database (RefSeq) under accession number NM_000132.3 (Homo sapiens Factor VIII, mRNA). The wild type Factor VIII canonical protein sequence is described at the RefSeq database under accession number AAA52420.1 and NP_000123.1. It is noted that the specific nucleic acid sequences encoding the reference protein sequence in the Ref Seq sequences are the coding sequence (CDS) as indicated in the respective RefSeq database entry.


In certain aspects, the present disclosure provides a polynucleotide (e.g., a ribonucleic acid (RNA), e.g., a messenger RNA (mRNA)) comprising a nucleotide sequence (e.g., an open reading frame (ORF)) encoding a Factor VIII polypeptide. In some embodiments, the Factor VIII polypeptide of the present disclosure is a wild type Factor VIII protein. In some embodiments, the Factor VIII polypeptide of the present disclosure is a variant, a peptide or a polypeptide containing a substitution, and insertion and/or an addition, a deletion and/or a covalent modification with respect to a wild-type Factor VIII sequence.


In some embodiments the Factor VIII polypeptide is a variant having a B domain deletion. A B domain deletion, as used herein refers to a deletion of part (i.e., a single amino acid or more) or the whole B domain. A Factor VIII polypeptide having a B domain deletion may involve the remaining portions of the B domain linked to the A2 and A3 domains, as in the wild type construct or it may include 1 or more spacer amino acids to replace part or all of the deleted domains. When the full B domain is deleted the Factor VIII polypeptide may be referred to as BDD-FVIII. In some embodiments a Factor VIII polypeptide having a B domain deletion includes a truncated B domain having 1-8 consensus sites for N-linked oligosaccharides. In some embodiments a Factor VIII polypeptide having a B domain deletion includes a truncated B domain having 3, 4, 5, 6, 7, or 8 consensus sites for N-linked oligosaccharides. In some embodiments the truncated B domain is the N-terminal portion of the B domain. In some embodiments the truncated B domain is the N-terminal portion of the B domain ranging in size from 20 -300, 25-300, 29-300, 29-269, 29-250, 30-300, 30-250, 50-300, 50-250, 100-300, 100-500, 100-250, 150-300, 150-250, 200-300, or 250-300 amino acids.


In some embodiments, sequence tags or amino acids, can be added to the sequences encoded by the polynucleotides of the present disclosure (e.g., at the N-terminal or C-terminal ends), e.g., for localization. In some embodiments, amino acid residues located at the carboxy, amino terminal, or internal regions of a polypeptide of the present disclosure can optionally be deleted providing for fragments.


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) comprising a nucleotide sequence (e.g., an ORF) of the present disclosure encodes a substitutional variant of a Factor VIII sequence, which can comprise one, two, three or more than three substitutions. In some embodiments, the substitutional variant can comprise one or more conservative amino acids substitutions. In other embodiments, the variant is an insertional variant. In other embodiments, the variant is a deletional variant.


As recognized by those skilled in the art, Factor VIII protein fragments, functional protein domains, variants, and homologous proteins (orthologs) are also considered to be within the scope of the Factor VIII polypeptides of the present disclosure.


Certain compositions and methods presented in this disclosure refer to the protein or polynucleotide sequences of Factor VIII. A person skilled in the art will understand that such disclosures are equally applicable to any other isoforms of Factor VIII known in the art.


The skilled artisan will appreciate that the therapeutic effectiveness of a drug or a treatment of the instant invention can be characterized or determined by measuring the level of expression of an encoded protein in a sample or in samples taken from a subject (e.g., from a preclinical test subject (rodent, primate, etc.) or from a clinical subject (human). Likewise, the therapeutic effectiveness of a drug or a treatment of the instant invention can be characterized or determined by measuring the level of activity of an encoded protein in a sample or in samples taken from a subject (e.g., from a preclinical test subject (rodent, primate, etc.) or from a clinical subject (human). Furthermore, the therapeutic effectiveness of a drug or a treatment of the instant invention can be characterized or determined by measuring the level of an appropriate biomarker in sample(s) taken from a subject. Levels of protein and/or biomarkers can be determined post-administration with a single dose of an mRNA therapeutic of the invention or can be determined and/or monitored at several time points following administration with a single dose or can be determined and/or monitored throughout a course of treatment, e.g., a multi-dose treatment.


In some embodiments the methods of the invention may be enhanced by an initial tolerization step. For instance a subject may first be treated with a tolerizing protein. In some embodiments the tolerizing protein may be an anti-CD3 antibody, such as an mRNA encoding an anti-CD3 antibody. After the antibody treatment the subject may be treated with the mRNA encoding the Factor VIII. In some embodiments the antibody is an mRNAs encoding a full length anti-CD3 antibody, a scFv-Fc and Fab.


Thus, in some aspects of the invention the Factor VIII polynucleotides may be administered to a subject in conjunction with an anti-CD3 antibody. An anti-CD3 antibody includes antibodies, fragments thereof and other biding peptides that specifically bind to CD3. In some cases, an anti-CD3 antibody preparation useful herein can bind to a CD3 molecule with little or no detectable binding to non-CD3 molecules. The term “antibody” as used herein refers to intact antibodies as well as antibody fragments that retain some ability to bind an epitope. Such fragments include, without limitation, Fab, F(ab′)2, and Fv antibody fragments. The term “epitope” refers to an antigenic determinant on an antigen to which the paratope of an antibody binds. Epitopic determinants usually consist of chemically active surface groupings of molecules (e.g., amino acid or sugar residues) and usually have specific three dimensional structural characteristics as well as specific charge characteristics.


Factor VIII Protein Expression Levels


Certain aspects of the invention feature measurement, determination and/or monitoring of the expression level or levels of Factor VIII protein in a subject, for example, in an animal (e.g., rodents, primates, and the like) or in a human subject. Animals include normal, healthy or wildtype animals, as well as animal models for use in understanding Hemophilia A and treatments thereof. Exemplary animal models include rodent models, for example, Factor VIII deficient mice or Factor VIII deficient zebrafish. Factor VIII protein expression levels can be measured or determined by any art-recognized method for determining protein levels in biological samples, e.g., serum sample. The term “level” or “level of a protein” as used herein, preferably means the weight, mass or concentration of the protein within a sample or a subject. It will be understood by the skilled artisan that in certain embodiments the sample may be subjected, e.g., to any of the following: purification, precipitation, separation, e.g. centrifugation and/or HPLC, and subsequently subjected to determining the level of the protein, e.g., using mass and/or spectrometric analysis. In exemplary embodiments, enzyme-linked immunosorbent assay (ELISA) can be used to determine protein expression levels. In other exemplary embodiments, protein purification, separation and LC-MS can be used as a means for determining the level of a protein according to the invention. In some embodiments, an mRNA therapy of the invention (e.g., a single intravenous dose) results in increased Factor VIII protein expression levels in the plasma of the subject (e.g., 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, or 10-fold increase and/or increased to at least 50%, at least 60%, at least 70%, at least 75%, 80%, at least 85%, at least 90%, at least 95%, or at least100% normal levels) for at least 6 hours, at least 12 hours, at least 24 hours, at least 36 hours, at least 48 hours, at least 60 hours, at least 72 hours, at least 84 hours, at least 96 hours, at least 108 hours, at least 122 hours after administration of a single dose of the mRNA therapy.


Factor VIII Protein Activity

In Hemophilia A patients, Factor VIII activity is reduced, e.g., to about 50%-80% of normal. Further aspects of the invention feature measurement, determination and/or monitoring of the activity level(s) (i.e., activity level(s)) of Factor VIII protein in a subject, for example, in an animal (e.g., rodent, primate, and the like) or in a human subject. Activity levels can be measured or determined by any art-recognized method for determining activity levels in biological samples. The term “activity level” as used herein, preferably means the activity of the protein per volume, mass or weight of sample or total protein within a sample. In exemplary embodiments, the “activity level” is described in terms of units per milliliter of fluid (e.g., bodily fluid, e.g., serum, plasma, urine and the like) or is described in terms of units per weight of tissue or per weight of protein (e.g., total protein) within a sample. Factor VIII is a component of the coagulation pathway and can be functionally characterized in terms of clotting or bleeding propensity or biologically characterized by binding assays such as ELISA.


In exemplary embodiments, an mRNA therapy of the invention features a pharmaceutical composition comprising a dose of mRNA effective to result in at least 5 U/mg, at least 10 U/mg, at least 20 U/mg, at least 30 U/mg, at least 40 U/mg, at least 50 U/mg, at least 60 U/mg, at least 70 U/mg, at least 80 U/mg, at least 90 U/mg, at least 100 U/mg, or at least 150 U/mg of Factor VIII activity in tissue between 6 and 12 hours, or between 12 and 24, between 24 and 48, or between 48 and 72 hours post administration (e.g., at 48 or at 72 hours post administration). In exemplary embodiments, an mRNA therapy of the invention features a pharmaceutical composition comprising a dose of mRNA effective to result in at least 50 U/mg, at least 100 U/mg, at least 200 U/mg, at least 300 U/mg, at least 400 U/mg, at least 500 U/mg, at least 600 U/mg, at least 700 U/mg, at least 800 U/mg, at least 900 U/mg, at least 1,000 U/mg, or at least 1,500 U/mg of Factor VIII activity between 6 and 12 hours, or between 12 and 24, between 24 and 48, or between 48 and 72 hours post administration (e.g., at 48 or at 72 hours post administration).


In exemplary embodiments, an mRNA therapy of the invention features a pharmaceutical composition comprising a single intravenous dose of mRNA that results in the above-described levels of activity. In another embodiment, an mRNA therapy of the invention features a pharmaceutical composition which can be administered in multiple single unit intravenous doses of mRNA that maintain the above-described levels of activity.


Polynucleotides and Open Reading Frames (ORFs)

In certain aspects, the present disclosure provides polynucleotides (e.g., a RNA, e.g., an mRNA) that comprise a nucleotide sequence (e.g., an ORF) encoding one or more Factor VIII polypeptides. In some embodiments, the encoded Factor VIII polypeptide of the present disclosure can be selected from:


a full length Factor VIII polypeptide (e.g., having the same or essentially the same length as wild-type Factor VIII);


a functional fragment of a Factor VIII sequences (e.g., a truncated (e.g., deletion of carboxy, amino terminal, or internal regions) sequence shorter than one of wild-type; but still retaining Factor VIII activity);


a variant thereof (e.g., full length or truncated proteins in which one or more amino acids have been replaced, e.g., variants that retain all or most of the Factor VIII activity of the polypeptide with respect to a reference sequence (or any other natural or artificial variants known in the art); or


a fusion protein comprising (i) a full length Factor VIII protein, a functional fragment or a variant thereof, and (ii) a heterologous protein.


In certain embodiments, the encoded Factor VIII polypeptide is a mammalian Factor VIII polypeptide, such as a human Factor VIII polypeptide, a functional fragment or a variant thereof.


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure increases Factor VIII protein expression levels and/or detectable Factor VIII activity levels in cells when introduced in those cells, e.g., by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100%, compared to Factor VIII protein expression levels and/or detectable Factor VIII activity levels in the cells prior to the administration of the polynucleotide of the present disclosure. Factor VIII protein expression levels and/or Factor VIII activity can be measured according to methods know in the art. In some embodiments, the polynucleotide is introduced to the cells in vitro. In some embodiments, the polynucleotide is introduced to the cells in vivo.


In some embodiments, the polynucleotides (e.g., a RNA, e.g., an mRNA) of the present disclosure comprise a nucleotide sequence (e.g., an ORF) that encodes a wild-type human Factor VIII, e.g., wild-type human Factor VIII (SEQ ID NO: 1 or 2).


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises a codon optimized nucleic acid sequence, wherein the open reading frame (ORF) of the codon optimized nucleic sequence is derived from a wild-type Factor VIII sequence. For example, for polynucleotides of present disclosure comprising a sequence optimized ORF encoding Factor VIII, the corresponding wild type sequence is the native Factor VIII.


In some embodiments, the polynucleotides (e.g., a RNA, e.g., an mRNA) of the present disclosure comprise a nucleotide sequence encoding Factor VIII having the full length sequence of human Factor VIII (i.e., including the initiator methionine). In mature human Factor VIII, the initiator methionine can be removed to yield a “mature Factor VIII”. The teachings of the present disclosure directed to the full sequence of human Factor VIII are also applicable to the mature form of human Factor VIII lacking the initiator methionine. Thus, in some embodiments, the polynucleotides (e.g., a RNA, e.g., an mRNA) of the present disclosure comprise a nucleotide sequence encoding Factor VIII having the mature sequence of human Factor VIII (i.e., lacking the initiator methionine). In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprising a nucleotide sequence encoding Factor VIII having the full length or mature sequence of human Factor VIII is sequence optimized. In some embodiments the polynucleotides (e.g., a RNA, e.g., an mRNA) of the present disclosure comprise a nucleotide sequence encoding activated Factor VIII.


In some embodiments, the polynucleotides (e.g., a RNA, e.g., an mRNA) of the present disclosure comprise a nucleotide sequence (e.g., an ORF) encoding a mutant Factor VIII polypeptide. In some embodiments, the polynucleotides of the present disclosure comprise an ORF encoding a Factor VIII polypeptide that comprises at least one point mutation in the Factor VIII sequence and retains Factor VIII activity. In some embodiments, the mutant Factor VIII polypeptide has a Factor VIII activity which is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% of the Factor VIII activity of the corresponding wild-type Factor VIII (i.e., the same Factor VIII sequence but without the mutation(s)). In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprising an ORF encoding a mutant Factor VIII polypeptide is sequence optimized.


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises a nucleotide sequence (e.g., an ORF) that encodes a Factor VIII polypeptide with mutations that do not alter Factor VIII activity. Such mutant Factor VIII polypeptides can be referred to as function-neutral. In some embodiments, the polynucleotide comprises an ORF that encodes a mutant Factor VIII polypeptide comprising one or more function-neutral point mutations.


In some embodiments, the mutant Factor VIII polypeptide has higher Factor VIII activity than the corresponding wild-type Factor VIII. In some embodiments, the mutant Factor VIII polypeptide has a Factor VIII activity that is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% higher than the activity of the corresponding wild-type Factor VIII (i.e., the same Factor VIII sequence but without the mutation(s)).


In some embodiments, the polynucleotides (e.g., a RNA, e.g., an mRNA) of the present disclosure comprise a nucleotide sequence (e.g., an ORF) encoding a functional Factor VIII fragment, e.g., where one or more fragments correspond to a polypeptide subsequence of a wild type Factor VIII polypeptide and retain Factor VIII activity. In some embodiments, the Factor VIII fragment has a Factor VIII activity which is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% of the Factor VIII activity of the corresponding full length Factor VIII. In some embodiments, the polynucleotides (e.g., a RNA, e.g., an mRNA) of the present disclosure comprising an ORF encoding a functional Factor VIII fragment is sequence optimized.


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises a nucleotide sequence (e.g., an ORF) encoding a Factor VIII fragment that has higher Factor VIII activity than the corresponding full length Factor VIII. Thus, in some embodiments the Factor VIII fragment has a Factor VIII activity which is at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% higher than the Factor VIII activity of the corresponding full length Factor VIII.


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises a nucleotide sequence (e.g., an ORF) encoding a Factor VIII fragment that is at least 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19%, 20%, 21%, 22%, 23%, 24% or 25% shorter than wild-type Factor VIII.


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises a nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide (e.g., the wild-type sequence, functional fragment, or variant thereof), wherein the nucleotide sequence is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to the sequence of SEQ ID NO:3, 127-135, or 166-169.


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises a nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide (e.g., the wild-type sequence, functional fragment, or variant thereof), wherein the nucleotide sequence has at least 70%, at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to a sequence selected from the group consisting of SEQ ID NO: 3, 127-135 and 166-169.


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises from about 3,105 to about 100,000 nucleotides (e.g., from 3,105 to 3,700, from 3,105 to 3,800, from 3,105 to 3,900, from 3,105 to 4,000, from 3,105 to 4,100 from 3,105 to 4,200, from 3,105 to 4,300, from 3,105 to 4,400, 3,654 to 3,700, from 3,654 to 3,800, from 3,654 to 3,900, from 3,654 to 4,000, from 3,654 to 4,100 from 3,654 to 4,200, from 3,654 to 4,300, from 3,654 to 4,400, from 3,654 to 5,000, from 3,654 to 7,000, from 3,654 to 10,000, from 3,654 to 25,000, from 3,654 to 50,000, from 3,654 to 70,000, or from 3,654 to 100,000).


In some embodiments, the polynucleotide of the present disclosure (e.g., a RNA, e.g., an mRNA) comprises a nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide (e.g., the wild-type sequence, functional fragment, or variant thereof), wherein the length of the nucleotide sequence (e.g., an ORF) is at least 500 nucleotides in length (e.g., at least or greater than about 500, 600, 700, 80, 900, 1,000, 1,050, 1,100, 1,200, 1,300, 1,400, 1,500, 1,600, 1,700, 1,800, 1,900, 2,000, 2,100, 2,200, 2,300, 2,400, 2,500, 2,600, 2,700, 2,800, 2,900, 3,000, 3,100, 3,200, 3,300, 3,400, 3,500, 3,600, 3,654, 3,700, 3,800, 3,900, 4,000, 4,100, 4,200, 4,300, 4,400, 4,500, 4,600, 4,700, 4,800, 4,900, 5,000, 5,100, 5,200, 5,300, 5,400, 5,500, 5,600, 5,700, 5,800, 5,900, 6,000, 7,000, 8,000, 9,000, 10,000, 20,000, 30,000, 40,000, 50,000, 60,000, 70,000, 80,000, 90,000 or up to and including 100,000 nucleotides).


In some embodiments, the polynucleotide of the present disclosure (e.g., a RNA, e.g., an mRNA) comprises a nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide (e.g., the wild-type sequence, functional fragment, or variant thereof) further comprises at least one nucleic acid sequence that is noncoding, e.g., a miRNA binding site.


In some embodiments, the polynucleotide of the present disclosure (e.g., a RNA, e.g., an mRNA) comprises a nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide is single stranded or double stranded.


In some embodiments, the polynucleotide of the present disclosure comprising a nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide (e.g., the wild-type sequence, functional fragment, or variant thereof) is DNA or RNA. In some embodiments, the polynucleotide of the present disclosure is RNA. In some embodiments, the polynucleotide of the present disclosure is, or functions as, a messenger RNA (mRNA). In some embodiments, the mRNA comprises a nucleotide sequence (e.g., an ORF) that encodes at least one Factor VIII polypeptide, and is capable of being translated to produce the encoded Factor VIII polypeptide in vitro, in vivo, in situ or ex vivo.


In some embodiments, the polynucleotide of the present disclosure (e.g., a RNA, e.g., an mRNA) comprises a sequence-optimized nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide (e.g., the wild-type sequence, functional fragment, or variant thereof), wherein the polynucleotide comprises 1-methylpseudouridines. In some embodiments, the polynucleotide further comprises a 5′ UTR having SEQ ID NO:125 or 126 and a 3′UTR having SEQ ID NO:146. In some embodiments, the polynucleotide disclosed herein is formulated with a delivery agent, e.g., a lipid nanoparticle comprised of an ionizable lipid of compound 18 or 25, a neutral lipid, a structural lipid and a PEG lipid. In some embodiments the delivery agent is an LNP comprised of:


an ionizable cationic lipid of




embedded image


and a PEG lipid comprising Formula VI, or


an ionizable cationic lipid of




embedded image


and an alternative lipid comprising oleic acid, or an ionizable cationic lipid of




embedded image


an alternative lipid comprising oleic acid, a structural lipid comprising cholesterol, and a PEG lipid comprising a compound having Formula VI.


Signal Sequences

The polynucleotides (e.g., a RNA, e.g., an mRNA) of the present disclosure can also comprise nucleotide sequences that encode additional features that facilitate trafficking of the encoded polypeptides to therapeutically relevant sites. One such feature that aids in protein trafficking is the signal sequence, or targeting sequence. The peptides encoded by these signal sequences are known by a variety of names, including targeting peptides, transit peptides, and signal peptides. In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) comprises a nucleotide sequence (e.g., an ORF) that encodes a signal peptide operably linked a nucleotide sequence that encodes a Factor VIII polypeptide described herein.


In some embodiments, the “signal sequence” or “signal peptide” is a polynucleotide or polypeptide, respectively, which is from about 30-210, e.g., about 45-80 or 15-60 nucleotides (3-70 amino acids) in length that, optionally, is incorporated at the 5′ (or N-terminus) of the coding region or the polypeptide, respectively. Addition of these sequences results in trafficking the encoded polypeptide to a desired site, such as the endoplasmic reticulum or the mitochondria through one or more targeting pathways. Some signal peptides are cleaved from the protein, for example by a signal peptidase after the proteins are transported to the desired site.


In some embodiments, the polynucleotide of the present disclosure comprises a nucleotide sequence encoding a Factor VIII polypeptide, wherein the nucleotide sequence further comprises a 5′ nucleic acid sequence encoding a native signal peptide. In another embodiment, the polynucleotide of the present disclosure comprises a nucleotide sequence encoding a Factor VIII polypeptide, wherein the nucleotide sequence lacks the nucleic acid sequence encoding a native signal peptide.


In some embodiments, the polynucleotide of the present disclosure comprises a nucleotide sequence encoding a Factor VIII polypeptide, wherein the nucleotide sequence further comprises a 5′ nucleic acid sequence encoding a heterologous signal peptide.


Fusion Proteins


In some embodiments, the polynucleotide of the present disclosure (e.g., a RNA, e.g., an mRNA) can comprise more than one nucleic acid sequence (e.g., an ORF) encoding a polypeptide of interest. In some embodiments, polynucleotides of the present disclosure comprise a single ORF encoding a Factor VIII polypeptide, a functional fragment, or a variant thereof. However, in some embodiments, the polynucleotide of the present disclosure can comprise more than one ORF, for example, a first ORF encoding a Factor VIII polypeptide (a first polypeptide of interest), a functional fragment, or a variant thereof, and a second ORF expressing a second polypeptide of interest. In some embodiments, two or morepolypeptides of interest can be genetically fused, i.e., two or more polypeptides can be encoded by the same ORF. In some embodiments, the polynucleotide can comprise a nucleic acid sequence encoding a linker (e.g., a GIS peptide linker or another linker known in the art) between two or more polypeptides of interest.


In some embodiments, a polynucleotide of the present disclosure (e.g., a RNA, e.g., an mRNA) can comprise two, three, four, or more ORFs, each expressing a polypeptide of interest.


In some embodiments, the polynucleotide of the present disclosure (e.g., a RNA, e.g., an mRNA) can comprise a first nucleic acid sequence (e.g., a first ORF) encoding a Factor VIII polypeptide and a second nucleic acid sequence (e.g., a second ORF) encoding a second polypeptide of interest such as an antibody Fc domain.


Sequence Optimization of Nucleotide Sequence Encoding a Factor VIII Polypeptide

In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure is sequence optimized. In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises a nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide, optionally, a nucleotide sequence (e.g, an ORF) encoding another polypeptide of interest, a 5′-UTR, a 3′-UTR, the 5′ UTR or 3′ UTR optionally comprising at least one microRNA binding site, optionally a nucleotide sequence encoding a linker, a polyA tail, or any combination thereof), in which the ORF(s) that are sequence optimized.


A sequence-optimized nucleotide sequence, e.g., an codon-optimized mRNA sequence encoding a Factor VIII polypeptide, is a sequence comprising at least one synonymous nucleobase substitution with respect to a reference sequence (e.g., a wild type nucleotide sequence encoding a Factor VIII polypeptide).


A sequence-optimized nucleotide sequence can be partially or completely different in sequence from the reference sequence. For example, a reference sequence encoding polyserine uniformly encoded by TCT codons can be sequence-optimized by having 100% of its nucleobases substituted (for each codon, T in position 1 replaced by A, C in position 2 replaced by G, and T in position 3 replaced by C) to yield a sequence encoding polyserine which would be uniformly encoded by AGC codons. The percentage of sequence identity obtained from a global pairwise alignment between the reference polyserine nucleic acid sequence and the sequence-optimized polyserine nucleic acid sequence would be 0%. However, the protein products from both sequences would be 100% identical.


Some sequence optimization (also sometimes referred to codon optimization) methods are known in the art (and discussed in more detail below) and can be useful to achieve one or more desired results. These results can include, e.g., matching codon frequencies in certain tissue targets and/or host organisms to ensure proper folding; biasing G/C content to increase mRNA stability or reduce secondary structures; minimizing tandem repeat codons or base runs that can impair gene construction or expression; customizing transcriptional and translational control regions; inserting or removing protein trafficking sequences; removing/adding post translation modification sites in an encoded protein (e.g., glycosylation sites); adding, removing or shuffling protein domains; inserting or deleting restriction sites; modifying ribosome binding sites and mRNA degradation sites; adjusting translational rates to allow the various domains of the protein to fold properly; and/or reducing or eliminating problem secondary structures within the polynucleotide. Sequence optimization tools, algorithms and services are known in the art, non-limiting examples include services from GeneArt (Life Technologies), DNA2.0 (Menlo Park Calif.) and/or proprietary methods.


Codon options for each amino acid are given in TABLE 1. The skilled artisan will appreciate that codon sequences (and other sequences recited herein) feature T when referring to DNA (e.g., DNA sequences for templates or constructs from which mRNAs of the invention are prodied via IVT) and feature U when referring to RNA.









TABLE 1







Codon Options












Single





Letter




Amino Acid
Code
Codon Options







Isoleucine
I
ATT, ATC, ATA



Leucine
L
CTT, CTC, CTA, CTG, TTA, TTG



Valine
V
GTT, GTC, GTA, GTG



Phenylalanine
F
TTT, TTC



Methionine
M
ATG



Cysteine
C
TGT, TGC



Alanine
A
GCT, GCC, GCA, GCG



Glycine
G
GGT, GGC, GGA, GGG



Proline
P
CCT, CCC, CCA, CCG



Threonine
T
ACT, ACC, ACA, ACG



Serine
S
TCT, TCC, TCA, TCG, AGT, AGC



Tyrosine
Y
TAT, TAC



Tryptophan
W
TGG



Glutamine
Q
CAA, CAG



Asparagine
N
AAT, AAC



Histidine
H
CAT, CAC



Glutamic acid
E
GAA, GAG



Aspartic acid
D
GAT, GAC



Lysine
K
AAA, AAG



Arginine
R
CGT, CGC, CGA, CGG, AGA, AGG



Selenocysteine
Sec
UGA in mRNA in presence of





Selenocysteine insertion element





(SECIS)



Stop codons
Stop
TAA, TAG, TGA










In some embodiments, a polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises a sequence-optimized nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide, a functional fragment, or a variant thereof, wherein the Factor VIII polypeptide, functional fragment, or a variant thereof encoded by the sequence-optimized nucleotide sequence has improved properties (e.g., compared to a Factor VIII polypeptide, functional fragment, or a variant thereof encoded by a reference nucleotide sequence that is not sequence optimized), e.g., improved properties related to expression efficacy after administration in vivo. Such properties include, but are not limited to, improving nucleic acid stability (e.g., mRNA stability), increasing translation efficacy in the target tissue, reducing the number of truncated proteins expressed, improving the folding or prevent misfolding of the expressed proteins, reducing toxicity of the expressed products, reducing cell death caused by the expressed products, increasing and/or decreasing protein aggregation.


In some embodiments, the sequence-optimized nucleotide sequence (e.g., an ORF) is codon optimized for expression in human subjects, having structural and/or chemical features that avoid one or more of the problems in the art, for example, features which are useful for optimizing formulation and delivery of nucleic acid-based therapeutics while retaining structural and functional integrity; overcoming a threshold of expression; improving expression rates; half-life and/or protein concentrations; optimizing protein localization; and avoiding deleterious bio-responses such as the immune response and/or degradation pathways.


In some embodiments, the polynucleotides of the present disclosure comprise a nucleotide sequence (e.g., a nucleotide sequence (e.g, an ORF) encoding a Factor VIII polypeptide, a 5′-UTR, a 3′-UTR, a microRNA, a nucleic acid sequence encoding a linker, or any combination thereof) that is sequence-optimized according to a method comprising:


(i) substituting at least one codon in a reference nucleotide sequence (e.g., an ORF encoding a Factor VIII polypeptide) with an alternative codon to increase or decrease uridine content to generate a uridine-modified sequence;


(ii) substituting at least one codon in a reference nucleotide sequence (e.g., an ORF encoding a Factor VIII polypeptide) with an alternative codon having a higher codon frequency in the synonymous codon set;


(iii) substituting at least one codon in a reference nucleotide sequence (e.g., an ORF encoding a Factor VIII polypeptide) with an alternative codon to increase G/C content; or


(iv) a combination thereof.


In some embodiments, the sequence-optimized nucleotide sequence (e.g., an ORF encoding a Factor VIII polypeptide) has at least one improved property with respect to the reference nucleotide sequence.


In some embodiments, the sequence optimization method is multiparametric and comprises one, two, three, four, or more methods disclosed herein and/or other optimization methods known in the art.


Features, which can be considered beneficial in some embodiments of the present disclosure, can be encoded by or within regions of the polynucleotide and such regions can be upstream (5′) to, downstream (3′) to, or within the region that encodes the Factor VIII polypeptide. These regions can be incorporated into the polynucleotide before and/or after sequence-optimization of the protein encoding region or open reading frame (ORF). Examples of such features include, but are not limited to, untranslated regions (UTRs), microRNA sequences, Kozak sequences, oligo(dT) sequences, poly-A tail, and detectable tags and can include multiple cloning sites that can have Xbal recognition.


In some embodiments, the polynucleotide of the present disclosure comprises a 5′ UTR. a 3′ UTR and/or a miRNA binding site. In some embodiments, the polynucleotide comprises two or more 5′ UTRs and/or 3′ UTRs, which can be the same or different sequences. In some embodiments, the polynucleotide comprises two or more miRNA binding site, which can be the same or different sequences. Any portion of the 5′ UTR, 3′ UTR, and/or miRNA binding site, including none, can be sequence-optimized and can independently contain one or more different structural or chemical modifications, before and/or after sequence optimization.


In some embodiments, after optimization, the polynucleotide is reconstituted and transformed into a vector such as, but not limited to, plasmids, viruses, cosmids, and artificial chromosomes. For example, the optimized polynucleotide can be reconstituted and transformed into chemically competent E. coli, yeast, neurospora, maize, drosophila, etc. where high copy plasmid-like or chromosome structures occur by methods described herein.


Exemplary amino acid sequences and nucleotide sequences encoding human Factor VIII are shown in TABLE 2


.









TABLE 2







Amino acid sequences and nucleotide sequences encoding human Factor VIII









SEQ




ID NO
NAME
SEQUENCE





1
WT
MQIELSTCFF LCLLRFCFSA TRRYYLGAVE LSWDYMQSDL GELPVDARFP PRVPKSFPFN



AAA52
TSVVYKKTLF VEFTDHLFNI AKPRPPWMGL LGPTIQAEVY DTVVITLKNM ASHPVSLHAV



420.1
GVSYWKASEG AEYDDQTSQR EKEDDKVFPG GSHTYVWQVL KENGPMASDP LCLTYSYLSH




VDLVKDLNSG LIGALLVCRE GSLAKEKTQT LHKFILLFAV FDEGKSWHSE TKNSLMQDRD




AASARAWPKM HTVNGYVNRS LPGLIGCHRK SVYWHVIGMG TTPEVHSIFL EGHTFLVRNH




RQASLEISPI TFLTAQTLLM DLGQFLLFCH ISSHQHDGME AYVKVDSCPE EPQLRMKNNE




EAEDYDDDLT DSEMDVVRFD DDNSPSFIQI RSVAKKHPKT WVHYIAAEEE DWDYAPLVLA




PDDRSYKSQY LNNGPQRIGR KYKKVRFMAY TDETFKTREA IQHESGILGP LLYGEVGDTL




LIIFKNQASR PYNIYPHGIT DVRPLYSRRL PKGVKHLKDF PILPGEIFKY KWTVTVEDGP




TKSDPRCLTR YYSSFVNMER DLASGLIGPL LICYKESVDQ RGNQIMSDKR NVILFSVFDE




NRSWYLTENI QRFLPNPAGV QLEDPEFQAS NIMHSINGYV FDSLQLSVCL HEVAYWYILS




IGAQTDFLSV FFSGYTFKHK MVYEDTLTLF PFSGETVFMS MENPGLWILG CHNSDFRNRG




MTALLKVSSC DKNTGDYYED SYEDISAYLL SKNNAIEPRS FSQNSRHPST RQKQFNATTI




PENDIEKTDP WFAHRTPMPK IQNVSSSDLL MLLRQSPTPH GLSLSDLQEA KYETFSDDPS




PGAIDSNNSL SEMTHFRPQL HHSGDMVFTP ESGLQLRLNE KLGTTAATEL KKLDFKVSST




SNNLISTIPS DNLAAGTDNT SSLGPPSMPV HYDSQLDTTL FGKKSSPLTE SGGPLSLSEE




NNDSKLLESG LMNSQESSWG KNVSSTESGR LFKGKRAHGP ALLTKDNALF KVSISLLKTN




KTSNNSATNR KTHIDGPSLL IENSPSVWQN ILESDTEFKK VTPLIHDRML MDKNATALRL




NHMSNKTTSS KNMEMVQQKK EGPIPPDAQN PDMSFFKMLF LPESARWIQR THGKNSLNSG




QGPSPKQLVS LGPEKSVEGQ NFLSEKNKVV VGKGEFTKDV GLKEMVFPSS RNLFLTNLDN




LHENNTHNQE KKIQEEIEKK ETLIQENVVL PQIHTVTGTK NFMKNLFLLS TRQNVEGSYD




GAYAPVLQDF RSLNDSTNRT KKHTAHFSKK GEEENLEGLG NQTKQIVEKY ACTTRISPNT




SQQNFVTQRS KRALKQFRLP LEETELEKRI IVDDTSTQWS KNMKHLTPST LTQIDYNEKE




KGAITQSPLS DCLTRSHSIP QANRSPLPIA KVSSFPSIRP IYLTRVLFQD NSSHLPAASY




RKKDSGVQES SHFLQGAKKN NLSLAILTLE MTGDQREVGS LGTSATNSVT YKKVENTVLP




KPDLPKTSGK VELLPKVHIY QKDLFPTETS NGSPGHLDLV EGSLLQGTEG AIKWNEANRP




GKVPFLRVAT ESSAKTPSKL LDPLAWDNHY GTQIPKEEWK SQEKSPEKTA FKKKDTILSL




NACESNHAIA AINEGQNKPE IEVTWAKQGR TERLCSQNPP VLKRHQREIT RTTLQSDQEE




IDYDDTISVE MKKEDFDIYD EDENQSPRSF QKKTRHYFIA AVERLWDYGM SSSPHVLRNR




AQSGSVPQFK KVVFQEFTDG SFTQPLYRGE LNEHLGLLGP YIRAEVEDNI MVTFRNQASR




PYSFYSSLIS YEEDQRQGAE PRKNFVKPNE TKTYFWKVQH HMAPTKDEFD CKAWAYFSDV




DLEKDVHSGL IGPLLVCHTN TLNPAHGRQV TVQEFALFFT IFDETKSWYF TENMERNCRA




PSNIQMEDPT FKENYRFHAI NGYIMDTLPG LVMAQDQRIR WYLLSMGSNE NIHSIHFSGH




VFTVRKKEEY KMALYNLYPG VFETVEMLPS KAGIWRVECL IGEHLHAGMS TLFLVYSNKC




QTPLGMASGH IRDFQITASG QYGQWAPKLA RLHYSGSINA WSTKEPFSWI KVDLLAPMII




HGIKTQGARQ KFSSLYISQF IIMYSLDGKK WQTYRGNSTG TLMVFFGNVD SSGIKHNIFN




PPIIARYIRL HPTHYSIRST LRMELMGCDL NSCSMPLGME SKAISDAQIT ASSYFTNMFA




TWSPSKARLH LQGRSNAWRP QVNNPKEWLQ VDFQKTMKVT GVTTQGVKSL LTSMYVKEFL




ISSSQDGHQW TLFFQNGKVK VFQGNQDSFT PVVNSLDPPL LTRYLRIHPQ SWVHQIALRM




EVLGCEAQDL Y





2
NP_000123.1
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY




KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASEG




AEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLIGAL




LVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNGYVNRS




LPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMDLGQF




LLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNSPSFIQI




RSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFMAYTDETF




KTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVKHLKDF




PILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQRGNQI




MSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLSVCL




HEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCHNSD




FRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNATTI




PENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAID




SNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS




DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ




ESSWGKNVSSTESGRLFKGKRAHGPALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLL




IENSPSVWQNILESDTEFKKVTPLIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIP




PDAQNPDMSFFKMLFLPESARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKVV




VGKGEFTKDVGLKEMVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENVVLPQIHT




VTGTKNFMKNLFLLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEGLG




NQTKQIVEKYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNMKH




LTPSTLTQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQD




NSSHLPAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVE




NTVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANRP




GKVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACES




NHAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVE




MKKEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQ




EFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAE




PRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPA




HGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPG




LVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIW




RVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINA




WSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVF




FGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQIT




ASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMY




VKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRM




EVLGCEAQDLY





3
Transcript
gcttagtgctgagcacatccagtgggtaaagttccttaaaatgctctgcaaagaaattgggactt



variant 1
ttcattaaatcagaaattttacttttttcccctcctgggagctaaagatattttagagaagaatt



NM_000132.3
aaccttttgcttctccagttgaacatttgtagcaataagtcatgcaaatagagctctccacctgc




ttctttctgtgccattgcgattctgctttagtgccaccagaagatactacctgggtgcagtggaa




ctgtcatgggactatatgcaaagtgatctcggtgagctgcctgtggacgcaagatttcctcctag




agtgccaaaatcttttccattcaacacctcagtcgtgtacaaaaagactctgtttgtagaattca




cggatcaccttttcaacatcgctaagccaaggccaccctggatgggtctgctaggtcctaccatc




caggctgaggtttatgatacagtggtcattacacttaagaacatggcttcccatcctgtcagtct




tcatgctgttggtgtatcctactggaaagcttctgagggagctgaatatgatgatcagaccagtc




aaagggagaaagaagatgataaagtcttccctggtggaagccatacatatgtctggcaggtcctg




aaagagaatggtccaatggcctctgacccactgtgccttacctactcatatctttctcatgtgga




cctggtaaaagacttgaattcaggcctcattggagccctactagtatgtagagaagggagtctgg




ccaaggaaaagacacagaccttgcacaaatttatactactttttgctgtatttgatgaagggaaa




agttggcactcagaaacaaagaactccttgatgcaggatagggatgctgcatctgctcgggcctg




gcctaaaatgcacacagtcaatggttatgtaaacaggtctctgccaggtctgattggatgccaca




ggaaatcagtctattggcatgtgattggaatgggcaccactcctgaagtgcactcaatattcctc




gaaggtcacacatttcttgtgaggaaccatcgccaggcgtccttggaaatctcgccaataacttt




ccttactgctcaaacactcttgatggaccttggacagtttctactgttttgtcatatctcttccc




accaacatgatggcatggaagcttatgtcaaagtagacagctgtccagaggaaccccaactacga




atgaaaaataatgaagaagcggaagactatgatgatgatcttactgattctgaaatggatgtggt




caggtttgatgatgacaactctccttcctttatccaaattcgctcagttgccaagaagcatccta




aaacttgggtacattacattgctgctgaagaggaggactgggactatgctcccttagtcctcgcc




cccgatgacagaagttataaaagtcaatatttgaacaatggccctcagcggattggtaggaagta




caaaaaagtccgatttatggcatacacagatgaaacctttaagactcgtgaagctattcagcatg




aatcaggaatcttgggacctttactttatggggaagttggagacacactgttgattatatttaag




aatcaagcaagcagaccatataacatctaccctcacggaatcactgatgtccgtcctttgtattc




aaggagattaccaaaaggtgtaaaacatttgaaggattttccaattctgccaggagaaatattca




aatataaatggacagtgactgtagaagatgggccaactaaatcagatcctcggtgcctgacccgc




tattactctagtttcgttaatatggagagagatctagcttcaggactcattggccctctcctcat




ctgctacaaagaatctgtagatcaaagaggaaaccagataatgtcagacaagaggaatgtcatcc




tgttttctgtatttgatgagaaccgaagctggtacctcacagagaatatacaacgctttctcccc




aatccagctggagtgcagcttgaggatccagagttccaagcctccaacatcatgcacagcatcaa




tggctatgtttttgatagtttgcagttgtcagtttgtttgcatgaggtggcatactggtacattc




tctaagcattggagcacagactgacttcctttctgtcttcttctctggatataccttcaaacaca




aaatggtctatgaagacacactcaccctattcccattctcaggagaaactgtcttcatgtcgatg




gaaaacccaggtctatggattctggggtgccacaactcagactttcggaacagaggcatgaccgc




cttactgaaggtttctagttgtgacaagaacactggtgattattacgaggacagttatgaagata




tttcagcatacttgctgagtaaaaacaatgccattgaaccaagaagcttctcccagaattcaaga




caccctagcactaggcaaaagcaatttaatgccaccacaattccagaaaatgacatagagaagac




tgacccttggtttgcacacagaacacctatgcctaaaatacaaaatgtctcctctagtgatttgt




tgatgctcttgcgacagagtcctactccacatgggctatccttatctgatctccaagaagccaaa




tatgagacatactgatgatccatcacctggagcaatagacagtaataacagcctgtctgaaatga




cacacttcaggccacagctccatcacagtggggacatggtatttacccctgagtcaggcctccaa




ttaagattaaatgagaaactggggacaactgcagcaacagagttgaagaaacttgatttcaaagt




ttctagtacatcaaataatctgatacaacaattccatcagacaatttggcagcaggtactgataa




tacaagttccttaggacccccaagtatgccagttcattatgatagtcaattagataccactctat




ttggcaaaaagtcatctccccttactgagtctggtggacctctgagcttgagtgaagaaaataat




gattcaaagttgttagaatcaggtttaatgaatagccaagaaagttcatggggaaaaaatgtatc




gtcaacagagagtggtaggttatttaaagggaaaagagctcatggacctgattgttgactaaaga




taatgccttattcaaagttagcatctattgttaaagacaaacaaaacttccaataattcagcaac




taatagaaagactcacattgatggcccatcattattaattgagaatagtccatcagtctggcaaa




atatattagaaagtgacactgagtttaaaaaagtgacacctttgattcatgacagaatgcttatg




gacaaaaatgctacagctttgaggctaaatcatatgtcaaataaaactacttcatcaaaaaacat




ggaaatggtccaacagaaaaaagagggccccattccaccagatgcacaaaatccagatatgtcgt




tctttaagatgctattcttgccagaatcagcaaggtggatacaaaggactcatggaaagaactct




ctgaactctgggcaaggccccagtccaaagcaattagtatccttaggaccagaaaaatctgtgga




aggtcagaatttcttgtctgagaaaaacaaagtggtagtaggaaagggtgaatttacaaaggacg




taggactcaaagagatggataccaagcagcagaaacctatttcttactaacttggataatttaca




tgaaaataatacacacaatcaagaaaaaaaaattcaggaagaaatagaaaagaaggaaacattaa




tccaagagaatgtagttttgcctcagatacatacagtgactggcactaagaatttcatgaagaac




atttcttactgagcactaggcaaaatgtagaaggttcatatgacggggcatatgctccagtactt




caagattttaggtcattaaatgattcaacaaatagaacaaagaaacacacagctcatttctcaaa




aaaaggggaggaagaaaacttggaaggcttgggaaatcaaaccaagcaaattgtagagaaatatg




catgcaccacaaggatatctcctaatacaagccagcagaattttgtcacgcaacgtagtaagaga




gctttgaaacaattcagactcccactagaagaaacagaacttgaaaaaaggataattgtggatga




cacctcaacccagtggtccaaaaacatgaaacatttgaccccgagcaccctcacacagatagact




acaatgagaaggagaaaggggccattactcagtctcccttatcagattgccttacgaggagtcat




agcatccctcaagcaaatagatctccattacccattgcaaaggtatcatcatttccatctattag




acctatatatctgaccagggtcctattccaagacaactcttctcatcttccagcagcatcttata




gaaagaaagattctggggtccaagaaagcagtcatttcttacaaggagccaaaaaaaataacctt




tctttagccattctaaccttggagatgactggtgatcaaagagaggttggctccctggggacaag




aagtgccacaaattcagtcacatacaagaaagttgagaacactgttctcccgaaaccagacttgc




ccaaaacatctggcaaagttgaattgcttccaaaagttcacatttatcagaaggacctattccct




acggaaactagcaatgggtctcctggccatctggatctcgtggaagggagccttcttcagggaac




agagggagcgattaagtggaatgaagcaaacagacctggaaaagttccctttctgagagtagcaa




cagaaagctctgcaaagactccctccaagctattggatcctcttgcttgggataaccactatggt




actcagataccaaaagaagagtggaaatcccaagagaagtcaccagaaaaaacagcttttaagaa




aaaggataccattttgtccctgaacgcttgtgaaagcaatcatgcaatagcagcaataaatgagg




gacaaaataagcccgaaatagaagtcacctgggcaaagcaaggtaggactgaaaggctgtgctct




caaaacccaccagtcttgaaacgccatcaacgggaaataactcgtactactcttcagtcagatca




agaggaaattgactatgatgataccatatcagttgaaatgaagaaggaagattttgacatttatg




atgaggatgaaaatcagagcccccgcagctttcaaaagaaaacacgacactattttattgctgca




gtggagaggctctgggattatgggatgagtagctccccacatgttctaagaaacagggctcagag




tggcagtgtccctcagttcaagaaagttgttttccaggaatttactgatggctcctttactcagc




ccttataccgtggagaactaaatgaacatttgggactcctggggccatatataagagcagaagtt




gaagataatatcatggtaactttcagaaatcaggcctctcgtccctattccttctattctagcct




tatttcttatgaggaagatcagaggcaaggagcagaacctagaaaaaactttgtcaagcctaatg




aaaccaaaacttacttaggaaagtgcaacatcatatggcacccactaaagatgagtttgactgca




aagcctgggcttatttctctgatgttgacctggaaaaagatgtgcactcaggcctgattggaccc




cttctggtctgccacactaacacactgaaccctgctcatgggagacaagtgacagtacaggaatt




tgctctgtttttcaccatctttgatgagaccaaaagctggtacttcactgaaaatatggaaagaa




actgcagggctccctgcaatatccagatggaagatcccacttttaaagagaattatcgcttccat




gcaatcaatggctacataatggatacactacctggcttagtaatggctcaggatcaaaggattcg




atggtatctgctcagcatgggcagcaatgaaaacatccattctattcatttcagtggacatgtgt




tcactgtacgaaaaaaagaggagtataaaatggcactgtacaatctctatccaggtgtattgaga




cagtggaaatgttaccatccaaagctggaatttggcgggtggaatgccttattggcgagcatcta




catgctgggatgagcacactttactggtgtacagcaataagtgtcagactcccctgggaatggct




tctggacacattagagattacagattacagcttcaggacaatatggacagtgggccccaaagctg




gccagacttcattattccggatcaatcaatgcctggagcaccaaggagcccttttcttggatcaa




ggtggatctgttggcaccaatgattattcacggcatcaagacccagggtgcccgtcagaagttct




ccagcctctacatctctcagtttatcatcatgtatagtcttgatgggaagaagtggcagacttat




cgaggaaattccactggaaccttaatggtcttctttggcaatgtggattcatctgggataaaaca




caatatttttaaccctccaattattgctcgatacatccgtttgcacccaactcattatagcattc




gcagcactcttcgcatggagttgatgggctgtgatttaaatagttgcagcatgccattgggaatg




gagagtaaagcaatatcagatgcacagattactgcttcatcctactttaccaatatgtttgccac




ctggtctccttcaaaagctcgacttcacctccaagggaggagtaatgcctggagacctcaggtga




ataatccaaaagagtggctgcaagtggacttccagaagacaatgaaagtcacaggagtaactact




cagggagtaaaatctctgcttaccagcatgtatgtgaaggagttcctcatctccagcagtcaaga




tggccatcagtggactctcttttacagaatggcaaagtaaaggtttttcagggaaatcaagactc




cttcacacctgtggtgaactctctagacccaccgttactgactcgctaccttcgaattcaccccc




agagttgggtgcaccagattgccctgaggatggaggttctgggctgcgaggcacaggacctctac




tgagggtggccactgcagcacctgccactgccgtcacctctccctcctcagctccagggcagtgt




ccctccctggcttgccttctacctttgtgctaaatcctagcagacactgccttgaagcctcctga




attaactatcatcagtcctgcatttctttggtggggggccaggagggtgcatccaatttaactta




actcttacctattttctgcagctgctcccagattactccttccttccaatataactaggcaaaaa




gaagtgaggagaaacctgcatgaaagcattcttccctgaaaagttaggcctctcagagtcaccac




ttcctctgttgtagaaaaactatgtgatgaaactttgaaaaagatatttatgatgttaacatttc




aggttaagcctcatacgtttaaaataaaactctcagttgtttattatcctgatcaagcatggaac




aaagcatgtttcaggatcagatcaatacaatcttggagtcaaaaggcaaatcatttggacaatct




gcaaaatggagagaatacaataactactacagtaaagtctgtttctgcttccttacacatagata




taattatgttatttagtcattatgaggggcacattcttatctccaaaactagcattcttaaactg




agaattatagatggggttcaagaatccctaagtcccctgaaattatataaggcattctgtataaa




tgcaaatgtgcatttttctgacgagtgtccatagatataaagccatttggtcttaattctgacca




ataaaaaaataagtcaggaggatgcaattgttgaaagctttgaaataaaataacaatgtcttctt




gaaatttgtgatggccaagaaagaaaatgatgatgacattaggcttctaaaggacatacatttaa




tatttctgtggaaatatgaggaaaatccatggttatctgagataggagatacaaactttgtaatt




ctaataatgcactcagtttactctctccctctactaatttcctgctgaaaataacacaacaaaaa




tgtaacaggggaaattatataccgtgactgaaaactagagtcctacttacatagttgaaatatca




aggaggtcagaagaaaattggactggtgaaaacagaaaaaacactccagtctgccatatcaccac




acaataggatcccccttcttgccctccacccccataagattgtgaagggtttactgctccttcca




tctgcctgaccccttcactatgactacacagaatctcctgatagtaaagggggctggaggcaagg




ataagttatagagcagttggaggaagcatccaaagattgcaacccagggcaaatggaaaacagga




gatcctaatatgaaagaaaaatggatcccaatctgagaaaaggcaaaagaatggctacattacta




tgctggagtattttctaataatcctgcttgacccttatctgacctctttggaaactataacatag




ctgtcacagtatagtcacaatccacaaatgatgcaggtgcaaatggtttatagccctgtgaagtt




cttaaagtttagaggctaacttacagaaatgaataagttgttttgttttatagcccggtagagga




gttaaccccaaaggtgatatggttttatttcctgttatgtttaacttgataatcttattttggca




ttcttacccattgactatatacaaatgagttaaataaaacattgacacatacaaacaaaaaaaaa




aaaaaa





4
mRNA
gcuuagugcugagcacauccaguggguaaaguuccuuaaaaugcucugcaaagaaauugggacuu




uucauuaaaucagaaauuuuacuuuuuuccccuccugggagcuaaagauauuuuagagaagaauu




aaccuuuugcuucuccaguugaacauuuguagcaauaagucaugcaaauagagcucuccaccugc




uucuuucugugccuuuugcgauucugcuuuagugccaccagaagauacuaccugggugcagugga




acugucaugggacuauaugcaaagugaucucggugagcugccuguggacgcaagauuuccuccua




gagugccaaaaucuuuuccauucaacaccucagucguguacaaaaagacucuguuuguagaauuc




acggaucaccuuuucaacaucgcuaagccaaggccacccuggaugggucugcuagguccuaccau




ccaggcugagguuuaugauacaguggucauuacacuuaagaacauggcuucccauccugucaguc




uucaugcuguugguguauccuacuggaaagcuucugagggagcugaauaugaugaucagaccagu




caaagggagaaagaagaugauaaagucuucccugguggaagccauacauaugucuggcagguccu




gaaagagaaugguccaauggccucugacccacugugccuuaccuacucauaucuuucucaugugg




accugguaaaagacuugaauucaggccucauuggagcccuacuaguauguagagaagggagucug




gccaaggaaaagacacagaccuugcacaaauuuauacuacuuuuugcuguauuugaugaagggaa




aaguuggcacucagaaacaaagaacuccuugaugcaggauagggaugcugcaucugcucgggccu




ggccuaaaaugcacacagucaaugguuauguaaacaggucucugccaggucugauuggaugccac




aggaaaucagucuauuggcaugugauuggaaugggcaccacuccugaagugcacucaauauuccu




cgaaggucacacauuucuugugaggaaccaucgccaggcguccuuggaaaucucgccaauaacuu




uccuuacugcucaaacacucuugauggaccuuggacaguuucuacuguuuugucauaucucuucc




ucccaccaacaugauggcauggaagcuuaugucaaaguagacagcuguccagaggaaccccaacu




acgaaugaaaaauaaugaagaagcggaagacuaugaugaugaucuuacugauucugaaauggaug




uggucagguuugaugaugacaacucuccuuccuuuauccaaauucgcucaguugccaagaagcau




ccuaaaacuuggguacauuacauugcugcugaagaggaggacugggacuaugcucccuuaguccu




cgcccccgaugacagaaguuauaaaagucaauauuugaacaauggcccucagcggauugguagga




aguacaaaaaaguccgauuuauggcauacacagaugaaaccuuuaagacucgugaagcuauucag




caugaaucaggaaucuugggaccuuuacuuuauggggaaguuggagacacacuguugauuauauu




uaagaaucaagcaagcagaccauauaacaucuacccucacggaaucacugauguccguccuuugu




auucaaggagauuaccaaaagguguaaaacauuugaaggauuuuccaauucugccaggagaaaua




uucaaauauaaauggacagugacuguagaagaugggccaacuaaaucagauccucggugccugac




ccgcuauuacucuaguuucguuaauauggagagagaucuagcuucaggacucauuggcccucucc




ucaucugcuacaaagaaucuguagaucaaagaggaaaccagauaaugucagacaagaggaauguc




auccuguuuucuguauuugaugagaaccgaagcugguaccucacagagaauauacaacgcuuucu




ccccaauccagcuggagugcagcuugaggauccagaguuccaagccuccaacaucaugcacagca




ucaauggcuauguuuuugauaguuugcaguugucaguuuguuugcaugagguggcauacugguac




auucuaagcauuggagcacagacugacuuccuuucugucuucuucucuggauauaccuucaaaca




caaaauggucuaugaagacacacucacccuauucccauucucaggagaaacugucuucaugucga




uggaaaacccaggucuauggauucuggggugccacaacucagacuuucggaacagaggcaugacc




gccuuacugaagguuucuaguugugacaagaacacuggugauuauuacgaggacaguuaugaaga




uauuucagcauacuugcugaguaaaaacaaugccauugaaccaagaagcuucucccagaauucaa




gacacccuagcacuaggcaaaagcaauuuaaugccaccacaauuccagaaaaugacauagagaag




acugacccuugguuugcacacagaacaccuaugccuaaaauacaaaaugucuccucuagugauuu




guugaugcucuugcgacagaguccuacuccacaugggcuauccuuaucugaucuccaagaagcca




aauaugagacuuuuucugaugauccaucaccuggagcaauagacaguaauaacagccugucugaa




augacacacuucaggccacagcuccaucacaguggggacaugguauuuaccccugagucaggccu




ccaauuaagauuaaaugagaaacuggggacaacugcagcaacagaguugaagaaacuugauuuca




aaguuucuaguacaucaaauaaucugauuucaacaauuccaucagacaauuuggcagcagguacu




gauaauacaaguuccuuaggacccccaaguaugccaguucauuaugauagucaauuagauaccac




ucuauuuggcaaaaagucaucuccccuuacugagucugguggaccucugagcuugagugaagaaa




auaaugauucaaaguuguuagaaucagguuuaaugaauagccaagaaaguucauggggaaaaaau




guaucgucaacagagagugguagguuauuuaaagggaaaagagcucauggaccugcuuuguugac




uaaagauaaugccuuauucaaaguuagcaucucuuuguuaaagacaaacaaaacuuccaauaauu




cagcaacuaauagaaagacucacauugauggcccaucauuauuaauugagaauaguccaucaguc




uggcaaaauauauuagaaagugacacugaguuuaaaaaagugacaccuuugauucaugacagaau




gcuuauggacaaaaaugcuacagcuuugaggcuaaaucauaugucaaauaaaacuacuucaucaa




aaaacauggaaaugguccaacagaaaaaagagggccccauuccaccagaugcacaaaauccagau




augucguucuuuaagaugcuauucuugccagaaucagcaagguggauacaaaggacucauggaaa




gaacucucugaacucugggcaaggccccaguccaaagcaauuaguauccuuaggaccagaaaaau




cuguggaaggucagaauuucuugucugagaaaaacaaagugguaguaggaaagggugaauuuaca




aaggacguaggacucaaagagaugguuuuuccaagcagcagaaaccuauuucuuacuaacuugga




uaauuuacaugaaaauaauacacacaaucaagaaaaaaaaauucaggaagaaauagaaaagaagg




aaacauuaauccaagagaauguaguuuugccucagauacauacagugacuggcacuaagaauuuc




augaagaaccuuuucuuacugagcacuaggcaaaauguagaagguucauaugacggggcauaugc




uccaguacuucaagauuuuaggucauuaaaugauucaacaaauagaacaaagaaacacacagcuc




auuucucaaaaaaaggggaggaagaaaacuuggaaggcuugggaaaucaaaccaagcaaauugua




gagaaauaugcaugcaccacaaggauaucuccuaauacaagccagcagaauuuugucacgcaacg




uaguaagagagcuuugaaacaauucagacucccacuagaagaaacagaacuugaaaaaaggauaa




uuguggaugacaccucaacccagugguccaaaaacaugaaacauuugaccccgagcacccucaca




cagauagacuacaaugagaaggagaaaggggccauuacucagucucccuuaucagauugccuuac




gaggagucauagcaucccucaagcaaauagaucuccauuacccauugcaaagguaucaucauuuc




caucuauuagaccuauauaucugaccaggguccuauuccaagacaacucuucucaucuuccagca




gcaucuuauagaaagaaagauucugggguccaagaaagcagucauuucuuacaaggagccaaaaa




aaauaaccuuucuuuagccauucuaaccuuggagaugacuggugaucaaagagagguuggcuccc




uggggacaagugccacaaauucagucacauacaagaaaguugagaacacuguucucccgaaacca




gacuugcccaaaacaucuggcaaaguugaauugcuuccaaaaguucacauuuaucagaaggaccu




auucccuacggaaacuagcaaugggucuccuggccaucuggaucucguggaagggagccuucuuc




agggaacagagggagcgauuaaguggaaugaagcaaacagaccuggaaaaguucccuuucugaga




guagcaacagaaagcucugcaaagacucccuccaagcuauuggauccucuugcuugggauaacca




cuaugguacucagauaccaaaagaagaguggaaaucccaagagaagucaccagaaaaaacagcuu




uuaagaaaaaggauaccauuuugucccugaacgcuugugaaagcaaucaugcaauagcagcaaua




aaugagggacaaaauaagcccgaaauagaagucaccugggcaaagcaagguaggacugaaaggcu




gugcucucaaaacccaccagucuugaaacgccaucaacgggaaauaacucguacuacucuucagu




cagaucaagaggaaauugacuaugaugauaccauaucaguugaaaugaagaaggaagauuuugac




auuuaugaugaggaugaaaaucagagcccccgcagcuuucaaaagaaaacacgacacuauuuuau




ugcugcaguggagaggcucugggauuaugggaugaguagcuccccacauguucuaagaaacaggg




cucagaguggcagugucccucaguucaagaaaguuguuuuccaggaauuuacugauggcuccuuu




acucagcccuuauaccguggagaacuaaaugaacauuugggacuccuggggccauauauaagagc




agaaguugaagauaauaucaugguaacuuucagaaaucaggccucucgucccuauuccuucuauu




cuagccuuauuucuuaugaggaagaucagaggcaaggagcagaaccuagaaaaaacuuugucaag




ccuaaugaaaccaaaacuuacuuuuggaaagugcaacaucauauggcacccacuaaagaugaguu




ugacugcaaagccugggcuuauuucucugauguugaccuggaaaaagaugugcacucaggccuga




uuggaccccuucuggucugccacacuaacacacugaacccugcucaugggagacaagugacagua




caggaauuugcucuguuuuucaccaucuuugaugagaccaaaagcugguacuucacugaaaauau




ggaaagaaacugcagggcucccugcaauauccagauggaagaucccacuuuuaaagagaauuauc




gcuuccaugcaaucaauggcuacauaauggauacacuaccuggcuuaguaauggcucaggaucaa




aggauucgaugguaucugcucagcaugggcagcaaugaaaacauccauucuauucauuucagugg




acauguguucacuguacgaaaaaaagaggaguauaaaauggcacuguacaaucucuauccaggug




uuuuugagacaguggaaauguuaccauccaaagcuggaauuuggcggguggaaugccuuauuggc




gagcaucuacaugcugggaugagcacacuuuuucugguguacagcaauaagugucagacuccccu




gggaauggcuucuggacacauuagagauuuucagauuacagcuucaggacaauauggacaguggg




ccccaaagcuggccagacuucauuauuccggaucaaucaaugccuggagcaccaaggagcccuuu




ucuuggaucaagguggaucuguuggcaccaaugauuauucacggcaucaagacccagggugcccg




ucagaaguucuccagccucuacaucucucaguuuaucaucauguauagucuugaugggaagaagu




ggcagacuuaucgaggaaauuccacuggaaccuuaauggucuucuuuggcaauguggauucaucu




gggauaaaacacaauauuuuuaacccuccaauuauugcucgauacauccguuugcacccaacuca




uuauagcauucgcagcacucuucgcauggaguugaugggcugugauuuaaauaguugcagcaugc




cauugggaauggagaguaaagcaauaucagaugcacagauuacugcuucauccuacuuuaccaau




auguuugccaccuggucuccuucaaaagcucgacuucaccuccaagggaggaguaaugccuggag




accucaggugaauaauccaaaagaguggcugcaaguggacuuccagaagacaaugaaagucacag




gaguaacuacucagggaguaaaaucucugcuuaccagcauguaugugaaggaguuccucaucucc




agcagucaagauggccaucaguggacucucuuuuuucagaauggcaaaguaaagguuuuucaggg




aaaucaagacuccuucacaccuguggugaacucucuagacccaccguuacugacucgcuaccuuc




gaauucacccccagaguugggugcaccagauugcccugaggauggagguucugggcugcgaggca




caggaccucuacugaggguggccacugcagcaccugccacugccgucaccucucccuccucagcu




ccagggcagugucccucccuggcuugccuucuaccuuugugcuaaauccuagcagacacugccuu




gaagccuccugaauuaacuaucaucaguccugcauuucuuugguggggggccaggagggugcauc




caauuuaacuuaacucuuaccuauuuucugcagcugcucccagauuacuccuuccuuccaauaua




acuaggcaaaaagaagugaggagaaaccugcaugaaagcauucuucccugaaaaguuaggccucu




cagagucaccacuuccucuguuguagaaaaacuaugugaugaaacuuugaaaaagauauuuauga




uguuaacauuucagguuaagccucauacguuuaaaauaaaacucucaguuguuuauuauccugau




caagcauggaacaaagcauguuucaggaucagaucaauacaaucuuggagucaaaaggcaaauca




uuuggacaaucugcaaaauggagagaauacaauaacuacuacaguaaagucuguuucugcuuccu




uacacauagauauaauuauguuauuuagucauuaugaggggcacauucuuaucuccaaaacuagc




auucuuaaacugagaauuauagaugggguucaagaaucccuaaguccccugaaauuauauaaggc




auucuguauaaaugcaaaugugcauuuuucugacgaguguccauagauauaaagccauuuggucu




uaauucugaccaauaaaaaaauaagucaggaggaugcaauuguugaaagcuuugaaauaaaauaa




caaugucuucuugaaauuugugauggccaagaaagaaaaugaugaugacauuaggcuucuaaagg




acauacauuuaauauuucuguggaaauaugaggaaaauccaugguuaucugagauaggagauaca




aacuuuguaauucuaauaaugcacucaguuuacucucucccucuacuaauuuccugcugaaaaua




acacaacaaaaauguaacaggggaaauuauauaccgugacugaaaacuagaguccuacuuacaua




guugaaauaucaaggaggucagaagaaaauuggacuggugaaaacagaaaaaacacuccagucug




ccauaucaccacacaauaggaucccccuucuugcccuccacccccauaagauugugaaggguuua




cugcuccuuccaucugccugaccccuucacuaugacuacacagaaucuccugauaguaaaggggg




cuggaggcaaggauaaguuauagagcaguuggaggaagcauccaaagauugcaacccagggcaaa




uggaaaacaggagauccuaauaugaaagaaaaauggaucccaaucugagaaaaggcaaaagaaug




gcuacuuuuuucuaugcuggaguauuuucuaauaauccugcuugacccuuaucugaccucuuugg




aaacuauaacauagcugucacaguauagucacaauccacaaaugaugcaggugcaaaugguuuau




agcccugugaaguucuuaaaguuuagaggcuaacuuacagaaaugaauaaguuguuuuguuuuau




agcccgguagaggaguuaaccccaaaggugauaugguuuuauuuccuguuauguuuaacuugaua




aucuuauuuuggcauucuuuucccauugacuauauacaaaugaguuaaauaaaacauugacacau




acaaacaaaaaaaaaaaaaaa









Sequence-Optimized Nucleotide Sequences Encoding Factor VIII Polypeptides


In some embodiments, the polynucleotide of the present disclosure comprises a sequence-optimized nucleotide sequence encoding a Factor VIII polypeptide disclosed herein. In some embodiments, the polynucleotide of the present disclosure comprises an open reading frame (ORF) encoding a Factor VIII polypeptide, wherein the ORF has been sequence optimized.


The sequence-optimized nucleotide sequences disclosed herein are distinct from the corresponding wild type nucleotide acid sequences and from other known sequence-optimized nucleotide sequences, e.g., these sequence-optimized nucleic acids have unique compositional characteristics.


In some embodiments, the percentage of uracil or thymine nucleobases in a sequence-optimized nucleotide sequence (e.g., encoding a Factor VIII polypeptide, a functional fragment, or a variant thereof) is modified (e.g,. reduced) with respect to the percentage of uracil or thymine nucleobases in the reference wild-type nucleotide sequence. Such a sequence is referred to as a uracil-modified or thymine-modified sequence. The percentage of uracil or thymine content in a nucleotide sequence can be determined by dividing the number of uracils or thymines in a sequence by the total number of nucleotides and multiplying by 100. In some embodiments, the sequence-optimized nucleotide sequence has a lower uracil or thymine content than the uracil or thymine content in the reference wild-type sequence. In some embodiments, the uracil or thymine content in a sequence-optimized nucleotide sequence of the present disclosure is greater than the uracil or thymine content in the reference wild-type sequence and still maintain beneficial effects, e.g., increased expression and/or reduced Toll-Like Receptor (TLR) response when compared to the reference wild-type sequence. Methods for optimizing codon usage are known in the art.


Characterization of Sequence Optimized Nucleic Acids


In some embodiments of the present disclosure, the polynucleotide (e.g., a RNA, e.g., an mRNA) comprising a sequence optimized nucleic acid disclosed herein encoding a Factor VIII polypeptide can be can be tested to determine whether at least one nucleic acid sequence property (e.g., stability when exposed to nucleases) or expression property has been improved with respect to the non-sequence optimized nucleic acid.


As used herein, “expression property” refers to a property of a nucleic acid sequence either in vivo (e.g., translation efficacy of a synthetic mRNA after administration to a subject in need thereof) or in vitro (e.g., translation efficacy of a synthetic mRNA tested in an in vitro model system). Expression properties include but are not limited to the amount of protein produced by an mRNA encoding a Factor VIII polypeptide after administration, and the amount of soluble or otherwise functional protein produced. In some embodiments, sequence optimized nucleic acids disclosed herein can be evaluated according to the viability of the cells expressing a protein encoded by a sequence optimized nucleic acid sequence (e.g., a RNA, e.g., an mRNA) encoding a Factor VIII polypeptide disclosed herein.


In a particular embodiment, a plurality of sequence optimized nucleic acids disclosed herein (e.g., a RNA, e.g., an mRNA) containing codon substitutions with respect to the non-optimized reference nucleic acid sequence can be characterized functionally to measure a property of interest, for example an expression property in an in vitro model system, or in vivo in a target tissue or cell.


a. Optimization of Nucleic Acid Sequence Intrinsic Properties


In some embodiments of the present disclosure, the desired property of the polynucleotide is an intrinsic property of the nucleic acid sequence. For example, the nucleotide sequence (e.g., a RNA, e.g., an mRNA) can be sequence optimized for in vivo or in vitro stability. In some embodiments, the nucleotide sequence can be sequence optimized for expression in a particular target tissue or cell. In some embodiments, the nucleic acid sequence is sequence optimized to increase its plasma half by preventing its degradation by endo and exonucleases.


In other embodiments, the nucleic acid sequence is sequence optimized to increase its resistance to hydrolysis in solution, for example, to lengthen the time that the sequence optimized nucleic acid or a pharmaceutical composition comprising the sequence optimized nucleic acid can be stored under aqueous conditions with minimal degradation.


In other embodiments, the sequence optimized nucleic acid can be optimized to increase its resistance to hydrolysis in dry storage conditions, for example, to lengthen the time that the sequence optimized nucleic acid can be stored after lyophilization with minimal degradation.


b. Nucleic Acids Sequence Optimized for Protein Expression


In some embodiments of the present disclosure, the desired property of the polynucleotide is the level of expression of a Factor VIII polypeptide encoded by a sequence optimized sequence disclosed herein. Protein expression levels can be measured using one or more expression systems. In some embodiments, expression can be measured in cell culture systems, e.g., CHO cells or HEK293 cells. In some embodiments, expression can be measured using in vitro expression systems prepared from extracts of living cells, e.g., rabbit reticulocyte lysates, or in vitro expression systems prepared by assembly of purified individual components. In other embodiments, the protein expression is measured in an in vivo system, e.g., mouse, rabbit, monkey, etc.


In some embodiments, protein expression in solution form can be desirable. Accordingly, in some embodiments, a reference sequence can be sequence optimized to yield a sequence optimized nucleic acid sequence having optimized levels of expressed proteins in soluble form. Levels of protein expression and other properties such as solubility, levels of aggregation, and the presence of truncation products (i.e., fragments due to proteolysis, hydrolysis, or defective translation) can be measured according to methods known in the art, for example, using electrophoresis (e.g., native or SDS-PAGE) or chromatographic methods (e.g., HPLC, size exclusion chromatography, etc.).


c. Optimization of Target Tissue or Target Cell Viability


In some embodiments, the expression of heterologous therapeutic proteins encoded by a nucleic acid sequence can have deleterious effects in the target tissue or cell, reducing protein yield, or reducing the quality of the expressed product (e.g., due to the presence of protein fragments or precipitation of the expressed protein in inclusion bodies), or causing toxicity.


Accordingly, in some embodiments of the present disclosure, the sequence optimization of a nucleic acid sequence disclosed herein, e.g., a nucleic acid sequence encoding a Factor VIII polypeptide, can be used to increase the viability of target cells expressing the protein encoded by the sequence optimized nucleic acid.


Heterologous protein expression can also be deleterious to cells transfected with a nucleic acid sequence for autologous or heterologous transplantation. Accordingly, in some embodiments of the present disclosure the sequence optimization of a nucleic acid sequence disclosed herein can be used to increase the viability of target cells expressing the protein encoded by the sequence optimized nucleic acid sequence. Changes in cell or tissue viability, toxicity, and other physiological reaction can be measured according to methods known in the art.


d. Reduction of Immune and/or Inflammatory Response


In some cases, the administration of a sequence optimized nucleic acid encoding Factor VIII polypeptide or a functional fragment thereof can trigger an immune response, which could be caused by (i) the therapeutic agent (e.g., an mRNA encoding a Factor VIII polypeptide), or (ii) the expression product of such therapeutic agent (e.g., the Factor VIII polypeptide encoded by the mRNA), or (iv) a combination thereof. Accordingly, in some embodiments of the present disclosure the sequence optimization of nucleic acid sequence (e.g., an mRNA) disclosed herein can be used to decrease an immune or inflammatory response (other than coagulation pathway activation) triggered by the administration of a nucleic acid encoding a Factor VIII polypeptide or by the expression product of Factor VIII encoded by such nucleic acid.


In some aspects, an inflammatory response can be measured by detecting increased levels of one or more inflammatory cytokines using methods known in the art, e.g., ELISA. The term “inflammatory cytokine” refers to cytokines that are elevated in an inflammatory response. Examples of inflammatory cytokines include interleukin-6 (IL-6), CXCL1 (chemokine (C—X—C motif) ligand 1; also known as GROα, interferon-γ (IFNγ), tumor necrosis factor α (TNFα), interferon γ-induced protein 10 (IP-10), or granulocyte-colony stimulating factor (G-CSF). The term inflammatory cytokines includes also other cytokines associated with inflammatory responses known in the art, e.g., interleukin-1 (IL-1), interleukin-8 (IL-8), interleukin-12 (IL-12), interleukin-13 (I1-13), interferon α (IFN-α), etc.


Modified Nucleotide Sequences Encoding Factor VIII Polypeptides


In some embodiments, the polynucleotide (e.g., a RNA, e.g., an mRNA) of the present disclosure comprises a chemically modified nucleobase, for example, a chemically modified uracil, e.g., pseudouracil, 1-methylpseuodouracil, 5-methoxyuracil, or the like. In some embodiments, the mRNA is a uracil-modified sequence comprising an ORF encoding a Factor VIII polypeptide, wherein the mRNA comprises a chemically modified nucleobase, for example, a chemically modified uracil, e.g., pseudouracil, 1-methylpseuodouracil, or 5-methoxyuracil.


In certain aspects of the present disclosure, when the modified uracil base (e.g., 5-methoxyuracil or N1-methylpseudouracil) is connected to a ribose sugar, as it is in polynucleotides, the resulting modified nucleoside or nucleotide is refered to as modified uridine (e.g., 5-methoxyuracil or N1-methylpseudouracil). In some embodiments, uracil in the polynucleotide is at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least 90%, at least 95%, at least 99%, or about 100% modified uracil. In one embodiment, uracil in the polynucleotide is at least 95% modified uracil. In another embodiment, uracil in the polynucleotide is 100% modified uracil.


In embodiments where uracil in the polynucleotide is at least 95% 5 modified uracil (e.g., 5-methoxyuracil or N1-methylpseudouracil), overall uracil content can be adjusted such that an mRNA provides suitable protein expression levels while inducing little to no immune response. In some embodiments, the uracil content of the ORF is between 100% and 141%, between 108% and 142%, between 107% and 143%, between 106% and 144%, between 105% and 145%, between 104% and 146%, between 103% and 147%, between 102% and 148%, between 101% and 149%, or between 100% and 150% of the theoretical minimum uracil content in the corresponding wild-type ORF (% Utm). In other embodiments, the uracil content of the ORF is between about 110% and about 150% or between 104% and 148% of the %UTM. In some embodiments, the uracil content of the ORF encoding a Factor VIII polypeptide is about 115%, about 120%, about 125%, about 130%, about 135%, about 140%, about 145%, or about 150% of the %Utm. In this context, the term “uracil” can refer to modified uracil and/or naturally occurring uracil.


In some embodiments, the uracil content in the ORF of the mRNA encoding a Factor VIII polypeptide of the present disclosure is less than about 30%, about 25%, about 20%, about 15% or about 10% of the total nucleobase content in the ORF. In some embodiments, the uracil content in the ORF is between about 15% and about 25% of the total nucleobase content in the ORF. In other embodiments, the uracil content in the ORF is between about 20% and about 30% of the total nuclebase content in the ORF. In one embodiment, the uracil content in the ORF of the mRNA encoding a Factor VIII polypeptide is less than about 25% or less than about 20% of the total nucleobase content in the open reading frame. In this context, the term “uracil” can refer to modified uracil (e.g., 5-methoxyuracil or N1-methylpseudouracil) and/or naturally occurring uracil.


In further embodiments, the ORF of the mRNA encoding a Factor VIII polypeptide having modified uracil (e.g., 5-methoxyuracil or N1-methylpseudouracil) and adjusted uracil content has increased Cytosine (C), Guanine (G), or Guanine/Cytosine (G/C) content (absolute or relative). In some embodiments, the overall increase in C, G, or G/C content (absolute or relative) of the ORF is at least about 2%, at least about 3%, at least about 4%, at least about 5%, at least about 6%, at least about 7%, at least about 10%, at least about 15%, at least about 20%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, or at least about 100% relative to the G/C content (absolute or relative) of the wild-type ORF. In some embodiments, the G, the C, or the G/C content in the ORF is less than about 100%, less than about 90%, less than about 85%, or less than about 80% of the theoretical maximum G, C, or G/C content of the corresponding wild type nucleotide sequence encoding the Factor VIII polypeptide (% GTMX; % CTMX; or % G/CTMX). In some embodiments, the increases in G and/or C content (absolute or relative) described herein can be conducted by replacing synonymous codons with low G, C, or G/C content with synonymous codons having higher G, C, or G/C content. In other embodiments, the increase in G and/or C content (absolute or relative) is conducted by replacing a codon ending with U with a synonymous codon ending with G or C.


In further embodiments, the ORF of the mRNA encoding a Factor VIII polypeptide of the present disclosure comprises modified uracil (e.g., 5-methoxyuracil or N1-methylpseudouracil) and has an adjusted uracil content containing less uracil pairs (UU) and/or uracil triplets (UUU) and/or uracil quadruplets (UUUU) than the corresponding wild-type nucleotide sequence encoding the Factor VIII polypeptide. In some embodiments, the ORF of the mRNA encoding a Factor VIII polypeptide of the present disclosure contains no uracil pairs and/or uracil triplets and/or uracil quadruplets. In some embodiments, uracil pairs and/or uracil triplets and/or uracil quadruplets are reduced below a certain threshold, e.g., no more than 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 occurrences in the ORF of the mRNA encoding the Factor VIII polypeptide. In a particular embodiment, the ORF of the mRNA encoding the Factor VIII polypeptide of the present disclosure contains less than 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 non-phenylalanine uracil pairs and/or triplets. In another embodiment, the the ORF of the mRNA encoding the Factor VIII polypeptide contains no non-phenylalanine uracil pairs and/or triplets.


In further embodiments, the ORF of the mRNA encoding a Factor VIII polypeptide of the present disclosure comprises modified uracil and has an adjusted uracil content containing less uracil-rich clusters than the corresponding wild-type nucleotide sequence encoding the Factor VIII polypeptide. In some embodiments, the ORF of the mRNA encoding the Factor VIII polypeptide of the present disclosure contains uracil-rich clusters that are shorter in length than corresponding uracil-rich clusters in the corresponding wild-type nucleotide sequence encoding the Factor VIII polypeptide.


In further embodiments, alternative lower frequency codons are employed. At least about 5%, at least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 99%, or 100% of the codons in the Factor VIII polypeptide-encoding ORF of the modified uracil-comprising mRNA are substituted with alternative codons, each alternative codon having a codon frequency lower than the codon frequency of the substituted codon in the synonymous codon set. The ORF also has adjusted uracil content, as described above. In some embodiments, at least one codon in the ORF of the mRNA encoding the Factor VIII polypeptide is substituted with an alternative codon having a codon frequency lower than the codon frequency of the substituted codon in the synonymous codon set.


In some embodiments, the adjusted uracil content, Factor VIII polypeptide-encoding ORF of the modified uracil-comprising mRNA exhibits expression levels of Factor VIII when administered to a mammalian cell that are higher than expression levels of Factor VIII from the corresponding wild-type mRNA In some embodiments, the mammalian cell is a mouse cell, a rat cell, or a rabbit cell. In other embodiments, the mammalian cell is a monkey cell or a human cell. In some embodiments, the human cell is a HeLa cell, a BJ fibroblast cell, or a peripheral blood mononuclear cell (PBMC). In some embodiments, Factor VIII is expressed a level higher than expression levels of Factor VIII from the corresponding wild-type mRNA when the mRNA is administered to a mammalian cell in vivo. In some embodiments, the mRNA is administered to mice, rabbits, rats, monkeys, or humans. In one embodiment, mice are null mice. In some embodiments, the mRNA is administered to mice in an amount of about 0.01 mg/kg, about 0.05 mg/kg, about 0.1 mg/kg, or 0.2 mg/kg or about 0.5 mg/kg. In some embodiments, the mRNA is administered intravenously or intramuscularly. In other embodiments, the Factor VIII polypeptide is expressed when the mRNA is administered to a mammalian cell in vitro. In some embodiments, the expression is increased by at least about 2-fold, at least about 5-fold, at least about 10-fold, at least about 50-fold, at least about 500-fold, at least about 1500-fold, or at least about 3000-fold. In other embodiments, the expression is increased by at least about 10%, about 20%, about 30%, about 40%, about 50%, 60%, about 70%, about 80%, about 90%, or about 100%.


In some embodiments, adjusted uracil content, Factor VIII polypeptide-encoding ORF of the 5-methoxyuracil-comprising mRNA exhibits increased stability. In some embodiments, the mRNA exhibits increased stability in a cell relative to the stability of a corresponding wild-type mRNA under the same conditions. In some embodiments, the mRNA exhibits increased stability including resistance to nucleases, thermal stability, and/or increased stabilization of secondary structure. In some embodiments, increased stability exhibited by the mRNA is measured by determining the half-life of the mRNA (e.g., in a plasma, cell, or tissue sample) and/or determining the area under the curve (AUC) of the protein expression by the mRNA over time (e.g., in vitro or in vivo). An mRNA is identified as having increased stability if the half-life and/or the AUC is greater than the half-life and/or the AUC of a corresponding wild-type mRNA under the same conditions.


In some embodiments, the mRNA of the present disclosure induces a detectably lower immune response (e.g., innate or acquired) relative to the immune response induced by a corresponding wild-type mRNA under the same conditions. In other embodiments, the mRNA of the present disclosure induces a detectably lower immune response (e.g., innate or acquired) relative to the immune response induced by an mRNA that encodes for a Factor VIII polypeptide but does not comprise modified uracil (e.g., 5-methoxyuracil or N1-methylpseudouracil) under the same conditions, or relative to the immune response induced by an mRNA that encodes for a Factor VIII polypeptide and that comprises modified uracil (e.g., 5-methoxyuracil or N1-methylpseudouracil) but that does not have adjusted uracil content under the same conditions. The innate immune response can be manifested by increased expression of pro-inflammatory cytokines, activation of intracellular PRRs (RIG-I, MDAS, etc), cell death, and/or termination or reduction in protein translation. In some embodiments, a reduction in the innate immune response can be measured by expression or activity level of Type 1 interferons (e.g., IFN-α, IFN-β, IFN-κ, IFN-δ, IFN-ϵ, IFN-τ, IFN-ω, and IFN-ζ) or the expression of interferon-regulated genes such as the toll-like receptors (e.g., TLR7 and TLR8), and/or by decreased cell death following one or more administrations of the mRNA of the present disclosure into a cell.


In some embodiments, the expression of Type-1 interferons by a mammalian cell in response to the mRNA of the present disclosure is reduced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 99%, 99.9%, or greater than 99.9% relative to a corresponding wild-type mRNA, to an mRNA that encodes a Factor VIII polypeptide but does not comprise 5-methoxyuracil, or to an mRNA that encodes a Factor VIII polypeptide and that comprises modified uracil (e.g., 5-methoxyuracil or N1-methylpseudouracil) but that does not have adjusted uracil content. In some embodiments, the interferon is IFN-β. In some embodiments, cell death frequency cased by administration of mRNA of the present disclosure to a mammalian cell is 10%, 25%, 50%, 75%, 85%, 90%, 95%, or over 95% less than the cell death frequency observed with a corresponding wild-type mRNA, an mRNA that encodes for a Factor VIII polypeptide but does not comprise 5-methoxyuracil, or an mRNA that encodes for a Factor VIII polypeptide and that comprises modified uracil (e.g., 5-methoxyuracil or N1-methylpseudouracil) but that does not have adjusted uracil content. In some embodiments, the mammalian cell is a BJ fibroblast cell. In other embodiments, the mammalian cell is a splenocyte. In some embodiments, the mammalian cell is that of a mouse or a rat. In other embodiments, the mammalian cell is that of a human. In one embodiment, the mRNA of the present disclosure does not substantially induce an innate immune response of a mammalian cell into which the mRNA is introduced.


Methods for Modifying Polynucleotides


The present disclosure includes modified polynucleotides comprising a polynucleotide described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide). The modified polynucleotides can be chemically modified and/or structurally modified. When the polynucleotides of the present disclosure are chemically and/or structurally modified the polynucleotides can be referred to as “modified polynucleotides.”


The present disclosure provides for modified nucleosides and nucleotides of a polynucleotide (e.g., RNA polynucleotides, such as mRNA polynucleotides) encoding a Factor VIII polypeptide. A “nucleoside” refers to a compound containing a sugar molecule (e.g., a pentose or ribose) or a derivative thereof in combination with an organic base (e.g., a purine or pyrimidine) or a derivative thereof (also referred to herein as “nucleobase”). A “nucleotide” refers to a nucleoside including a phosphate group. Modified nucleotides can by synthesized by any useful method, such as, for example, chemically, enzymatically, or recombinantly, to include one or more modified or non-natural nucleosides. Polynucleotides can comprise a region or regions of linked nucleosides. Such regions can have variable backbone linkages. The linkages can be standard phosphodiester linkages, in which case the polynucleotides would comprise regions of nucleotides.


The modified polynucleotides disclosed herein can comprise various distinct modifications. In some embodiments, the modified polynucleotides contain one, two, or more (optionally different) nucleoside or nucleotide modifications. In some embodiments, a modified polynucleotide, introduced to a cell can exhibit one or more desirable properties, e.g., improved protein expression, reduced immunogenicity, or reduced degradation in the cell, as compared to an unmodified polynucleotide.


In some embodiments, a polynucleotide of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) is structurally modified. As used herein, a “structural” modification is one in which two or more linked nucleosides are inserted, deleted, duplicated, inverted or randomized in a polynucleotide without significant chemical modification to the nucleotides themselves. Because chemical bonds will necessarily be broken and reformed to effect a structural modification, structural modifications are of a chemical nature and hence are chemical modifications. However, structural modifications will result in a different sequence of nucleotides. For example, the polynucleotide “ATCG” can be chemically modified to “AT-5meC-G”. The same polynucleotide can be structurally modified from “ATCG” to “ATCCCG”. Here, the dinucleotide “CC” has been inserted, resulting in a structural modification to the polynucleotide.


Therapeutic compositions of the present disclosure comprise, in some embodiments, at least one nucleic acid (e.g., RNA) having an open reading frame encoding at least one Factor VIII, wherein the nucleic acid comprises nucleotides and/or nucleosides that can be standard (unmodified) or modified as is known in the art. In some embodiments, nucleotides and nucleosides of the present disclosure comprise modified nucleotides or nucleosides. Such modified nucleotides and nucleosides can be naturally-occurring modified nucleotides and nucleosides or non-naturally occurring modified nucleotides and nucleosides. Such modifications can include those at the sugar, backbone, or nucleobase portion of the nucleotide and/or nucleoside as are recognized in the art.


In some embodiments, a naturally-occurring modified nucleotide or nucleotide of the disclosure is one as is generally known or recognized in the art. Non-limiting examples of such naturally occurring modified nucleotides and nucleotides can be found, inter alia, in the widely recognized MODOMICS database.


In some embodiments, a non-naturally occurring modified nucleotide or nucleoside of the disclosure is one as is generally known or recognized in the art. Non-limiting examples of such non-naturally occurring modified nucleotides and nucleosides can be found, inter alia, in published US application Nos. PCT/US2012/058519; PCT/US2013/075177; PCT/US2014/058897; PCT/US2014/058891; PCT/US2014/070413; PCT/US2015/36773; PCT/US2015/36759; PCT/US2015/36771; or PCT/IB2017/051367 all of which are incorporated by reference herein.


In some embodiments, at least one RNA (e.g., mRNA) of the present disclosure is not chemically modified and comprises the standard ribonucleotides consisting of adenosine, guanosine, cytosine and uridine. In some embodiments, nucleotides and nucleosides of the present disclosure comprise standard nucleoside residues such as those present in transcribed RNA (e.g. A, G, C, or U). In some embodiments, nucleotides and nucleosides of the present disclosure comprise standard deoxyribonucleosides such as those present in DNA (e.g. dA, dG, dC, or dT).


Hence, nucleic acids of the disclosure (e.g., DNA nucleic acids and RNA nucleic acids, such as mRNA nucleic acids) can comprise standard nucleotides and nucleosides, naturally-occurring nucleotides and nucleosides, non-naturally-occurring nucleotides and nucleosides, or any combination thereof.


Nucleic acids of the disclosure (e.g., DNA nucleic acids and RNA nucleic acids, such as mRNA nucleic acids), in some embodiments, comprise various (more than one) different types of standard and/or modified nucleotides and nucleosides. In some embodiments, a particular region of a nucleic acid contains one, two or more (optionally different) types of standard and/or modified nucleotides and nucleosides.


In some embodiments, a modified RNA nucleic acid (e.g., a modified mRNA nucleic acid), introduced to a cell or organism, exhibits reduced degradation in the cell or organism, respectively, relative to an unmodified nucleic acid comprising standard nucleotides and nucleosides.


In some embodiments, a modified RNA nucleic acid (e.g., a modified mRNA nucleic acid), introduced into a cell or organism, may exhibit reduced immunogenicity in the cell or organism, respectively (e.g., a reduced innate response) relative to an unmodified nucleic acid comprising standard nucleotides and nucleosides.


Nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids), in some embodiments, comprise non-natural modified nucleotides that are introduced during synthesis or post-synthesis of the nucleic acids to achieve desired functions or properties. The modifications may be present on internucleotide linkages, purine or pyrimidine bases, or sugars. The modification may be introduced with chemical synthesis or with a polymerase enzyme at the terminal of a chain or anywhere else in the chain. Any of the regions of a nucleic acid may be chemically modified.


The present disclosure provides for modified nucleosides and nucleotides of a nucleic acid (e.g., RNA nucleic acids, such as mRNA nucleic acids). A “nucleoside” refers to a compound containing a sugar molecule (e.g., a pentose or ribose) or a derivative thereof in combination with an organic base (e.g., a purine or pyrimidine) or a derivative thereof (also referred to herein as “nucleobase”). A “nucleotide” refers to a nucleoside, including a phosphate group. Modified nucleotides may by synthesized by any useful method, such as, for example, chemically, enzymatically, or recombinantly, to include one or more modified or non-natural nucleosides. Nucleic acids can comprise a region or regions of linked nucleosides. Such regions may have variable backbone linkages. The linkages can be standard phosphodiester linkages, in which case the nucleic acids would comprise regions of nucleotides.


Modified nucleotide base pairing encompasses not only the standard adenosine-thymine, adenosine-uracil, or guanosine-cytosine base pairs, but also base pairs formed between nucleotides and/or modified nucleotides comprising non-standard or modified bases, wherein the arrangement of hydrogen bond donors and hydrogen bond acceptors permits hydrogen bonding between a non-standard base and a standard base or between two complementary non-standard base structures, such as, for example, in those nucleic acids having at least one chemical modification. One example of such non-standard base pairing is the base pairing between the modified nucleotide inosine and adenine, cytosine or uracil. Any combination of base/sugar or linker may be incorporated into nucleic acids of the present disclosure.


In some embodiments, modified nucleobases in nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids) comprise 1-methyl-pseudouridine (m1ψ), 1-ethyl-pseudouridine (e1ψ), 5-methoxy-uridine (mo5U), 5-methyl-cytidine (m5C), and/or pseudouridine (ψ). In some embodiments, modified nucleobases in nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids) comprise 5-methoxymethyl uridine, 5-methylthio uridine, 1-methoxymethyl pseudouridine, 5-methyl cytidine, and/or 5-methoxy cytidine. In some embodiments, the polyribonucleotide includes a combination of at least two (e.g., 2, 3, 4 or more) of any of the aforementioned modified nucleobases, including but not limited to chemical modifications.


In some embodiments, a RNA nucleic acid of the disclosure comprises 1-methyl-pseudouridine (m1ψ) substitutions at one or more or all uridine positions of the nucleic acid.


In some embodiments, a RNA nucleic acid of the disclosure comprises 1-methyl-pseudouridine (m1ψ) substitutions at one or more or all uridine positions of the nucleic acid and 5-methyl cytidine substitutions at one or more or all cytidine positions of the nucleic acid.


In some embodiments, a RNA nucleic acid of the disclosure comprises pseudouridine (ψ) substitutions at one or more or all uridine positions of the nucleic acid.


In some embodiments, a RNA nucleic acid of the disclosure comprises pseudouridine (ψ) substitutions at one or more or all uridine positions of the nucleic acid and 5-methyl cytidine substitutions at one or more or all cytidine positions of the nucleic acid..


In some embodiments, a RNA nucleic acid of the disclosure comprises uridine at one or more or all uridine positions of the nucleic acid.


In some embodiments, nucleic acids (e.g., RNA nucleic acids, such as mRNA nucleic acids) are uniformly modified (e.g., fully modified, modified throughout the entire sequence) for a particular modification. For example, a nucleic acid can be uniformly modified with 1-methyl-pseudouridine, meaning that all uridine residues in the mRNA sequence are replaced with 1-methyl-pseudouridine. Similarly, a nucleic acid can be uniformly modified for any type of nucleoside residue present in the sequence by replacement with a modified residue such as those set forth above.


The nucleic acids of the present disclosure may be partially or fully modified along the entire length of the molecule. For example, one or more or all or a given type of nucleotide (e.g., purine or pyrimidine, or any one or more or all of A, G, U, C) may be uniformly modified in a nucleic acid of the disclosure, or in a predetermined sequence region thereof (e.g., in the mRNA including or excluding the polyA tail). In some embodiments, all nucleotides X in a nucleic acid of the present disclosure (or in a sequence region thereof) are modified nucleotides, wherein X may be any one of nucleotides A, G, U, C, or any one of the combinations A+G, A+U, A+C, G+U, G+C, U+C, A+G+U, A+G+C, G+U+C or A+G+C.


The nucleic acid may contain from about 1% to about 100% modified nucleotides (either in relation to overall nucleotide content, or in relation to one or more types of nucleotide, i.e., any one or more of A, G, U or C) or any intervening percentage (e.g., from 1% to 20%, from 1% to 25%, from 1% to 50%, from 1% to 60%, from 1% to 70%, from 1% to 80%, from 1% to 90%, from 1% to 95%, from 10% to 20%, from 10% to 25%, from 10% to 50%, from 10% to 60%, from 10% to 70%, from 10% to 80%, from 10% to 90%, from 10% to 95%, from 10% to 100%, from 20% to 25%, from 20% to 50%, from 20% to 60%, from 20% to 70%, from 20% to 80%, from 20% to 90%, from 20% to 95%, from 20% to 100%, from 50% to 60%, from 50% to 70%, from 50% to 80%, from 50% to 90%, from 50% to 95%, from 50% to 100%, from 70% to 80%, from 70% to 90%, from 70% to 95%, from 70% to 100%, from 80% to 90%, from 80% to 95%, from 80% to 100%, from 90% to 95%, from 90% to 100%, and from 95% to 100%). It will be understood that any remaining percentage is accounted for by the presence of unmodified A, G, U, or C.


The nucleic acids may contain at a minimum 1% and at maximum 100% modified nucleotides, or any intervening percentage, such as at least 5% modified nucleotides, at least 10% modified nucleotides, at least 25% modified nucleotides, at least 50% modified nucleotides, at least 80% modified nucleotides, or at least 90% modified nucleotides. For example, the nucleic acids may contain a modified pyrimidine such as a modified uracil or cytosine. In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the uracil in the nucleic acid is replaced with a modified uracil (e.g., a 5-substituted uracil). The modified uracil can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures). In some embodiments, at least 5%, at least 10%, at least 25%, at least 50%, at least 80%, at least 90% or 100% of the cytosine in the nucleic acid is replaced with a modified cytosine (e.g., a 5-substituted cytosine). The modified cytosine can be replaced by a compound having a single unique structure, or can be replaced by a plurality of compounds having different structures (e.g., 2, 3, 4 or more unique structures).


Untranslated Regions (UTRs)


Translation of a polynucleotide comprising an open reading frame encoding a polypeptide can be controlled and regulated by a variety of mechanisms that are provided by various cis-acting nucleic acid structures. For example, naturally-occurring, cis-acting RNA elements that form hairpins or other higher-order (e.g., pseudoknot) intramolecular mRNA secondary structures can provide a translational regulatory activity to a polynucleotide, wherein the RNA element influences or modulates the initiation of polynucleotide translation, particularly when the RNA element is positioned in the 5′ UTR close to the 5′-cap structure (Pelletier and Sonenberg (1985) Cell 40(3):515-526; Kozak (1986) Proc Natl Acad Sci 83:2850-2854).


Untranslated regions (UTRs) are nucleic acid sections of a polynucleotide before a start codon (5′ UTR) and after a stop codon (3′ UTR) that are not translated. In some embodiments, a polynucleotide (e.g., a ribonucleic acid (RNA), e.g., a messenger RNA (mRNA)) of the invention comprising an open reading frame (ORF) encoding a Factor VIII polypeptide further comprises UTR (e.g., a 5′UTR or functional fragment thereof, a 3′UTR or functional fragment thereof, or a combination thereof).


Cis-acting RNA elements can also affect translation elongation, being involved in numerous frameshifting events (Namy et al., (2004) Mol Cell 13(2):157-168). Internal ribosome entry sequences (IRES) represent another type of cis-acting RNA element that are typically located in 5′ UTRs, but have also been reported to be found within the coding region of naturally-occurring mRNAs (Holcik et al. (2000) Trends Genet 16(10):469-473). In cellular mRNAs, IRES often coexist with the 5′-cap structure and provide mRNAs with the functional capacity to be translated under conditions in which cap-dependent translation is compromised (Gebauer et al., (2012) Cold Spring Harb Perspect Biol 4(7):a012245). Another type of naturally-occurring cis-acting RNA element comprises upstream open reading frames (uORFs). Naturally-occurring uORFs occur singularly or multiply within the 5′ UTRs of numerous mRNAs and influence the translation of the downstream major ORF, usually negatively (with the notable exception of GCN4 mRNA in yeast and ATF4 mRNA in mammals, where uORFs serve to promote the translation of the downstream major ORF under conditions of increased eIF2 phosphorylation (Hinnebusch (2005) Annu Rev Microbiol 59:407-450)). Additional exemplary translational regulatory activities provided by components, structures, elements, motifs, and/or specific sequences comprising polynucleotides (e.g., mRNA) include, but are not limited to, mRNA stabilization or destabilization (Baker & Parker (2004) Curr Opin Cell Biol 16(3):293-299), translational activation (Villalba et al., (2011) Curr Opin Genet Dev 21(4):452-457), and translational repression (Blumer et al., (2002) Mech Dev 110(1-2):97-112). Studies have shown that naturally-occurring, cis-acting RNA elements can confer their respective functions when used to modify, by incorporation into, heterologous polynucleotides (Goldberg-Cohen et al., (2002) J Biol Chem 277(16):13635-13640).


A UTR can be homologous or heterologous to the coding region in a polynucleotide. In some embodiments, the UTR is homologous to the ORF encoding the Factor VIII polypeptide. In some embodiments, the UTR is heterologous to the ORF encoding the Factor VIII polypeptide. In some embodiments, the polynucleotide comprises two or more 5′UTRs or functional fragments thereof, each of which have the same or different nucleotide sequences. In some embodiments, the polynucleotide comprises two or more 3′UTRs or functional fragments thereof, each of which have the same or different nucleotide sequences.


In some embodiments, the 5′UTR or functional fragment thereof, 3′ UTR or functional fragment thereof, or any combination thereof is sequence optimized.


In some embodiments, the 5′UTR or functional fragment thereof, 3′ UTR or functional fragment thereof, or any combination thereof comprises at least one chemically modified nucleobase, e.g., 5-methoxyuracil.


UTRs can have features that provide a regulatory role, e.g., increased or decreased stability, localization and/or translation efficiency. A polynucleotide comprising a UTR can be administered to a cell, tissue, or organism, and one or more regulatory features can be measured using routine methods. In some embodiments, a functional fragment of a 5′UTR or 3′UTR comprises one or more regulatory features of a full length 5′ or 3′ UTR, respectively.


Natural 5′UTRs bear features that play roles in translation initiation. They harbor signatures like Kozak sequences that are commonly known to be involved in the process by which the ribosome initiates translation of many genes. Kozak sequences have the consensus CCR(A/G)CCAUGG, where R is a purine (adenine or guanine) three bases upstream of the start codon (AUG), which is followed by another ‘G’. 5′UTRs also have been known to form secondary structures that are involved in elongation factor binding.


By engineering the features typically found in abundantly expressed genes of specific target organs, one can enhance the stability and protein production of a polynucleotide. For example, introduction of 5′UTR of liver-expressed mRNA, such as albumin, serum amyloid A, Apolipoprotein A/B/E, transferrin, alpha fetoprotein, erythropoietin, or Factor VIII, can enhance expression of polynucleotides in hepatic cell lines or liver. Likewise, use of 5′UTR from other tissue-specific mRNA to improve expression in that tissue is possible for muscle (e.g., MyoD, Myosin, Myoglobin, Myogenin, Herculin), for endothelial cells (e.g., Tie-1, CD36), for myeloid cells (e.g., C/EBP, AML1, G-CSF, GM-CSF, CD11b, MSR, Fr-1, i-NOS), for leukocytes (e.g., CD45, CD18), for adipose tissue (e.g., CD36, GLUT4, ACRP30, adiponectin) and for lung epithelial cells (e.g., SP-A/B/C/D).


In some embodiments, UTRs are selected from a family of transcripts whose proteins share a common function, structure, feature or property. For example, an encoded polypeptide can belong to a family of proteins (i.e., that share at least one function, structure, feature, localization, origin, or expression pattern), which are expressed in a particular cell, tissue or at some time during development. The UTRs from any of the genes or mRNA can be swapped for any other UTR of the same or different family of proteins to create a new polynucleotide.


In some embodiments, the 5′UTR and the 3′UTR can be heterologous. In some embodiments, the 5′UTR can be derived from a different species than the 3′UTR. In some embodiments, the 3′UTR can be derived from a different species than the 5′UTR.


Co-owned International Patent Application No. PCT/US2014/021522 (Publ. No. WO/2014/164253, incorporated herein by reference in its entirety) provides a listing of exemplary UTRs that can be utilized in the polynucleotide of the present disclosure as flanking regions to an ORF.


Exemplary UTRs of the application include, but are not limited to, one or more 5′UTR and/or 3′UTR derived from the nucleic acid sequence of: a globin, such as an α- or β-globin (e.g., a Xenopus, mouse, rabbit, or human globin); a strong Kozak translational initiation signal; a CYBA (e.g., human cytochrome b-245 α polypeptide); an albumin (e.g., human albumin7); a HSD17B4 (hydroxysteroid (17-β) dehydrogenase); a virus (e.g., a tobacco etch virus (TEV), a Venezuelan equine encephalitis virus (VEEV), a Dengue virus, a cytomegalovirus (CMV) (e.g., CMV immediate early 1 (IE1)), a hepatitis virus (e.g., hepatitis B virus), a sindbis virus, or a PAV barley yellow dwarf virus); a heat shock protein (e.g., hsp70); a translation initiation factor (e.g., elF4G); a glucose transporter (e.g., hGLUT1 (human glucose transporter 1)); an actin (e.g., human α or β actin); a GAPDH; a tubulin; a histone; a citric acid cycle enzyme; a topoisomerase (e.g., a 5′UTR of a TOP gene lacking the 5′ TOP motif (the oligopyrimidine tract)); a ribosomal protein Large 32 (L32); a ribosomal protein (e.g., human or mouse ribosomal protein, such as, for example, rps9); an ATP synthase (e.g., ATP5A1 or the β subunit of mitochondrial H+-ATP synthase); a growth hormone e (e.g., bovine (bGH) or human (hGH)); an elongation factor (e.g., elongation factor 1 α1 (EEF1A1)); a manganese superoxide dismutase (MnSOD); a myocyte enhancer factor 2A (MEF2A); a β-F1-ATPase, a creatine kinase, a myoglobin, a granulocyte-colony stimulating factor (G-CSF); a collagen (e.g., collagen type I, alpha 2 (Col1A2), collagen type I, alpha 1 (Col1A1), collagen type VI, alpha 2 (Col6A2), collagen type VI, alpha 1 (Col6A1)); a ribophorin (e.g., ribophorin I (RPNI)); a low density lipoprotein receptor-related protein (e.g., LRP1); a cardiotrophin-like cytokine factor (e.g., Nnt1); calreticulin (Calr); a procollagen-lysine, 2-oxoglutarate 5-dioxygenase 1 (Plod1); and a nucleobindin (e.g., Nucb1).


In some embodiments, the 5′UTR is selected from the group consisting of a β-globin 5′UTR; a 5′UTR containing a strong Kozak translational initiation signal; a cytochrome b-245 α polypeptide (CYBA) 5′UTR; a hydroxysteroid (17-β) dehydrogenase (HSD17B4) 5′UTR; a Tobacco etch virus (TEV) 5′UTR; a Venezuelen equine encephalitis virus (TEEV) 5′UTR; a 5′ proximal open reading frame of rubella virus (RV) RNA encoding nonstructural proteins; a Dengue virus (DEN) 5′UTR; a heat shock protein 70 (Hsp70) 5′UTR; a eIF4G 5′UTR; a GLUT1 5′UTR; functional fragments thereof and any combination thereof.


In some embodiments, the 3′UTR is selected from the group consisting of a β-globin 3′UTR; a CYBA 3′UTR; an albumin 3′UTR; a growth hormone (GH) 3′UTR; a VEEV 3′UTR; a hepatitis B virus (HBV) 3′UTR; a-globin 3′UTR; a DEN 3′UTR; a PAV barley yellow dwarf virus (BYDV-PAV) 3′UTR; an elongation factor 1 α1 (EEF1A1) 3′UTR; a manganese superoxide dismutase (MnSOD) 3′UTR; a β subunit of mitochondrial H(+)-ATP synthase (β-mRNA) 3′UTR; a GLUT1 3′UTR; a MEF2A 3′UTR; a β-F1-ATPase 3′UTR; functional fragments thereof and combinations thereof.


Wild-type UTRs derived from any gene or mRNA can be incorporated into the polynucleotides of the present disclosure. In some embodiments, a UTR can be altered relative to a wild type or native UTR to produce a variant UTR, e.g., by changing the orientation or location of the UTR relative to the ORF; or by inclusion of additional nucleotides, deletion of nucleotides, swapping or transposition of nucleotides. In some embodiments, variants of 5′ or 3′ UTRs can be utilized, for example, mutants of wild type UTRs, or variants wherein one or more nucleotides are added to or removed from a terminus of the UTR.


Additionally, one or more synthetic UTRs can be used in combination with one or more non-synthetic UTRs. See, e.g., Mandal and Rossi, Nat. Protoc. 2013 8(3):568-82.


UTRs or portions thereof can be placed in the same orientation as in the transcript from which they were selected or can be altered in orientation or location. Hence, a 5′ and/or 3′ UTR can be inverted, shortened, lengthened, or combined with one or more other 5′ UTRs or 3′ UTRs.


In some embodiments, the polynucleotide comprises multiple UTRs, e.g., a double, a triple or a quadruple 5′UTR or 3′UTR. For example, a double UTR comprises two copies of the same UTR either in series or substantially in series. For example, a double beta-globin 3′UTR can be used (see US2010/0129877, the contents of which are incorporated herein by reference in its entirety).


In certain embodiments, the polynucleotides of the present disclosure comprise a 5′UTR and/or a 3′UTR selected from any of the UTRs disclosed herein. In some embodiments, the 5′UTR comprises:














SEQ


Name
ID NO







5′UTR-001 (Upstream UTR)
36


GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACC






5′UTR-002 (Upstream UTR)
37


GGGAGAUCAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACC






5′UTR-003 (Upstream UTR)
38





5′UTR-004 (Upstream UTR)
39


GGGAGACAAGCUUGGCAUUCCGGUACUGUUGGUAAAGCCACC






5′UTR-005 (Upstream UTR)
40


GGGAGAUCAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACC






5′UTR-006 (Upstream UTR)
41





5′UTR-007 (Upstream UTR)
42


GGGAGACAAGCUUGGCAUUCCGGUACUGUUGGUAAAGCCACC






5′UTR-008 (Upstream UTR)
43


GGGAAUUAACAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACC






5′UTR-009 (Upstream UTR)
44


GGGAAAUUAGACAGAAAAGAAGAGUAAGAAGAAAUAUAAGAGCCACC






5′UTR-010 (Upstream UTR)
45


GGGAAAUAAGAGAGUAAAGAACAGUAAGAAGAAAUAUAAGAGCCACC






5′UTR-011 (Upstream UTR)
46


GGGAAAAAAGAGAGAAAAGAAGACUAAGAAGAAAUAUAAGAGCCACC






5′UTR-012 (Upstream UTR)
47


GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAUAUAUAAGAGCCACC






5′UTR-013 (Upstream UTR)
48


GGGAAAUAAGAGACAAAACAAGAGUAAGAAGAAAUAUAAGAGCCACC






5′UTR-014 (Upstream UTR)
49


GGGAAAUUAGAGAGUAAAGAACAGUAAGUAGAAUUAAAAGAGCCACC






5′UTR-015 (Upstream UTR)
50


GGGAAAUAAGAGAGAAUAGAAGAGUAAGAAGAAAUAUAAGAGCCACC






5′UTR-016 (Upstream UTR)
51


GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAAUUAAGAGCCACC






5′UTR-017 (Upstream UTR)
52


GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUUUAAGAGCCACC






5′UTR-018 (Upstream UTR)
53


UCAAGCUUUUGGACCCUCGUACAGAAGCUAAUACGACUCACUAUAGGGAAAUAAGAGAGAAAA



GAAGAGUAAGAAGAAAUAUAAGAGCCACC






142-3p 5′UTR-001 (Upstream UTR including miR142-3p binding site)
54





142-3p 5′UTR-002 (Upstream UTR including miR142-3p binding site)
55





142-3p 5′UTR-003 (Upstream UTR including miR142-3p binding site)
56





142-3p 5′UTR-004 (Upstream UTR including miR142-3p binding site)
57





142-3p 5′UTR-005 (Upstream UTR including miR142-3p binding site)
58





142-3p 5′UTR-006 (Upstream UTR including miR142-3p binding site)
59





142-3p 5′UTR-007 (Upstream UTR including miR142-3p binding site)
60





GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGCCGCCACC
61





GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAAGACCCCGGCGCCGCCACC
70









In some embodiments, the 3′ UTR comprises:









142-3p 3′ UTR


(UTR including miR142-3p binding site)


(SEQ ID NO: 112)


(UGAUAAUAGUCCAUAAAGUAGGAAACACUACAGCUGGAGCCUCGGUGGC





CAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGC





ACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC);





142-3p 3′ UTR


(UTR including miR142-3p binding site)


(SEQ ID NO: 113)


(UGAUAAUAGGCUGGAGCCUCGGUGGCUCCAUAAAGUAGGAAACACUACA





CAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGC





ACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC);


or





142-3p 3′ UTR


(UTR including miR142-3p binding site)


(SEQ ID NO: 114)


(UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUCCAUAA





AGUAGGAAACACUACAUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGC





ACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC);





142-3p 3′ UTR


(UTR including miR142-3p binding site)


(SEQ ID NO: 115)


(UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCU





CCCCCCAGUCCAUAAAGUAGGAAACACUACACCCCUCCUCCCCUUCCUGC





ACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC);





142-3p 3′ UTR


(UTR including miR142-3p binding site)


(SEQ ID NO: 116)


(UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCU





CCCCCCAGCCCCUCCUCCCCUUCUCCAUAAAGUAGGAAACACUACACUGC





ACCCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC);





142-3p 3′ UTR


(UTR including miR142-3p binding site)


(SEQ ID NO: 117)


(UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCU





CCCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCUCCAUAAAGUA





GGAAACACUACAGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC).





142-3p 3′ UTR


(UTR including miR142-3p binding site)


(SEQ ID NO: 118)


(UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCCCCUUGGGCCU





CCCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCGUGGUCUUUGA





AUAAAGUUCCAUAAAGUAGGAAACACUACACUGAGUGGGCGGC);





3′ UTR


(miR142 and miR126 binding sites variant 1)


(SEQ ID NO: 119)


(UGAUAAUAGUCCAUAAAGUAGGAAACACUACAGCUGGAGCCUCGGUGGC





CAUGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGC





ACCCGUACCCCCCGCAUUAUUACUCACGGUACGAGUGGUCUUUGAAUAAA





GUCUGAGUGGGCGGC)





3′ UTR


(miR142 and miR126 binding sites variant 2)


(SEQ ID NO: 120)


(UGAUAAUAGUCCAUAAAGUAGGAAACACUACAGCUGGAGCCUCGGUGGC





CUAGCUUCUUGCCCCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGC





ACCCGUACCCCCCGCAUUAUUACUCACGGUACGAGUGGUCUUUGAAUAAA





GUCUGAGUGGGCGGC);


or





3′UTR


(miR142-3p binding site variant 3)


(SEQ ID NO: 121)


UGAUAAUAGGCUGGAGCCUCGGUGGCCUAGCUUCUUGCCCCUUGGGCCUC





CCCCCAGCCCCUCCUCCCCUUCCUGCACCCGUACCCCCUCCAUAAAGUAG





GAAACACUACAGUGGUCUUUGAAUAAAGUCUGAGUGGGCGGC.





3′UTR


(miR142-3p binding site variant 3, DNA sequence)


(SEQ ID NO: 122)


TGATAATAGGCTGGAGCCTCGGTGGCCTAGCTTCTTGCCCCTTGGGCCTC





CCCCCAGCCCCTCCTCCCCTTCCTGCACCCGTACCCCCTCCATAAAGTAG





GAAACACTACAGTGGTCTTTGAATAAAGTCTGAGTGGGCGGC.






In certain embodiments, the 5′UTR and/or 3′UTR sequence of the present disclosure comprises a nucleotide sequence at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to a sequence selected from the group consisting of 5′UTR sequences comprising any of SEQ ID NOs: 36-60 and/or 3′UTR sequences comprises any of SEQ ID NOs: 112-122 and 146, and any combination thereof.


The polynucleotides of the present disclosure can comprise combinations of features. For example, the ORF can be flanked by a 5′UTR that comprises a strong Kozak translational initiation signal and/or a 3′UTR comprising an oligo(dT) sequence for templated addition of a poly-A tail. A 5′UTR can comprise a first polynucleotide fragment and a second polynucleotide fragment from the same and/or different UTRs (see, e.g., US2010/0293625, herein incorporated by reference in its entirety).


Other non-UTR sequences can be used as regions or subregions within the polynucleotides of the present disclosure. For example, introns or portions of intron sequences can be incorporated into the polynucleotides of the present disclosure. Incorporation of intronic sequences can increase protein production as well as polynucleotide expression levels. In some embodiments, the polynucleotide of the present disclosure comprises an internal ribosome entry site (IRES) instead of or in addition to a UTR (see, e.g., Yakubov et al., Biochem. Biophys. Res. Commun. 2010 394(1):189-193, the contents of which are incorporated herein by reference in their entirety). In some embodiments, the polynucleotide comprises an IRES instead of a 5′UTR sequence. In some embodiments, the polynucleotide comprises an ORF and a viral capsid sequence. In some embodiments, the polynucleotide comprises a synthetic 5′UTR in combination with a non-synthetic 3′UTR.


In some embodiments, the UTR can also include at least one translation enhancer polynucleotide, translation enhancer element, or translational enhancer elements (collectively, “TEE,” which refers to nucleic acid sequences that increase the amount of polypeptide or protein produced from a polynucleotide. As a non-limiting example, the TEE can be located between the transcription promoter and the start codon. In some embodiments, the 5′UTR comprises a TEE.


In some embodiments, a 5′UTR and/or 3′UTR comprising at least one TEE described herein can be incorporated in a monocistronic sequence such as, but not limited to, a vector system or a nucleic acid vector.


In some embodiments, a 5′UTR and/or 3′UTR of a polynucleotide of the present disclosure comprises a TEE or portion thereof described herein. In some embodiments, the TEEs in the 3′UTR can be the same and/or different from the TEE located in the 5′UTR.


In some embodiments, a 5′UTR and/or 3′UTR of a polynucleotide of the present disclosure can include at least 1, at least 2, at least 3, at least 4, at least 5, at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15, at least 16, at least 17, at least 18 at least 19, at least 20, at least 21, at least 22, at least 23, at least 24, at least 25, at least 30, at least 35, at least 40, at least 45, at least 50, at least 55 or more than 60 TEE sequences. In one embodiment, the 5′UTR of a polynucleotide of the present disclosure can include 1-60, 1-55, 1-50, 1-45, 1-40, 1-35, 1-30, 1-25, 1-20, 1-15, 1-10, 9, 8, 7, 6, 5, 4, 3, 2, or 1 TEE sequences. The TEE sequences in the 5′UTR of the polynucleotide of the present disclosure can be the same or different TEE sequences. A combination of different TEE sequences in the 5′UTR of the polynucleotide of the present disclosure can include combinations in which more than one copy of any of the different TEE sequences are incorporated.


In some embodiments, the 5′UTR and/or 3′UTR comprises a spacer to separate two TEE sequences. As a non-limiting example, the spacer can be a 15 nucleotide spacer and/or other spacers known in the art. As another non-limiting example, the 5′UTR and/or 3′UTR comprises a TEE sequence-spacer module repeated at least once, at least twice, at least 3 times, at least 4 times, at least 5 times, at least 6 times, at least 7 times, at least 8 times, at least 9 times, at least 10 times, or more than 10 times in the 5′UTR and/or 3′UTR, respectively. In some embodiments, the 5′UTR and/or 3′UTR comprises a TEE sequence-spacer module repeated 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 times.


In some embodiments, the spacer separating two TEE sequences can include other sequences known in the art that can regulate the translation of the polynucleotide of the present disclosure, e.g., miR binding site sequences described herein (e.g., miR binding sites and miR seeds). As a non-limiting example, each spacer used to separate two TEE sequences can include a different miR binding site sequence or component of a miR sequence (e.g., miR seed sequence).


The present disclosure provides synthetic polynucleotides comprising a modification (e.g., an RNA element), wherein the modification provides a desired translational regulatory activity. In some embodiments, the disclosure provides a polynucleotide comprising a 5′ untranslated region (UTR), an initiation codon, a full open reading frame encoding a polypeptide, a 3′ UTR, and at least one modification, wherein the at least one modification provides a desired translational regulatory activity, for example, a modification that promotes and/or enhances the translational fidelity of mRNA translation. In some embodiments, the desired translational regulatory activity is a cis-acting regulatory activity. In some embodiments, the desired translational regulatory activity is an increase in the residence time of the 43S pre-initiation complex (PIC) or ribosome at, or proximal to, the initiation codon. In some embodiments, the desired translational regulatory activity is an increase in the initiation of polypeptide synthesis at or from the initiation codon. In some embodiments, the desired translational regulatory activity is an increase in the amount of polypeptide translated from the full open reading frame. In some embodiments, the desired translational regulatory activity is an increase in the fidelity of initiation codon decoding by the PIC or ribosome. In some embodiments, the desired translational regulatory activity is inhibition or reduction of leaky scanning by the PIC or ribosome. In some embodiments, the desired translational regulatory activity is a decrease in the rate of decoding the initiation codon by the PIC or ribosome. In some embodiments, the desired translational regulatory activity is inhibition or reduction in the initiation of polypeptide synthesis at any codon within the mRNA other than the initiation codon. In some embodiments, the desired translational regulatory activity is inhibition or reduction of the amount of polypeptide translated from any open reading frame within the mRNA other than the full open reading frame. In some embodiments, the desired translational regulatory activity is inhibition or reduction in the production of aberrant translation products. In some embodiments, the desired translational regulatory activity is a combination of one or more of the foregoing translational regulatory activities.


Accordingly, the present disclosure provides a polynucleotide, e.g., an mRNA, comprising an RNA element that comprises a sequence and/or an RNA secondary structure(s) that provides a desired translational regulatory activity as described herein. In some aspects, the mRNA comprises an RNA element that comprises a sequence and/or an RNA secondary structure(s) that promotes and/or enhances the translational fidelity of mRNA translation. In some aspects, the mRNA comprises an RNA element that comprises a sequence and/or an RNA secondary structure(s) that provides a desired translational regulatory activity, such as inhibiting and/or reducing leaky scanning. In some aspects, the disclosure provides an mRNA that comprises an RNA element that comprises a sequence and/or an RNA secondary structure(s) that inhibits and/or reduces leaky scanning thereby promoting the translational fidelity of the mRNA.


In some embodiments, the RNA element comprises natural and/or modified nucleotides. In some embodiments, the RNA element comprises of a sequence of linked nucleotides, or derivatives or analogs thereof, that provides a desired translational regulatory activity as described herein. In some embodiments, the RNA element comprises a sequence of linked nucleotides, or derivatives or analogs thereof, that forms or folds into a stable RNA secondary structure, wherein the RNA secondary structure provides a desired translational regulatory activity as described herein. RNA elements can be identified and/or characterized based on the primary sequence of the element (e.g., GC-rich element), by RNA secondary structure formed by the element (e.g. stem-loop), by the location of the element within the RNA molecule (e.g., located within the 5′ UTR of an mRNA), by the biological function and/or activity of the element (e.g., “translational enhancer element”), and any combination thereof.


In some aspects, the disclosure provides an mRNA having one or more structural modifications that inhibits leaky scanning and/or promotes the translational fidelity of mRNA translation, wherein at least one of the structural modifications is a GC-rich RNA element. In some aspects, the disclosure provides a modified mRNA comprising at least one modification, wherein at least one modification is a GC-rich RNA element comprising a sequence of linked nucleotides, or derivatives or analogs thereof, preceding a Kozak consensus sequence in a 5′ UTR of the mRNA. In one embodiment, the GC-rich RNA element is located about 30, about 25, about 20, about 15, about 10, about 5, about 4, about 3, about 2, or about 1 nucleotide(s) upstream of a Kozak consensus sequence in the 5′ UTR of the mRNA. In another embodiment, the GC-rich RNA element is located 15-30, 15-20, 15-25, 10-15, or 5-10 nucleotides upstream of a Kozak consensus sequence. In another embodiment, the GC-rich RNA element is located immediately adjacent to a Kozak consensus sequence in the 5′ UTR of the mRNA.


In any of the foregoing or related aspects, the disclosure provides a GC-rich RNA element which comprises a sequence of 3-30, 5-25, 10-20, 15-20, about 20, about 15, about 12, about 10, about 7, about 6 or about 3 nucleotides, derivatives or analogs thereof, linked in any order, wherein the sequence composition is 70-80% cytosine, 60-70% cytosine, 50%-60% cytosine, 40-50% cytosine, 30-40% cytosine bases. In any of the foregoing or related aspects, the disclosure provides a GC-rich RNA element which comprises a sequence of 3-30, 5-25, 10-20, 15-20, about 20, about 15, about 12, about 10, about 7, about 6 or about 3 nucleotides, derivatives or analogs thereof, linked in any order, wherein the sequence composition is about 80% cytosine, about 70% cytosine, about 60% cytosine, about 50% cytosine, about 40% cytosine, or about 30% cytosine.


In any of the foregoing or related aspects, the disclosure provides a GC-rich RNA element which comprises a sequence of 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, or 3 nucleotides, or derivatives or analogs thereof, linked in any order, wherein the sequence composition is 70-80% cytosine, 60-70% cytosine, 50%-60% cytosine, 40-50% cytosine, or 30-40% cytosine. In any of the foregoing or related aspects, the disclosure provides a GC-rich RNA element which comprises a sequence of 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, or 3 nucleotides, or derivatives or analogs thereof, linked in any order, wherein the sequence composition is about 80% cytosine, about 70% cytosine, about 60% cytosine, about 50% cytosine, about 40% cytosine, or about 30% cytosine.


In some embodiments, the disclosure provides a modified mRNA comprising at least one modification, wherein at least one modification is a GC-rich RNA element comprising a sequence of linked nucleotides, or derivatives or analogs thereof, preceding a Kozak consensus sequence in a 5′ UTR of the mRNA, wherein the GC-rich RNA element is located about 30, about 25, about 20, about 15, about 10, about 5, about 4, about 3, about 2, or about 1 nucleotide(s) upstream of a Kozak consensus sequence in the 5′ UTR of the mRNA, and wherein the GC-rich RNA element comprises a sequence of 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 nucleotides, or derivatives or analogs thereof, linked in any order, wherein the sequence composition is >50% cytosine. In some embodiments, the sequence composition is >55% cytosine, >60% cytosine, >65% cytosine, >70% cytosine, >75% cytosine, >80% cytosine, >85% cytosine, or >90% cytosine.


In other aspects, the disclosure provides a modified mRNA comprising at least one modification, wherein at least one modification is a GC-rich RNA element comprising a sequence of linked nucleotides, or derivatives or analogs thereof, preceding a Kozak consensus sequence in a 5′ UTR of the mRNA, wherein the GC-rich RNA element is located about 30, about 25, about 20, about 15, about 10, about 5, about 4, about 3, about 2, or about 1 nucleotide(s) upstream of a Kozak consensus sequence in the 5′ UTR of the mRNA, and wherein the GC-rich RNA element comprises a sequence of about 3-30, 5-25, 10-20, 15-20 or about 20, about 15, about 12, about 10, about 6 or about 3 nucleotides, or derivatives or analogues thereof, wherein the sequence comprises a repeating GC-motif, wherein the repeating GC-motif is [CCG]n, wherein n=1 to 10, n=2 to 8, n=3 to 6, or n=4 to 5. In some embodiments, the sequence comprises a repeating GC-motif [CCG]n, wherein n=1, 2, 3, 4 or 5. In some embodiments, the sequence comprises a repeating GC-motif [CCG]n, wherein n=1, 2, or 3. In some embodiments, the sequence comprises a repeating GC-motif [CCG]n, wherein n=1. In some embodiments, the sequence comprises a repeating GC-motif [CCG]n, wherein n=2. In some embodiments, the sequence comprises a repeating GC-motif [CCG]n, wherein n=3. In some embodiments, the sequence comprises a repeating GC-motif [CCG]n, wherein n=4. In some embodiments, the sequence comprises a repeating GC-motif [CCG]n, wherein n=5.


In another aspect, the disclosure provides a modified mRNA comprising at least one modification, wherein at least one modification is a GC-rich RNA element comprising a sequence of linked nucleotides, or derivatives or analogs thereof, preceding a Kozak consensus sequence in a 5′ UTR of the mRNA, wherein the GC-rich RNA element comprises any one of the sequences set forth in Table 3. In one embodiment, the GC-rich RNA element is located about 30, about 25, about 20, about 15, about 10, about 5, about 4, about 3, about 2, or about 1 nucleotide(s) upstream of a Kozak consensus sequence in the 5′ UTR of the mRNA. In another embodiment, the GC-rich RNA element is located about 15-30, 15-20, 15-25, 10-15, or 5-10 nucleotides upstream of a Kozak consensus sequence. In another embodiment, the GC-rich RNA element is located immediately adjacent to a Kozak consensus sequence in the 5′ UTR of the mRNA.


In other aspects, the disclosure provides a modified mRNA comprising at least one modification, wherein at least one modification is a GC-rich RNA element comprising the sequence V1 [CCCCGGCGCC] as set forth in Table 3, or derivatives or analogs thereof, preceding a Kozak consensus sequence in the 5′ UTR of the mRNA. In some embodiments, the GC-rich element comprises the sequence V1 as set forth in Table 3 located immediately adjacent to and upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA. In some embodiments, the GC-rich element comprises the sequence V1 as set forth in Table 3 located 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 bases upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA. In other embodiments, the GC-rich element comprises the sequence V1 as set forth in Table 3 located 1-3, 3-5, 5-7, 7-9, 9-12, or 12-15 bases upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA.


In other aspects, the disclosure provides a modified mRNA comprising at least one modification, wherein at least one modification is a GC-rich RNA element comprising the sequence V2 [CCCCGGC] as set forth in Table 3, or derivatives or analogs thereof, preceding a Kozak consensus sequence in the 5′ UTR of the mRNA. In some embodiments, the GC-rich element comprises the sequence V2 as set forth in Table 3 located immediately adjacent to and upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA. In some embodiments, the GC-rich element comprises the sequence V2 as set forth in Table 3 located 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 bases upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA. In other embodiments, the GC-rich element comprises the sequence V2 as set forth in Table 3 located 1-3, 3-5, 5-7, 7-9, 9-12, or 12-15 bases upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA.


In other aspects, the disclosure provides a modified mRNA comprising at least one modification, wherein at least one modification is a GC-rich RNA element comprising the sequence EK [GCCGCC] as set forth in Table 3, or derivatives or analogs thereof, preceding a Kozak consensus sequence in the 5′ UTR of the mRNA. In some embodiments, the GC-rich element comprises the sequence EK as set forth in Table 3 located immediately adjacent to and upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA. In some embodiments, the GC-rich element comprises the sequence EK as set forth in Table 3 located 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 bases upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA. In other embodiments, the GC-rich element comprises the sequence EK as set forth in Table 3 located 1-3, 3-5, 5-7, 7-9, 9-12, or 12-15 bases upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA.


In yet other aspects, the disclosure provides a modified mRNA comprising at least one modification, wherein at least one modification is a GC-rich RNA element comprising the sequence V1 [CCCCGGCGCC] as set forth in Table 3, or derivatives or analogs thereof, preceding a Kozak consensus sequence in the 5′ UTR of the mRNA, wherein the 5′ UTR comprises the following sequence shown in Table 3:











GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGA.






In some embodiments, the GC-rich element comprises the sequence V1 as set forth in Table 3 located immediately adjacent to and upstream of the Kozak consensus sequence in the 5′ UTR sequence shown in Table 3. In some embodiments, the GC-rich element comprises the sequence V1 as set forth in Table 3 located 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 bases upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA, wherein the 5′ UTR comprises the following sequence shown in Table 3:











GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGA.






In other embodiments, the GC-rich element comprises the sequence V1 as set forth in Table 3 located 1-3, 3-5, 5-7, 7-9, 9-12, or 12-15 bases upstream of the Kozak consensus sequence in the 5′ UTR of the mRNA, wherein the 5′ UTR comprises the following sequence shown in Table 3:











GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGA.






In some embodiments, the 5′ UTR comprises the following sequence set forth in Table 3:









(SEQ ID NO: 61)


GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCCCGGCGC





CGCCACC














TABLE 3







5′ UTRs
5′UTR Sequence





Standard
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGAGCC



ACC(SEQ ID NO: 61)


UTR-1
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCC



CGGCGCCGCCACC(SEQ ID NO: 62)


UTR-2
GGGAAATAAGAGAGAAAAGAAGAGTAAGAAGAAATATAAGACCC



CGGCGCCACC(SEQ ID NO: 63)





GC-Rich RNA Elements
Sequence





K0 (Traditional Kozak
[GCCA/GCC] (SEQ ID NO: 69)


consensus)



EK
[GCCGCC] (SEQ ID NO: 64)


UTR section 1
[CCCCGGCGCC] (SEQ ID NO: 65)


UTR section 2
[CCCCGGC] (SEQ ID NO: 66)


(CCG)n, where n = 1-10
[CCG]n (SEQ ID NO: 67)


(GCC)n, where n = 1-10
[GCC]n (SEQ ID NO: 68)









In another aspect, the disclosure provides a modified mRNA comprising at least one modification, wherein at least one modification is a GC-rich RNA element comprising a stable RNA secondary structure comprising a sequence of nucleotides, or derivatives or analogs thereof, linked in an order which forms a hairpin or a stem-loop. In one embodiment, the stable RNA secondary structure is upstream of the Kozak consensus sequence. In another embodiment, the stable RNA secondary structure is located about 30, about 25, about 20, about 15, about 10, or about 5 nucleotides upstream of the Kozak consensus sequence. In another embodiment, the stable RNA secondary structure is located about 20, about 15, about 10 or about 5 nucleotides upstream of the Kozak consensus sequence. In another embodiment, the stable RNA secondary structure is located about 5, about 4, about 3, about 2, about 1 nucleotides upstream of the Kozak consensus sequence. In another embodiment, the stable RNA secondary structure is located about 15-30, about 15-20, about 15-25, about 10-15, or about 5-10 nucleotides upstream of the Kozak consensus sequence. In another embodiment, the stable RNA secondary structure is located 12-15 nucleotides upstream of the Kozak consensus sequence. In another embodiment, the stable RNA secondary structure has a deltaG of about −30 kcal/mol, about −20 to −30 kcal/mol, about −20 kcal/mol, about −10 to −20 kcal/mol, about −10 kcal/mol, about −5 to −10 kcal/mol.


In another embodiment, the modification is operably linked to an open reading frame encoding a polypeptide and wherein the modification and the open reading frame are heterologous.


In another embodiment, the sequence of the GC-rich RNA element is comprised exclusively of guanine (G) and cytosine (C) nucleobases.


RNA elements that provide a desired translational regulatory activity as described herein can be identified and characterized using known techniques, such as ribosome profiling. Ribosome profiling is a technique that allows the determination of the positions of PICs and/or ribosomes bound to mRNAs (see e.g., Ingolia et al., (2009) Science 324(5924):218-23, incorporated herein by reference). The technique is based on protecting a region or segment of mRNA, by the PIC and/or ribosome, from nuclease digestion. Protection results in the generation of a 30-bp fragment of RNA termed a ‘footprint’. The sequence and frequency of RNA footprints can be analyzed by methods known in the art (e.g., RNA-seq). The footprint is roughly centered on the A-site of the ribosome. If the PIC or ribosome dwells at a particular position or location along an mRNA, footprints generated at these position would be relatively common. Studies have shown that more footprints are generated at positions where the PIC and/or ribosome exhibits decreased processivity and fewer footprints where the PIC and/or ribosome exhibits increased processivity (Gardin et al., (2014) eLife 3:e03735). In some embodiments, residence time or the time of occupancy of a the PIC or ribosome at a discrete position or location along an polynucleotide comprising any one or more of the RNA elements described herein is determined by ribosome profiling.


In some embodiments, a polynucleotide of the present disclosure comprises a miR and/or TEE sequence. In some embodiments, the incorporation of a miR sequence and/or a TEE sequence into a polynucleotide of the present disclosure can change the shape of the stem loop region, which can increase and/or decrease translation. See e.g., Kedde et al., Nature Cell Biology 2010 12(10):1014-20, herein incorporated by reference in its entirety).


MicroRNA (miRNA) Binding Sites


Polynucleotides of the present disclosure can include regulatory elements, for example, microRNA (miRNA) binding sites, transcription factor binding sites, structured mRNA sequences and/or motifs, artificial binding sites engineered to act as pseudo-receptors for endogenous nucleic acid binding molecules, and combinations thereof. In some embodiments, polynucleotides including such regulatory elements are referred to as including “sensor sequences”.


In some embodiments, a polynucleotide (e.g., a ribonucleic acid (RNA), e.g., a messenger RNA (mRNA)) of the present disclosure comprises an open reading frame (ORF) encoding a polypeptide of interest and further comprises one or more miRNA binding site(s). Inclusion or incorporation of miRNA binding site(s) provides for regulation of polynucleotides of the present disclosure, and in turn, of the polypeptides encoded therefrom, based on tissue-specific and/or cell-type specific expression of naturally-occurring miRNAs.


A miRNA, e.g., a natural-occurring miRNA, is a 19-25 nucleotide long noncoding RNA that binds to a polynucleotide and down-regulates gene expression either by reducing stability or by inhibiting translation of the polynucleotide. A miRNA sequence comprises a “seed” region, i.e., a sequence in the region of positions 2-8 of the mature miRNA. A miRNA seed can comprise positions 2-8 or 2-7 of the mature miRNA.


As used herein, the term “microRNA (miRNA or miR) binding site” refers to a sequence within a polynucleotide, e.g., within a DNA or within an RNA transcript, including in the 5′UTR and/or 3′UTR, that has sufficient complementarity to all or a region of a miRNA to interact with, associate with or bind to the miRNA. In some embodiments, a polynucleotide of the present disclosure comprising an ORF encoding a polypeptide of interest and further comprises one or more miRNA binding site(s). In exemplary embodiments, a 5′UTR and/or 3′UTR of the polynucleotide (e.g., a ribonucleic acid (RNA), e.g., a messenger RNA (mRNA)) comprises the one or more miRNA binding site(s).


A miRNA binding site having sufficient complementarity to a miRNA refers to a degree of complementarity sufficient to facilitate miRNA-mediated regulation of a polynucleotide, e.g., miRNA-mediated translational repression or degradation of the polynucleotide. In exemplary aspects of the present disclosure, a miRNA binding site having sufficient complementarity to the miRNA refers to a degree of complementarity sufficient to facilitate miRNA-mediated degradation of the polynucleotide, e.g., miRNA-guided RNA-induced silencing complex (RISC)-mediated cleavage of mRNA. The miRNA binding site can have complementarity to, for example, a 19-25 nucleotide miRNA sequence, to a 19-23 nucleotide miRNA sequence, or to a 22 nucleotide miRNA sequence. A miRNA binding site can be complementary to only a portion of a miRNA, e.g., to a portion less than 1, 2, 3, or 4 nucleotides of the full length of a naturally-occurring miRNA sequence. Full or complete complementarity (e.g., full complementarity or complete complementarity over all or a significant portion of the length of a naturally-occurring miRNA) is preferred when the desired regulation is mRNA degradation.


In some embodiments, a miRNA binding site includes a sequence that has complementarity (e.g., partial or complete complementarity) with an miRNA seed sequence. In some embodiments, the miRNA binding site includes a sequence that has complete complementarity with a miRNA seed sequence. In some embodiments, a miRNA binding site includes a sequence that has complementarity (e.g., partial or complete complementarity) with an miRNA sequence. In some embodiments, the miRNA binding site includes a sequence that has complete complementarity with a miRNA sequence. In some embodiments, a miRNA binding site has complete complementarity with a miRNA sequence but for 1, 2, or 3 nucleotide substitutions, terminal additions, and/or truncations.


In some embodiments, the miRNA binding site is the same length as the corresponding miRNA. In other embodiments, the miRNA binding site is one, two, three, four, five, six, seven, eight, nine, ten, eleven or twelve nucleotide(s) shorter than the corresponding miRNA at the 5′ terminus, the 3′ terminus, or both. In still other embodiments, the microRNA binding site is two nucleotides shorter than the corresponding microRNA at the 5′ terminus, the 3′ terminus, or both. The miRNA binding sites that are shorter than the corresponding miRNAs are still capable of degrading the mRNA incorporating one or more of the miRNA binding sites or preventing the mRNA from translation.


In some embodiments, the miRNA binding site binds the corresponding mature miRNA that is part of an active RISC containing Dicer. In another embodiment, binding of the miRNA binding site to the corresponding miRNA in RISC degrades the mRNA containing the miRNA binding site or prevents the mRNA from being translated. In some embodiments, the miRNA binding site has sufficient complementarity to miRNA so that a RISC complex comprising the miRNA cleaves the polynucleotide comprising the miRNA binding site. In other embodiments, the miRNA binding site has imperfect complementarity so that a RISC complex comprising the miRNA induces instability in the polynucleotide comprising the miRNA binding site. In another embodiment, the miRNA binding site has imperfect complementarity so that a RISC complex comprising the miRNA represses transcription of the polynucleotide comprising the miRNA binding site.


In some embodiments, the miRNA binding site has one, two, three, four, five, six, seven, eight, nine, ten, eleven or twelve mismatch(es) from the corresponding miRNA.


In some embodiments, the miRNA binding site has at least about ten, at least about eleven, at least about twelve, at least about thirteen, at least about fourteen, at least about fifteen, at least about sixteen, at least about seventeen, at least about eighteen, at least about nineteen, at least about twenty, or at least about twenty-one contiguous nucleotides complementary to at least about ten, at least about eleven, at least about twelve, at least about thirteen, at least about fourteen, at least about fifteen, at least about sixteen, at least about seventeen, at least about eighteen, at least about nineteen, at least about twenty, or at least about twenty-one, respectively, contiguous nucleotides of the corresponding miRNA, .


By engineering one or more miRNA binding sites into a polynucleotide of the present disclosure, the polynucleotide can be targeted for degradation or reduced translation, provided the miRNA in question is available. This can reduce off-target effects upon delivery of the polynucleotide. For example, if a polynucleotide of the present disclosure is not intended to be delivered to a tissue or cell but ends up is said tissue or cell, then a miRNA abundant in the tissue or cell can inhibit the expression of the gene of interest if one or multiple binding sites of the miRNA are engineered into the 5′UTR and/or 3′UTR of the polynucleotide.


Conversely, miRNA binding sites can be removed from polynucleotide sequences in which they naturally occur in order to increase protein expression in specific tissues. For example, a binding site for a specific miRNA can be removed from a polynucleotide to improve protein expression in tissues or cells containing the miRNA.


In one embodiment, a polynucleotide of the present disclosure can include at least one miRNA-binding site in the 5′UTR and/or 3′UTR in order to regulate cytotoxic or cytoprotective mRNA therapeutics to specific cells such as, but not limited to, normal and/or cancerous cells. In another embodiment, a polynucleotide of the present disclosure can include two, three, four, five, six, seven, eight, nine, ten, or more miRNA-binding sites in the 5′-UTR and/or 3′-UTR in order to regulate cytotoxic or cytoprotective mRNA therapeutics to specific cells such as, but not limited to, normal and/or cancerous cells.


Regulation of expression in multiple tissues can be accomplished through introduction or removal of one or more miRNA binding sites, e.g., one or more distinct miRNA binding sites. The decision whether to remove or insert a miRNA binding site can be made based on miRNA expression patterns and/or their profilings in tissues and/or cells in development and/or disease. Identification of miRNAs, miRNA binding sites, and their expression patterns and role in biology have been reported (e.g., Bonauer et al., Curr Drug Targets 2010 11:943-949; Anand and Cheresh Curr Opin Hematol 2011 18:171-176; Contreras and Rao Leukemia 2012 26:404-413 (2011 Dec. 20. doi: 10.1038/leu.2011.356); Bartel Cell 2009 136:215-233; Landgraf et al, Cell, 2007 129:1401-1414; Gentner and Naldini, Tissue Antigens. 2012 80:393-403 and all references therein; each of which is incorporated herein by reference in its entirety).


Examples of tissues where miRNA are known to regulate mRNA, and thereby protein expression, include, but are not limited to, liver (miR-122), muscle (miR-133, miR-206, miR-208), endothelial cells (miR-17-92, miR-126), myeloid cells (miR-142-3p, miR-142-5p, miR-16, miR-21, miR-223, miR-24, miR-27), adipose tissue (let-7, miR-30c), heart (miR-id, miR-149), kidney (miR-192, miR-194, miR-204), and lung epithelial cells (let-7, miR-133, miR-126).


Specifically, miRNAs are known to be differentially expressed in immune cells (also called hematopoietic cells), such as antigen presenting cells (APCs) (e.g., dendritic cells and macrophages), macrophages, monocytes, B lymphocytes, T lymphocytes, granulocytes, natural killer cells, etc. Immune cell specific miRNAs are involved in immunogenicity, autoimmunity, the immune-response to infection, inflammation, as well as unwanted immune response after gene therapy and tissue/organ transplantation. Immune cells specific miRNAs also regulate many aspects of development, proliferation, differentiation and apoptosis of hematopoietic cells (immune cells). For example, miR-142 and miR-146 are exclusively expressed in immune cells, particularly abundant in myeloid dendritic cells. It has been demonstrated that the immune response to a polynucleotide can be shut-off by adding miR-142 binding sites to the 3′-UTR of the polynucleotide, enabling more stable gene transfer in tissues and cells. miR-142 efficiently degrades exogenous polynucleotides in antigen presenting cells and suppresses cytotoxic elimination of transduced cells (e.g., Annoni A et al., blood, 2009, 114, 5152-5161; Brown BD, et al., Nat med. 2006, 12(5), 585-591; Brown BD, et al., blood, 2007, 110(13): 4144-4152, each of which is incorporated herein by reference in its entirety).


An antigen-mediated immune response can refer to an immune response triggered by foreign antigens, which, when entering an organism, are processed by the antigen presenting cells and displayed on the surface of the antigen presenting cells. T cells can recognize the presented antigen and induce a cytotoxic elimination of cells that express the antigen.


Introducing a miR-142 binding site into the 5′UTR and/or 3′UTR of a polynucleotide of the present disclosure can selectively repress gene expression in antigen presenting cells through miR-142 mediated degradation, limiting antigen presentation in antigen presenting cells (e.g., dendritic cells) and thereby preventing antigen-mediated immune response after the delivery of the polynucleotide. The polynucleotide is then stably expressed in target tissues or cells without triggering cytotoxic elimination.


In one embodiment, binding sites for miRNAs that are known to be expressed in immune cells, in particular, antigen presenting cells, can be engineered into a polynucleotide of the present disclosure to suppress the expression of the polynucleotide in antigen presenting cells through miRNA mediated RNA degradation, subduing the antigen-mediated immune response. Expression of the polynucleotide is maintained in non-immune cells where the immune cell specific miRNAs are not expressed. For example, in some embodiments, to prevent an immunogenic reaction against a liver specific protein, any miR-122 binding site can be removed and a miR-142 (and/or mirR-146) binding site can be engineered into the 5′UTR and/or 3′UTR of a polynucleotide of the present disclosure.


To further drive the selective degradation and suppression in APCs and macrophage, a polynucleotide of the present disclosure can include a further negative regulatory element in the 5′UTR and/or 3′UTR, either alone or in combination with miR-142 and/or miR-146 binding sites. As a non-limiting example, the further negative regulatory element is a Constitutive Decay Element (CDE).


Immune cell specific miRNAs include, but are not limited to, hsa-let-7a-2-3p, hsa-let-7a-3p, hsa-7a-5p, hsa-let-7c, hsa-let-7e-3p, hsa-let-7e-5p, hsa-let-7g-3p, hsa-let-7g-5p, hsa-let-7i-3p, hsa-let-7i-5p, miR-10a-3p, miR-10a-5p, miR-1184, hsa-let-7f-1-3p, hsa-let-7f-2-5p, hsa-let-7f-5p, miR-125b-1-3p, miR-125b-2-3p, miR-125b-5p, miR-1279, miR-130a-3p, miR-130a-5p, miR-132-3p, miR-132-5p, miR-142-3p, miR-142-5p, miR-143-3p, miR-143-5p, miR-146a-3p, miR-146a-5p, miR-146b-3p, miR-146b-5p, miR-147a, miR-147b, miR-148a-5p, miR-148a-3p, miR-150-3p, miR-150-5p, miR-151b, miR-155-3p, miR-155-5p, miR-15a-3p, miR-15a-5p, miR-15b-5p, miR-15b-3p, miR-16-1-3p, miR-16-2-3p, miR-16-5p, miR-17-5p, miR-181a-3p, miR-181a-5p, miR-181a-2-3p, miR-182-3p, miR-182-5p, miR-197-3p, miR-197-5p, miR-21-5p, miR-21-3p, miR-214-3p, miR-214-5p, miR-223-3p, miR-223-5p, miR-221-3p, miR-221-5p, miR-23b-3p, miR-23b-5p, miR-24-1-5p,miR-24-2-5p, miR-24-3p, miR-26a-1-3p, miR-26a-2-3p, miR-26a-5p, miR-26b-3p, miR-26b-5p, miR-27a-3p, miR-27a-5p, miR-27b-3p,miR-27b-5p, miR-28-3p, miR-28-5p, miR-2909, miR-29a-3p, miR-29a-5p, miR-29b-1-5p, miR-29b-2-5p, miR-29c-3p, miR-29c-5p, miR-30e-3p, miR-30e-5p, miR-331-5p, miR-339-3p, miR-339-5p, miR-345-3p, miR-345-5p, miR-346, miR-34a-3p, miR-34a-5p, miR-363-3p, miR-363-5p, miR-372, miR-377-3p, miR-377-5p, miR-493-3p, miR-493-5p, miR-542, miR-548b-5p, miR548c-5p, miR-548i, miR-548j, miR-548n, miR-574-3p, miR-598, miR-718, miR-935, miR-99a-3p, miR-99a-5p, miR-99b-3p, and miR-99b-5p. Furthermore, novel miRNAs can be identified in immune cell through micro-array hybridization and microtome analysis (e.g., Jima D D et al, Blood, 2010, 116:e118-e127; Vaz C et al., BMC Genomics, 2010, 11,288, the content of each of which is incorporated herein by reference in its entirety.)


miRNAs that are known to be expressed in the liver include, but are not limited to, miR-107, miR-122-3p, miR-122-5p, miR-1228-3p, miR-1228-5p, miR-1249, miR-129-5p, miR-1303, miR-151a-3p, miR-151a-5p, miR-152, miR-194-3p, miR-194-5p, miR-199a-3p, miR-199a-5p, miR-199b-3p, miR-199b-5p, miR-296-5p, miR-557, miR-581, miR-939-3p, and miR-939-5p. MiRNA binding sites from any liver specific miRNA can be introduced to or removed from a polynucleotide of the present disclosure to regulate expression of the polynucleotide in the liver. Liver specific miRNA binding sites can be engineered alone or further in combination with immune cell (e.g., APC) miRNA binding sites in a polynucleotide of the present disclosure.


miRNAs that are known to be expressed in the lung include, but are not limited to, let-7a-2-3p, let-7a-3p, let-7a-5p, miR-126-3p, miR-126-5p, miR-127-3p, miR-127-5p, miR-130a-3p, miR-130a-5p, miR-130b-3p, miR-130b-5p, miR-133a, miR-133b, miR-134, miR-18a-3p, miR-18a-5p, miR-18b-3p, miR-18b-5p, miR-24-1-5p, miR-24-2-5p, miR-24-3p, miR-296-3p, miR-296-5p, miR-32-3p, miR-337-3p, miR-337-5p, miR-381-3p, and miR-381-5p. miRNA binding sites from any lung specific miRNA can be introduced to or removed from a polynucleotide of the present disclosure to regulate expression of the polynucleotide in the lung. Lung specific miRNA binding sites can be engineered alone or further in combination with immune cell (e.g., APC) miRNA binding sites in a polynucleotide of the present disclosure.


miRNAs that are known to be expressed in the heart include, but are not limited to, miR-1, miR-133a, miR-133b, miR-149-3p, miR-149-5p, miR-186-3p, miR-186-5p, miR-208a, miR-208b, miR-210, miR-296-3p, miR-320, miR-451a, miR-451b, miR-499a-3p, miR-499a-5p, miR-499b-3p, miR-499b-5p, miR-744-3p, miR-744-5p, miR-92b-3p, and miR-92b-5p. mMiRNA binding sites from any heart specific microRNA can be introduced to or removed from a polynucleotide of the present disclosure to regulate expression of the polynucleotide in the heart. Heart specific miRNA binding sites can be engineered alone or further in combination with immune cell (e.g., APC) miRNA binding sites in a polynucleotide of the present disclosure.


miRNAs that are known to be expressed in the nervous system include, but are not limited to, miR-124-5p, miR-125a-3p, miR-125a-5p, miR-125b-1-3p, miR-125b-2-3p, miR-125b-5p,miR-1271-3p, miR-1271-5p, miR-128, miR-132-5p, miR-135a-3p, miR-135a-5p, miR-135b-3p, miR-135b-5p, miR-137, miR-139-5p, miR-139-3p, miR-149-3p, miR-149-5p, miR-153, miR-181c-3p, miR-181c-5p, miR-183-3p, miR-183-5p, miR-190a, miR-190b, miR-212-3p, miR-212-5p, miR-219-1-3p, miR-219-2-3p, miR-23a-3p, miR-23a-5p,miR-30a-5p, miR-30b-3p, miR-30b-5p, miR-30c-1-3p, miR-30c-2-3p, miR-30c-5p, miR-30d-3p, miR-30d-5p, miR-329, miR-342-3p, miR-3665, miR-3666, miR-380-3p, miR-380-5p, miR-383, miR-410, miR-425-3p, miR-425-5p, miR-454-3p, miR-454-5p, miR-483, miR-510, miR-516a-3p, miR-548b-5p, miR-548c-5p, miR-571, miR-7-1-3p, miR-7-2-3p, miR-7-5p, miR-802, miR-922, miR-9-3p, and miR-9-5p. miRNAs enriched in the nervous system further include those specifically expressed in neurons, including, but not limited to, miR-132-3p, miR-132-3p, miR-148b-3p, miR-148b-5p, miR-151a-3p, miR-151a-5p, miR-212-3p, miR-212-5p, miR-320b, miR-320e, miR-323a-3p, miR-323a-5p, miR-324-5p, miR-325, miR-326, miR-328, miR-922 and those specifically expressed in glial cells, including, but not limited to, miR-1250, miR-219-1-3p, miR-219-2-3p, miR-219-5p, miR-23a-3p, miR-23a-5p, miR-3065-3p, miR-3065-5p, miR-30e-3p, miR-30e-5p, miR-32-5p, miR-338-5p, and miR-657. miRNA binding sites from any CNS specific miRNA can be introduced to or removed from a polynucleotide of the present disclosure to regulate expression of the polynucleotide in the nervous system. Nervous system specific miRNA binding sites can be engineered alone or further in combination with immune cell (e.g., APC) miRNA binding sites in a polynucleotide of the present disclosure.


miRNAs that are known to be expressed in the pancreas include, but are not limited to, miR-105-3p, miR-105-5p, miR-184, miR-195-3p, miR-195-5p, miR-196a-3p, miR-196a-5p, miR-214-3p, miR-214-5p, miR-216a-3p, miR-216a-5p, miR-30a-3p, miR-33a-3p, miR-33a-5p, miR-375, miR-7-1-3p, miR-7-2-3p, miR-493-3p, miR-493-5p, and miR-944. MiRNA binding sites from any pancreas specific miRNA can be introduced to or removed from a polynucleotide of the present disclosure to regulate expression of the polynucleotide in the pancreas. Pancreas specific miRNA binding sites can be engineered alone or further in combination with immune cell (e.g. APC) miRNA binding sites in a polynucleotide of the present disclosure.


miRNAs that are known to be expressed in the kidney include, but are not limited to, miR-122-3p, miR-145-5p, miR-17-5p, miR-192-3p, miR-192-5p, miR-194-3p, miR-194-5p, miR-20a-3p, miR-20a-5p, miR-204-3p, miR-204-5p, miR-210, miR-216a-3p, miR-216a-5p, miR-296-3p, miR-30a-3p, miR-30a-5p, miR-30b-3p, miR-30b-5p, miR-30c-1-3p, miR-30c-2-3p, miR30c-5p, miR-324-3p, miR-335-3p, miR-335-5p, miR-363-3p, miR-363-5p, and miR-562. miRNA binding sites from any kidney specific miRNA can be introduced to or removed from a polynucleotide of the present disclosure to regulate expression of the polynucleotide in the kidney. Kidney specific miRNA binding sites can be engineered alone or further in combination with immune cell (e.g., APC) miRNA binding sites in a polynucleotide of the present disclosure.


miRNAs that are known to be expressed in the muscle include, but are not limited to, let-7g-3p, let-7g-5p, miR-1, miR-1286, miR-133a, miR-133b, miR-140-3p, miR-143-3p, miR-143-5p, miR-145-3p, miR-145-5p, miR-188-3p, miR-188-5p, miR-206, miR-208a, miR-208b, miR-25-3p, and miR-25-5p. MiRNA binding sites from any muscle specific miRNA can be introduced to or removed from a polynucleotide of the present disclosure to regulate expression of the polynucleotide in the muscle. Muscle specific miRNA binding sites can be engineered alone or further in combination with immune cell (e.g., APC) miRNA binding sites in a polynucleotide of the present disclosure.


miRNAs are also differentially expressed in different types of cells, such as, but not limited to, endothelial cells, epithelial cells, and adipocytes.


miRNAs that are known to be expressed in endothelial cells include, but are not limited to, let-7b-3p, let-7b-5p, miR-100-3p, miR-100-5p, miR-101-3p, miR-101-5p, miR-126-3p, miR-126-5p, miR-1236-3p, miR-1236-5p, miR-130a-3p, miR-130a-5p, miR-17-5p, miR-17-3p, miR-18a-3p, miR-18a-5p, miR-19a-3p, miR-19a-5p, miR-19b-1-5p, miR-19b-2-5p, miR-19b-3p, miR-20a-3p, miR-20a-5p, miR-217, miR-210, miR-21-3p, miR-21-5p, miR-221-3p, miR-221-5p, miR-222-3p, miR-222-5p, miR-23a-3p, miR-23a-5p, miR-296-5p, miR-361-3p, miR-361-5p, miR-421, miR-424-3p, miR-424-5p, miR-513a-5p, miR-92a-1-5p, miR-92a-2-5p, miR-92a-3p, miR-92b-3p, and miR-92b-5p. Many novel miRNAs are discovered in endothelial cells from deep-sequencing analysis (e.g., Voellenkle C et al., RNA, 2012, 18, 472-484, herein incorporated by reference in its entirety). miRNA binding sites from any endothelial cell specific miRNA can be introduced to or removed from a polynucleotide of the present disclosure to regulate expression of the polynucleotide in the endothelial cells.


miRNAs that are known to be expressed in epithelial cells include, but are not limited to, let-7b-3p, let-7b-5p, miR-1246, miR-200a-3p, miR-200a-5p, miR-200b-3p, miR-200b-5p, miR-200c-3p, miR-200c-5p, miR-338-3p, miR-429, miR-451a, miR-451b, miR-494, miR-802 and miR-34a, miR-34b-5p, miR-34c-5p, miR-449a, miR-449b-3p, miR-449b-5p specific in respiratory ciliated epithelial cells, let-7 family, miR-133a, miR-133b, miR-126 specific in lung epithelial cells, miR-382-3p, miR-382-5p specific in renal epithelial cells, and miR-762 specific in corneal epithelial cells. miRNA binding sites from any epithelial cell specific miRNA can be introduced to or removed from a polynucleotide of the present disclosure to regulate expression of the polynucleotide in the epithelial cells.


In addition, a large group of miRNAs are enriched in embryonic stem cells, controlling stem cell self-renewal as well as the development and/or differentiation of various cell lineages, such as neural cells, cardiac, hematopoietic cells, skin cells, osteogenic cells and muscle cells (e.g., Kuppusamy K T et al., Curr. Mol Med, 2013, 13(5), 757-764; Vidigal J A and Ventura A, Semin Cancer Biol. 2012, 22(5-6), 428-436; Goff L A et al., PLoS One, 2009, 4:e7192; Morin R D et al., Genome Res,2008, 18, 610-621; Yoo J K et al., Stem Cells Dev. 2012, 21(11), 2049-2057, each of which is herein incorporated by reference in its entirety). MiRNAs abundant in embryonic stem cells include, but are not limited to, let-7a-2-3p, let-a-3p, let-7a-5p, let7d-3p, let-7d-5p, miR-103a-2-3p, miR-103a-5p, miR-106b-3p, miR-106b-5p, miR-1246, miR-1275, miR-138-1-3p, miR-138-2-3p, miR-138-5p, miR-154-3p, miR-154-5p, miR-200c-3p, miR-200c-5p, miR-290, miR-301a-3p, miR-301a-5p, miR-302a-3p, miR-302a-5p, miR-302b-3p, miR-302b-5p, miR-302c-3p, miR-302c-5p, miR-302d-3p, miR-302d-5p, miR-302e, miR-367-3p, miR-367-5p, miR-369-3p, miR-369-5p, miR-370, miR-371, miR-373, miR-380-5p, miR-423-3p, miR-423-5p, miR-486-5p, miR-520c-3p, miR-548e, miR-548f, miR-548g-3p, miR-548g-5p, miR-548i, miR-548k, miR-5481, miR-548m, miR-548n, miR-5480-3p, miR-5480-5p, miR-548p, miR-664a-3p, miR-664a-5p, miR-664b-3p, miR-664b-5p, miR-766-3p, miR-766-5p, miR-885-3p, miR-885-5p,miR-93-3p, miR-93-5p, miR-941,miR-96-3p, miR-96-5p, miR-99b-3p and miR-99b-5p. Many predicted novel miRNAs are discovered by deep sequencing in human embryonic stem cells (e.g., Morin R D et al., Genome Res,2008,18, 610-621; Goff L A et al., PLoS One, 2009, 4:e7192; Bar M et al., Stem cells, 2008, 26, 2496-2505, the content of each of which is incorporated herein by reference in its entirety).


In one embodiment, the binding sites of embryonic stem cell specific miRNAs can be included in or removed from the 3′UTR of a polynucleotide of the present disclosure to modulate the development and/or differentiation of embryonic stem cells, to inhibit the senescence of stem cells in a degenerative condition (e.g. degenerative diseases), or to stimulate the senescence and apoptosis of stem cells in a disease condition (e.g. cancer stem cells).


As a non-limiting example, miRNA binding sites for miRNAs that are over-expressed in certain cancer and/or tumor cells can be removed from the 3′UTR of a polynucleotide of the present disclosure, restoring the expression suppressed by the over-expressed miRNAs in cancer cells, thus ameliorating the corresponsive biological function, for instance, transcription stimulation and/or repression, cell cycle arrest, apoptosis and cell death. Normal cells and tissues, wherein miRNAs expression is not up-regulated, will remain unaffected.


miRNA can also regulate complex biological processes such as angiogenesis (e.g., miR-132) (Anand and Cheresh Curr Opin Hematol 2011 18:171-176). In the polynucleotides of the present disclosure, miRNA binding sites that are involved in such processes can be removed or introduced, in order to tailor the expression of the polynucleotides to biologically relevant cell types or relevant biological processes. In this context, the polynucleotides of the present disclosure are defined as auxotrophic polynucleotides.


In some embodiments, a polynucleotide of the present disclosure comprises a miRNA binding site, wherein the miRNA binding site comprises one or more nucleotide sequences selected from Table 4, including one or more copies of any one or more of the miRNA binding site sequences. In some embodiments, a polynucleotide of the present disclosure further comprises at least one, two, three, four, five, six, seven, eight, nine, ten, or more of the same or different miRNA binding sites selected from Table 4, including any combination thereof. In some embodiments, the miRNA binding site binds to miR-142 or is complementary to miR-142. In some embodiments, the miR-142 comprises SEQ ID NO:79. In some embodiments, the miRNA binding site binds to miR-142-3p or miR-142-5p. In some embodiments, the miR-142-3p binding site comprises SEQ ID NO:81. In some embodiments, the miR-142-5p binding site comprises SEQ ID NO:83. In some embodiments, the miRNA binding site comprises a nucleotide sequence at least 80%, at least 85%, at least 90%, at least 95%, or 100% identical to SEQ ID NO:81 or SEQ ID NO:83.









TABLE 4







miR-142 and miR-142 binding sites









SEQ ID NO.
Description
Sequence





79
miR-142
GACAGUGCAGUCACCCAUAAAGUAGAAAGCAC




UACUAACAGCACUGGAGGGUGUAGUGUUUCCU




ACUUUAUGGAUGAGUGUACUGUG





80
miR-142-3p
UGUAGUGUUUCCUACUUUAUGGA





81
miR-142-3p binding site
UCCAUAAAGUAGGAAACACUACA





82
miR-142-5p
CAUAAAGUAGAAAGCACUACU





83
miR-142-5p binding site
AGUAGUGCUUUCUACUUUAUG









In some embodiments, a miRNA binding site is inserted in the polynucleotide of the present disclosure in any position of the polynucleotide (e.g., the 5′UTR and/or 3′UTR). In some embodiments, the 5′UTR comprises a miRNA binding site. In some embodiments, the 3′UTR comprises a miRNA binding site. In some embodiments, the 5′UTR and the 3′UTR comprise a miRNA binding site. The insertion site in the polynucleotide can be anywhere in the polynucleotide as long as the insertion of the miRNA binding site in the polynucleotide does not interfere with the translation of a functional polypeptide in the absence of the corresponding miRNA; and in the presence of the miRNA, the insertion of the miRNA binding site in the polynucleotide and the binding of the miRNA binding site to the corresponding miRNA are capable of degrading the polynucleotide or preventing the translation of the polynucleotide.


In some embodiments, a miRNA binding site is inserted in at least about 30 nucleotides downstream from the stop codon of an ORF in a polynucleotide of the present disclosure comprising the ORF. In some embodiments, a miRNA binding site is inserted in at least about 10 nucleotides, at least about 15 nucleotides, at least about 20 nucleotides, at least about 25 nucleotides, at least about 30 nucleotides, at least about 35 nucleotides, at least about 40 nucleotides, at least about 45 nucleotides, at least about 50 nucleotides, at least about 55 nucleotides, at least about 60 nucleotides, at least about 65 nucleotides, at least about 70 nucleotides, at least about 75 nucleotides, at least about 80 nucleotides, at least about 85 nucleotides, at least about 90 nucleotides, at least about 95 nucleotides, or at least about 100 nucleotides downstream from the stop codon of an ORF in a polynucleotide of the present disclosure. In some embodiments, a miRNA binding site is inserted in about 10 nucleotides to about 100 nucleotides, about 20 nucleotides to about 90 nucleotides, about 30 nucleotides to about 80 nucleotides, about 40 nucleotides to about 70 nucleotides, about 50 nucleotides to about 60 nucleotides, about 45 nucleotides to about 65 nucleotides downstream from the stop codon of an ORF in a polynucleotide of the present disclosure.


miRNA gene regulation can be influenced by the sequence surrounding the miRNA such as, but not limited to, the species of the surrounding sequence, the type of sequence (e.g., heterologous, homologous, exogenous, endogenous, or artificial), regulatory elements in the surrounding sequence and/or structural elements in the surrounding sequence. The miRNA can be influenced by the 5′UTR and/or 3′UTR. As a non-limiting example, a non-human 3′UTR can increase the regulatory effect of the miRNA sequence on the expression of a polypeptide of interest compared to a human 3′UTR of the same sequence type.


In one embodiment, other regulatory elements and/or structural elements of the 5′UTR can influence miRNA mediated gene regulation. One example of a regulatory element and/or structural element is a structured IRES (Internal Ribosome Entry Site) in the 5′UTR, which is necessary for the binding of translational elongation factors to initiate protein translation. EIF4A2 binding to this secondarily structured element in the 5′-UTR is necessary for miRNA mediated gene expression (Meijer H A et al., Science, 2013, 340, 82-85, herein incorporated by reference in its entirety). The polynucleotides of the present disclosure can further include this structured 5′UTR in order to enhance microRNA mediated gene regulation.


At least one miRNA binding site can be engineered into the 3′UTR of a polynucleotide of the present disclosure. In this context, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine, at least ten, or more miRNA binding sites can be engineered into a 3′UTR of a polynucleotide of the present disclosure. For example, 1 to 10, 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 2, or 1 miRNA binding sites can be engineered into the 3′UTR of a polynucleotide of the present disclosure. In one embodiment, miRNA binding sites incorporated into a polynucleotide of the present disclosure can be the same or can be different miRNA sites. A combination of different miRNA binding sites incorporated into a polynucleotide of the present disclosure can include combinations in which more than one copy of any of the different miRNA sites are incorporated. In another embodiment, miRNA binding sites incorporated into a polynucleotide of the present disclosure can target the same or different tissues in the body. As a non-limiting example, through the introduction of tissue-, cell-type-, or disease-specific miRNA binding sites in the 3′-UTR of a polynucleotide of the present disclosure, the degree of expression in specific cell types (e.g., hepatocytes, myeloid cells, endothelial cells, cancer cells, etc.) can be reduced.


In one embodiment, a miRNA binding site can be engineered near the 5′ terminus of the 3′UTR, about halfway between the 5′ terminus and 3′ terminus of the 3′UTR and/or near the 3′ terminus of the 3′UTR in a polynucleotide of the present disclosure. As a non-limiting example, a miRNA binding site can be engineered near the 5′ terminus of the 3′UTR and about halfway between the 5′ terminus and 3′ terminus of the 3′UTR. As another non-limiting example, a miRNA binding site can be engineered near the 3′ terminus of the 3′UTR and about halfway between the 5′ terminus and 3′ terminus of the 3′UTR. As yet another non-limiting example, a miRNA binding site can be engineered near the 5′ terminus of the 3′UTR and near the 3′ terminus of the 3′UTR.


In another embodiment, a 3′UTR can comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 miRNA binding sites. The miRNA binding sites can be complementary to a miRNA, miRNA seed sequence, and/or miRNA sequences flanking the seed sequence.


In one embodiment, a polynucleotide of the present disclosure can be engineered to include more than one miRNA site expressed in different tissues or different cell types of a subject. As a non-limiting example, a polynucleotide of the present disclosure can be engineered to include miR-192 and miR-122 to regulate expression of the polynucleotide in the liver and kidneys of a subject. In another embodiment, a polynucleotide of the present disclosure can be engineered to include more than one miRNA site for the same tissue.


In some embodiments, the expression of a polynucleotide of the present disclosure can be controlled by incorporating at least one miR binding site in the polynucleotide and formulating the polynucleotide for administration. As a non-limiting example, a polynucleotide of the present disclosure can be targeted to a tissue or cell by incorporating a miRNA binding site and formulating the polynucleotide in a lipid nanoparticle comprising an ionizable e.g., an ionizable amino lipid, sometimes referred to in the prior art as an “ionizable cationic lipid”, including any of the lipids described herein.


A polynucleotide of the present disclosure can be engineered for more targeted expression in specific tissues, cell types, or biological conditions based on the expression patterns of miRNAs in the different tissues, cell types, or biological conditions. Through introduction of tissue-specific miRNA binding sites, a polynucleotide of the present disclosure can be designed for optimal protein expression in a tissue or cell, or in the context of a biological condition.


In some embodiments, a polynucleotide of the present disclosure can be designed to incorporate miRNA binding sites that either have 100% identity to known miRNA seed sequences or have less than 100% identity to miRNA seed sequences. In some embodiments, a polynucleotide of the present disclosure can be designed to incorporate miRNA binding sites that have at least: 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to known miRNA seed sequences. The miRNA seed sequence can be partially mutated to decrease miRNA binding affinity and as such result in reduced downmodulation of the polynucleotide. In essence, the degree of match or mis-match between the miRNA binding site and the miRNA seed can act as a rheostat to more finely tune the ability of the miRNA to modulate protein expression. In addition, mutation in the non-seed region of a miRNA binding site can also impact the ability of a miRNA to modulate protein expression.


In one embodiment, a miRNA sequence can be incorporated into the loop of a stem loop.


In another embodiment, a miRNA seed sequence can be incorporated in the loop of a stem loop and a miRNA binding site can be incorporated into the 5′ or 3′ stem of the stem loop.


In one embodiment the miRNA sequence in the 5′UTR can be used to stabilize a polynucleotide of the present disclosure described herein.


In another embodiment, a miRNA sequence in the 5′UTR of a polynucleotide of the present disclosure can be used to decrease the accessibility of the site of translation initiation such as, but not limited to a start codon. See, e.g., Matsuda et al., PLoS One. 2010 11(5):e15057; incorporated herein by reference in its entirety, which used antisense locked nucleic acid (LNA) oligonucleotides and exon junction complexes (EJCs) around a start codon (−4 to +37 where the A of the AUG codons is +1) in order to decrease the accessibility to the first start codon (AUG). Matsuda showed that altering the sequence around the start codon with an LNA or EJC affected the efficiency, length and structural stability of a polynucleotide. A polynucleotide of the present disclosure can comprise a miRNA sequence, instead of the LNA or EJC sequence described by Matsuda et al, near the site of translation initiation in order to decrease the accessibility to the site of translation initiation. The site of translation initiation can be prior to, after or within the miRNA sequence. As a non-limiting example, the site of translation initiation can be located within a miRNA sequence such as a seed sequence or binding site. As another non-limiting example, the site of translation initiation can be located within a miR-122 sequence such as the seed sequence or the mir-122 binding site.


In some embodiments, a polynucleotide of the present disclosure can include at least one miRNA in order to dampen the antigen presentation by antigen presenting cells. The miRNA can be the complete miRNA sequence, the miRNA seed sequence, the miRNA sequence without the seed, or a combination thereof. As a non-limiting example, a miRNA incorporated into a polynucleotide of the present disclosure can be specific to the hematopoietic system. As another non-limiting example, a miRNA incorporated into a polynucleotide of the present disclosure to dampen antigen presentation is miR-142-3p.


In some embodiments, a polynucleotide of the present disclosure can include at least one miRNA in order to dampen expression of the encoded polypeptide in a tissue or cell of interest. As a non-limiting example, a polynucleotide of the present disclosure can include at least one miR-122 binding site in order to dampen expression of an encoded polypeptide of interest in the liver. As another non-limiting example a polynucleotide of the present disclosure can include at least one miR-142-3p binding site, miR-142-3p seed sequence, miR-142-3p binding site without the seed, miR-142-5p binding site, miR-142-5p seed sequence, miR-142-5p binding site without the seed, miR-146 binding site, miR-146 seed sequence and/or miR-146 binding site without the seed sequence.


In some embodiments, a polynucleotide of the present disclosure can comprise at least one miRNA binding site in the 3′UTR in order to selectively degrade mRNA therapeutics in the immune cells to subdue unwanted immunogenic reactions caused by therapeutic delivery. As a non-limiting example, the miRNA binding site can make a polynucleotide of the present disclosure more unstable in antigen presenting cells. Non-limiting examples of these miRNAs include mir-142-5p, mir-142-3p, mir-146a-5p, and mir-146-3p.


In one embodiment, a polynucleotide of the present disclosure comprises at least one miRNA sequence in a region of the polynucleotide that can interact with a RNA binding protein.


In some embodiments, the polynucleotide of the present disclosure (e.g., a RNA, e.g., an mRNA) comprising (i) a sequence-optimized nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide (e.g., the wild-type sequence, functional fragment, or variant thereof) and (ii) a miRNA binding site (e.g., a miRNA binding site that binds to miR-142).


3′-UTR is the section of mRNA that immediately follows the translation termination codon and often contains regulatory regions that post-transcriptionally influence gene expression. Regulatory regions within the 3′-UTR can influence polyadenylation, translation efficiency, localization, and stability of the mRNA. In one embodiment, the 3′-UTR useful for the present disclosure comprises a binding site for regulatory proteins or microRNAs.


Regions having a 5′ Cap


The present disclosure also includes a polynucleotide that comprises both a 5′ Cap and a polynucleotide of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide).


The 5′ cap structure of a natural mRNA is involved in nuclear export, increasing mRNA stability and binds the mRNA Cap Binding Protein (CBP), which is responsible for mRNA stability in the cell and translation competency through the association of CBP with poly(A) binding protein to form the mature cyclic mRNA species. The cap further assists the removal of 5′ proximal introns during mRNA splicing.


Endogenous mRNA molecules can be 5′-end capped generating a 5′-ppp-5′-triphosphate linkage between a terminal guanosine cap residue and the 5′-terminal transcribed sense nucleotide of the mRNA molecule. This 5′-guanylate cap can then be methylated to generate an N7-methyl-guanylate residue. The ribose sugars of the terminal and/or anteterminal transcribed nucleotides of the 5′ end of the mRNA can optionally also be 2′-O-methylated. 5′-decapping through hydrolysis and cleavage of the guanylate cap structure can target a nucleic acid molecule, such as an mRNA molecule, for degradation.


In some embodiments, the polynucleotides of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) incorporate a cap moiety.


In some embodiments, polynucleotides of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) comprise a non-hydrolyzable cap structure preventing decapping and thus increasing mRNA half-life. Because cap structure hydrolysis requires cleavage of 5′-ppp-5′ phosphorodiester linkages, modified nucleotides can be used during the capping reaction. For example, a Vaccinia Capping Enzyme from New England Biolabs (Ipswich, Mass.) can be used with α-thio-guanosine nucleotides according to the manufacturer's instructions to create a phosphorothioate linkage in the 5′-ppp-5′ cap. Additional modified guanosine nucleotides can be used such as α-methyl-phosphonate and seleno-phosphate nucleotides.


Additional modifications include, but are not limited to, 2′-O-methylation of the ribose sugars of 5′-terminal and/or 5′-anteterminal nucleotides of the polynucleotide (as mentioned above) on the 2′-hydroxyl group of the sugar ring. Multiple distinct 5′-cap structures can be used to generate the 5′-cap of a nucleic acid molecule, such as a polynucleotide that functions as an mRNA molecule. Cap analogs, which herein are also referred to as synthetic cap analogs, chemical caps, chemical cap analogs, or structural or functional cap analogs, differ from natural (i.e., endogenous, wild-type or physiological) 5′-caps in their chemical structure, while retaining cap function. Cap analogs can be chemically (i.e., non-enzymatically) or enzymatically synthesized and/or linked to the polynucleotides of the present disclosure.


For example, the Anti-Reverse Cap Analog (ARCA) cap contains two guanines linked by a 5′-5′-triphosphate group, wherein one guanine contains an N7 methyl group as well as a 3′-O-methyl group (i.e., N7,3′-O-dimethyl-guanosine-5′-triphosphate-5′-guanosine (m7G-3′mppp-G; which can equivalently be designated 3′ O-Me-m7G(5′)ppp(5′)G). The 3′-O atom of the other, unmodified, guanine becomes linked to the 5′-terminal nucleotide of the capped polynucleotide. The N7- and 3′-O-methlyated guanine provides the terminal moiety of the capped polynucleotide.


Another exemplary cap is mCAP, which is similar to ARCA but has a 2′-O-methyl group on guanosine (i.e., N7,2′-O-dimethyl-guanosine-5′-triphosphate-5′-guanosine, m7Gm-ppp-G).


In some embodiments, the cap is a dinucleotide cap analog. As a non-limiting example, the dinucleotide cap analog can be modified at different phosphate positions with a boranophosphate group or a phophoroselenoate group such as the dinucleotide cap analogs described in U.S. Pat. No. U.S. 8,519,110, the contents of which are herein incorporated by reference in its entirety.


In another embodiment, the cap is a cap analog is a N7-(4-chlorophenoxyethyl) substituted dicucleotide form of a cap analog known in the art and/or described herein. Non-limiting examples of a N7-(4-chlorophenoxyethyl) substituted dicucleotide form of a cap analog include a N7-(4-chlorophenoxyethyl)-G(5′)ppp(5′)G and a N7-(4-chlorophenoxyethyl)-m3′-° G(5′)ppp(5′)G cap analog (See, e.g., the various cap analogs and the methods of synthesizing cap analogs described in Kore et al. Bioorganic & Medicinal Chemistry 2013 21:4570-4574; the contents of which are herein incorporated by reference in its entirety). In another embodiment, a cap analog of the present disclosure is a 4-chloro/bromophenoxyethyl analog.


While cap analogs allow for the concomitant capping of a polynucleotide or a region thereof, in an in vitro transcription reaction, up to 20% of transcripts can remain uncapped. This, as well as the structural differences of a cap analog from an endogenous 5′-cap structures of nucleic acids produced by the endogenous, cellular transcription machinery, can lead to reduced translational competency and reduced cellular stability.


Polynucleotides of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) can also be capped post-manufacture (whether IVT or chemical synthesis), using enzymes, in order to generate more authentic 5′-cap structures. As used herein, the phrase “more authentic” refers to a feature that closely mirrors or mimics, either structurally or functionally, an endogenous or wild type feature. That is, a “more authentic” feature is better representative of an endogenous, wild-type, natural or physiological cellular function and/or structure as compared to synthetic features or analogs, etc., of the prior art, or which outperforms the corresponding endogenous, wild-type, natural or physiological feature in one or more respects. Non-limiting examples of more authentic 5′cap structures of the present disclosure are those that, among other things, have enhanced binding of cap binding proteins, increased half-life, reduced susceptibility to 5′ endonucleases and/or reduced 5′decapping, as compared to synthetic 5′cap structures known in the art (or to a wild-type, natural or physiological 5′cap structure). For example, recombinant Vaccinia Virus Capping Enzyme and recombinant 2′-O-methyltransferase enzyme can create a canonical 5′-5′-triphosphate linkage between the 5′-terminal nucleotide of a polynucleotide and a guanine cap nucleotide wherein the cap guanine contains an N7 methylation and the 5′-terminal nucleotide of the mRNA contains a 2′-O-methyl. Such a structure is termed the Cap1 structure. This cap results in a higher translational-competency and cellular stability and a reduced activation of cellular pro-inflammatory cytokines, as compared, e.g., to other 5′cap analog structures known in the art. Cap structures include, but are not limited to, 7mG(5′)ppp(5′)N,pN2p (cap 0), 7mG(5′)ppp(5′)NlmpNp (cap 1), and 7mG(5′)-ppp(5′)NlmpN2mp (cap 2).


As a non-limiting example, capping chimeric polynucleotides post-manufacture can be more efficient as nearly 100% of the chimeric polynucleotides can be capped. This is in contrast to ˜80% when a cap analog is linked to a chimeric polynucleotide in the course of an in vitro transcription reaction.


According to the present disclosure, 5′ terminal caps can include endogenous caps or cap analogs. According to the present disclosure, a 5′ terminal cap can comprise a guanine analog. Useful guanine analogs include, but are not limited to, inosine, N1-methyl-guanosine, 2′fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine, 2-amino-guanosine, LNA-guanosine, and 2-azido-guanosine.


Poly-A Tails


In some embodiments, the polynucleotides of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) further comprise a poly-A tail. In further embodiments, terminal groups on the poly-A tail can be incorporated for stabilization. In other embodiments, a poly-A tail comprises des-3′ hydroxyl tails.


During RNA processing, a long chain of adenine nucleotides (poly-A tail) can be added to a polynucleotide such as an mRNA molecule in order to increase stability. Immediately after transcription, the 3′ end of the transcript can be cleaved to free a 3′ hydroxyl. Then poly-A polymerase adds a chain of adenine nucleotides to the RNA. The process, called polyadenylation, adds a poly-A tail that can be between, for example, approximately 80 to approximately 250 residues long, including approximately 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, 240 or 250 residues long.


PolyA tails can also be added after the construct is exported from the nucleus.


According to the present disclosure, terminal groups on the poly A tail can be incorporated for stabilization. Polynucleotides of the present disclosure can include des-3′ hydroxyl tails. They can also include structural moieties or 2′-Omethyl modifications as taught by Junjie Li, et al. (Current Biology, Vol. 15, 1501-1507, Aug. 23, 2005, the contents of which are incorporated herein by reference in its entirety).


The polynucleotides of the present disclosure can be designed to encode transcripts with alternative polyA tail structures including histone mRNA. According to Norbury, “Terminal uridylation has also been detected on human replication-dependent histone mRNAs. The turnover of these mRNAs is thought to be important for the prevention of potentially toxic histone accumulation following the completion or inhibition of chromosomal DNA replication. These mRNAs are distinguished by their lack of a 3′ poly(A) tail, the function of which is instead assumed by a stable stem-loop structure and its cognate stem-loop binding protein (SLBP); the latter carries out the same functions as those of PABP on polyadenylated mRNAs” (Norbury, “Cytoplasmic RNA: a case of the tail wagging the dog,” Nature Reviews Molecular Cell Biology; AOP, published online 29 Aug. 2013; doi:10.1038/nrm3645) the contents of which are incorporated herein by reference in its entirety.


Unique poly-A tail lengths provide certain advantages to the polynucleotides of the present disclosure. Generally, the length of a poly-A tail, when present, is greater than 30 nucleotides in length. In another embodiment, the poly-A tail is greater than 35 nucleotides in length (e.g., at least or greater than about 35, 40, 45, 50, 55, 60, 70, 80, 90, 100, 120, 140, 160, 180, 200, 250, 300, 350, 400, 450, 500, 600, 700, 800, 900, 1,000, 1,100, 1,200, 1,300, 1,400, 1,500, 1,600, 1,700, 1,800, 1,900, 2,000, 2,500, and 3,000 nucleotides).


In some embodiments, the polynucleotide or region thereof includes from about 30 to about 3,000 nucleotides (e.g., from 30 to 50, from 30 to 100, from 30 to 250, from 30 to 500, from 30 to 750, from 30 to 1,000, from 30 to 1,500, from 30 to 2,000, from 30 to 2,500, from 50 to 100, from 50 to 250, from 50 to 500, from 50 to 750, from 50 to 1,000, from 50 to 1,500, from 50 to 2,000, from 50 to 2,500, from 50 to 3,000, from 100 to 500, from 100 to 750, from 100 to 1,000, from 100 to 1,500, from 100 to 2,000, from 100 to 2,500, from 100 to 3,000, from 500 to 750, from 500 to 1,000, from 500 to 1,500, from 500 to 2,000, from 500 to 2,500, from 500 to 3,000, from 1,000 to 1,500, from 1,000 to 2,000, from 1,000 to 2,500, from 1,000 to 3,000, from 1,500 to 2,000, from 1,500 to 2,500, from 1,500 to 3,000, from 2,000 to 3,000, from 2,000 to 2,500, and from 2,500 to 3,000).


In some embodiments, the poly-A tail is designed relative to the length of the overall polynucleotide or the length of a particular region of the polynucleotide. This design can be based on the length of a coding region, the length of a particular feature or region or based on the length of the ultimate product expressed from the polynucleotides.


In this context, the poly-A tail can be 10, 20, 30, 40, 50, 60, 70, 80, 90, or 100% greater in length than the polynucleotide or feature thereof. The poly-A tail can also be designed as a fraction of the polynucleotides to which it belongs. In this context, the poly-A tail can be 10, 20, 30, 40, 50, 60, 70, 80, or 90% or more of the total length of the construct, a construct region or the total length of the construct minus the poly-A tail. Further, engineered binding sites and conjugation of polynucleotides for Poly-A binding protein can enhance expression.


Additionally, multiple distinct polynucleotides can be linked together via the PABP (Poly-A binding protein) through the 3′-end using modified nucleotides at the 3′-terminus of the poly-A tail. Transfection experiments can be conducted in relevant cell lines at and protein production can be assayed by ELISA at 12 hr, 24 hr, 48 hr, 72 hr and day 7 post-transfection.


In some embodiments, the polynucleotides of the present disclosure are designed to include a polyA-G Quartet region. The G-quartet is a cyclic hydrogen bonded array of four guanine nucleotides that can be formed by G-rich sequences in both DNA and RNA. In this embodiment, the G-quartet is incorporated at the end of the poly-A tail. The resultant polynucleotide is assayed for stability, protein production and other parameters including half-life at various time points. It has been discovered that the polyA-G quartet results in protein production from an mRNA equivalent to at least 75% of that seen using a poly-A tail of 120 nucleotides alone.


Start Codon Region


The present disclosure also includes a polynucleotide that comprises both a start codon region and the polynucleotide described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide). In some embodiments, the polynucleotides of the present disclosure can have regions that are analogous to or function like a start codon region.


In some embodiments, the translation of a polynucleotide can initiate on a codon that is not the start codon AUG. Translation of the polynucleotide can initiate on an alternative start codon such as, but not limited to, ACG, AGG, AAG, CTG/CUG, GTG/GUG, ATA/AUA, ATT/AUU, TTG/UUG (see Touriol et al. Biology of the Cell 95 (2003) 169-178 and Matsuda and Mauro PLoS ONE, 2010 5:11; the contents of each of which are herein incorporated by reference in its entirety).


As a non-limiting example, the translation of a polynucleotide begins on the alternative start codon ACG. As another non-limiting example, polynucleotide translation begins on the alternative start codon CTG or CUG. As yet another non-limiting example, the translation of a polynucleotide begins on the alternative start codon GTG or GUG.


Nucleotides flanking a codon that initiates translation such as, but not limited to, a start codon or an alternative start codon, are known to affect the translation efficiency, the length and/or the structure of the polynucleotide. (See, e.g., Matsuda and Mauro PLoS ONE, 2010 5:11; the contents of which are herein incorporated by reference in its entirety). Masking any of the nucleotides flanking a codon that initiates translation can be used to alter the position of translation initiation, translation efficiency, length and/or structure of a polynucleotide.


In some embodiments, a masking agent can be used near the start codon or alternative start codon in order to mask or hide the codon to reduce the probability of translation initiation at the masked start codon or alternative start codon. Non-limiting examples of masking agents include antisense locked nucleic acids (LNA) polynucleotides and exon junction complexes (EJCs) (See, e.g., Matsuda and Mauro describing masking agents LNA polynucleotides and EJCs (PLoS ONE, 2010 5:11); the contents of which are herein incorporated by reference in its entirety).


In another embodiment, a masking agent can be used to mask a start codon of a polynucleotide in order to increase the likelihood that translation will initiate on an alternative start codon. In some embodiments, a masking agent can be used to mask a first start codon or alternative start codon in order to increase the chance that translation will initiate on a start codon or alternative start codon downstream to the masked start codon or alternative start codon.


In some embodiments, a start codon or alternative start codon can be located within a perfect complement for a miR binding site. The perfect complement of a miR binding site can help control the translation, length and/or structure of the polynucleotide similar to a masking agent. As a non-limiting example, the start codon or alternative start codon can be located in the middle of a perfect complement for a miRNA binding site. The start codon or alternative start codon can be located after the first nucleotide, second nucleotide, third nucleotide, fourth nucleotide, fifth nucleotide, sixth nucleotide, seventh nucleotide, eighth nucleotide, ninth nucleotide, tenth nucleotide, eleventh nucleotide, twelfth nucleotide, thirteenth nucleotide, fourteenth nucleotide, fifteenth nucleotide, sixteenth nucleotide, seventeenth nucleotide, eighteenth nucleotide, nineteenth nucleotide, twentieth nucleotide or twenty-first nucleotide.


In another embodiment, the start codon of a polynucleotide can be removed from the polynucleotide sequence in order to have the translation of the polynucleotide begin on a codon that is not the start codon. Translation of the polynucleotide can begin on the codon following the removed start codon or on a downstream start codon or an alternative start codon. In a non-limiting example, the start codon ATG or AUG is removed as the first 3 nucleotides of the polynucleotide sequence in order to have translation initiate on a downstream start codon or alternative start codon. The polynucleotide sequence where the start codon was removed can further comprise at least one masking agent for the downstream start codon and/or alternative start codons in order to control or attempt to control the initiation of translation, the length of the polynucleotide and/or the structure of the polynucleotide.


Stop Codon Region


The present disclosure also includes a polynucleotide that comprises both a stop codon region and the polynucleotide described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide). In some embodiments, the polynucleotides of the present disclosure can include at least two stop codons before the 3′ untranslated region (UTR). The stop codon can be selected from TGA, TAA and TAG in the case of DNA, or from UGA, UAA and UAG in the case of RNA. In some embodiments, the polynucleotides of the present disclosure include the stop codon TGA in the case or DNA, or the stop codon UGA in the case of RNA, and one additional stop codon. In a further embodiment the addition stop codon can be TAA or UAA. In another embodiment, the polynucleotides of the present disclosure include three consecutive stop codons, four stop codons, or more.


Polynucleotide Comprising an mRNA Encoding a Factor VIII Polypeptide


In certain embodiments, a polynucleotide of the present disclosure, for example a polynucleotide comprising an mRNA nucleotide sequence encoding a Factor VIII polypeptide, comprises from 5′ to 3′ end:


(i) a 5′ cap provided above;


(ii) a 5′ UTR, such as the sequences provided above;


(iii) an open reading frame encoding a Factor VIII polypeptide, e.g., a sequence optimized nucleic acid sequence encoding Factor VIII disclosed herein;


(iv) at least one stop codon;


(v) a 3′ UTR, such as the sequences provided above; and


(vi) a poly-A tail provided above.


In some embodiments, the polynucleotide further comprises a miRNA binding site, e.g, a miRNA binding site that binds to miRNA-142. In some embodiments, the 5′UTR comprises the miRNA binding site.


In some embodiments, a polynucleotide of the present disclosure comprises a nucleotide sequence encoding a polypeptide sequence at least 70%, at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96% , at least 97%, at least 98%, at least 99%, or 100% identical to the protein sequence of a wild type Factor VIII.


Methods of Making Polynucleotides


The present disclosure also provides methods for making a polynucleotide of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) or a complement thereof.


In some aspects, a polynucleotide (e.g., a RNA, e.g., an mRNA) disclosed herein, and encoding a Factor VIII polypeptide, can be constructed using in vitro transcription. In other aspects, a polynucleotide (e.g., a RNA, e.g., an mRNA) disclosed herein, and encoding a Factor VIII polypeptide, can be constructed by chemical synthesis using an oligonucleotide synthesizer.


In other aspects, a polynucleotide (e.g., a RNA, e.g., an mRNA) disclosed herein, and encoding a Factor VIII polypeptide is made by using a host cell. In certain aspects, a polynucleotide (e.g., a RNA, e.g., an mRNA) disclosed herein, and encoding a Factor VIII polypeptide is made by one or more combination of the IVT, chemical synthesis, host cell expression, or any other methods known in the art.


Naturally occurring nucleosides, non-naturally occurring nucleosides, or combinations thereof, can totally or partially naturally replace occurring nucleosides present in the candidate nucleotide sequence and can be incorporated into a sequence-optimized nucleotide sequence (e.g., a RNA, e.g., an mRNA) encoding a Factor VIII polypeptide. The resultant polynucleotides, e.g., mRNAs, can then be examined for their ability to produce protein and/or produce a therapeutic outcome.


a. In Vitro Transcription/Enzymatic Synthesis


The polynucleotides of the present disclosure disclosed herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) can be transcribed using an in vitro transcription (IVT) system. The system typically comprises a transcription buffer, nucleotide triphosphates (NTPs), an RNase inhibitor and a polymerase. The NTPs can be selected from, but are not limited to, those described herein including natural and unnatural (modified) NTPs. The polymerase can be selected from, but is not limited to, T7 RNA polymerase, T3 RNA polymerase and mutant polymerases such as, but not limited to, polymerases able to incorporate polynucleotides disclosed herein. See U.S. Publ. No. US20130259923, which is herein incorporated by reference in its entirety.


Any number of RNA polymerases or variants can be used in the synthesis of the polynucleotides of the present disclosure. RNA polymerases can be modified by inserting or deleting amino acids of the RNA polymerase sequence. As a non-limiting example, the RNA polymerase can be modified to exhibit an increased ability to incorporate a 2′-modified nucleotide triphosphate compared to an unmodified RNA polymerase (see International Publication WO2008078180 and U.S. Pat. No. 8,101,385; herein incorporated by reference in their entireties).


Variants can be obtained by evolving an RNA polymerase, optimizing the RNA polymerase amino acid and/or nucleic acid sequence and/or by using other methods known in the art. As a non-limiting example, T7 RNA polymerase variants can be evolved using the continuous directed evolution system set out by Esvelt et al. (Nature 472:499-503 (2011); herein incorporated by reference in its entirety) where clones of T7 RNA polymerase can encode at least one mutation such as, but not limited to, lysine at position 93 substituted for threonine (K93T), I4M, A7T, E63V, V64D, A65E, D66Y, T76N, C125R, S128R, A136T, N165S, G175R, H176L, Y178H, F182L, L196F, G198V, D208Y, E222K, S228A, Q239R, T243N, G259D, M2671, G280C, H300R, D351A, A354S, E356D, L360P, A383V, Y385C, D388Y, S397R, M401T, N410S, K450R, P451T, G452V, E484A, H523L, H524N, G542V, E565K, K577E, K577M, N601S, S684Y, L6991, K713E, N748D, Q754R, E775K, A827V, D851N or L864F. As another non-limiting example, T7 RNA polymerase variants can encode at least mutation as described in U.S. Pub. Nos. 20100120024 and 20070117112; herein incorporated by reference in their entireties. Variants of RNA polymerase can also include, but are not limited to, substitutional variants, conservative amino acid substitution, insertional variants, deletional variants and/or covalent derivatives.


In one aspect, the polynucleotide can be designed to be recognized by the wild type or variant RNA polymerases. In doing so, the polynucleotide can be modified to contain sites or regions of sequence changes from the wild type or parent chimeric polynucleotide.


Polynucleotide or nucleic acid synthesis reactions can be carried out by enzymatic methods utilizing polymerases. Polymerases catalyze the creation of phosphodiester bonds between nucleotides in a polynucleotide or nucleic acid chain. Currently known DNA polymerases can be divided into different families based on amino acid sequence comparison and crystal structure analysis. DNA polymerase I (pol I) or A polymerase family, including the Klenow fragments of E. coli, Bacillus DNA polymerase I, Therms aquaticus (Taq) DNA polymerases, and the T7 RNA and DNA polymerases, is among the best studied of these families. Another large family is DNA polymerase a (pol a) or B polymerase family, including all eukaryotic replicating DNA polymerases and polymerases from phages T4 and RB69. Although they employ similar catalytic mechanism, these families of polymerases differ in substrate specificity, substrate analog-incorporating efficiency, degree and rate for primer extension, mode of DNA synthesis, exonuclease activity, and sensitivity against inhibitors.


DNA polymerases are also selected based on the optimum reaction conditions they require, such as reaction temperature, pH, and template and primer concentrations. Sometimes a combination of more than one DNA polymerases is employed to achieve the desired DNA fragment size and synthesis efficiency. For example, Cheng et al. increase pH, add glycerol and dimethyl sulfoxide, decrease denaturation times, increase extension times, and utilize a secondary thermostable DNA polymerase that possesses a 3′ to 5′ exonuclease activity to effectively amplify long targets from cloned inserts and human genomic DNA. (Cheng et al., PNAS 91:5695-5699 (1994), the contents of which are incorporated herein by reference in their entirety). RNA polymerases from bacteriophage T3, T7, and SP6 have been widely used to prepare RNAs for biochemical and biophysical studies. RNA polymerases, capping enzymes, and poly-A polymerases are disclosed in the co-pending International Publication No. WO2014028429, the contents of which are incorporated herein by reference in their entirety.


In one aspect, the RNA polymerase which can be used in the synthesis of the polynucleotides of the present disclosure is a SynS RNA polymerase. (see Zhu et al. Nucleic Acids Research 2013, doi:10.1093/nar/gkt1193, which is herein incorporated by reference in its entirety). The SynS RNA polymerase was recently characterized from marine cyanophage SynS by Zhu et al. where they also identified the promoter sequence (see Zhu et al. Nucleic Acids Research 2013, the contents of which is herein incorporated by reference in its entirety). Zhu et al. found that SynS RNA polymerase catalyzed RNA synthesis over a wider range of temperatures and salinity as compared to T7 RNA polymerase. Additionally, the requirement for the initiating nucleotide at the promoter was found to be less stringent for Syn5 RNA polymerase as compared to the T7 RNA polymerase making Syn5 RNA polymerase promising for RNA synthesis.


In one aspect, a Syn5 RNA polymerase can be used in the synthesis of the polynucleotides described herein. As a non-limiting example, a Syn5 RNA polymerase can be used in the synthesis of the polynucleotide requiring a precise 3′-terminus.


In one aspect, a Syn5 promoter can be used in the synthesis of the polynucleotides. As a non-limiting example, the Syn5 promoter can be 5′-ATTGGGCACCCGTAAGGG-3′ (SEQ ID NO: 86.


In one aspect, a Syn5 RNA polymerase can be used in the synthesis of polynucleotides comprising at least one chemical modification described herein and/or known in the art (see e.g., the incorporation of pseudo-UTP and 5Me-CTP.


In one aspect, the polynucleotides described herein can be synthesized using a Syn5 RNA polymerase which has been purified using modified and improved purification procedure described by Zhu et al. (Nucleic Acids Research 2013).


Various tools in genetic engineering are based on the enzymatic amplification of a target gene which acts as a template. For the study of sequences of individual genes or specific regions of interest and other research needs, it is necessary to generate multiple copies of a target gene from a small sample of polynucleotides or nucleic acids. Such methods can be applied in the manufacture of the polynucleotides of the present disclosure.


For example, polymerase chain reaction (PCR), strand displacement amplification (SDA), nucleic acid sequence-based amplification (NASBA), also called transcription mediated amplification (TMA), and rolling-circle amplification (RCA) can be utilized in the manufacture of one or more regions of the polynucleotides of the present disclosure.


Assembling polynucleotides or nucleic acids by a ligase is also widely used. DNA or RNA ligases promote intermolecular ligation of the 5′ and 3′ ends of polynucleotide chains through the formation of a phosphodiester bond.


b. Chemical Synthesis


Standard methods can be applied to synthesize an isolated polynucleotide sequence encoding an isolated polypeptide of interest, such as a polynucleotide of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide). For example, a single DNA or RNA oligomer containing a codon-optimized nucleotide sequence coding for the particular isolated polypeptide can be synthesized. In other aspects, several small oligonucleotides coding for portions of the desired polypeptide can be synthesized and then ligated. In some aspects, the individual oligonucleotides typically contain 5′ or 3′ overhangs for complementary assembly.


A polynucleotide disclosed herein (e.g., a RNA, e.g., an mRNA) can be chemically synthesized using chemical synthesis methods and potential nucleobase substitutions known in the art. See, for example, International Publication Nos. WO2014093924, WO2013052523; WO2013039857, WO2012135805, WO2013151671; U.S. Publ. No. US20130115272; or U.S. Pat. Nos. US8,999,380 or US8,710,200, all of which are herein incorporated by reference in their entireties.


c. Purification of Polynucleotides Encoding Factor VIII


Purification of the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) can include, but is not limited to, polynucleotide clean-up, quality assurance and quality control. Clean-up can be performed by methods known in the arts such as, but not limited to, AGENCOURT® beads (Beckman Coulter Genomics, Danvers, Mass.), poly-T beads, LNA™ oligo-T capture probes (EXIQON® Inc., Vedbaek, Den.) or HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC).


The term “purified” when used in relation to a polynucleotide such as a “purified polynucleotide” refers to one that is separated from at least one contaminant. As used herein, a “contaminant” is any substance that makes another unfit, impure or inferior. Thus, a purified polynucleotide (e.g., DNA and RNA) is present in a form or setting different from that in which it is found in nature, or a form or setting different from that which existed prior to subjecting it to a treatment or purification method.


In some embodiments, purification of a polynucleotide of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) removes impurities that can reduce or remove an unwanted immune response, e.g., reducing cytokine activity.


In some embodiments, the polynucleotide of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) is purified prior to administration using column chromatography (e.g., strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), or (LCMS)).


In some embodiments, the polynucleotide of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence a Factor VIII polypeptide) purified using column chromatography (e.g., strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC, hydrophobic interaction HPLC (HIC-HPLC), or (LCMS)) presents increased expression of the encoded Factor VIII protein compared to the expression level obtained with the same polynucleotide of the present disclosure purified by a different purification method.


In some embodiments, a column chromatography (e.g., strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), hydrophobic interaction HPLC (HIC-HPLC), or (LCMS)) purified polynucleotide comprises a nucleotide sequence encoding a Factor VIII polypeptide comprising one or more of the point mutations known in the art.


In some embodiments, the use of RP-HPLC purified polynucleotide increases Factor VIII protein expression levels in cells when introduced into those cells, e.g., by 10-100%, i.e., at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, or at least about 100% with respect to the expression levels of Factor VIII protein in the cells before the RP-HPLC purified polynucleotide was introduced in the cells, or after a non-RP-HPLC purified polynucleotide was introduced in the cells.


In some embodiments, the use of RP-HPLC purified polynucleotide increases functional Factor VIII protein expression levels in cells when introduced into those cells, e.g., by 10-100%, i.e., at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, or at least about 100% with respect to the functional expression levels of Factor VIII protein in the cells before the RP-HPLC purified polynucleotide was introduced in the cells, or after a non-RP-HPLC purified polynucleotide was introduced in the cells.


In some embodiments, the use of RP-HPLC purified polynucleotide increases detectable Factor VIII activity in cells when introduced into those cells, e.g., by 10-100%, i.e., at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 90%, at least about 95%, or at least about 100% with respect to the activity levels of functional Factor VIII in the cells before the RP-HPLC purified polynucleotide was introduced in the cells, or after a non-RP-HPLC purified polynucleotide was introduced in the cells.


In some embodiments, the purified polynucleotide is at least about 80% pure, at least about 85% pure, at least about 90% pure, at least about 95% pure, at least about 96% pure, at least about 97% pure, at least about 98% pure, at least about 99% pure, or about 100% pure.


A quality assurance and/or quality control check can be conducted using methods such as, but not limited to, gel electrophoresis, UV absorbance, or analytical HPLC. In another embodiment, the polynucleotide can be sequenced by methods including, but not limited to reverse-transcriptase-PCR.


d. Quantification of Expressed Polynucleotides Encoding Factor VIII


In some embodiments, the polynucleotides of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide), their expression products, as well as degradation products and metabolites can be quantified according to methods known in the art.


In some embodiments, the polynucleotides of the present disclosure can be quantified in exosomes or when derived from one or more bodily fluid. As used herein “bodily fluids” include peripheral blood, serum, plasma, ascites, urine, cerebrospinal fluid (CSF), sputum, saliva, bone marrow, synovial fluid, aqueous humor, amniotic fluid, cerumen, breast milk, broncheoalveolar lavage fluid, semen, prostatic fluid, cowper's fluid or pre-ejaculatory fluid, sweat, fecal matter, hair, tears, cyst fluid, pleural and peritoneal fluid, pericardial fluid, lymph, chyme, chyle, bile, interstitial fluid, menses, pus, sebum, vomit, vaginal secretions, mucosal secretion, stool water, pancreatic juice, lavage fluids from sinus cavities, bronchopulmonary aspirates, blastocyl cavity fluid, and umbilical cord blood. Alternatively, exosomes can be retrieved from an organ selected from the group consisting of lung, heart, pancreas, stomach, intestine, bladder, kidney, ovary, testis, skin, colon, breast, prostate, brain, esophagus, liver, and placenta.


In the exosome quantification method, a sample of not more than 2 mL is obtained from the subject and the exosomes isolated by size exclusion chromatography, density gradient centrifugation, differential centrifugation, nanomembrane ultrafiltration, immunoabsorbent capture, affinity purification, microfluidic separation, or combinations thereof. In the analysis, the level or concentration of a polynucleotide can be an expression level, presence, absence, truncation or alteration of the administered construct. It is advantageous to correlate the level with one or more clinical phenotypes or with an assay for a human disease biomarker.


The assay can be performed using construct specific probes, cytometry, qRT-PCR, real-time PCR, PCR, flow cytometry, electrophoresis, mass spectrometry, or combinations thereof while the exosomes can be isolated using immunohistochemical methods such as enzyme linked immunosorbent assay (ELISA) methods. Exosomes can also be isolated by size exclusion chromatography, density gradient centrifugation, differential centrifugation, nanomembrane ultrafiltration, immunoabsorbent capture, affinity purification, microfluidic separation, or combinations thereof.


These methods afford the investigator the ability to monitor, in real time, the level of polynucleotides remaining or delivered. This is possible because the polynucleotides of the present disclosure differ from the endogenous forms due to the structural or chemical modifications.


In some embodiments, the polynucleotide can be quantified using methods such as, but not limited to, ultraviolet visible spectroscopy (UV/Vis). A non-limiting example of a UV/Vis spectrometer is a NANODROP® spectrometer (ThermoFisher, Waltham, Mass.). The quantified polynucleotide can be analyzed in order to determine if the polynucleotide can be of proper size, check that no degradation of the polynucleotide has occurred. Degradation of the polynucleotide can be checked by methods such as, but not limited to, agarose gel electrophoresis, HPLC based purification methods such as, but not limited to, strong anion exchange HPLC, weak anion exchange HPLC, reverse phase HPLC (RP-HPLC), and hydrophobic interaction HPLC (HIC-HPLC), liquid chromatography-mass spectrometry (LCMS), capillary electrophoresis (CE) and capillary gel electrophoresis (CGE).


Pharmaceutical Compositions and Formulations


The present disclosure provides pharmaceutical compositions and formulations that comprise any of the polynucleotides described above. In some embodiments, the composition or formulation further comprises a delivery agent.


In some embodiments, the composition or formulation can contain a polynucleotide comprising a sequence optimized nucleic acid sequence disclosed herein which encodes a Factor VIII polypeptide. In some embodiments, the composition or formulation can contain a polynucleotide (e.g., a RNA, e.g., an mRNA) comprising a polynucleotide (e.g., an ORF) having significant sequence identity to a sequence optimized nucleic acid sequence disclosed herein which encodes a Factor VIII polypeptide. In some embodiments, the polynucleotide further comprises a miRNA binding site, e.g., a miRNA binding site that binds miR-142, and/or miR-126.


Pharmaceutical compositions or formulation can optionally comprise one or more additional active substances, e.g., therapeutically and/or prophylactically active substances. Pharmaceutical compositions or formulation of the present disclosure can be sterile and/or pyrogen-free. General considerations in the formulation and/or manufacture of pharmaceutical agents can be found, for example, in Remington: The Science and Practice of Pharmacy 21st ed., Lippincott Williams & Wilkins, 2005 (incorporated herein by reference in its entirety). In some embodiments, compositions are administered to humans, human patients or subjects. For the purposes of the present disclosure, the phrase “active ingredient” generally refers to polynucleotides to be delivered as described herein.


Formulations and pharmaceutical compositions described herein can be prepared by any method known or hereafter developed in the art of pharmacology. In general, such preparatory methods include the step of associating the active ingredient with an excipient and/or one or more other accessory ingredients, and then, if necessary and/or desirable, dividing, shaping and/or packaging the product into a desired single- or multi-dose unit.


A pharmaceutical composition or formulation in accordance with the present disclosure can be prepared, packaged, and/or sold in bulk, as a single unit dose, and/or as a plurality of single unit doses. As used herein, a “unit dose” refers to a discrete amount of the pharmaceutical composition comprising a predetermined amount of the active ingredient. The amount of the active ingredient is generally equal to the dosage of the active ingredient that would be administered to a subject and/or a convenient fraction of such a dosage such as, for example, one-half or one-third of such a dosage.


Relative amounts of the active ingredient, the pharmaceutically acceptable excipient, and/or any additional ingredients in a pharmaceutical composition in accordance with the present disclosure can vary, depending upon the identity, size, and/or condition of the subject being treated and further depending upon the route by which the composition is to be administered.


In some embodiments, the compositions and formulations described herein can contain at least one polynucleotide of the present disclosure. As a non-limiting example, the composition or formulation can contain 1, 2, 3, 4 or 5 polynucleotides of the present disclosure. In some embodiments, the compositions or formulations described herein can comprise more than one type of polynucleotide. In some embodiments, the composition or formulation can comprise a polynucleotide in linear and circular form. In another embodiment, the composition or formulation can comprise a circular polynucleotide and an IVT polynucleotide. In yet another embodiment, the composition or formulation can comprise an IVT polynucleotide, a chimeric polynucleotide and a circular polynucleotide.


Although the descriptions of pharmaceutical compositions and formulations provided herein are principally directed to pharmaceutical compositions and formulations that are suitable for administration to humans, it will be understood by the skilled artisan that such compositions are generally suitable for administration to any other animal, e.g., to non-human animals, e.g. non-human mammals.


The present disclosure provides pharmaceutical formulations that comprise a polynucleotide described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide). The polynucleotides described herein can be formulated using one or more excipients to: (1) increase stability; (2) increase cell transfection; (3) permit the sustained or delayed release (e.g., from a depot formulation of the polynucleotide); (4) alter the biodistribution (e.g., target the polynucleotide to specific tissues or cell types); (5) increase the translation of encoded protein in vivo; and/or (6) alter the release profile of encoded protein in vivo. In some embodiments, the pharmaceutical formulation further comprises a delivery agent, (e.g., a compound having the Formula (I), (IA), (II), (IIa), (IIb), (IIc), (IId) or (IIe), e.g., any of Compounds 1-232).


A pharmaceutically acceptable excipient, as used herein, includes, but are not limited to, any and all solvents, dispersion media, or other liquid vehicles, dispersion or suspension aids, diluents, granulating and/or dispersing agents, surface active agents, isotonic agents, thickening or emulsifying agents, preservatives, binders, lubricants or oil, coloring, sweetening or flavoring agents, stabilizers, antioxidants, antimicrobial or antifungal agents, osmolality adjusting agents, pH adjusting agents, buffers, chelants, cyoprotectants, and/or bulking agents, as suited to the particular dosage form desired. Various excipients for formulating pharmaceutical compositions and techniques for preparing the composition are known in the art (see Remington: The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro (Lippincott, Williams & Wilkins, Baltimore, Md., 2006; incorporated herein by reference in its entirety).


Exemplary diluents include, but are not limited to, calcium or sodium carbonate, calcium phosphate, calcium hydrogen phosphate, sodium phosphate, lactose, sucrose, cellulose, microcrystalline cellulose, kaolin, mannitol, sorbitol, etc., and/or combinations thereof.


Exemplary granulating and/or dispersing agents include, but are not limited to, starches, pregelatinized starches, or microcrystalline starch, alginic acid, guar gum, agar, poly(vinyl-pyrrolidone), (providone), cross-linked poly(vinyl-pyrrolidone) (crospovidone), cellulose, methylcellulose, carboxymethyl cellulose, cross-linked sodium carboxymethyl cellulose (croscarmellose), magnesium aluminum silicate (VEEGUM®), sodium lauryl sulfate, etc., and/or combinations thereof.


Exemplary surface active agents and/or emulsifiers include, but are not limited to, natural emulsifiers (e.g., acacia, agar, alginic acid, sodium alginate, tragacanth, chondrux, cholesterol, xanthan, pectin, gelatin, egg yolk, casein, wool fat, cholesterol, wax, and lecithin), sorbitan fatty acid esters (e.g., polyoxyethylene sorbitan monooleate [TWEEN®80], sorbitan monopalmitate [SPAN®40], glyceryl monooleate, polyoxyethylene esters, polyethylene glycol fatty acid esters (e.g., CREMOPHOR®), polyoxyethylene ethers (e.g., polyoxyethylene lauryl ether [BRIJ®30]), PLUORINC®F 68, POLOXAMER®188, etc. and/or combinations thereof.


Exemplary binding agents include, but are not limited to, starch, gelatin, sugars (e.g., sucrose, glucose, dextrose, dextrin, molasses, lactose, lactitol, mannitol), amino acids (e.g., glycine), natural and synthetic gums (e.g., acacia, sodium alginate), ethylcellulose, hydroxyethylcellulose, hydroxypropyl methylcellulose, etc., and combinations thereof.


Oxidation is a potential degradation pathway for mRNA, especially for liquid mRNA formulations. In order to prevent oxidation, antioxidants can be added to the formulations. Exemplary antioxidants include, but are not limited to, alpha tocopherol, ascorbic acid, acorbyl palmitate, benzyl alcohol, butylated hydroxyanisole, m-cresol, methionine, butylated hydroxytoluene, monothioglycerol, sodium or potassium metabisulfite, propionic acid, propyl gallate, sodium ascorbate, etc., and combinations thereof.


Exemplary chelating agents include, but are not limited to, ethylenediaminetetraacetic acid (EDTA), citric acid monohydrate, disodium edetate, fumaric acid, malic acid, phosphoric acid, sodium edetate, tartaric acid, trisodium edetate, etc., and combinations thereof.


Exemplary antimicrobial or antifungal agents include, but are not limited to, benzalkonium chloride, benzethonium chloride, methyl paraben, ethyl paraben, propyl paraben, butyl paraben, benzoic acid, hydroxybenzoic acid, potassium or sodium benzoate, potassium or sodium sorbate, sodium propionate, sorbic acid, etc., and combinations thereof.


Exemplary preservatives include, but are not limited to, vitamin A, vitamin C, vitamin E, beta-carotene, citric acid, ascorbic acid, butylated hydroxyanisol, ethylenediamine, sodium lauryl sulfate (SLS), sodium lauryl ether sulfate (SLES), etc., and combinations thereof.


In some embodiments, the pH of polynucleotide solutions are maintained between pH 5 and pH 8 to improve stability. Exemplary buffers to control pH can include, but are not limited to sodium phosphate, sodium citrate, sodium succinate, histidine (or histidine-HCl), sodium malate, sodium carbonate, etc., and/or combinations thereof.


Exemplary lubricating agents include, but are not limited to, magnesium stearate, calcium stearate, stearic acid, silica, talc, malt, hydrogenated vegetable oils, polyethylene glycol, sodium benzoate, sodium or magnesium lauryl sulfate, etc., and combinations thereof.


The pharmaceutical composition or formulation described here can contain a cryoprotectant to stabilize a polynucleotide described herein during freezing. Exemplary cryoprotectants include, but are not limited to mannitol, sucrose, trehalose, lactose, glycerol, dextrose, etc., and combinations thereof.


The pharmaceutical composition or formulation described here can contain a bulking agent in lyophilized polynucleotide formulations to yield a “pharmaceutically elegant” cake, stabilize the lyophilized polynucleotides during long term (e.g., 36 month) storage. Exemplary bulking agents of the present disclosure can include, but are not limited to sucrose, trehalose, mannitol, glycine, lactose, raffinose, and combinations thereof.


In some embodiments, the pharmaceutical composition or formulation further comprises a delivery agent. The delivery agent of the present disclosure can include, without limitation, liposomes, lipid nanoparticles, lipidoids, polymers, lipoplexes, microvesicles, exosomes, peptides, proteins, cells transfected with polynucleotides, hyaluronidase, nanoparticle mimics, nanotubes, conjugates, and combinations thereof.


Accelerated Blood Clearance


The invention provides compounds, compositions and methods of use thereof for reducing the effect of ABC on a repeatedly administered active agent such as a biologically active agent. As will be readily apparent, reducing or eliminating altogether the effect of ABC on an administered active agent effectively increases its half-life and thus its efficacy.


In some embodiments the term reducing ABC refers to any reduction in ABC in comparison to a positive reference control ABC inducing LNP such as an MC3 LNP. ABC inducing LNPs cause a reduction in circulating levels of an active agent upon a second or subsequent administration within a given time frame. Thus a reduction in ABC refers to less clearance of circulating agent upon a second or subsequent dose of agent, relative to a standard LNP. The reduction may be, for instance, at least 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 98%, or 100%. In some embodiments the reduction is 10-100%, 10-50%, 20-100%, 20-50%, 30-100%, 30-50%, 40%-100%, 40-80%, 50-90%, or 50-100%. Alternatively the reduction in ABC may be characterized as at least a detectable level of circulating agent following a second or subsequent administration or at least a 2 fold, 3 fold, 4 fold, 5 fold increase in circulating agent relative to circulating agent following administration of a standard LNP. In some embodiments the reduction is a 2-100 fold, 2-50 fold, 3-100 fold, 3-50 fold, 3-20 fold, 4-100 fold, 4-50 fold, 4-40 fold, 4-30 fold, 4-25 fold, 4-20 fold, 4-15 fold, 4-10 fold, 4-5 fold, 5 -100 fold, 5-50 fold, 5-40 fold, 5-30 fold, 5-25 fold, 5-20 fold, 5-15 fold, 5-10 fold, 6-100 fold, 6-50 fold, 6-40 fold, 6-30 fold, 6-25 fold, 6-20 fold, 6-15 fold, 6-10 fold, 8-100 fold, 8-50 fold, 8-40 fold, 8-30 fold, 8-25 fold, 8-20 fold, 8-15 fold, 8-10 fold, 10-100 fold, 10-50 fold, 10-40 fold, 10-30 fold, 10-25 fold, 10-20 fold, 10-15 fold, 20-100 fold, 20-50 fold, 20-40 fold, 20-30 fold, or 20-25 fold.


The disclosure provides lipid-comprising compounds and compositions that are less susceptible to clearance and thus have a longer half-life in vivo. This is particularly the case where the compositions are intended for repeated including chronic administration, and even more particularly where such repeated administration occurs within days or weeks.


Significantly, these compositions are less susceptible or altogether circumvent the observed phenomenon of accelerated blood clearance (ABC). ABC is a phenomenon in which certain exogenously administered agents are rapidly cleared from the blood upon second and subsequent administrations. This phenomenon has been observed, in part, for a variety of lipid-containing compositions including but not limited to lipidated agents, liposomes or other lipid-based delivery vehicles, and lipid-encapsulated agents. Heretofore, the basis of ABC has been poorly understood and in some cases attributed to a humoral immune response and accordingly strategies for limiting its impact in vivo particularly in a clinical setting have remained elusive.


This disclosure provides compounds and compositions that are less susceptible, if at all susceptible, to ABC. In some important aspects, such compounds and compositions are lipid-comprising compounds or compositions. The lipid-containing compounds or compositions of this disclosure, surprisingly, do not experience ABC upon second and subsequent administration in vivo. This resistance to ABC renders these compounds and compositions particularly suitable for repeated use in vivo, including for repeated use within short periods of time, including days or 1-2 weeks. This enhanced stability and/or half-life is due, in part, to the inability of these compositions to activate B1a and/or B1b cells and/or conventional B cells, pDCs and/or platelets.


This disclosure therefore provides an elucidation of the mechanism underlying accelerated blood clearance (ABC). It has been found, in accordance with this disclosure and the inventions provided herein, that the ABC phenomenon at least as it relates to lipids and lipid nanoparticles is mediated, at least in part an innate immune response involving B1a and/or B1b cells, pDC and/or platelets. B1a cells are normally responsible for secreting natural antibody, in the form of circulating IgM. This IgM is poly-reactive, meaning that it is able to bind to a variety of antigens, albeit with a relatively low affinity for each.


It has been found in accordance with the invention that some lipidated agents or lipid-comprising formulations such as lipid nanoparticles administered in vivo trigger and are subject to ABC. It has now been found in accordance with the invention that upon administration of a first dose of the LNP, one or more cells involved in generating an innate immune response (referred to herein as sensors) bind such agent, are activated, and then initiate a cascade of immune factors (referred to herein as effectors) that promote ABC and toxicity. For instance, B1a and B1b cells may bind to LNP, become activated (alone or in the presence of other sensors such as pDC and/or effectors such as IL6) and secrete natural IgM that binds to the LNP. Pre-existing natural IgM in the subject may also recognize and bind to the LNP, thereby triggering complement fixation. After administration of the first dose, the production of natural IgM begins within 1-2 hours of administration of the LNP. Typically by about 2-3 weeks the natural IgM is cleared from the system due to the natural half-life of IgM. Natural IgG is produced beginning around 96 hours after administration of the LNP. The agent, when administered in a naïve setting, can exert its biological effects relatively unencumbered by the natural IgM produced post-activation of the B1a cells or B1b cells or natural IgG. The natural IgM and natural IgG are non-specific and thus are distinct from anti-PEG IgM and anti-PEG IgG.


Although Applicant is not bound by mechanism, it is proposed that LNPs trigger ABC and/or toxicity through the following mechanisms. It is believed that when an LNP is administered to a subject the LNP is rapidly transported through the blood to the spleen. The LNPs may encounter immune cells in the blood and/or the spleen. A rapid innate immune response is triggered in response to the presence of the LNP within the blood and/or spleen. Applicant has shown herein that within hours of administration of an LNP several immune sensors have reacted to the presence of the LNP. These sensors include but are not limited to immune cells involved in generating an immune response, such as B cells, pDC, and platelets. The sensors may be present in the spleen, such as in the marginal zone of the spleen and/or in the blood. The LNP may physically interact with one or more sensors, which may interact with other sensors. In such a case the LNP is directly or indirectly interacting with the sensors. The sensors may interact directly with one another in response to recognition of the LNP. For instance many sensors are located in the spleen and can easily interact with one another. Alternatively one or more of the sensors may interact with LNP in the blood and become activated. The activated sensor may then interact directly with other sensors or indirectly (e.g., through the stimulation or production of a messenger such as a cytokine e.g., IL6).


In some embodiments the LNP may interact directly with and activate each of the following sensors: pDC, B1a cells, B1b cells, and platelets. These cells may then interact directly or indirectly with one another to initiate the production of effectors which ultimately lead to the ABC and/or toxicity associated with repeated doses of LNP. For instance, Applicant has shown that LNP administration leads to pDC activation, platelet aggregation and activation and B cell activation. In response to LNP platelets also aggregate and are activated and aggregate with B cells. pDC cells are activated. LNP has been found to interact with the surface of platelets and B cells relatively quickly. Blocking the activation of any one or combination of these sensors in response to LNP is useful for dampening the immune response that would ordinarily occur. This dampening of the immune response results in the avoidance of ABC and/or toxicity.


The sensors once activated produce effectors. An effector, as used herein, is an immune molecule produced by an immune cell, such as a B cell. Effectors include but are not limited to immunoglobulin such as natural IgM and natural IgG and cytokines such as IL6. B1a and B1b cells stimulate the production of natural IgMs within 2-6 hours following administration of an LNP. Natural IgG can be detected within 96 hours. IL6 levels are increased within several hours. The natural IgM and IgG circulate in the body for several days to several weeks. During this time the circulating effectors can interact with newly administered LNPs, triggering those LNPs for clearance by the body. For instance, an effector may recognize and bind to an LNP. The Fc region of the effector may be recognized by and trigger uptake of the decorated LNP by macrophage. The macrophage are then transported to the spleen. The production of effectors by immune sensors is a transient response that correlates with the timing observed for ABC.


If the administered dose is the second or subsequent administered dose, and if such second or subsequent dose is administered before the previously induced natural IgM and/or IgG is cleared from the system (e.g., before the 2-3 window time period), then such second or subsequent dose is targeted by the circulating natural IgM and/or natural IgG or Fc which trigger alternative complement pathway activation and is itself rapidly cleared. When LNP are administered after the effectors have cleared from the body or are reduced in number, ABC is not observed.


Thus, it is useful according to aspects of the invention to inhibit the interaction between LNP and one or more sensors, to inhibit the activation of one or more sensors by LNP (direct or indirect), to inhibit the production of one or more effectors, and/or to inhibit the activity of one or more effectors. In some embodiments the LNP is designed to limit or block interaction of the LNP with a sensor. For instance the LNP may have an altered PC and/or PEG to prevent interactions with sensors. Alternatively or additionally an agent that inhibits immune responses induced by LNPs may be used to achieve any one or more of these effects.


It has also been determined that conventional B cells are also implicated in ABC. Specifically, upon first administration of an agent, conventional B cells, referred to herein as CD19(+), bind to and react against the agent. Unlike B1a and B1b cells though, conventional B cells are able to mount first an IgM response (beginning around 96 hours after administration of the LNPs) followed by an IgG response (beginning around 14 days after administration of the LNPs) concomitant with a memory response. Thus conventional B cells react against the administered agent and contribute to IgM (and eventually IgG) that mediates ABC. The IgM and IgG are typically anti-PEG IgM and anti-PEG IgG.


It is contemplated that in some instances, the majority of the ABC response is mediated through B1a cells and B1a-mediated immune responses. It is further contemplated that in some instances, the ABC response is mediated by both IgM and IgG, with both conventional B cells and B1a cells mediating such effects. In yet still other instances, the ABC response is mediated by natural IgM molecules, some of which are capable of binding to natural IgM, which may be produced by activated B1a cells. The natural IgMs may bind to one or more components of the LNPs, e.g., binding to a phospholipid component of the LNPs (such as binding to the PC moiety of the phospholipid) and/or binding to a PEG-lipid component of the LNPs (such as binding to PEG-DMG, in particular, binding to the PEG moiety of PEG-DMG). Since B1a expresses CD36, to which phosphatidylcholine is a ligand, it is contemplated that the CD36 receptor may mediate the activation of B1a cells and thus production of natural IgM. In yet still other instances, the ABC response is mediated primarily by conventional B cells.


It has been found in accordance with the invention that the ABC phenomenon can be reduced or abrogated, at least in part, through the use of compounds and compositions (such as agents, delivery vehicles, and formulations) that do not activate B1a cells. Compounds and compositions that do not activate B1a cells may be referred to herein as B1a inert compounds and compositions. It has been further found in accordance with the invention that the ABC phenomenon can be reduced or abrogated, at least in part, through the use of compounds and compositions that do not activate conventional B cells. Compounds and compositions that do not activate conventional B cells may in some embodiments be referred to herein as CD19-inert compounds and compositions. Thus, in some embodiments provided herein, the compounds and compositions do not activate B1a cells and they do not activate conventional B cells. Compounds and compositions that do not activate B1a cells and conventional B cells may in some embodiments be referred to herein as B1a/CD19-inert compounds and compositions.


These underlying mechanisms were not heretofore understood, and the role of B1a and B1b cells and their interplay with conventional B cells in this phenomenon was also not appreciated.


Accordingly, this disclosure provides compounds and compositions that do not promote ABC. These may be further characterized as not capable of activating B1a and/or B1b cells, platelets and/or pDC, and optionally conventional B cells also. These compounds (e.g., agents, including biologically active agents such as prophylactic agents, therapeutic agents and diagnostic agents, delivery vehicles, including liposomes, lipid nanoparticles, and other lipid-based encapsulating structures, etc.) and compositions (e.g., formulations, etc.) are particularly desirable for applications requiring repeated administration, and in particular repeated administrations that occur within with short periods of time (e.g., within 1-2 weeks). This is the case, for example, if the agent is a nucleic acid based therapeutic that is provided to a subject at regular, closely-spaced intervals. The findings provided herein may be applied to these and other agents that are similarly administered and/or that are subject to ABC.


Of particular interest are lipid-comprising compounds, lipid-comprising particles, and lipid-comprising compositions as these are known to be susceptible to ABC. Such lipid-comprising compounds particles, and compositions have been used extensively as biologically active agents or as delivery vehicles for such agents. Thus, the ability to improve their efficacy of such agents, whether by reducing the effect of ABC on the agent itself or on its delivery vehicle, is beneficial for a wide variety of active agents.


Also provided herein are compositions that do not stimulate or boost an acute phase response (ARP) associated with repeat dose administration of one or more biologically active agents.


The composition, in some instances, may not bind to IgM, including but not limited to natural IgM.


The composition, in some instances, may not bind to an acute phase protein such as but not limited to C-reactive protein.


The composition, in some instances, may not trigger a CD5(+) mediated immune response. As used herein, a CD5(+) mediated immune response is an immune response that is mediated by B1a and/or B1b cells. Such a response may include an ABC response, an acute phase response, induction of natural IgM and/or IgG, and the like.


The composition, in some instances, may not trigger a CD19(+) mediated immune response. As used herein, a CD19(+) mediated immune response is an immune response that is mediated by conventional CD19(+), CD5(−) B cells. Such a response may include induction of IgM, induction of IgG, induction of memory B cells, an ABC response, an anti-drug antibody (ADA) response including an anti-protein response where the protein may be encapsulated within an LNP, and the like.


B1a cells are a subset of B cells involved in innate immunity. These cells are the source of circulating IgM, referred to as natural antibody or natural serum antibody. Natural IgM antibodies are characterized as having weak affinity for a number of antigens, and therefore they are referred to as “poly-specific” or “poly-reactive”, indicating their ability to bind to more than one antigen. B1a cells are not able to produce IgG. Additionally, they do not develop into memory cells and thus do not contribute to an adaptive immune response. However, they are able to secrete IgM upon activation. The secreted IgM is typically cleared within about 2-3 weeks, at which point the immune system is rendered relatively naïve to the previously administered antigen. If the same antigen is presented after this time period (e.g., at about 3 weeks after the initial exposure), the antigen is not rapidly cleared. However, significantly, if the antigen is presented within that time period (e.g., within 2 weeks, including within 1 week, or within days), then the antigen is rapidly cleared. This delay between consecutive doses has rendered certain lipid-containing therapeutic or diagnostic agents unsuitable for use.


In humans, B1a cells are CD19(+), CD20(+), CD27(+), CD43(+), CD70(−) and CD5(+). In mice, B1a cells are CD19(+), CD5(+), and CD45 B cell isoform B220(+). It is the expression of CD5 which typically distinguishes B1a cells from other convention B cells. B1a cells may express high levels of CD5, and on this basis may be distinguished from other B-1 cells such as B-1b cells which express low or undetectable levels of CD5. CD5 is a pan-T cell surface glycoprotein. B1a cells also express CD36, also known as fatty acid translocase. CD36 is a member of the class B scavenger receptor family. CD36 can bind many ligands, including oxidized low density lipoproteins, native lipoproteins, oxidized phospholipids, and long-chain fatty acids.


B1b cells are another subset of B cells involved in innate immunity. These cells are another source of circulating natural IgM. Several antigens, including PS, are capable of inducing T cell independent immunity through B1b activation. CD27 is typically upregulated on B1b cells in response to antigen activation. Similar to B1a cells, the B1b cells are typically located in specific body locations such as the spleen and peritoneal cavity and are in very low abundance in the blood. The B1b secreted natural IgM is typically cleared within about 2-3 weeks, at which point the immune system is rendered relatively naïve to the previously administered antigen. If the same antigen is presented after this time period (e.g., at about 3 weeks after the initial exposure), the antigen is not rapidly cleared. However, significantly, if the antigen is presented within that time period (e.g., within 2 weeks, including within 1 week, or within days), then the antigen is rapidly cleared. This delay between consecutive doses has rendered certain lipid-containing therapeutic or diagnostic agents unsuitable for use.


In some embodiments it is desirable to block B1a and/or B1b cell activation. One strategy for blocking B1a and/or B1b cell activation involves determining which components of a lipid nanoparticle promote B cell activation and neutralizing those components. It has been discovered herein that at least PEG and phosphatidylcholine (PC) contribute to B1a and B1b cell interaction with other cells and/or activation. PEG may play a role in promoting aggregation between B1 cells and platelets, which may lead to activation. PC (a helper lipid in LNPs) is also involved in activating the B1 cells, likely through interaction with the CD36 receptor on the B cell surface. Numerous particles have PEG-lipid alternatives, PEG-less, and/or PC replacement lipids (e.g. oleic acid or analogs thereof) have been designed and tested. Applicant has established that replacement of one or more of these components within an LNP that otherwise would promote ABC upon repeat administration, is useful in preventing ABC by reducing the production of natural IgM and/or B cell activation. Thus, the invention encompasses LNPs that have reduced ABC as a result of a design which eliminates the inclusion of B cell triggers.


Another strategy for blocking B1a and/or B1b cell activation involves using an agent that inhibits immune responses induced by LNPs. These types of agents are discussed in more detail below. In some embodiments these agents block the interaction between B1a/B1b cells and the LNP or platelets or pDC. For instance the agent may be an antibody or other binding agent that physically blocks the interaction. An example of this is an antibody that binds to CD36 or CD6. The agent may also be a compound that prevents or disables the B1a/B1b cell from signaling once activated or prior to activation. For instance, it is possible to block one or more components in the B1a/B1b signaling cascade the results from B cell interaction with LNP or other immune cells. In other embodiments the agent may act one or more effectors produced by the B1a/B1b cells following activation. These effectors include for instance, natural IgM and cytokines.


It has been demonstrated according to aspects of the invention that when activation of pDC cells is blocked, B cell activation in response to LNP is decreased. Thus, in order to avoid ABC and/or toxicity, it may be desirable to prevent pDC activation. Similar to the strategies discussed above, pDC cell activation may be blocked by agents that interfere with the interaction between pDC and LNP and/or B cells/platelets. Alternatively agents that act on the pDC to block its ability to get activated or on its effectors can be used together with the LNP to avoid ABC.


Platelets may also play an important role in ABC and toxicity. Very quickly after a first dose of LNP is administered to a subject platelets associate with the LNP, aggregate and are activated. In some embodiments it is desirable to block platelet aggregation and/or activation. One strategy for blocking platelet aggregation and/or activation involves determining which components of a lipid nanoparticle promote platelet aggregation and/or activation and neutralizing those components. It has been discovered herein that at least PEG contribute to platelet aggregation, activation and/or interaction with other cells. Numerous particles have PEG-lipid alternatives and PEG-less have been designed and tested. Applicant has established that replacement of one or more of these components within an LNP that otherwise would promote ABC upon repeat administration, is useful in preventing ABC by reducing the production of natural IgM and/or platelet aggregation. Thus, the invention encompasses LNPs that have reduced ABC as a result of a design which eliminates the inclusion of platelet triggers. Alternatively agents that act on the platelets to block its activity once it is activated or on its effectors can be used together with the LNP to avoid ABC.


Measuring ABC Activity and Related Activities


Various compounds and compositions provided herein, including LNPs, do not promote ABC activity upon administration in vivo. These LNPs may be characterized and/or identified through any of a number of assays, such as but not limited to those described below, as well as any of the assays disclosed in the Examples section, include the methods subsection of the Examples.


In some embodiments the methods involve administering an LNP without producing an immune response that promotes ABC. An immune response that promotes ABC involves activation of one or more sensors, such as B1 cells, pDC, or platelets, and one or more effectors, such as natural IgM, natural IgG or cytokines such as IL6. Thus administration of an LNP without producing an immune response that promotes ABC, at a minimum involves administration of an LNP without significant activation of one or more sensors and significant production of one or more effectors. Significant used in this context refers to an amount that would lead to the physiological consequence of accelerated blood clearance of all or part of a second dose with respect to the level of blood clearance expected for a second dose of an ABC triggering LNP. For instance, the immune response should be dampened such that the ABC observed after the second dose is lower than would have been expected for an ABC triggering LNP.


B1a or B1b Activation Assay


Certain compositions provided in this disclosure do not activate B cells, such as B1a or B1b cells (CD19+ CD5+) and/or conventional B cells (CD19+ CD5−). Activation of B1a cells, B1b cells, or conventional B cells may be determined in a number of ways, some of which are provided below. B cell population may be provided as fractionated B cell populations or unfractionated populations of splenocytes or peripheral blood mononuclear cells (PBMC). If the latter, the cell population may be incubated with the LNP of choice for a period of time, and then harvested for further analysis. Alternatively, the supernatant may be harvested and analyzed.


Upregulation of activation marker cell surface expression Activation of B1a cells, B1b cells, or conventional B cells may be demonstrated as increased expression of B cell activation markers including late activation markers such as CD86. In an exemplary non-limiting assay, unfractionated B cells are provided as a splenocyte population or as a PBMC population, incubated with an LNP of choice for a particular period of time, and then stained for a standard B cell marker such as CD19 and for an activation marker such as CD86, and analyzed using for example flow cytometry. A suitable negative control involves incubating the same population with medium, and then performing the same staining and visualization steps. An increase in CD86 expression in the test population compared to the negative control indicates B cell activation.


Pro-Inflammatory Cytokine Release


B cell activation may also be assessed by cytokine release assay. For example, activation may be assessed through the production and/or secretion of cytokines such as IL-6 and/or TNF-alpha upon exposure with LNPs of interest.


Such assays may be performed using routine cytokine secretion assays well known in the art. An increase in cytokine secretion is indicative of B cell activation.


LNP Binding/Association to and/or Uptake by B Cells


LNP association or binding to B cells may also be used to assess an LNP of interest and to further characterize such LNP. Association/binding and/or uptake/internalization may be assessed using a detectably labeled, such as fluorescently labeled, LNP and tracking the location of such LNP in or on B cells following various periods of incubation.


The invention further contemplates that the compositions provided herein may be capable of evading recognition or detection and optionally binding by downstream mediators of ABC such as circulating IgM and/or acute phase response mediators such as acute phase proteins (e.g., C-reactive protein (CRP).


Methods of Use for Reducing ABC


Also provided herein are methods for delivering LNPs, which may encapsulate an agent such as a therapeutic agent, to a subject without promoting ABC.


In some embodiments, the method comprises administering any of the LNPs described herein, which do not promote ABC, for example, do not induce production of natural IgM binding to the LNPs, do not activate B1a and/or B1b cells. As used herein, an LNP that “does not promote ABC” refers to an LNP that induces no immune responses that would lead to substantial ABC or a substantially low level of immune responses that is not sufficient to lead to substantial ABC. An LNP that does not induce the production of natural IgMs binding to the LNP refers to LNPs that induce either no natural IgM binding to the LNPs or a substantially low level of the natural IgM molecules, which is insufficient to lead to substantial ABC. An LNP that does not activate B1a and/or B1b cells refer to LNPs that induce no response of B1a and/or B1b cells to produce natural IgM binding to the LNPs or a substantially low level of B1a and/or B1b responses, which is insufficient to lead to substantial ABC.


In some embodiments the terms do not activate and do not induce production are a relative reduction to a reference value or condition. In some embodiments the reference value or condition is the amount of activation or induction of production of a molecule such as IgM by a standard LNP such as an MC3 LNP. In some embodiments the relative reduction is a reduction of at least 30%, for example at least 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%. In other embodiments the terms do not activate cells such as B cells and do not induce production of a protein such as IgM may refer to an undetectable amount of the active cells or the specific protein.


Platelet Effects and Toxicity


The invention is further premised in part on the elucidation of the mechanism underlying dose-limiting toxicity associated with LNP administration. Such toxicity may involve coagulopathy, disseminated intravascular coagulation (DIC, also referred to as consumptive coagulopathy), whether acute or chronic, and/or vascular thrombosis. In some instances, the dose-limiting toxicity associated with LNPs is acute phase response (APR) or complement activation-related psudoallergy (CARPA).


As used herein, coagulopathy refers to increased coagulation (blood clotting) in vivo. The findings reported in this disclosure are consistent with such increased coagulation and significantly provide insight on the underlying mechanism. Coagulation is a process that involves a number of different factors and cell types, and heretofore the relationship between and interaction of LNPs and platelets has not been understood in this regard. This disclosure provides evidence of such interaction and also provides compounds and compositions that are modified to have reduced platelet effect, including reduced platelet association, reduced platelet aggregation, and/or reduced platelet aggregation. The ability to modulate, including preferably down-modulate, such platelet effects can reduce the incidence and/or severity of coagulopathy post-LNP administration. This in turn will reduce toxicity relating to such LNP, thereby allowing higher doses of LNPs and importantly their cargo to be administered to patients in need thereof.


CARPA is a class of acute immune toxicity manifested in hypersensitivity reactions (HSRs), which may be triggered by nanomedicines and biologicals. Unlike allergic reactions, CARPA typically does not involve IgE but arises as a consequence of activation of the complement system, which is part of the innate immune system that enhances the body's abilities to clear pathogens. One or more of the following pathways, the classical complement pathway (CP), the alternative pathway (AP), and the lectin pathway (LP), may be involved in CARPA. Szebeni, Molecular Immunology, 61:163-173 (2014).


The classical pathway is triggered by activation of the C1-complex, which contains. C1q, C1r, C1s, or C1qr2s2. Activation of the C1-complex occurs when C1q binds to IgM or IgG complexed with antigens, or when C1q binds directly to the surface of the pathogen. Such binding leads to conformational changes in the C1q molecule, which leads to the activation of C1r, which in turn, cleave C1s. The C1r2s2 component now splits C4 and then C2, producing C4a, C4b, C2a, and C2b. C4b and C2b bind to form the classical pathway C3-convertase (C4b2b complex), which promotes cleavage of C3 into C3a and C3b. C3b then binds the C3 convertase to from the C5 convertase (C4b2b3b complex). The alternative pathway is continuously activated as a result of spontaneous C3 hydrolysis. Factor P (properdin) is a positive regulator of the alternative pathway. Oligomerization of properdin stabilizes the C3 convertase, which can then cleave much more C3. The C3 molecules can bind to surfaces and recruit more B, D, and P activity, leading to amplification of the complement activation.


Acute phase response (APR) is a complex systemic innate immune responses for preventing infection and clearing potential pathogens. Numerous proteins are involved in APR and C-reactive protein is a well-characterized one.


It has been found, in accordance with the invention, that certain LNP are able to associate physically with platelets almost immediately after administration in vivo, while other LNP do not associate with platelets at all or only at background levels. Significantly, those LNPs that associate with platelets also apparently stabilize the platelet aggregates that are formed thereafter. Physical contact of the platelets with certain LNPs correlates with the ability of such platelets to remain aggregated or to form aggregates continuously for an extended period of time after administration. Such aggregates comprise activated platelets and also innate immune cells such as macrophages and B cells.


Delivery Agents


In one set of embodiments, lipid nanoparticles (LNPs) are provided. In one embodiment, a lipid nanoparticle comprises lipids including an ionizable lipid, a structural lipid, a phospholipid, and mRNA. Each of the LNPs described herein may be used as a formulation for the mRNA described herein. In one embodiment, a lipid nanoparticle comprises an ionizable lipid, a structural lipid, a phospholipid, and mRNA. In some embodiments, the LNP comprises an ionizable lipid, a PEG-modified lipid, a phospholipid and a structural lipid. In some embodiments, the LNP has a molar ratio of about 20-60% ionizable lipid: about 5-25% phospholipid: about 25-55% structural lipid; and about 0.5-15% PEG-modified lipid. In some embodiments, the LNP comprises a molar ratio of about 50% ionizable lipid, about 1.5% PEG-modified lipid, about 38.5% structural lipid and about 10% phospholipid. In some embodiments, the LNP comprises a molar ratio of about 55% ionizable lipid, about 2.5% PEG lipid, about 32.5% structural lipid and about 10% phospholipid. In some embodiments, the ionizable lipid is an ionizable amino or cationic lipid and the phospholipid is a neutral lipid, and the structural lipid is a cholesterol. In some embodiments, the LNP has a molar ratio of 50:38.5:10:1.5 of ionizable lipid: cholesterol: DSPC: PEG2000-DMG.


a. Ionizable Lipid


The present disclosure provides pharmaceutical compositions with advantageous properties. For example, the lipids described herein (e.g. those having any of Formula (I), (IA), (II), (IIa), (IIb), (IIc), (IId), (IIe), (III), (IV), (V), or (VI) may be advantageously used in lipid nanoparticle compositions for the delivery of therapeutic and/or prophylactic agents to mammalian cells or organs. For example, the lipids described herein have little or no immunogenicity. For example, the lipid compounds disclosed hereinhave a lower immunogenicity as compared to a reference lipid (e.g., MC3, KC2, or DLinDMA). For example, a formulation comprising a lipid disclosed herein and a therapeutic or prophylactic agent has an increased therapeutic index as compared to a corresponding formulation which comprises a reference lipid (e.g., MC3, KC2, or DLinDMA) and the same therapeutic or prophylactic agent. In particular, the present application provides pharmaceutical compositions comprising:


(a) a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide; and


(b) a delivery agent.


Lipid Nanoparticle Formulations


In some embodiments, nucleic acids of the invention (e.g. Factor VIII mRNA) are formulated in a lipid nanoparticle (LNP). Lipid nanoparticles typically comprise ionizable cationic lipid, non-cationic lipid, sterol and PEG lipid components along with the nucleic acid cargo of interest. The lipid nanoparticles of the invention can be generated using components, compositions, and methods as are generally known in the art, see for example PCT/US2016/052352; PCT/US2016/068300; PCT/US2017/037551; PCT/US2015/027400; PCT/US2016/047406; PCT/US2016000129; PCT/US2016/014280; PCT/US2016/014280; PCT/US2017/038426; PCT/US2014/027077; PCT/US2014/055394; PCT/US2016/52117; PCT/US2012/069610; PCT/US2017/027492; PCT/US2016/059575 and PCT/US2016/069491 all of which are incorporated by reference herein in their entirety.


Nucleic acids of the present disclosure (e.g. Factor VIII mRNA) are typically formulated in lipid nanoparticle. In some embodiments, the lipid nanoparticle comprises at least one ionizable cationic lipid, at least one non-cationic lipid, at least one sterol, and/or at least one polyethylene glycol (PEG)-modified lipid.


In some embodiments, the lipid nanoparticle comprises a molar ratio of 20-60% ionizable cationic lipid. For example, the lipid nanoparticle may comprise a molar ratio of 20-50%, 20-40%, 20-30%, 30-60%, 30-50%, 30-40%, 40-60%, 40-50%, or 50-60% ionizable cationic lipid. In some embodiments, the lipid nanoparticle comprises a molar ratio of 20%, 30%, 40%, 50, or 60% ionizable cationic lipid.


In some embodiments, the lipid nanoparticle comprises a molar ratio of 5-25% non-cationic lipid. For example, the lipid nanoparticle may comprise a molar ratio of 5-20%, 5-15%, 5-10%, 10-25%, 10-20%, 10-25%, 15-25%, 15-20%, or 20-25% non-cationic lipid. In some embodiments, the lipid nanoparticle comprises a molar ratio of 5%, 10%, 15%, 20%, or 25% non-cationic lipid.


In some embodiments, the lipid nanoparticle comprises a molar ratio of 25-55% sterol. For example, the lipid nanoparticle may comprise a molar ratio of 25-50%, 25-45%, 25-40%, 25-35%, 25-30%, 30-55%, 30-50%, 30-45%, 30-40%, 30-35%, 35-55%, 35-50%, 35-45%, 35-40%, 40-55%, 40-50%, 40-45%, 45-55%, 45-50%, or 50-55% sterol. In some embodiments, the lipid nanoparticle comprises a molar ratio of 25%, 30%, 35%, 40%, 45%, 50%, or 55% sterol.


In some embodiments, the lipid nanoparticle comprises a molar ratio of 0.5-15% PEG-modified lipid. For example, the lipid nanoparticle may comprise a molar ratio of 0.5-10%, 0.5-5%, 1-15%, 1-10%, 1-5%, 2-15%, 2-10%, 2-5%, 5-15%, 5-10%, or 10-15%. In some embodiments, the lipid nanoparticle comprises a molar ratio of 0.5%, 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, or 15% PEG-modified lipid.


In some embodiments, the lipid nanoparticle comprises a molar ratio of 20-60% ionizable cationic lipid, 5-25% non-cationic lipid, 25-55% sterol, and 0.5-15% PEG-modified lipid.


In some aspects, the ionizable lipids of the present disclosure may be one or more of compounds of Formula (I):




embedded image


or their N-oxides, or salts or isomers thereof, wherein:


R1 is selected from the group consisting of C5-30 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;


R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;


R4 is selected from the group consisting of hydrogen, a C3-6 carbocycle, —(CH2)nQ, —(CH2)nCHQR,


—CHQR, —CQ(R)2, and unsubstituted C1-6 alkyl, where Q is selected from a carbocycle, heterocycle, —OR, —O(CH2)nN(R)2, —C(O)OR, —OC(O)R, —CX3, —CX2H, —CXH2, —CN, —N(R)2, —C(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)C(O)N(R)2, —N(R)C(S)N(R)2, —N(R)R8, —N(R)S(O)2R8, —O(CH2)nOR, —N(R)C(═NR9)N(R)2, —N(R)C(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, —N(OR)C(O)R, —N(OR)S(O)2R, —N(OR)C(O)OR, —N(OR)C(O)N(R)2, —N(OR)C(S)N(R)2, —N(OR)C(═NR9)N(R)2, —N(OR)C(═CHR9)N(R)2, —C(═NR9)N(R)2, —C(═NR9)R, —C(O)N(R)OR, and —C(R)N(R)2C(O)OR, and each n is independently selected from 1, 2, 3, 4, and 5;


each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


M and M′ are independently selected from —C(O)O—, —OC(O)—, —OC(O)-M″-C(O)O—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, —S—S—, an aryl group, and a heteroaryl group, in which M″ is a bond, C1-13 alkyl or C2-13 alkenyl;


R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


R8 is selected from the group consisting of C3-6 carbocycle and heterocycle;


R9 is selected from the group consisting of H, CN, NO2, C1-6 alkyl, —OR, —S(O)2R, —S(O)2N(R)2, C2-6 alkenyl, C3-6 carbocycle and heterocycle;


each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;


each R″ is independently selected from the group consisting of C3-15 alkyl and C3-15 alkenyl;


each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl;


each Y is independently a C3-6 carbocycle;


each X is independently selected from the group consisting of F, Cl, Br, and I; and


m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13; and wherein when R4 is —(CH2)nQ, —(CH2)nCHQR, —CHQR, or —CQ(R)2, then (i) Q is not —N(R)2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2.


In certain embodiments, a subset of compounds of Formula (I) includes those of Formula (IA):




embedded image


or its N-oxide, or a salt or isomer thereof, wherein 1 is selected from 1, 2, 3, 4, and 5; m is selected from 5, 6, 7, 8, and 9; M1 is a bond or M′; R4 is hydrogen, unsubstituted C1-3 alkyl, or —(CH2)nQ, in which Q is OH, —NHC(S)N(R)2, —NHC(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)R8, —NHC(═NR9)N(R)2, —NHC(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M′ are independently selected from —C(O)O—, —OC(O)—, —OC(O)-M″-C(O)O—, —C(O)N(R′)—, —P(O)(OR′)O—, —S—S—, an aryl group, and a heteroaryl group,; and R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl. For example, m is 5, 7, or 9. For example, Q is OH, —NHC(S)N(R)2, or —NHC(O)N(R)2. For example, Q is —N(R)C(O)R, or —N(R)S(O)2R. In certain embodiments, a subset of compounds of Formula (I) includes those of Formula (IB):




embedded image


or its N-oxide, or a salt or isomer thereof in which all variables are as defined herein. For example, m is selected from 5, 6, 7, 8, and 9; R4 is hydrogen, unsubstituted C1-3 alkyl, or —(CH2)nQ, in which Q is OH, —NHC(S)N(R)2, —NHC(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)R8, —NHC(═NR9)N(R)2, —NHC(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M′ are independently selected from —C(O)O—, —OC(O)—, —OC(O)-M″-C(O)O—, —C(O)N(R′)—, —P(O)(OR′)O—, —S—S—, an aryl group, and a heteroaryl group; and R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl. For example, m is 5, 7, or 9. For example, Q is OH, —NHC(S)N(R)2, or —NHC(O)N(R)2. For example, Q is —N(R)C(O)R, or —N(R)S(O)2R. In certain embodiments, a subset of compounds of Formula (I) includes those of Formula (II):




embedded image


or its N-oxide, or a salt or isomer thereof, wherein 1 is selected from 1, 2, 3, 4, and 5; M1 is a bond or M′; R4 is hydrogen, unsubstituted C1-3 alkyl, or —(CH2)nQ, in which n is 2, 3, or 4, and Q is OH, —NHC(S)N(R)2, —NHC(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)R8, —NHC(═NR9)N(R)2, —NHC(═CHR9)N(R)2, —OC(O)N(R)2, —N(R)C(O)OR, heteroaryl or heterocycloalkyl; M and M′ are independently selected from —C(O)O—, —OC(O)—, —OC(O)-M″-C(O)O—, —C(O)N(R′)—, —P(O)(OR′)O—, —S—S—, an aryl group, and a heteroaryl group; and R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl.


In one embodiment, the compounds of Formula (I) are of Formula (IIa),




embedded image


or their N-oxides, or salts or isomers thereof, wherein R4 is as described herein.


In another embodiment, the compounds of Formula (I) are of Formula (IIb),




embedded image


or their N-oxides, or salts or isomers thereof, wherein R4 is as described herein.


In another embodiment, the compounds of Formula (I) are of Formula (IIc) or (IIe):




embedded image


or their N-oxides, or salts or isomers thereof, wherein R4 is as described herein.


In another embodiment, the compounds of Formula (I) are of Formula (IIf):




embedded image


or their N-oxides, or salts or isomers thereof,


wherein M is —C(O)O— or —OC(O)—, M″ is C1-6 alkyl or C2-6 alkenyl, R2 and R3 are independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl, and n is selected from 2, 3, and 4.


In a further embodiment, the compounds of Formula (I) are of Formula (IId),




embedded image


or their N-oxides, or salts or isomers thereof, wherein n is 2, 3, or 4; and m, R′, R″, and R2 through R6 are as described herein. For example, each of R2 and R3 may be independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl.


In a further embodiment, the compounds of Formula (I) are of Formula (IIg),




embedded image


or their N-oxides, or salts or isomers thereof, wherein 1 is selected from 1, 2, 3, 4, and 5; m is selected from 5, 6, 7, 8, and 9; M1 is a bond or M′; M and M′ are independently selected from —C(O)O—, —OC(O)—, —OC(O)-M″-C(O)O—, —C(O)N(R′)—, —P(O)(OR′)O—, —S—S—, an aryl group, and a heteroaryl group; and R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl. For example, M″ is C1-6 alkyl (e.g., C1-4 alkyl) or C2-6 alkenyl (e.g. C2-4 alkenyl). For example, R2 and R3 are independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl.


In some embodiments, the ionizable lipids are one or more of the compounds described in U.S. Application Nos. 62/220,091, 62/252,316, 62/253,433, 62/266,460, 62/333,557, 62/382,740, 62/393,940, 62/471,937, 62/471,949, 62/475,140, and 62/475,166, and PCT Application No. PCT/US2016/052352.


In some embodiments, the ionizable lipids are selected from Compounds 1-280 described in U.S. Application No. 62/475,166.


In some embodiments, the ionizable lipid is




embedded image


or a salt thereof.


In some embodiments, the ionizable lipid is




embedded image


or a salt thereof.


In some embodiments, the ionizable lipid is




embedded image


or a salt thereof.


In some embodiments, the ionizable lipid is




embedded image


or a salt thereof. The central amine moiety of a lipid according to Formula (I), (IA), (IB), (II), (IIa), (IIb), (IIc), (IId), (IIe), (IIf), or (IIg) may be protonated at a physiological pH. Thus, a lipid may have a positive or partial positive charge at physiological pH. Such lipids may be referred to as cationic or ionizable (amino)lipids. Lipids may also be zwitterionic, i.e., neutral molecules having both a positive and a negative charge.


In some aspects, the ionizable lipids of the present disclosure may be one or more of compounds of formula (III),




embedded image


or salts or isomers thereof, wherein


W is




embedded image


ring A is




embedded image


t is 1 or 2;


A1 and A2 are each independently selected from CH or N;


Z is CH2 or absent wherein when Z is CH2, the dashed lines (1) and (2) each represent a single bond; and when Z is absent, the dashed lines (1) and (2) are both absent;


R1, R2, R3, R4, and R5 are independently selected from the group consisting of C5-20 alkyl, C5-20 alkenyl, —R″MR′, —R*YR″, —YR″, and —R*OR″;


RX1 and RX2 are each independently H or C1-3 alkyl;


each M is independently selected from the group consisting of —C(O)O—, —OC(O)—, —OC(O)O—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, —C(O)S—, —SC(O)—, an aryl group, and a heteroaryl group;


M* is C1-C6 alkyl,


W1 and W2 are each independently selected from the group consisting of —O— and —N(R6)—;


each R6 is independently selected from the group consisting of H and C1-5 alkyl;


X1, X2, and X3 are independently selected from the group consisting of a bond, —CH2—, —(CH2)2—, —CHR—, —CHY—, —C(O)—, —C(O)O—, —OC(O)—, —(CH2)n—C(O)—, —C(O)—(CH2)n—, —(CH2)n—C(O)O—, —OC(O)—(CH2)n—, —(CH2)n—OC(O)—, —C(O)O—(CH2)n—, —CH(OH)—, —C(S)—, and —CH(SH)—;


each Y is independently a C3-6 carbocycle;


each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl;


each R is independently selected from the group consisting of C1-3 alkyl and a C3-6 carbocycle;


each R′ is independently selected from the group consisting of C1-12 alkyl, C2-12 alkenyl, and H;


each R″ is independently selected from the group consisting of C3-12 alkyl, C3-12 alkenyl and —R*MR′; and


n is an integer from 1-6;


wherein when ring A is




embedded image


then


i) at least one of X1, X2, and X3 is not —CH2—; and/or


ii) at least one of R1, R2, R3, R4, and R5 is —R″MR′.


In some embodiments, the compound is of any of formulae (IIIa1)-(IIIa8):




embedded image


In some embodiments, the ionizable lipids are one or more of the compounds described in U.S. Application Nos. 62/271,146, 62/338,474, 62/413,345, and 62/519,826, and PCT Application No. PCT/US2016/068300.


In some embodiments, the ionizable lipids are selected from Compounds 1-156 described in U.S. Application No. 62/519,826.


In some embodiments, the ionizable lipids are selected from Compounds 1-16, 42-66, 68-76, and 78-156 described in U.S. Application No. 62/519,826.


In some embodiments, the ionizable lipid is




embedded image


or a salt thereof.


The central amine moiety of a lipid according to Formula (III), (IIIa1), (IIIa2), (IIIa3), (IIIa4), (IIIa5), (IIIa6), (IIIa7), or (IIIa8) may be protonated at a physiological pH. Thus, a lipid may have a positive or partial positive charge at physiological pH. Such lipids may be referred to as cationic or ionizable (amino)lipids. Lipids may also be zwitterionic, i.e., neutral molecules having both a positive and a negative charge.


Phospholipids


The lipid composition of the lipid nanoparticle composition disclosed herein can comprise one or more phospholipids, for example, one or more saturated or (poly)unsaturated phospholipids or a combination thereof. In general, phospholipids comprise a phospholipid moiety and one or more fatty acid moieties.


A phospholipid moiety can be selected, for example, from the non-limiting group consisting of phosphatidyl choline, phosphatidyl ethanolamine, phosphatidyl glycerol, phosphatidyl serine, phosphatidic acid, 2-lysophosphatidyl choline, and a sphingomyelin.


A fatty acid moiety can be selected, for example, from the non-limiting group consisting of lauric acid, myristic acid, myristoleic acid, palmitic acid, palmitoleic acid, stearic acid, oleic acid, linoleic acid, alpha-linolenic acid, erucic acid, phytanoic acid, arachidic acid, arachidonic acid, eicosapentaenoic acid, behenic acid, docosapentaenoic acid, and docosahexaenoic acid.


Particular phospholipids can facilitate fusion to a membrane. For example, a cationic phospholipid can interact with one or more negatively charged phospholipids of a membrane (e.g., a cellular or intracellular membrane). Fusion of a phospholipid to a membrane can allow one or more elements (e.g., a therapeutic agent) of a lipid-containing composition (e.g., LNPs) to pass through the membrane permitting, e.g., delivery of the one or more elements to a target tissue.


Non-natural phospholipid species including natural species with modifications and substitutions including branching, oxidation, cyclization, and alkynes are also contemplated. For example, a phospholipid can be functionalized with or cross-linked to one or more alkynes (e.g., an alkenyl group in which one or more double bonds is replaced with a triple bond). Under appropriate reaction conditions, an alkyne group can undergo a copper-catalyzed cycloaddition upon exposure to an azide. Such reactions can be useful in functionalizing a lipid bilayer of a nanoparticle composition to facilitate membrane permeation or cellular recognition or in conjugating a nanoparticle composition to a useful component such as a targeting or imaging moiety (e.g., a dye).


Phospholipids include, but are not limited to, glycerophospholipids such as phosphatidylcholines, phosphatidylethanolamines, phosphatidylserines, phosphatidylinositols, phosphatidy glycerols, and phosphatidic acids. Phospholipids also include phosphosphingolipid, such as sphingomyelin.


In some embodiments, a phospholipid of the invention comprises 1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), 1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC), 1,2-dimyristoyl-sn-glycero-phosphocholine (DMPC), 1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC), 1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC), 1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC), 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC), 1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC), 1-oleoyl-2 cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine (OChemsPC), 1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC), 1,2-dilinolenoyl-sn-glycero-3-phosphocholine,1,2-diarachidonoyl-sn-glycero-3-phosphocholine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine, 1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16.0 PE), 1,2-distearoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinoleoyl-sn-glycero-3-phosphoethanolamine, 1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine, 1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine, 1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine, 1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt (DOPG), sphingomyelin, and mixtures thereof.


In certain embodiments, a phospholipid useful or potentially useful in the present invention is an analog or variant of DSPC. In certain embodiments, a phospholipid useful or potentially useful in the present invention is a compound of Formula (IV):




embedded image


or a salt thereof, wherein:


each R1 is independently optionally substituted alkyl; or optionally two R1 are joined together with the intervening atoms to form optionally substituted monocyclic carbocyclyl or optionally substituted monocyclic heterocyclyl; or optionally three R1 are joined together with the intervening atoms to form optionally substituted bicyclic carbocyclyl or optionally substitute bicyclic heterocyclyl;


n is 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10;


m is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10;


A is of the formula:




embedded image


each instance of L2 is independently a bond or optionally substituted C1-6 alkylene, wherein one methylene unit of the optionally substituted C1-6 alkylene is optionally replaced with O, N(RN), S, C(O), C(O)N(RN), NRNC(O), C(O)O, OC(O), OC(O)O, OC(O)N(RN), NRNC(O)O, or NRNC(O)N(RN);


each instance of R2 is independently optionally substituted C1-30 alkyl, optionally substituted C1-30 alkenyl, or optionally substituted C1-30 alkynyl; optionally wherein one or more methylene units of R2 are independently replaced with optionally substituted carbocyclylene, optionally substituted heterocyclylene, optionally substituted arylene, optionally substituted heteroarylene, N(RN), O, S, C(O), C(O)N(RN), NRNC(O), NRNC(O)N(RN), C(O)O, OC(O), —OC(O)O, OC(O)N(RN), NRNC(O)O, C(O)S, SC(O), C(═NRN), C(═NRN)N(RN), NRNC(═NRN), —NRNC(═NRN)N(RN), C(S), C(S)N(RN), NRNC(S), NRNC(S)N(RN), S(O), OS(O), S(O)O, —OS(O)O, OS(O)2, S(O)2O, OS(O)2O, N(RN)S(O), S(O)N(RN), N(RN)S(O)N(RN), OS(O)N(RN), —N(RN)S(O)O, S(O)2, N(RN)S(O)2, S(O)2N(RN), N(RN)S(O)2N(RN), OS(O)2N(RN), or —N(RN)S(O)2O;


each instance of RN is independently hydrogen, optionally substituted alkyl, or a nitrogen protecting group;


Ring B is optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl; and


p is 1 or 2;


provided that the compound is not of the formula:




embedded image


wherein each instance of R2 is independently unsubstituted alkyl, unsubstituted alkenyl, or unsubstituted alkynyl.


In some embodiments, the phospholipids may be one or more of the phospholipids described in U.S. Application No. 62/520,530.


i) Phospholipid Head Modifications


In certain embodiments, a phospholipid useful or potentially useful in the present invention comprises a modified phospholipid head (e.g., a modified choline group). In certain embodiments, a phospholipid with a modified head is DSPC, or analog thereof, with a modified quaternary amine. For example, in embodiments of Formula (IV), at least one of R1 is not methyl. In certain embodiments, at least one of R1 is not hydrogen or methyl. In certain embodiments, the compound of Formula (IV) is of one of the following formulae:




embedded image


or a salt thereof, wherein:


each t is independently 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10;


each u is independently 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10; and


each v is independently 1, 2, or 3.


In certain embodiments, a compound of Formula (IV) is of Formula (IV-a):




embedded image


or a salt thereof.


In certain embodiments, a phospholipid useful or potentially useful in the present invention comprises a cyclic moiety in place of the glyceride moiety. In certain embodiments, a phospholipid useful in the present invention is DSPC, or analog thereof, with a cyclic moiety in place of the glyceride moiety. In certain embodiments, the compound of Formula (IV) is of Formula (IV-b):




embedded image


or a salt thereof.


(ii) Phospholipid Tail Modifications


In certain embodiments, a phospholipid useful or potentially useful in the present invention comprises a modified tail. In certain embodiments, a phospholipid useful or potentially useful in the present invention is DSPC, or analog thereof, with a modified tail. As described herein, a “modified tail” may be a tail with shorter or longer aliphatic chains, aliphatic chains with branching introduced, aliphatic chains with substituents introduced, aliphatic chains wherein one or more methylenes are replaced by cyclic or heteroatom groups, or any combination thereof. For example, in certain embodiments, the compound of (IV) is of Formula (IV-a), or a salt thereof, wherein at least one instance of R2 is each instance of R2 is optionally substituted C1-30 alkyl, wherein one or more methylene units of R2 are independently replaced with optionally substituted carbocyclylene, optionally substituted heterocyclylene, optionally substituted arylene, optionally substituted heteroarylene, N(RN), O, S, C(O), C(O)N(RN), NRNC(O), NRNC(O)N(RN), C(O)O, OC(O), OC(O)O, OC(O)N(RN), NRNC(O)O, C(O)S, SC(O), C(═NRN), C(═NRN)N(RN), NRNC(═NRN), NRNC(═NRN)N(RN), C(S), C(S)N(RN), NRNC(S), NRNC(S)N(RN), S(O), OS(O), S(O)O, OS(O)O, OS(O)2, S(O)2O, OS(O)2O, N(RN)S(O), S(O)N(RN), N(RN)S(O)N(RN), —OS(O)N(RN), N(RN)S(O)O, S(O)2, N(RN)S(O)2, S(O)2N(RN), N(RN)S(O)2N(RN), OS(O)2N(RN), or N(RN)S(O)2O.


In certain embodiments, the compound of Formula (IV) is of Formula (IV-c):




embedded image


or a salt thereof, wherein:


each x is independently an integer between 0-30, inclusive; and


each instance is G is independently selected from the group consisting of optionally substituted carbocyclylene, optionally substituted heterocyclylene, optionally substituted arylene, optionally substituted heteroarylene, N(RN), O, S, C(O), C(O)N(RN), NRNC(O), NRNC(O)N(RN), C(O)O, OC(O), OC(O)O, OC(O)N(RN), NRNC(O)O, C(O)S, SC(O), C(═NRN), C(═NRN)N(RN), NRNC(═NRN), NRNC(═NRN)N(RN), C(S), C(S)N(RN), NRNC(S), NRNC(S)N(RN), S(O), OS(O), S(O)O, OS(O)O, OS(O)2, S(O)2O, OS(O)2O, N(RN)S(O), S(O)N(RN), N(RN)S(O)N(RN), —OS(O)N(RN), N(RN)S(O)O, S(O)2, N(RN)S(O)2, S(O)2N(RN), N(RN)S(O)2N(RN), OS(O)2N(RN), or N(RN)S(O)2O. Each possibility represents a separate embodiment of the present invention. In certain embodiments, a phospholipid useful or potentially useful in the present invention comprises a modified phosphocholine moiety, wherein the alkyl chain linking the quaternary amine to the phosphoryl group is not ethylene (e.g., n is not 2). Therefore, in certain embodiments, a phospholipid useful or potentially useful in the present invention is a compound of Formula (IV), wherein n is 1, 3, 4, 5, 6, 7, 8, 9, or 10. For example, in certain embodiments, a compound of Formula (IV) is of one of the following formulae:




embedded image


or a salt thereof.


Alternative Lipids


In certain embodiments, an alternative lipid is used in place of a phospholipid of the present disclosure.


In certain embodiments, an alternative lipid of the invention is oleic acid. In certain embodiments, the alternative lipid is one of the following:




embedded image


Structural Lipids


The lipid composition of a pharmaceutical composition disclosed herein can comprise one or more structural lipids. As used herein, the term “structural lipid” refers to sterols and also to lipids containing sterol moieties.


Incorporation of structural lipids in the lipid nanoparticle may help mitigate aggregation of other lipids in the particle. Structural lipids can be selected from the group including but not limited to, cholesterol, fecosterol, sitosterol, ergosterol, campesterol, stigmasterol, brassicasterol, tomatidine, tomatine, ursolic acid, alpha-tocopherol, hopanoids, phytosterols, steroids, and mixtures thereof In some embodiments, the structural lipid is a sterol. As defined herein, “sterols” are a subgroup of steroids consisting of steroid alcohols. In certain embodiments, the structural lipid is a steroid. In certain embodiments, the structural lipid is cholesterol. In certain embodiments, the structural lipid is an analog of cholesterol. In certain embodiments, the structural lipid is alpha-tocopherol.


In some embodiments, the structural lipids may be one or more of the structural lipids described in U.S. Application No. 62/520,530.


Polyethylene Glycol (PEG)-Lipids


The lipid composition of a pharmaceutical composition disclosed herein can comprise one or more a polyethylene glycol (PEG) lipid.


As used herein, the term “PEG-lipid” refers to polyethylene glycol (PEG)-modified lipids. Non-limiting examples of PEG-lipids include PEG-modified phosphatidylethanolamine and phosphatidic acid, PEG-ceramide conjugates (e.g., PEG-CerC14 or PEG-CerC20), PEG-modified dialkylamines and PEG-modified 1,2-diacyloxypropan-3-amines. Such lipids are also referred to as PEGylated lipids. For example, a PEG lipid can be PEG-c-DOMG, PEG-DMG, PEG-DLPE, PEG-DMPE, PEG-DPPC, or a PEG-DSPE lipid.


In some embodiments, the PEG-lipid includes, but not limited to 1,2-dimyristoyl-sn-glycerol methoxypolyethylene glycol (PEG-DMG), 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol)] (PEG-DSPE), PEG-disteryl glycerol (PEG-DSG), PEG-dipalmetoleyl, PEG-dioleyl, PEG-distearyl, PEG-diacylglycamide (PEG-DAG), PEG-dipalmitoyl phosphatidylethanolamine (PEG-DPPE), or PEG-1,2-dimyristyloxlpropyl-3-amine (PEG-c-DMA).


In one embodiment, the PEG-lipid is selected from the group consisting of a PEG-modified phosphatidylethanolamine, a PEG-modified phosphatidic acid, a PEG-modified ceramide, a PEG-modified dialkylamine, a PEG-modified diacylglycerol, a PEG-modified dialkylglycerol, and mixtures thereof.


In some embodiments, the lipid moiety of the PEG-lipids includes those having lengths of from about C14 to about C22, preferably from about C14 to about C16. In some embodiments, a PEG moiety, for example an mPEG-NH2, has a size of about 1000, 2000, 5000, 10,000, 15,000 or 20,000 daltons. In one embodiment, the PEG-lipid is PEG2k-DMG.


In one embodiment, the lipid nanoparticles described herein can comprise a PEG lipid which is a non-diffusible PEG. Non-limiting examples of non-diffusible PEGs include PEG-DSG and PEG-DSPE.


PEG-lipids are known in the art, such as those described in U.S. Pat. No. 8,158,601 and International Publ. No. WO 2015/130584 A2, which are incorporated herein by reference in their entirety.


In general, some of the other lipid components (e.g., PEG lipids) of various formulae, described herein may be synthesized as described International Patent Application No. PCT/US2016/000129, filed Dec. 10, 2016, entitled “Compositions and Methods for Delivery of Therapeutic Agents,” which is incorporated by reference in its entirety.


The lipid component of a lipid nanoparticle composition may include one or more molecules comprising polyethylene glycol, such as PEG or PEG-modified lipids. Such species may be alternately referred to as PEGylated lipids. A PEG lipid is a lipid modified with polyethylene glycol. A PEG lipid may be selected from the non-limiting group including PEG-modified phosphatidylethanolamines, PEG-modified phosphatidic acids, PEG-modified ceramides, PEG-modified dialkylamines, PEG-modified diacylglycerols, PEG-modified dialkylglycerols, and mixtures thereof. For example, a PEG lipid may be PEG-c-DOMG, PEG-DMG, PEG-DLPE, PEG-DMPE, PEG-DPPC, or a PEG-DSPE lipid.


In some embodiments the PEG-modified lipids are a modified form of PEG DMG. PEG-DMG has the following structure:




embedded image


In one embodiment, PEG lipids useful in the present invention can be PEGylated lipids described in International Publication No. WO2012099755, the contents of which is herein incorporated by reference in its entirety. Any of these exemplary PEG lipids described herein may be modified to comprise a hydroxyl group on the PEG chain. In certain embodiments, the PEG lipid is a PEG-OH lipid. As generally defined herein, a “PEG-OH lipid” (also referred to herein as “hydroxy-PEGylated lipid”) is a PEGylated lipid having one or more hydroxyl (—OH) groups on the lipid. In certain embodiments, the PEG-OH lipid includes one or more hydroxyl groups on the PEG chain. In certain embodiments, a PEG-OH or hydroxy-PEGylated lipid comprises an —OH group at the terminus of the PEG chain. Each possibility represents a separate embodiment of the present invention.


In certain embodiments, a PEG lipid useful in the present invention is a compound of Formula (V). Provided herein are compounds of Formula (V):




embedded image


or salts thereof, wherein:


R3 is —ORO;


RO is hydrogen, optionally substituted alkyl, or an oxygen protecting group;


r is an integer between 1 and 100, inclusive;


L1 is optionally substituted C1-10 alkylene, wherein at least one methylene of the optionally substituted C1-10 alkylene is independently replaced with optionally substituted carbocyclylene, optionally substituted heterocyclylene, optionally substituted arylene, optionally substituted heteroarylene, O, N(RN), S, C(O), C(O)N(RN), NRNC(O), C(O)O, OC(O), OC(O)O, —OC(O)N(RN), NRNC(O)O, or NRNC(O)N(RN);


D is a moiety obtained by click chemistry or a moiety cleavable under physiological conditions;


m is 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10;


A is of the formula:




embedded image


each instance of L2 is independently a bond or optionally substituted C1-6 alkylene, wherein one methylene unit of the optionally substituted C1-6 alkylene is optionally replaced with O, N(RN), S, C(O), C(O)N(RN), NRNC(O), C(O)O, OC(O), OC(O)O, OC(O)N(RN), NRNC(O)O, or NRNC(O)N(RN);


each instance of R2 is independently optionally substituted C1-30 alkyl, optionally substituted C1-30 alkenyl, or optionally substituted C1-30 alkynyl; optionally wherein one or more methylene units of R2 are independently replaced with optionally substituted carbocyclylene, optionally substituted heterocyclylene, optionally substituted arylene, optionally substituted heteroarylene, N(RN), O, S, C(O), C(O)N(RN), NRNC(O), NRNC(O)N(RN), C(O)O, OC(O), —OC(O)O, OC(O)N(RN), NRNC(O)O, C(O)S, SC(O), C(═NRN), C(═NRN)N(RN), NRNC(═NRN), —NRNC(═NRN)N(RN), C(S), C(S)N(RN), NRNC(S), NRNC(S)N(RN), S(O), OS(O), S(O)O, —OS(O)O, OS(O)2, S(O)2O, OS(O)2O, N(RN)S(O), S(O)N(RN), N(RN)S(O)N(RN), OS(O)N(RN), —N(RN)S(O)O, S(O)2, N(RN)S(O)2, S(O)2N(RN), N(RN)S(O)2N(RN), OS(O)2N(RN), or —N(RN)S(O)2O;


each instance of RN is independently hydrogen, optionally substituted alkyl, or a nitrogen protecting group;


Ring B is optionally substituted carbocyclyl, optionally substituted heterocyclyl, optionally substituted aryl, or optionally substituted heteroaryl; and


p is 1 or 2.


In certain embodiments, the compound of Fomula (V) is a PEG-OH lipid (i.e., R3 is —ORO, and RO is hydrogen). In certain embodiments, the compound of Formula (V) is of Formula (V-OH):




embedded image


or a salt thereof.


In certain embodiments, a PEG lipid useful in the present invention is a PEGylated fatty acid. In certain embodiments, a PEG lipid useful in the present invention is a compound of Formula (VI). Provided herein are compounds of Formula (VI):




embedded image


or a salts thereof, wherein:


R3 is —ORO;


RO is hydrogen, optionally substituted alkyl or an oxygen protecting group;


r is an integer between 1 and 100, inclusive;


R5 is optionally substituted C10-40 alkyl, optionally substituted C10-40 alkenyl, or optionally substituted C10-40 alkynyl; and optionally one or more methylene groups of R5 are replaced with optionally substituted carbocyclylene, optionally substituted heterocyclylene, optionally substituted arylene, optionally substituted heteroarylene, N(RN), O, S, C(O), C(O)N(RN), —NRNC(O), NRNC(O)N(RN), C(O)O, OC(O), OC(O)O, OC(O)N(RN), NRNC(O)O, C(O)S, SC(O), C(═NRN), C(═NRN)N(RN), NRNC(═NRN), NRNC(═NRN)N(RN), C(S), C(S)N(RN), NRNC(S), —NRNC(S)N(RN), S(O), OS(O), S(O)O, OS(O)O, OS(O)2, S(O)2O, OS(O)2O, N(RN)S(O), —S(O)N(RN), N(RN)S(O)N(RN), OS(O)N(RN), N(RN)S(O)O, S(O)2, N(RN)S(O)2, S(O)2N(RN), —N(RN)S(O)2N(RN), OS(O)2N(RN), or N(RN)S(O)2O; and


each instance of RN is independently hydrogen, optionally substituted alkyl, or a nitrogen protecting group.


In certain embodiments, the compound of Formula (VI) is of Formula (VI-OH):




embedded image


or a salt thereof. In some embodiments, r is 45.


In yet other embodiments the compound of Formula (VI) is:




embedded image


or a salt thereof.


In one embodiment, the compound of Formula (VI) is




embedded image


In some aspects, the lipid composition of the pharmaceutical compositions disclosed herein does not comprise a PEG-lipid.


In some embodiments, the PEG-lipids may be one or more of the PEG lipids described in U.S. Application No. 62/520,530.


In some embodiments, a PEG lipid of the invention comprises a PEG-modified phosphatidylethanolamine, a PEG-modified phosphatidic acid, a PEG-modified ceramide, a PEG-modified dialkylamine, a PEG-modified diacylglycerol, a PEG-modified dialkylglycerol, and mixtures thereof In some embodiments, the PEG-modified lipid is PEG-DMG, PEG-c-DOMG (also referred to as PEG-DOMG), PEG-DSG and/or PEG-DPG. In some embodiments, a LNP of the invention comprises an ionizable cationic lipid of any of Formula I, II or III, a phospholipid comprising DSPC, a structural lipid, and a PEG lipid comprising PEG-DMG.


In some embodiments, a LNP of the invention comprises an ionizable cationic lipid of any of Formula I, II or III, a phospholipid comprising DSPC, a structural lipid, and a PEG lipid comprising a compound having Formula VI.


In some embodiments, a LNP of the invention comprises an ionizable cationic lipid of Formula I, II or III, a phospholipid comprising a compound having Formula IV, a structural lipid, and the PEG lipid comprising a compound having Formula V or VI.


In some embodiments, a LNP of the invention comprises an ionizable cationic lipid of Formula I, II or III, a phospholipid comprising a compound having Formula IV, a structural lipid, and the PEG lipid comprising a compound having Formula V or VI.


In some embodiments, a LNP of the invention comprises an ionizable cationic lipid of Formula I, II or III, a phospholipid having Formula IV, a structural lipid, and a PEG lipid comprising a compound having Formula VI.


In some embodiments, a LNP of the invention comprises an ionizable cationic lipid of




embedded image


and a PEG lipid comprising Formula VI.


In some embodiments, a LNP of the invention comprises an ionizable cationic lipid of




embedded image


and an alternative lipid comprising oleic acid.


In some embodiments, a LNP of the invention comprises an ionizable cationic lipid of




embedded image


an alternative lipid comprising oleic acid, a structural lipid comprising cholesterol, and a PEG lipid comprising a compound having Formula VI.


In some embodiments, a LNP of the invention comprises an ionizable cationic lipid of




embedded image


a phospholipid comprising DOPE, a structural lipid comprising cholesterol, and a PEG lipid comprising a compound having Formula VI.


In some embodiments, a LNP of the invention comprises an N:P ratio of from about 2:1 to about 30:1.


In some embodiments, a LNP of the invention comprises an N:P ratio of about 6:1.


In some embodiments, a LNP of the invention comprises an N:P ratio of about 3:1.


In some embodiments, a LNP of the invention comprises a wt/wt ratio of the ionizable cationic lipid component to the RNA of from about 10:1 to about 100:1.


In some embodiments, a LNP of the invention comprises a wt/wt ratio of the ionizable cationic lipid component to the RNA of about 20:1.


In some embodiments, a LNP of the invention comprises a wt/wt ratio of the ionizable cationic lipid component to the RNA of about 10:1.


In some embodiments, a LNP of the invention has a mean diameter from about 50 nm to about 150 nm.


In some embodiments, a LNP of the invention has a mean diameter from about 70 nm to about 120 nm.


As used herein, the term “alkyl”, “alkyl group”, or “alkylene” means a linear or branched, saturated hydrocarbon including one or more carbon atoms (e.g., one, two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, or more carbon atoms), which is optionally substituted. The notation “C1-14 alkyl” means an optionally substituted linear or branched, saturated hydrocarbon including 1-14 carbon atoms. Unless otherwise specified, an alkyl group described herein refers to both unsubstituted and substituted alkyl groups.


As used herein, the term “alkenyl”, “alkenyl group”, or “alkenylene” means a linear or branched hydrocarbon including two or more carbon atoms (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, or more carbon atoms) and at least one double bond, which is optionally substituted. The notation “C2-14 alkenyl” means an optionally substituted linear or branched hydrocarbon including 2-14 carbon atoms and at least one carbon-carbon double bond. An alkenyl group may include one, two, three, four, or more carbon-carbon double bonds. For example, C18 alkenyl may include one or more double bonds. A C18 alkenyl group including two double bonds may be a linoleyl group. Unless otherwise specified, an alkenyl group described herein refers to both unsubstituted and substituted alkenyl groups.


As used herein, the term “alkynyl”, “alkynyl group”, or “alkynylene” means a linear or branched hydrocarbon including two or more carbon atoms (e.g., two, three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, twenty, or more carbon atoms) and at least one carbon-carbon triple bond, which is optionally substituted. The notation “C2-14 alkynyl” means an optionally substituted linear or branched hydrocarbon including 2-14 carbon atoms and at least one carbon-carbon triple bond. An alkynyl group may include one, two, three, four, or more carbon-carbon triple bonds. For example, C18 alkynyl may include one or more carbon-carbon triple bonds. Unless otherwise specified, an alkynyl group described herein refers to both unsubstituted and substituted alkynyl groups.


As used herein, the term “carbocycle” or “carbocyclic group” means an optionally substituted mono- or multi-cyclic system including one or more rings of carbon atoms. Rings may be three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, fourteen, fifteen, sixteen, seventeen, eighteen, nineteen, or twenty membered rings. The notation “C3-6 carbocycle” means a carbocycle including a single ring having 3-6 carbon atoms. Carbocycles may include one or more carbon-carbon double or triple bonds and may be non-aromatic or aromatic (e.g., cycloalkyl or aryl groups). Examples of carbocycles include cyclopropyl, cyclopentyl, cyclohexyl, phenyl, naphthyl, and 1,2-dihydronaphthyl groups. The term “cycloalkyl” as used herein means a non-aromatic carbocycle and may or may not include any double or triple bond. Unless otherwise specified, carbocycles described herein refers to both unsubstituted and substituted carbocycle groups, i.e., optionally substituted carbocycles.


As used herein, the term “heterocycle” or “heterocyclic group” means an optionally substituted mono- or multi-cyclic system including one or more rings, where at least one ring includes at least one heteroatom. Heteroatoms may be, for example, nitrogen, oxygen, or sulfur atoms. Rings may be three, four, five, six, seven, eight, nine, ten, eleven, twelve, thirteen, or fourteen membered rings. Heterocycles may include one or more double or triple bonds and may be non-aromatic or aromatic (e.g., heterocycloalkyl or heteroaryl groups). Examples of heterocycles include imidazolyl, imidazolidinyl, oxazolyl, oxazolidinyl, thiazolyl, thiazolidinyl, pyrazolidinyl, pyrazolyl, isoxazolidinyl, isoxazolyl, isothiazolidinyl, isothiazolyl, morpholinyl, pyrrolyl, pyrrolidinyl, furyl, tetrahydrofuryl, thiophenyl, pyridinyl, piperidinyl, quinolyl, and isoquinolyl groups. The term “heterocycloalkyl” as used herein means a non-aromatic heterocycle and may or may not include any double or triple bond. Unless otherwise specified, heterocycles described herein refers to both unsubstituted and substituted heterocycle groups, i.e., optionally substituted heterocycles.


As used herein, the term “heteroalkyl”, “heteroalkenyl”, or “heteroalkynyl”, refers respectively to an alkyl, alkenyl, alkynyl group, as defined herein, which further comprises one or more (e.g., 1, 2, 3, or 4) heteroatoms (e.g., oxygen, sulfur, nitrogen, boron, silicon, phosphorus) wherein the one or more heteroatoms is inserted between adjacent carbon atoms within the parent carbon chain and/or one or more heteroatoms is inserted between a carbon atom and the parent molecule, i.e., between the point of attachment. Unless otherwise specified, heteroalkyls, heteroalkenyls, or heteroalkynyls described herein refers to both unsubstituted and substituted heteroalkyls, heteroalkenyls, or heteroalkynyls, i.e., optionally substituted heteroalkyls, heteroalkenyls, or heteroalkynyls.


As used herein, a “biodegradable group” is a group that may facilitate faster metabolism of a lipid in a mammalian entity. A biodegradable group may be selected from the group consisting of, but is not limited to, —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, an aryl group, and a heteroaryl group. As used herein, an “aryl group” is an optionally substituted carbocyclic group including one or more aromatic rings. Examples of aryl groups include phenyl and naphthyl groups. As used herein, a “heteroaryl group” is an optionally substituted heterocyclic group including one or more aromatic rings. Examples of heteroaryl groups include pyrrolyl, furyl, thiophenyl, imidazolyl, oxazolyl, and thiazolyl. Both aryl and heteroaryl groups may be optionally substituted. For example, M and M′ can be selected from the non-limiting group consisting of optionally substituted phenyl, oxazole, and thiazole. In the formulas herein, M and M′ can be independently selected from the list of biodegradable groups above. Unless otherwise specified, aryl or heteroaryl groups described herein refers to both unsubstituted and substituted groups, i.e., optionally substituted aryl or heteroaryl groups.


Alkyl, alkenyl, and cyclyl (e.g., carbocyclyl and heterocyclyl) groups may be optionally substituted unless otherwise specified. Optional substituents may be selected from the group consisting of, but are not limited to, a halogen atom (e.g., a chloride, bromide, fluoride, or iodide group), a carboxylic acid (e.g., —C(O)OH), an alcohol (e.g., a hydroxyl, —OH), an ester (e.g., —C(O)OR —OC(O)R), an aldehyde (e.g., —C(O)H), a carbonyl (e.g., —C(O)R, alternatively represented by C═O), an acyl halide (e.g., —C(O)X, in which X is a halide selected from bromide, fluoride, chloride, and iodide), a carbonate (e.g., —OC(O)OR), an alkoxy (e.g., —OR), an acetal (e.g., —C(OR)2R″″, in which each OR are alkoxy groups that can be the same or different and R″″ is an alkyl or alkenyl group), a phosphate (e.g., P(O)43—), a thiol (e.g., —SH), a sulfoxide (e.g., —S(O)R), a sulfinic acid (e.g., —S(O)OH), a sulfonic acid (e.g., —S(O)20H), a thial (e.g., —C(S)H), a sulfate (e.g., S(O)42—), a sulfonyl (e.g., —S(O)2—), an amide (e.g., —C(O)NR2, or —N(R)C(O)R), an azido (e.g., —N3), a nitro (e.g., —NO2), a cyano (e.g., —CN), an isocyano (e.g., —NC), an acyloxy (e.g., —OC(O)R), an amino (e.g., —NR2, —NRH, or —NH2), a carbamoyl (e.g., —OC(O)NR2, —OC(O)NRH, or —OC(O)NH2), a sulfonamide (e.g., —S(O)2NR2, —S(O)2NRH, —S(O)2NH2, —N(R)S(O)2R, —N(H)S(O)2R, —N(R)S(O)2H, or —N(H)S(O)2H), an alkyl group, an alkenyl group, and a cyclyl (e.g., carbocyclyl or heterocyclyl) group. In any of the preceding, R is an alkyl or alkenyl group, as defined herein.


In some embodiments, the substituent groups themselves may be further substituted with, for example, one, two, three, four, five, or six substituents as defined herein. For example, a C1-6 alkyl group may be further substituted with one, two, three, four, five, or six substituents as described herein.


Compounds of the disclosure that contain nitrogens can be converted to N-oxides by treatment with an oxidizing agent (e.g., 3-chloroperoxybenzoic acid (mCPBA) and/or hydrogen peroxides) to afford other compounds of the disclosure. Thus, all shown and claimed nitrogen-containing compounds are considered, when allowed by valency and structure, to include both the compound as shown and its N-oxide derivative (which can be designated as N+O or N+—O—). Furthermore, in other instances, the nitrogens in the compounds of the disclosure can be converted to N-hydroxy or N-alkoxy compounds. For example, N-hydroxy compounds can be prepared by oxidation of the parent amine by an oxidizing agent such as m-CPBA. All shown and claimed nitrogen-containing compounds are also considered, when allowed by valency and structure, to cover both the compound as shown and its N-hydroxy (i.e., N—OH) and N-alkoxy (i.e., N—OR, wherein R is substituted or unsubstituted C1-C6 alkyl, C1-C6 alkenyl, C1-C6 alkynyl, 3-14-membered carbocycle or 3-14-membered heterocycle) derivatives. About, Approximately: As used herein, the terms “approximately” and “about,” as applied to one or more values of interest, refer to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” or “about” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value). For example, when used in the context of an amount of a given compound in a lipid component of a nanoparticle composition, “about” may mean +/−10% of the recited value. For instance, a nanoparticle composition including a lipid component having about 40% of a given compound may include 30-50% of the compound. As used herein, the term “compound,” is meant to include all isomers and isotopes of the structure depicted. “Isotopes” refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei. For example, isotopes of hydrogen include tritium and deuterium. Further, a compound, salt, or complex of the present disclosure can be prepared in combination with solvent or water molecules to form solvates and hydrates by routine methods.


g. Nanoparticle Compositions


The lipid composition of a pharmaceutical composition disclosed herein can include one or more components in addition to those described above. For example, the lipid composition can include one or more permeability enhancer molecules, carbohydrates, polymers, surface altering agents (e.g., surfactants), or other components. For example, a permeability enhancer molecule can be a molecule described by U.S. Patent Application Publication No. 2005/0222064. Carbohydrates can include simple sugars (e.g., glucose) and polysaccharides (e.g., glycogen and derivatives and analogs thereof).


A polymer can be included in and/or used to encapsulate or partially encapsulate a pharmaceutical composition disclosed herein (e.g., a pharmaceutical composition in lipid nanoparticle form). A polymer can be biodegradable and/or biocompatible. A polymer can be selected from, but is not limited to, polyamines, polyethers, polyamides, polyesters, polycarbamates, polyureas, polycarbonates, polystyrenes, polyimides, polysulfones, polyurethanes, polyacetylenes, polyethylenes, polyethyleneimines, polyisocyanates, polyacrylates, polymethacrylates, polyacrylonitriles, and polyarylates.


The ratio between the lipid composition and the polynucleotide range can be from about 10:1 to about 60:1 (wt/wt).


In some embodiments, the ratio between the lipid composition and the polynucleotide can be about 10:1, 11:1, 12:1, 13:1, 14:1, 15:1, 16:1, 17:1, 18:1, 19:1, 20:1, 21:1, 22:1, 23:1, 24:1, 25:1, 26:1, 27:1, 28:1, 29:1, 30:1, 31:1, 32:1, 33:1, 34:1, 35:1, 36:1, 37:1, 38:1, 39:1, 40:1, 41:1, 42:1, 43:1, 44:1, 45:1, 46:1, 47:1, 48:1, 49:1, 50:1, 51:1, 52:1, 53:1, 54:1, 55:1, 56:1, 57:1, 58:1, 59:1 or 60:1 (wt/wt). In some embodiments, the wt/wt ratio of the lipid composition to the polynucleotide encoding a therapeutic agent is about 20:1 or about 15:1.


In one embodiment, the lipid nanoparticles described herein can comprise polynucleotides (e.g., mRNA) in a lipid:polynucleotide weight ratio of 5:1, 10:1, 15:1, 20:1, 25:1, 30:1, 35:1, 40:1, 45:1, 50:1, 55:1, 60:1 or 70:1, or a range or any of these ratios such as, but not limited to, 5:1 to about 10:1, from about 5:1 to about 15:1, from about 5:1 to about 20:1, from about 5:1 to about 25:1, from about 5:1 to about 30:1, from about 5:1 to about 35:1, from about 5:1 to about 40:1, from about 5:1 to about 45:1, from about 5:1 to about 50:1, from about 5:1 to about 55:1, from about 5:1 to about 60:1, from about 5:1 to about 70:1, from about 10:1 to about 15:1, from about 10:1 to about 20:1, from about 10:1 to about 25:1, from about 10:1 to about 30:1, from about 10:1 to about 35:1, from about 10:1 to about 40:1, from about 10:1 to about 45:1, from about 10:1 to about 50:1, from about 10:1 to about 55:1, from about 10:1 to about 60:1, from about 10:1 to about 70:1, from about 15:1 to about 20:1, from about 15:1 to about 25:1,from about 15:1 to about 30:1, from about 15:1 to about 35:1, from about 15:1 to about 40:1, from about 15:1 to about 45:1, from about 15:1 to about 50:1, from about 15:1 to about 55:1, from about 15:1 to about 60:1 or from about 15:1 to about 70:1.


In one embodiment, the lipid nanoparticles described herein can comprise the polynucleotide in a concentration from approximately 0.1 mg/ml to 2 mg/ml such as, but not limited to, 0.1 mg/ml, 0.2 mg/ml, 0.3 mg/ml, 0.4 mg/ml, 0.5 mg/ml, 0.6 mg/ml, 0.7 mg/ml, 0.8 mg/ml, 0.9 mg/ml, 1.0 mg/ml, 1.1 mg/ml, 1.2 mg/ml, 1.3 mg/ml, 1.4 mg/ml, 1.5 mg/ml, 1.6 mg/ml, 1.7 mg/ml, 1.8 mg/ml, 1.9 mg/ml, 2.0 mg/ml or greater than 2.0 mg/ml.


In some embodiments, the pharmaceutical compositions disclosed herein are formulated as lipid nanoparticles (LNP). Accordingly, the present disclosure also provides nanoparticle compositions comprising (i) a lipid composition comprising a delivery agent such as a compound of Formula (I) or (III) as described herein, and (ii) a polynucleotide encoding a Factor VIII polypeptide. In such nanoparticle composition, the lipid composition disclosed herein can encapsulate the polynucleotide encoding a Factor VIII polypeptide.


Nanoparticle compositions are typically sized on the order of micrometers or smaller and can include a lipid bilayer. Nanoparticle compositions encompass lipid nanoparticles (LNPs), liposomes (e.g., lipid vesicles), and lipoplexes. For example, a nanoparticle composition can be a liposome having a lipid bilayer with a diameter of 500 nm or less.


Nanoparticle compositions include, for example, lipid nanoparticles (LNPs), liposomes, and lipoplexes. In some embodiments, nanoparticle compositions are vesicles including one or more lipid bilayers. In certain embodiments, a nanoparticle composition includes two or more concentric bilayers separated by aqueous compartments. Lipid bilayers can be functionalized and/or crosslinked to one another. Lipid bilayers can include one or more ligands, proteins, or channels.


In one embodiment, a lipid nanoparticle comprises an ionizable lipid, a structural lipid, a phospholipid, and mRNA. In some embodiments, the LNP comprises an ionizable lipid, a PEG-modified lipid, a phospholipid and a structural lipid. In some embodiments, the LNP has a molar ratio of about 20-60% ionizable lipid: about 5-25% phospholipid: about 25-55% structural lipid; and about 0.5-15% PEG-modified lipid. In some embodiments, the LNP comprises a molar ratio of about 50% ionizable lipid, about 1.5% PEG-modified lipid, about 38.5% structural lipid and about 10% phospholipid. In some embodiments, the LNP comprises a molar ratio of about 55% ionizable lipid, about 2.5% PEG lipid, about 32.5% structural lipid and about 10% phospholipid. In some embodiments, the ionizable lipid is an ionizable amino lipid and the phospholipid is a neutral lipid, and the structural lipid is a cholesterol.


In some embodiments, the LNP has a polydispersity value of less than 0.4. In some embodiments, the LNP has a net neutral charge at a neutral pH. In some embodiments, the LNP has a mean diameter of 50-150 nm. In some embodiments, the LNP has a mean diameter of 80-100 nm.


As generally defined herein, the term “lipid” refers to a small molecule that has hydrophobic or amphiphilic properties. Lipids may be naturally occurring or synthetic. Examples of classes of lipids include, but are not limited to, fats, waxes, sterol-containing metabolites, vitamins, fatty acids, glycerolipids, glycerophospholipids, sphingolipids, saccharolipids, and polyketides, and prenol lipids. In some instances, the amphiphilic properties of some lipids leads them to form liposomes, vesicles, or membranes in aqueous media.


In some embodiments, a lipid nanoparticle (LNP) may comprise an ionizable lipid. As used herein, the term “ionizable lipid” has its ordinary meaning in the art and may refer to a lipid comprising one or more charged moieties. In some embodiments, an ionizable lipid may be positively charged or negatively charged. An ionizable lipid may be positively charged, in which case it can be referred to as “cationic lipid”. In certain embodiments, an ionizable lipid molecule may comprise an amine group, and can be referred to as an ionizable amino lipids. As used herein, a “charged moiety” is a chemical moiety that carries a formal electronic charge, e.g., monovalent (+1, or −1), divalent (+2, or −2), trivalent (+3, or −3), etc. The charged moiety may be anionic (i.e., negatively charged) or cationic (i.e., positively charged). Examples of positively-charged moieties include amine groups (e.g., primary, secondary, and/or tertiary amines), ammonium groups, pyridinium group, guanidine groups, and imidizolium groups. In a particular embodiment, the charged moieties comprise amine groups. Examples of negatively-charged groups or precursors thereof, include carboxylate groups, sulfonate groups, sulfate groups, phosphonate groups, phosphate groups, hydroxyl groups, and the like. The charge of the charged moiety may vary, in some cases, with the environmental conditions, for example, changes in pH may alter the charge of the moiety, and/or cause the moiety to become charged or uncharged. In general, the charge density of the molecule may be selected as desired.


It should be understood that the terms “charged” or “charged moiety” does not refer to a “partial negative charge” or “partial positive charge” on a molecule. The terms “partial negative charge” and “partial positive charge” are given its ordinary meaning in the art. A “partial negative charge” may result when a functional group comprises a bond that becomes polarized such that electron density is pulled toward one atom of the bond, creating a partial negative charge on the atom. Those of ordinary skill in the art will, in general, recognize bonds that can become polarized in this way.


In some embodiments, the ionizable lipid is an ionizable amino lipid, sometimes referred to in the art as an “ionizable cationic lipid”. In one embodiment, the ionizable amino lipid may have a positively charged hydrophilic head and a hydrophobic tail that are connected via a linker structure.


In addition to these, an ionizable lipid may also be a lipid including a cyclic amine group.


In one embodiment, the ionizable lipid may be selected from, but not limited to, a ionizable lipid described in International Publication Nos. WO2013086354 and WO2013116126; the contents of each of which are herein incorporated by reference in their entirety.


In yet another embodiment, the ionizable lipid may be selected from, but not limited to, formula CLI-CLXXXXII of U.S. Pat. No. 7,404,969; each of which is herein incorporated by reference in their entirety.


In one embodiment, the lipid may be a cleavable lipid such as those described in International Publication No. WO2012170889, herein incorporated by reference in its entirety. In one embodiment, the lipid may be synthesized by methods known in the art and/or as described in International Publication Nos. WO2013086354; the contents of each of which are herein incorporated by reference in their entirety.


Nanoparticle compositions can be characterized by a variety of methods. For example, microscopy (e.g., transmission electron microscopy or scanning electron microscopy) can be used to examine the morphology and size distribution of a nanoparticle composition. Dynamic light scattering or potentiometry (e.g., potentiometric titrations) can be used to measure zeta potentials. Dynamic light scattering can also be utilized to determine particle sizes. Instruments such as the Zetasizer Nano ZS (Malvern Instruments Ltd, Malvern, Worcestershire, UK) can also be used to measure multiple characteristics of a nanoparticle composition, such as particle size, polydispersity index, and zeta potential.


In some embodiments, the nanoparticle composition comprises a lipid composition consisting or consisting essentially of compound of Formula (I) (e.g., Compounds 18, 25, 26 or 48). In some embodiments, the nanoparticle composition comprises a lipid composition consisting or consisting essentially of a compound of Formula (I) (e.g., Compounds 18, 25, 26 or 48) and a phospholipid (e.g., DSPC or MSPC).


Nanoparticle compositions can be characterized by a variety of methods. For example, microscopy (e.g., transmission electron microscopy or scanning electron microscopy) can be used to examine the morphology and size distribution of a nanoparticle composition. Dynamic light scattering or potentiometry (e.g., potentiometric titrations) can be used to measure zeta potentials. Dynamic light scattering can also be utilized to determine particle sizes. Instruments such as the Zetasizer Nano ZS (Malvern Instruments Ltd, Malvern, Worcestershire, UK) can also be used to measure multiple characteristics of a nanoparticle composition, such as particle size, polydispersity index, and zeta potential.


The size of the nanoparticles can help counter biological reactions such as, but not limited to, inflammation, or can increase the biological effect of the polynucleotide.


As used herein, “size” or “mean size” in the context of nanoparticle compositions refers to the mean diameter of a nanoparticle composition.


In one embodiment, the polynucleotide encoding a Factor VIII polypeptide are formulated in lipid nanoparticles having a diameter from about 10 to about 100 nm such as, but not limited to, about 10 to about 20 nm, about 10 to about 30 nm, about 10 to about 40 nm, about 10 to about 50 nm, about 10 to about 60 nm, about 10 to about 70 nm, about 10 to about 80 nm, about 10 to about 90 nm, about 20 to about 30 nm, about 20 to about 40 nm, about 20 to about 50 nm, about 20 to about 60 nm, about 20 to about 70 nm, about 20 to about 80 nm, about 20 to about 90 nm, about 20 to about 100 nm, about 30 to about 40 nm, about 30 to about 50 nm, about 30 to about 60 nm, about 30 to about 70 nm, about 30 to about 80 nm, about 30 to about 90 nm, about 30 to about 100 nm, about 40 to about 50 nm, about 40 to about 60 nm, about 40 to about 70 nm, about 40 to about 80 nm, about 40 to about 90 nm, about 40 to about 100 nm, about 50 to about 60 nm, about 50 to about 70 nm, about 50 to about 80 nm, about 50 to about 90 nm, about 50 to about 100 nm, about 60 to about 70 nm, about 60 to about 80 nm, about 60 to about 90 nm, about 60 to about 100 nm, about 70 to about 80 nm, about 70 to about 90 nm, about 70 to about 100 nm, about 80 to about 90 nm, about 80 to about 100 nm and/or about 90 to about 100 nm.


In one embodiment, the nanoparticles have a diameter from about 10 to 500 nm. In one embodiment, the nanoparticle has a diameter greater than 100 nm, greater than 150 nm, greater than 200 nm, greater than 250 nm, greater than 300 nm, greater than 350 nm, greater than 400 nm, greater than 450 nm, greater than 500 nm, greater than 550 nm, greater than 600 nm, greater than 650 nm, greater than 700 nm, greater than 750 nm, greater than 800 nm, greater than 850 nm, greater than 900 nm, greater than 950 nm or greater than 1000 nm.


In some embodiments, the largest dimension of a nanoparticle composition is 1 μm or shorter (e.g., 1 μm, 900 nm, 800 nm, 700 nm, 600 nm, 500 nm, 400 nm, 300 nm, 200 nm, 175 nm, 150 nm, 125 nm, 100 nm, 75 nm, 50 nm, or shorter).


A nanoparticle composition can be relatively homogenous. A polydispersity index can be used to indicate the homogeneity of a nanoparticle composition, e.g., the particle size distribution of the nanoparticle composition. A small (e.g., less than 0.3) polydispersity index generally indicates a narrow particle size distribution. A nanoparticle composition can have a polydispersity index from about 0 to about 0.25, such as 0.01, 0.02, 0.03, 0.04, 0.05, 0.06, 0.07, 0.08, 0.09, 0.10, 0.11, 0.12, 0.13, 0.14, 0.15, 0.16, 0.17, 0.18, 0.19, 0.20, 0.21, 0.22, 0.23, 0.24, or 0.25. In some embodiments, the polydispersity index of a nanoparticle composition disclosed herein can be from about 0.10 to about 0.20.


The zeta potential of a nanoparticle composition can be used to indicate the electrokinetic potential of the composition. For example, the zeta potential can describe the surface charge of a nanoparticle composition. Nanoparticle compositions with relatively low charges, positive or negative, are generally desirable, as more highly charged species can interact undesirably with cells, tissues, and other elements in the body. In some embodiments, the zeta potential of a nanoparticle composition disclosed herein can be from about −10 mV to about +20 mV, from about −10 mV to about +15 mV, from about 10 mV to about +10 mV, from about −10 mV to about +5 mV, from about −10 mV to about 0 mV, from about −10 mV to about −5 mV, from about −5 mV to about +20 mV, from about −5 mV to about +15 mV, from about −5 mV to about +10 mV, from about −5 mV to about +5 mV, from about −5 mV to about 0 mV, from about 0 mV to about +20 mV, from about 0 mV to about +15 mV, from about 0 mV to about +10 mV, from about 0 mV to about +5 mV, from about +5 mV to about +20 mV, from about +5 mV to about +15 mV, or from about +5 mV to about +10 mV.


In some embodiments, the zeta potential of the lipid nanoparticles can be from about 0 mV to about 100 mV, from about 0 mV to about 90 mV, from about 0 mV to about 80 mV, from about 0 mV to about 70 mV, from about 0 mV to about 60 mV, from about 0 mV to about 50 mV, from about 0 mV to about 40 mV, from about 0 mV to about 30 mV, from about 0 mV to about 20 mV, from about 0 mV to about 10 mV, from about 10 mV to about 100 mV, from about 10 mV to about 90 mV, from about 10 mV to about 80 mV, from about 10 mV to about 70 mV, from about 10 mV to about 60 mV, from about 10 mV to about 50 mV, from about 10 mV to about 40 mV, from about 10 mV to about 30 mV, from about 10 mV to about 20 mV, from about 20 mV to about 100 mV, from about 20 mV to about 90 mV, from about 20 mV to about 80 mV, from about 20 mV to about 70 mV, from about 20 mV to about 60 mV, from about 20 mV to about 50 mV, from about 20 mV to about 40 mV, from about 20 mV to about 30 mV, from about 30 mV to about 100 mV, from about 30 mV to about 90 mV, from about 30 mV to about 80 mV, from about 30 mV to about 70 mV, from about 30 mV to about 60 mV, from about 30 mV to about 50 mV, from about 30 mV to about 40 mV, from about 40 mV to about 100 mV, from about 40 mV to about 90 mV, from about 40 mV to about 80 mV, from about 40 mV to about 70 mV, from about 40 mV to about 60 mV, and from about 40 mV to about 50 mV. In some embodiments, the zeta potential of the lipid nanoparticles can be from about 10 mV to about 50 mV, from about 15 mV to about 45 mV, from about 20 mV to about 40 mV, and from about 25 mV to about 35 mV. In some embodiments, the zeta potential of the lipid nanoparticles can be about 10 mV, about 20 mV, about 30 mV, about 40 mV, about 50 mV, about 60 mV, about 70 mV, about 80 mV, about 90 mV, and about 100 mV.


The term “encapsulation efficiency” of a polynucleotide describes the amount of the polynucleotide that is encapsulated by or otherwise associated with a nanoparticle composition after preparation, relative to the initial amount provided. As used herein, “encapsulation” can refer to complete, substantial, or partial enclosure, confinement, surrounding, or encasement.


Encapsulation efficiency is desirably high (e.g., close to 100%). The encapsulation efficiency can be measured, for example, by comparing the amount of the polynucleotide in a solution containing the nanoparticle composition before and after breaking up the nanoparticle composition with one or more organic solvents or detergents.


Fluorescence can be used to measure the amount of free polynucleotide in a solution. For the nanoparticle compositions described herein, the encapsulation efficiency of a polynucleotide can be at least 50%, for example 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%. In some embodiments, the encapsulation efficiency can be at least 80%. In certain embodiments, the encapsulation efficiency can be at least 90%.


The amount of a polynucleotide present in a pharmaceutical composition disclosed herein can depend on multiple factors such as the size of the polynucleotide, desired target and/or application, or other properties of the nanoparticle composition as well as on the properties of the polynucleotide.


For example, the amount of an mRNA useful in a nanoparticle composition can depend on the size (expressed as length, or molecular mass), sequence, and other characteristics of the mRNA. The relative amounts of a polynucleotide in a nanoparticle composition can also vary.


The relative amounts of the lipid composition and the polynucleotide present in a lipid nanoparticle composition of the present disclosure can be optimized according to considerations of efficacy and tolerability. For compositions including an mRNA as a polynucleotide, the N:P ratio can serve as a useful metric.


As the N:P ratio of a nanoparticle composition controls both expression and tolerability, nanoparticle compositions with low N:P ratios and strong expression are desirable. N:P ratios vary according to the ratio of lipids to RNA in a nanoparticle composition.


In general, a lower N:P ratio is preferred. The one or more RNA, lipids, and amounts thereof can be selected to provide an N:P ratio from about 2:1 to about 30:1, such as 2:1, 3:1, 4:1, 5:1, 6:1, 7:1, 8:1, 9:1, 10:1, 12:1, 14:1, 16:1, 18:1, 20:1, 22:1, 24:1, 26:1, 28:1, or 30:1. In certain embodiments, the N:P ratio can be from about 2:1 to about 8:1. In other embodiments, the N:P ratio is from about 5:1 to about 8:1. In certain embodiments, the N:P ratio is between 5:1 and 6:1. In one specific aspect, the N:P ratio is about is about 5.67:1.


In addition to providing nanoparticle compositions, the present disclosure also provides methods of producing lipid nanoparticles comprising encapsulating a polynucleotide. Such method comprises using any of the pharmaceutical compositions disclosed herein and producing lipid nanoparticles in accordance with methods of production of lipid nanoparticles known in the art. See, e.g., Wang et al. (2015) “Delivery of oligonucleotides with lipid nanoparticles” Adv. Drug Deliv. Rev. 87:68-80; Silva et al. (2015) “Delivery Systems for Biopharmaceuticals. Part I: Nanoparticles and Microparticles” Curr. Pharm. Technol. 16: 940-954; Naseri et al. (2015) “Solid Lipid Nanoparticles and Nanostructured Lipid Carriers: Structure, Preparation and Application” Adv. Pharm. Bull. 5:305-13; Silva et al. (2015) “Lipid nanoparticles for the delivery of biopharmaceuticals” Curr. Pharm. Biotechnol. 16:291-302, and references cited therein.


Other Delivery Agents


a. Liposomes, Lipoplexes, and Lipid Nanoparticles


In some embodiments, the compositions or formulations of the present disclosure comprise a delivery agent, e.g., a liposome, a lioplexes, a lipid nanoparticle, or any combination thereof. The polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) can be formulated using one or more liposomes, lipoplexes, or lipid nanoparticles. Liposomes, lipoplexes, or lipid nanoparticles can be used to improve the efficacy of the polynucleotides directed protein production as these formulations can increase cell transfection by the polynucleotide; and/or increase the translation of encoded protein. The liposomes, lipoplexes, or lipid nanoparticles can also be used to increase the stability of the polynucleotides.


Liposomes are artificially-prepared vesicles that can primarily be composed of a lipid bilayer and can be used as a delivery vehicle for the administration of pharmaceutical formulations. Liposomes can be of different sizes. A multilamellar vesicle (MLV) can be hundreds of nanometers in diameter, and can contain a series of concentric bilayers separated by narrow aqueous compartments. A small unicellular vesicle (SUV) can be smaller than 50 nm in diameter, and a large unilamellar vesicle (LUV) can be between 50 and 500 nm in diameter. Liposome design can include, but is not limited to, opsonins or ligands to improve the attachment of liposomes to unhealthy tissue or to activate events such as, but not limited to, endocytosis. Liposomes can contain a low or a high pH value in order to improve the delivery of the pharmaceutical formulations.


The formation of liposomes can depend on the pharmaceutical formulation entrapped and the liposomal ingredients, the nature of the medium in which the lipid vesicles are dispersed, the effective concentration of the entrapped substance and its potential toxicity, any additional processes involved during the application and/or delivery of the vesicles, the optimal size, polydispersity and the shelf-life of the vesicles for the intended application, and the batch-to-batch reproducibility and scale up production of safe and efficient liposomal products, etc.


As a non-limiting example, liposomes such as synthetic membrane vesicles can be prepared by the methods, apparatus and devices described in U.S. Pub. Nos. US20130177638, US20130177637, US20130177636, US20130177635, US20130177634, US20130177633, US20130183375, US20130183373, and US20130183372. In some embodiments, the polynucleotides described herein can be encapsulated by the liposome and/or it can be contained in an aqueous core that can then be encapsulated by the liposome as described in, e.g., Intl. Pub. Nos. WO2012031046, WO2012031043, WO2012030901, WO2012006378, and WO2013086526; and U.S. Pub.Nos. US20130189351, US20130195969 and US20130202684. Each of the references in herein incorporated by reference in its entirety.


In some embodiments, the polynucleotides described herein can be formulated in a cationic oil-in-water emulsion where the emulsion particle comprises an oil core and a cationic lipid that can interact with the polynucleotide anchoring the molecule to the emulsion particle. In some embodiments, the polynucleotides described herein can be formulated in a water-in-oil emulsion comprising a continuous hydrophobic phase in which the hydrophilic phase is dispersed. Exemplary emulsions can be made by the methods described in Intl. Pub. Nos. WO2012006380 and WO201087791, each of which is herein incorporated by reference in its entirety.


In some embodiments, the polynucleotides described herein can be formulated in a lipid-polycation complex. The formation of the lipid-polycation complex can be accomplished by methods as described in, e.g., U.S. Pub. No. US20120178702. As anon-limiting example, the polycation can include a cationic peptide or a polypeptide such as, but not limited to, polylysine, polyornithine and/or polyarginine and the cationic peptides described in Intl. Pub. No. WO2012013326 or U.S. Pub. No. US20130142818. Each of the references is herein incorporated by reference in its entirety.


In some embodiments, the polynucleotides described herein can be formulated in a lipid nanoparticle (LNP) such as those described in Intl. Pub. Nos. WO2013123523, WO2012170930, WO2011127255 and WO2008103276; and U.S. Pub. No. US20130171646, each of which is herein incorporated by reference in its entirety.


Lipid nanoparticle formulations typically comprise one or more lipids. In some embodiments, the lipid is a cationic or an ionizable lipid. In some embodiments, lipid nanoparticle formulations further comprise other components, including a phospholipid, a structural lipid, a quaternary amine compound, and a molecule capable of reducing particle aggregation, for example a PEG or PEG-modified lipid.


Cationic and ionizable lipids can include those as described in, e.g., Intl. Pub. Nos. WO2015199952, WO 2015130584, WO 2015011633, and WO2012040184 WO2013126803, WO2011153120, WO2011149733, WO2011090965, WO2011043913, WO2011022460, WO2012061259, WO2012054365, WO2012044638, WO2010080724, WO201021865, WO2008103276, and WO2013086373; U.S. Pat. Nos. 7,893,302, 7,404,969, 8,283,333, and 8,466,122; and U.S. Pub. Nos. US20110224447, US20120295832, US20150315112, US20100036115, US20120202871, US20130064894, US20130129785, US20130150625, US20130178541, US20130123338 and US20130225836, each of which is herein incorporated by reference in its entirety. In some embodiments, the amount of the cationic and ionizable lipids in the lipid composition ranges from about 0.01 mol % to about 99 mol %.


Exemplary ionizable lipids include, but not limited to, any one of Compounds 1-232 disclosed herein, DLin-MC3-DMA (MC3), DLin-DMA, DLenDMA, DLin-D-DMA, DLin-K-DMA, DLin-M-C2-DMA, DLin-K-DMA, DLin-KC2-DMA, DLin-KC3-DMA, DLin-KC4-DMA, DLin-C2K-DMA, DLin-MP-DMA, DODMA, 98N12-5, C12-200, DLin-C-DAP, DLin-DAC, DLinDAP, DLinAP, DLin-EG-DMA, DLin-2-DMAP, KL10, KL22, KL25, Octyl-CLinDMA, Octyl-CLinDMA (2R), Octyl-CLinDMA (2S), and any combination thereof. Other exemplary ionizable lipids include, (13Z,16Z)-N,N-dimethyl-3-nonyldocosa-13,16-dien-1-amine (L608), (20Z,23Z)-N,N-dimethylnonacosa-20,23-dien-10-amine, (17Z,20Z)-N,N-dimemylhexacosa-17,20-dien-9-amine, (16Z,19Z)-N5N-dimethylpentacosa-16,19-dien-8-amine, (13Z,16Z)-N,N-dimethyldocosa-13,16-dien-5-amine, (12Z,15Z)-N,N-dimethylhenicosa-12,15-dien-4-amine, (14Z,17Z)-N,N-dimethyltricosa-14,17-dien-6-amine, (15Z,18Z)-N,N-dimethyltetracosa-15,18-dien-7-amine, (18Z,21Z)-N,N-dimethylheptacosa-18,21-dien-10-amine, (15Z,18Z)-N,N-dimethyltetracosa-15,18-dien-5-amine, (14Z,17Z)-N,N-dimethyltricosa-14,17-dien-4-amine, (19Z,22Z)-N,N-dimeihyloctacosa-19,22-dien-9-amine, (18Z,21Z)-N,N-dimethylheptacosa-18,21-dien-8-amine, (17Z,20Z)-N,N-dimethylhexacosa-17,20-dien-7-amine, (16Z,19Z)-N,N-dimethylpentacosa-16,19-dien-6-amine, (22Z,25Z)-N,N-dimethylhentriaconta-22,25-dien-10-amine, (21Z,24Z)-N,N-dimethyltriaconta-21,24-dien-9-amine, (18Z)-N,N-dimetylheptacos-18-en-10-amine, (17Z)-N,N-dimethylhexacos-17-en-9-amine, (19Z,22Z)-N,N-dimethyloctacosa-19,22-dien-7-amine, N,N-dimethylheptacosan-10-amine, (20Z,23Z)-N-ethyl-N-methylnonacosa-20,23-dien-10-amine, 1-[(11Z,14Z)-1-nonylicosa-11,14-dien-1-yl]pyrrolidine, (20Z)-N,N-dimethylheptacos-20-en-10-amine, (15Z)-N,N-dimethyl eptacos-15-en-10-amine, (14Z)-N,N-dimethylnonacos-14-en-10-amine, (17Z)-N,N-dimethylnonacos-17-en-10-amine, (24Z)-N,N-dimethyltritriacont-24-en-10-amine, (20Z)-N,N-dimethylnonacos-20-en-10-amine, (22Z)-N,N-dimethylhentriacont-22-en-10-amine, (16Z)-N,N-dimethylpentacos-16-en-8-amine, (12Z,15Z)-N,N-dimethyl-2-nonylhenicosa-12,15-dien-l-amine, N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]eptadecan-8-amine, 1-[(1S,2R)-2-hexylcyclopropyl]-N,N-dimethylnonadecan-10-amine, N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]nonadecan-10-amine, N,N-dimethyl-21-[(1S,2R)-2-octylcyclopropyl]henicosan-10-amine, N,N-dimethyl-1-[(1S,2S)-2-{[(1R,2R)-2-pentylcydopropyl]methyl}cyclopropyl]nonadecan-10-amine, N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]hexadecan-8-amine, N,N-dimethyl- [(1R,2S)-2-undecylcyclopropyl]tetradecan-5-amine, N,N-dimethyl-3-{7-[(1S,2R)-2-octylcyclopropyl]heptyl}dodecan-1-amine, 1-[(1R,2S)-2-heptylcyclopropyl]-N,N-dimethyloctadecan-9-amine, 1-[(1S ,2R)-2-decylcyclopropyl]-N,N-dimethylpentadecan-6-amine, N,N-dimethyl-1-[(1S,2R)-2-octylcyclopropyl]pentadecan-8-amine, R—N,N-dimethyl-1-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-3-(octyloxy)propan-2-amine, S—N,N-dimethyl-1-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-3-(octyloxy)propan-2-amine, 1-{2-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-1-[(octyloxy)methyl]ethyl}pyrrolidine, (2S)-N,N-dimethyl-1-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-3-[(5Z)-oct-5-en-1-yloxy]propan-2-amine, 1-{2-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]-1-[(octyloxy)methyl]ethyl}azetidine, (2S)-1-(hexyloxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-2-amine, (2S)-1-(heptyloxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-2-amine, N,N-dimethyl-1-(nonyloxy)-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-2-amine, N,N-dimethyl-1-[(9Z)-octadec-9-en-1-yloxy]-3-(octyloxy)propan-2-amine; (2S)-N,N-dimethyl-1-[(6Z,9Z,12Z)-octadeca-6,9,12-trien-1-yloxy]-3-(octyloxy)propan-2-amine, (2S)-1-[(11Z,14Z)-icosa-11,14-dien-1-yloxy]-N,N-dimethyl-3-(pentyloxy)propan-2-amine, (2S)-1-(hexyloxy)-3-[(11Z,14Z)-icosa-11,14-dien-1-yloxy]-N,N-dimethylpropan-2-amine, 1-[(11Z,14Z)-icosa-11,14-dien-1-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2-amine, 1-[(13Z,16Z)-docosa-13,16-dien-l-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2-amine, (2S)-1-[(13Z, 16Z)-docosa-13,16-dien-1-yloxy]-3-(hexyloxy)-N,N-dimethylpropan-2-amine, (2S)-1-[(13Z)-docos-13-en-1-yloxy]-3-(hexyloxy)-N,N-dimethylpropan-2-amine, 1-[(13Z)-docos-13-en-1-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2-amine, 1-[(9Z)-hexadec-9-en-1-yloxy]-N,N-dimethyl-3-(octyloxy)propan-2-amine, (2R)-N,N-dimethyl-H(1-metoyloctyl)oxy]-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-2-amine, (2R)-1-[(3,7-dimethyloctyl)oxy]-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-2-amine, N,N-dimethyl-1-(octyloxy)-3-({8-[(1S ,2S)-2-{[(1R,2R)-2-pentylcyclopropyl]methyl}cyclopropyl]octyl}oxy)propan-2-amine, N,N-dimethyl-1-{[8-(2-oclylcyclopropyl)octyl]oxy}-3-(octyloxy)propan-2-amine, and (11E,20Z,23Z)-N,N-dimethylnonacosa-11,20,2-trien-10-amine, and any combination thereof.


Phospholipids include, but are not limited to, glycerophospholipids such as phosphatidylcholines, phosphatidylethanolamines, phosphatidylserines, phosphatidylinositols, phosphatidy glycerols, and phosphatidic acids. Phospholipids also include phosphosphingolipid, such as sphingomyelin. In some embodiments, the phospholipids are DLPC, DMPC, DOPC, DPPC, DSPC, DUPC, 18:0 Diether PC, DLnPC, DAPC, DHAPC, DOPE, 4ME 16:0 PE, DSPE, DLPE, DLnPE, DAPE, DHAPE, DOPG, and any combination thereof. In some embodiments, the phospholipids are MPPC, MSPC, PMPC, PSPC, SMPC, SPPC, DHAPE, DOPG, and any combination thereof. In some embodiments, the amount of phospholipids (e.g.,) in the lipid composition ranges from about 1 mol % to about 20 mol %.


The structural lipids include sterols and lipids containing sterol moieties. In some embodiments, the structural lipids include cholesterol, fecosterol, sitosterol, ergosterol, campesterol, stigmasterol, brassicasterol, tomatidine, tomatine, ursolic acid, alpha-tocopherol, and mixtures thereof In some embodiments, the structural lipid is cholesterol. In some embodiments, the amount of the structural lipids (e.g., cholesterol) in the lipid composition ranges from about 20 mol % to about 60 mol %.


The PEG-modified lipids include PEG-modified phosphatidylethanolamine and phosphatidic acid, PEG-ceramide conjugates (e.g., PEG-CerC14 or PEG-CerC20), PEG-modified dialkylamines and PEG-modified 1,2-diacyloxypropan-3-amines. Such lipids are also referred to as PEGylated lipids. For example, a PEG lipid can be PEG-c-DOMG, PEG-DMG, PEG-DLPE, PEG DMPE, PEG-DPPC, or a PEG-DSPE lipid. In some embodiments, the PEG-lipid are 1,2-dimyristoyl-sn-glycerol methoxypolyethylene glycol (PEG-DMG), 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[amino(polyethylene glycol)] (PEG-DSPE), PEG-disteryl glycerol (PEG-DSG), PEG-dipalmetoleyl, PEG-dioleyl, PEG-distearyl, PEG-diacylglycamide (PEG-DAG), PEG-dipalmitoyl phosphatidylethanolamine (PEG-DPPE), or PEG-1,2-dimyristyloxlpropyl-3-amine (PEG-c-DMA). In some embodiments, the PEG moiety has a size of about 1000, 2000, 5000, 10,000, 15,000 or 20,000 daltons. In some embodiments, the amount of PEG-lipid in the lipid composition ranges from about 0.1 mol % to about 5 mol %.


In some embodiments, the LNP formulations described herein can additionally comprise a permeability enhancer molecule. Non-limiting permeability enhancer molecules are described in U.S. Pub. No. US20050222064, herein incorporated by reference in its entirety.


The LNP formulations can further contain a phosphate conjugate. The phosphate conjugate can increase in vivo circulation times and/or increase the targeted delivery of the nanoparticle. Phosphate conjugates can be made by the methods described in, e.g., Intl. Pub. No. WO2013033438 or U.S. Pub. No. US20130196948. The LNP formulation can also contain a polymer conjugate (e.g., a water soluble conjugate) as described in, e.g., U.S. Pub. Nos. US20130059360, US20130196948, and US20130072709. Each of the references is herein incorporated by reference in its entirety.


The LNP formulations can comprise a conjugate to enhance the delivery of nanoparticles of the present disclosure in a subject. Further, the conjugate can inhibit phagocytic clearance of the nanoparticles in a subject. In some embodiments, the conjugate can be a “self” peptide designed from the human membrane protein CD47 (e.g., the “self” particles described by Rodriguez et al, Science 2013 339, 971-975, herein incorporated by reference in its entirety). As shown by Rodriguez et al. the self peptides delayed macrophage-mediated clearance of nanoparticles which enhanced delivery of the nanoparticles.


The LNP formulations can comprise a carbohydrate carrier. As a non-limiting example, the carbohydrate carrier can include, but is not limited to, an anhydride-modified phytoglycogen or glycogen-type material, phytoglycogen octenyl succinate, phytoglycogen beta-dextrin, anhydride-modified phytoglycogen beta-dextrin (e.g., Intl. Pub. No. WO2012109121, herein incorporated by reference in its entirety).


The LNP formulations can be coated with a surfactant or polymer to improve the delivery of the particle. In some embodiments, the LNP can be coated with a hydrophilic coating such as, but not limited to, PEG coatings and/or coatings that have a neutral surface charge as described in U.S. Pub. No. US20130183244, herein incorporated by reference in its entirety.


The LNP formulations can be engineered to alter the surface properties of particles so that the lipid nanoparticles can penetrate the mucosal barrier as described in U.S. Pat. No. 8,241,670 or Intl. Pub. No. WO2013110028, each of which is herein incorporated by reference in its entirety.


The LNP engineered to penetrate mucus can comprise a polymeric material (i.e., a polymeric core) and/or a polymer-vitamin conjugate and/or a tri-block co-polymer. The polymeric material can include, but is not limited to, polyamines, polyethers, polyamides, polyesters, polycarbamates, polyureas, polycarbonates, poly(styrenes), polyimides, polysulfones, polyurethanes, polyacetylenes, polyethylenes, polyethyeneimines, polyisocyanates, polyacrylates, polymethacrylates, polyacrylonitriles, and polyarylates.


LNP engineered to penetrate mucus can also include surface altering agents such as, but not limited to, polynucleotides, anionic proteins (e.g., bovine serum albumin), surfactants (e.g., cationic surfactants such as for example dimethyldioctadecyl-ammonium bromide), sugars or sugar derivatives (e.g., cyclodextrin), nucleic acids, polymers (e.g., heparin, polyethylene glycol and poloxamer), mucolytic agents (e.g., N-acetylcysteine, mugwort, bromelain, papain, clerodendrum, acetylcysteine, bromhexine, carbocisteine, eprazinone, mesna, ambroxol, sobrerol, domiodol, letosteine, stepronin, tiopronin, gelsolin, thymosin dornase alfa, neltenexine, erdosteine) and various DNases including rhDNase.


In some embodiments, the mucus penetrating LNP can be a hypotonic formulation comprising a mucosal penetration enhancing coating. The formulation can be hypotonic for the epithelium to which it is being delivered. Non-limiting examples of hypotonic formulations can be found in, e.g., Intl. Pub. No. WO2013110028, herein incorporated by reference in its entirety.


In some embodiments, the polynucleotide described herein is formulated as a lipoplex, such as, without limitation, the ATUPLEXTM system, the DACC system, the DBTC system and other siRNA-lipoplex technology from Silence Therapeutics (London, United Kingdom), STEMFECT™ from STEMGENT® (Cambridge, Mass.), and polyethylenimine (PEI) or protamine-based targeted and non-targeted delivery of nucleic acids (Aleku et al. Cancer Res. 2008 68:9788-9798; Strumberg et al. Int J Clin Pharmacol Ther 2012 50:76-78; Santel et al., Gene Ther 2006 13:1222-1234; Santel et al., Gene Ther 2006 13:1360-1370; Gutbier et al., Pulm Pharmacol. Ther. 2010 23:334-344; Kaufmann et al. Microvasc Res 2010 80:286-293Weide et al. J Immunother. 2009 32:498-507; Weide et al. J Immunother. 2008 31:180-188; Pascolo Expert Opin. Biol. Ther. 4:1285-1294; Fotin-Mleczek et al., 2011 J. Immunother. 34:1-15; Song et al., Nature Biotechnol. 2005, 23:709-717; Peer et al., Proc Natl Acad Sci U S A. 2007 6;104:4095-4100; deFougerolles Hum Gene Ther. 2008 19:125-132; all of which are incorporated herein by reference in its entirety).


In some embodiments, the polynucleotides described herein are formulated as a solid lipid nanoparticle (SLN), which can be spherical with an average diameter between 10 to 1000 nm. SLN possess a solid lipid core matrix that can solubilize lipophilic molecules and can be stabilized with surfactants and/or emulsifiers. Exemplary SLN can be those as described in Intl. Pub. No. WO2013105101, herein incorporated by reference in its entirety.


In some embodiments, the polynucleotides described herein can be formulated for controlled release and/or targeted delivery. As used herein, “controlled release” refers to a pharmaceutical composition or compound release profile that conforms to a particular pattern of release to effect a therapeutic outcome. In one embodiment, the polynucleotides can be encapsulated into a delivery agent described herein and/or known in the art for controlled release and/or targeted delivery. As used herein, the term “encapsulate” means to enclose, surround or encase. As it relates to the formulation of the compounds of the present disclosure, encapsulation can be substantial, complete or partial. The term “substantially encapsulated” means that at least greater than 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.9 or greater than 99.999% of the pharmaceutical composition or compound of the present disclosure can be enclosed, surrounded or encased within the delivery agent. “Partially encapsulation” means that less than 10, 10, 20, 30, 40 50 or less of the pharmaceutical composition or compound of the present disclosure can be enclosed, surrounded or encased within the delivery agent.


Advantageously, encapsulation can be determined by measuring the escape or the activity of the pharmaceutical composition or compound of the present disclosure using fluorescence and/or electron micrograph. For example, at least 1, 5, 10, 20, 30, 40, 50, 60, 70, 80, 85, 90, 95, 96, 97, 98, 99, 99.9, 99.99 or greater than 99.99% of the pharmaceutical composition or compound of the present disclosure are encapsulated in the delivery agent.


In some embodiments, the polynucleotides described herein can be encapsulated in a therapeutic nanoparticle, referred to herein as “therapeutic nanoparticle polynucleotides.” Therapeutic nanoparticles can be formulated by methods described in, e.g., Intl. Pub. Nos. WO2010005740, WO2010030763, WO2010005721, WO2010005723, and WO2012054923; and U.S. Pub. Nos. US20110262491, US20100104645, US20100087337, US20100068285, US20110274759, US20100068286, US20120288541, US20120140790, US20130123351 and US20130230567; and U.S. Pat. Nos. 8,206,747, 8,293,276, 8,318,208 and 8,318,211, each of which is herein incorporated by reference in its entirety.


In some embodiments, the therapeutic nanoparticle polynucleotide can be formulated for sustained release. As used herein, “sustained release” refers to a pharmaceutical composition or compound that conforms to a release rate over a specific period of time. The period of time can include, but is not limited to, hours, days, weeks, months and years. As a non-limiting example, the sustained release nanoparticle of the polynucleotides described herein can be formulated as disclosed in Intl. Pub. No. WO2010075072 and U.S. Pub. Nos. US20100216804, US20110217377, US20120201859 and US20130150295, each of which is herein incorporated by reference in their entirety.


In some embodiments, the therapeutic nanoparticle polynucleotide can be formulated to be target specific, such as those described in Intl. Pub. Nos. WO2008121949, WO2010005726, WO2010005725, WO2011084521 and WO2011084518; and U.S. Pub. Nos. US20100069426, US20120004293 and US20100104655, each of which is herein incorporated by reference in its entirety.


The LNPs can be prepared using microfluidic mixers or micromixers. Exemplary microfluidic mixers can include, but are not limited to, a slit interdigitial micromixer including, but not limited to those manufactured by Microinnova (Allerheiligen bei Wildon, Austria) and/or a staggered herringbone micromixer (SHM) (see Zhigaltsevet al., “Bottom-up design and synthesis of limit size lipid nanoparticle systems with aqueous and triglyceride cores using millisecond microfluidic mixing,” Langmuir 28:3633-40 (2012); Belliveau et al., “Microfluidic synthesis of highly potent limit-size lipid nanoparticles for in vivo delivery of siRNA,” Molecular Therapy-Nucleic Acids. 1:e37 (2012); Chen et al., “Rapid discovery of potent siRNA-containing lipid nanoparticles enabled by controlled microfluidic formulation,” J. Am. Chem. Soc. 134(16):6948-51 (2012); each of which is herein incorporated by reference in its entirety). Exemplary micromixers include Slit Interdigital Microstructured Mixer (SIMM-V2) or a Standard Slit Interdigital Micro Mixer (SSIMM) or Caterpillar (CPMM) or Impinging-jet (IJMM,) from the Institut für Mikrotechnik Mainz GmbH, Mainz Germany. In some embodiments, methods of making LNP using SHM further comprise mixing at least two input streams wherein mixing occurs by microstructure-induced chaotic advection (MICA). According to this method, fluid streams flow through channels present in a herringbone pattern causing rotational flow and folding the fluids around each other. This method can also comprise a surface for fluid mixing wherein the surface changes orientations during fluid cycling. Methods of generating LNPs using SHM include those disclosed in U.S. Pub. Nos. US20040262223 and US20120276209, each of which is incorporated herein by reference in their entirety.


In some embodiments, the polynucleotides described herein can be formulated in lipid nanoparticles using microfluidic technology (see Whitesides, George M., “The Origins and the Future of Microfluidics,” Nature 442: 368-373 (2006); and Abraham et al., “Chaotic Mixer for Microchannels,” Science 295: 647-651 (2002); each of which is herein incorporated by reference in its entirety). In some embodiments, the polynucleotides can be formulated in lipid nanoparticles using a micromixer chip such as, but not limited to, those from Harvard Apparatus (Holliston, Mass.) or Dolomite Microfluidics (Royston, UK). A micromixer chip can be used for rapid mixing of two or more fluid streams with a split and recombine mechanism.


In some embodiments, the polynucleotides described herein can be formulated in lipid nanoparticles having a diameter from about 1 nm to about 100 nm such as, but not limited to, about 1 nm to about 20 nm, from about 1 nm to about 30 nm, from about 1 nm to about 40 nm, from about 1 nm to about 50 nm, from about 1 nm to about 60 nm, from about 1 nm to about 70 nm, from about 1 nm to about 80 nm, from about 1 nm to about 90 nm, from about 5 nm to about from 100 nm, from about 5 nm to about 10 nm, about 5 nm to about 20 nm, from about 5 nm to about 30 nm, from about 5 nm to about 40 nm, from about 5 nm to about 50 nm, from about 5 nm to about 60 nm, from about 5 nm to about 70 nm, from about 5 nm to about 80 nm, from about 5 nm to about 90 nm, about 10 to about 20 nm, about 10 to about 30 nm, about 10 to about 40 nm, about 10 to about 50 nm, about 10 to about 60 nm, about 10 to about 70 nm, about 10 to about 80 nm, about 10 to about 90 nm, about 20 to about 30 nm, about 20 to about 40 nm, about 20 to about 50 nm, about 20 to about 60 nm, about 20 to about 70 nm, about 20 to about 80 nm, about 20 to about 90 nm, about 20 to about 100 nm, about 30 to about 40 nm, about 30 to about 50 nm, about 30 to about 60 nm, about 30 to about 70 nm, about 30 to about 80 nm, about 30 to about 90 nm, about 30 to about 100 nm, about 40 to about 50 nm, about 40 to about 60 nm, about 40 to about 70 nm, about 40 to about 80 nm, about 40 to about 90 nm, about 40 to about 100 nm, about 50 to about 60 nm, about 50 to about 70 nm about 50 to about 80 nm, about 50 to about 90 nm, about 50 to about 100 nm, about 60 to about 70 nm, about 60 to about 80 nm, about 60 to about 90 nm, about 60 to about 100 nm, about 70 to about 80 nm, about 70 to about 90 nm, about 70 to about 100 nm, about 80 to about 90 nm, about 80 to about 100 nm and/or about 90 to about 100 nm.


In some embodiments, the lipid nanoparticles can have a diameter from about 10 to 500 nm. In one embodiment, the lipid nanoparticle can have a diameter greater than 100 nm, greater than 150 nm, greater than 200 nm, greater than 250 nm, greater than 300 nm, greater than 350 nm, greater than 400 nm, greater than 450 nm, greater than 500 nm, greater than 550 nm, greater than 600 nm, greater than 650 nm, greater than 700 nm, greater than 750 nm, greater than 800 nm, greater than 850 nm, greater than 900 nm, greater than 950 nm or greater than 1000 nm.


In some embodiments, the polynucleotides can be delivered using smaller LNPs. Such particles can comprise a diameter from below 0.1 μm up to 100 nm such as, but not limited to, less than 0.1 μm, less than 1.0 μm, less than 5 μm, less than 10 μm, less than 15 um, less than 20 um, less than 25 um, less than 30 um, less than 35 um, less than 40 um, less than 50 um, less than 55 um, less than 60 um, less than 65 um, less than 70 um, less than 75 um, less than 80 um, less than 85 um, less than 90 um, less than 95 um, less than 100 um, less than 125 um, less than 150 um, less than 175 um, less than 200 um, less than 225 um, less than 250 um, less than 275 um, less than 300 um, less than 325 um, less than 350 um, less than 375 um, less than 400 um, less than 425 um, less than 450 urn, less than 475 urn, less than 500 urn, less than 525 urn, less than 550 um, less than 575 um, less than 600 um, less than 625 um, less than 650 um, less than 675 urn, less than 700 urn, less than 725 urn, less than 750 urn, less than 775 um, less than 800 um, less than 825 urn, less than 850 urn, less than 875 urn, less than 900 urn, less than 925 urn, less than 950 urn, or less than 975 um.


The nanoparticles and microparticles described herein can be geometrically engineered to modulate macrophage and/or the immune response. The geometrically engineered particles can have varied shapes, sizes and/or surface charges to incorporate the polynucleotides described herein for targeted delivery such as, but not limited to, pulmonary delivery (see, e.g., Intl. Pub. No. WO2013082111, herein incorporated by reference in its entirety). Other physical features the geometrically engineering particles can include, but are not limited to, fenestrations, angled arms, asymmetry and surface roughness, charge that can alter the interactions with cells and tissues.


In some embodiment, the nanoparticles described herein are stealth nanoparticles or target-specific stealth nanoparticles such as, but not limited to, those described in U.S. Pub. No. US20130172406, herein incorporated by reference in its entirety. The stealth or target-specific stealth nanoparticles can comprise a polymeric matrix, which can comprise two or more polymers such as, but not limited to, polyethylenes, polycarbonates, polyanhydrides, polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers, polyesters, poly(orthoesters), polycyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyacrylates, polymethacrylates, polycyanoacrylates, polyureas, polystyrenes, polyamines, polyesters, polyanhydrides, polyethers, polyurethanes, polymethacrylates, polyacrylates, polycyanoacrylates, or combinations thereof


b. Lipidoids


In some embodiments, the compositions or formulations of the present disclosure comprise a delivery agent, e.g., a lipidoid. The polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) can be formulated with lipidoids. Complexes, micelles, liposomes or particles can be prepared containing these lipidoids and therefore to achieve an effective delivery of the polynucleotide, as judged by the production of an encoded protein, following the injection of a lipidoid formulation via localized and/or systemic routes of administration. Lipidoid complexes of polynucleotides can be administered by various means including, but not limited to, intravenous, intramuscular, or subcutaneous routes.


The synthesis of lipidoids is described in literature (see Mahon et al., Bioconjug. Chem. 2010 21:1448-1454; Schroeder et al., J Intern Med. 2010 267:9-21; Akinc et al., Nat Biotechnol. 2008 26:561-569; Love et al., Proc Natl Acad Sci U S A. 2010 107:1864-1869; Siegwart et al., Proc Natl Acad Sci U S A. 2011 108:12996-3001; all of which are incorporated herein in their entireties).


Formulations with the different lipidoids, including, but not limited to penta[3-(1-laurylaminopropionyl)]-triethylenetetramine hydrochloride (TETA-SLAP; also known as 98N12-5, see Murugaiah et al., Analytical Biochemistry, 401:61 (2010)), C12-200 (including derivatives and variants), and MD1, can be tested for in vivo activity. The lipidoid “98N12-5” is disclosed by Akinc et al., Mol Ther. 2009 17:872-879. The lipidoid “C12-200” is disclosed by Love et al., Proc Natl Acad Sci U S A. 2010 107:1864-1869 and Liu and Huang, Molecular Therapy. 2010 669-670. Each of the references is herein incorporated by reference in its entirety.


In one embodiment, the polynucleotides described herein can be formulated in an aminoalcohol lipidoid. Aminoalcohol lipidoids can be prepared by the methods described in U.S. Pat. No. 8,450,298 (herein incorporated by reference in its entirety).


The lipidoid formulations can include particles comprising either 3 or 4 or more components in addition to polynucleotides. Lipidoids and polynucleotide formulations comprising lipidoids are described in Intl. Pub. No. WO 2015051214 (herein incorporated by reference in its entirety.


c. Hyaluronidase


In some embodiments, the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) and hyaluronidase for injection (e.g., intramuscular or subcutaneous injection). Hyaluronidase catalyzes the hydrolysis of hyaluronan, which is a constituent of the interstitial barrier. Hyaluronidase lowers the viscosity of hyaluronan, thereby increases tissue permeability (Frost, Expert Opin. Drug Deliv. (2007) 4:427-440). Alternatively, the hyaluronidase can be used to increase the number of cells exposed to the polynucleotides administered intramuscularly, intratumorally, or subcutaneously.


d Nanoparticle Mimics


In some embodiments, the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) is encapsulated within and/or absorbed to a nanoparticle mimic. A nanoparticle mimic can mimic the delivery function organisms or particles such as, but not limited to, pathogens, viruses, bacteria, fungus, parasites, prions and cells. As a non-limiting example, the polynucleotides described herein can be encapsulated in a non-viron particle that can mimic the delivery function of a virus (see e.g., Intl. Pub. No. WO2012006376 and U.S. Pub. Nos. US20130171241 and US20130195968, each of which is herein incorporated by reference in its entirety).


Self-Assembled Nanoparticles, or Self-Assembled Macromolecules


In some embodiments, the compositions or formulations of the present disclosure comprise the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) in self-assembled nanoparticles, or amphiphilic macromolecules (AMs) for delivery. AMs comprise biocompatible amphiphilic polymers that have an alkylated sugar backbone covalently linked to poly(ethylene glycol). In aqueous solution, the AMs self-assemble to form micelles. Nucleic acid self-assembled nanoparticles are described in Intl. Appl. No. PCT/US2014/027077, and AMs and methods of forming AMs are described in U.S. Pub. No. US20130217753, each of which is herein incorporated by reference in its entirety.


f. Cations and Anions


In some embodiments, the compositions or formulations of the present disclosure comprise the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) and a cation or anion, such as Zn2+, Ca2+, Cu2+, Mg2+ and combinations thereof. Exemplary formulations can include polymers and a polynucleotide complexed with a metal cation as described in, e.g., U.S. Pat. Nos. 6,265,389 and 6,555,525, each of which is herein incorporated by reference in its entirety. In some embodiments, cationic nanoparticles can contain a combination of divalent and monovalent cations. The delivery of polynucleotides in cationic nanoparticles or in one or more depot comprising cationic nanoparticles can improve polynucleotide bioavailability by acting as a long-acting depot and/or reducing the rate of degradation by nucleases.


g Amino Acid Lipids


In some embodiments, the compositions or formulations of the present disclosure comprise the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) that is formulation with an amino acid lipid. Amino acid lipids are lipophilic compounds comprising an amino acid residue and one or more lipophilic tails. Non-limiting examples of amino acid lipids and methods of making amino acid lipids are described in U.S. Pat. No. 8,501,824. The amino acid lipid formulations can deliver a polynucleotide in releasable form that comprises an amino acid lipid that binds and releases the polynucleotides. As a non-limiting example, the release of the polynucleotides described herein can be provided by an acid-labile linker as described in, e.g., U.S. Pat. Nos. 7,098,032, 6,897,196, 6,426,086, 7,138,382, 5,563,250, and 5,505,931, each of which is herein incorporated by reference in its entirety.


h. Interpolyelectrolyte Complexes


In some embodiments, the compositions or formulations of the present disclosure comprise the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) in an interpolyelectrolyte complex. Interpolyelectrolyte complexes are formed when charge-dynamic polymers are complexed with one or more anionic molecules. Non-limiting examples of charge-dynamic polymers and interpolyelectrolyte complexes and methods of making interpolyelectrolyte complexes are described in U.S. Pat. No. 8,524,368, herein incorporated by reference in its entirety.


Crystalline Polymeric Systems


In some embodiments, the compositions or formulations of the present disclosure comprise the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) in crystalline polymeric systems. Crystalline polymeric systems are polymers with crystalline moieties and/or terminal units comprising crystalline moieties. Exemplary polymers are described in U.S. Pat. No. 8,524,259 (herein incorporated by reference in its entirety).


j Polymers, Biodegradable Nanoparticles, and Core-Shell Nanoparticles


In some embodiments, the compositions or formulations of the present disclosure comprise the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) and a natural and/or synthetic polymer. The polymers include, but not limited to, polyethenes, polyethylene glycol (PEG), poly(1-lysine)(PLL), PEG grafted to PLL, cationic lipopolymer, biodegradable cationic lipopolymer, polyethyleneimine (PEI), cross-linked branched poly(alkylene imines), a polyamine derivative, a modified poloxamer, elastic biodegradable polymer, biodegradable copolymer, biodegradable polyester copolymer, biodegradable polyester copolymer, multiblock copolymers, poly[α-(4-aminobutyl)-L-glycolic acid) (PAGA), biodegradable cross-linked cationic multi-block copolymers, polycarbonates, polyanhydrides, polyhydroxyacids, polypropylfumerates, polycaprolactones, polyamides, polyacetals, polyethers, polyesters, poly(orthoesters), poly cyanoacrylates, polyvinyl alcohols, polyurethanes, polyphosphazenes, polyureas, polystyrenes, polyamines, polylysine, poly(ethylene imine), poly(serine ester), poly(L-lactide-co-L-lysine), poly(4-hydroxy-L-proline ester), amine-containing polymers, dextran polymers, dextran polymer derivatives or combinations thereof.


Exemplary polymers include, DYNAMIC POLYCONJUGATE® (Arrowhead Research Corp., Pasadena, Calif.) formulations from MIRUS® Bio (Madison, Wis.) and Roche Madison (Madison, Wis.), PHASERX™ polymer formulations such as, without limitation, SMARTT POLYMER TECHNOLOGYTM (PHASERX®, Seattle, Wash.), DMRI/DOPE, poloxamer, VAXFECTIN® adjuvant from Vical (San Diego, Calif.), chitosan, cyclodextrin from Calando Pharmaceuticals (Pasadena, Calif.), dendrimers and poly(lactic-co-glycolic acid) (PLGA) polymers. RONDELTM (RNAi/Oligonucleotide Nanoparticle Delivery) polymers (Arrowhead Research Corporation, Pasadena, Calif.) and pH responsive co-block polymers such as PHASERX® (Seattle, Wash.).


The polymer formulations allow a sustained or delayed release of the polynucleotide (e.g., following intramuscular or subcutaneous injection). The altered release profile for the polynucleotide can result in, for example, translation of an encoded protein over an extended period of time. The polymer formulation can also be used to increase the stability of the polynucleotide. Sustained release formulations can include, but are not limited to, PLGA microspheres, ethylene vinyl acetate (EVAc), poloxamer, GELSITE® (Nanotherapeutics, Inc. Alachua, Fla.), HYLENEX® (Halozyme Therapeutics, San Diego Calif.), surgical sealants such as fibrinogen polymers (Ethicon Inc. Cornelia, Ga.), TISSELL® (Baxter International, Inc. Deerfield, Ill.), PEG-based sealants, and COSEAL® (Baxter International, Inc. Deerfield, Ill.).


As a non-limiting example modified mRNA can be formulated in PLGA microspheres by preparing the PLGA microspheres with tunable release rates (e.g., days and weeks) and encapsulating the modified mRNA in the PLGA microspheres while maintaining the integrity of the modified mRNA during the encapsulation process. EVAc are non-biodegradable, biocompatible polymers that are used extensively in pre-clinical sustained release implant applications (e.g., extended release products Ocusert a pilocarpine ophthalmic insert for glaucoma or progestasert a sustained release progesterone intrauterine device; transdermal delivery systems Testoderm, Duragesic and Selegiline; catheters). Poloxamer F-407 NF is a hydrophilic, non-ionic surfactant triblock copolymer of polyoxyethylene-polyoxypropylene-polyoxyethylene having a low viscosity at temperatures less than 5° C. and forms a solid gel at temperatures greater than 15° C.


As a non-limiting example, the polynucleotides described herein can be formulated with the polymeric compound of PEG grafted with PLL as described in U.S. Pat. No. 6,177,274. As another non-limiting example, the polynucleotides described herein can be formulated with a block copolymer such as a PLGA-PEG block copolymer (see e.g., U.S. Pub. No. US20120004293 and U.S. Pat. Nos. 8,236,330 and 8,246,968), or a PLGA-PEG-PLGA block copolymer (see e.g., U.S. Pat. No. 6,004,573). Each of the references is herein incorporated by reference in its entirety.


In some embodiments, the polynucleotides described herein can be formulated with at least one amine-containing polymer such as, but not limited to polylysine, polyethylene imine, poly(amidoamine) dendrimers, poly(amine-co-esters) or combinations thereof. Exemplary polyamine polymers and their use as delivery agents are described in, e.g., U.S. Pat. Nos. 8,460,696, 8,236,280, each of which is herein incorporated by reference in its entirety.


In some embodiments, the polynucleotides described herein can be formulated in a biodegradable cationic lipopolymer, a biodegradable polymer, or a biodegradable copolymer, a biodegradable polyester copolymer, a biodegradable polyester polymer, a linear biodegradable copolymer, PAGA, a biodegradable cross-linked cationic multi-block copolymer or combinations thereof as described in, e.g., U.S. Pat. Nos. 6,696,038, 6,517,869, 6,267,987, 6,217,912, 6,652,886, 8,057,821, and 8,444,992; U.S. Pub. Nos. US20030073619, US20040142474, US20100004315, US2012009145 and US20130195920; and Intl Pub. Nos. WO2006063249 and WO2013086322, each of which is herein incorporated by reference in its entirety.


In some embodiments, the polynucleotides described herein can be formulated in or with at least one cyclodextrin polymer as described in U.S. Pub. No. US20130184453. In some embodiments, the polynucleotides described herein can be formulated in or with at least one crosslinked cation-binding polymers as described in Intl. Pub. Nos. WO2013106072, WO2013106073 and WO2013106086. In some embodiments, the polynucleotides described herein can be formulated in or with at least PEGylated albumin polymer as described in U.S. Pub. No. US20130231287. Each of the references is herein incorporated by reference in its entirety.


In some embodiments, the polynucleotides disclosed herein can be formulated as a nanoparticle using a combination of polymers, lipids, and/or other biodegradable agents, such as, but not limited to, calcium phosphate. Components can be combined in a core-shell, hybrid, and/or layer-by-layer architecture, to allow for fine-tuning of the nanoparticle for delivery (Wang et al., Nat Mater. 2006 5:791-796; Fuller et al., Biomaterials. 2008 29:1526-1532; DeKoker et al., Adv Drug Deliv Rev. 2011 63:748-761; Endres et al., Biomaterials. 2011 32:7721-7731; Su et al., Mol Pharm. 2011 Jun 6;8(3):774-87; herein incorporated by reference in their entireties). As a non-limiting example, the nanoparticle can comprise a plurality of polymers such as, but not limited to hydrophilic-hydrophobic polymers (e.g., PEG-PLGA), hydrophobic polymers (e.g., PEG) and/or hydrophilic polymers (Intl. Pub. No. WO20120225129, herein incorporated by reference in its entirety).


The use of core-shell nanoparticles has additionally focused on a high-throughput approach to synthesize cationic cross-linked nanogel cores and various shells (Siegwart et al., Proc Natl Acad Sci U S A. 2011 108:12996-13001; herein incorporated by reference in its entirety). The complexation, delivery, and internalization of the polymeric nanoparticles can be precisely controlled by altering the chemical composition in both the core and shell components of the nanoparticle. For example, the core-shell nanoparticles can efficiently deliver siRNA to mouse hepatocytes after they covalently attach cholesterol to the nanoparticle.


In some embodiments, a hollow lipid core comprising a middle PLGA layer and an outer neutral lipid layer containing PEG can be used to delivery of the polynucleotides as described herein. In some embodiments, the lipid nanoparticles can comprise a core of the polynucleotides disclosed herein and a polymer shell, which is used to protect the polynucleotides in the core. The polymer shell can be any of the polymers described herein and are known in the art., the polymer shell can be used to protect the polynucleotides in the core.


Core-shell nanoparticles for use with the polynucleotides described herein are described in U.S. Pat. No. 8,313,777 or Intl. Pub. No. WO2013124867, each of which is herein incorporated by reference in their entirety.


k. Peptides and Proteins


In some embodiments, the compositions or formulations of the present disclosure comprise the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) that is formulated with peptides and/or proteins to increase transfection of cells by the polynucleotide, and/or to alter the biodistribution of the polynucleotide (e.g., by targeting specific tissues or cell types), and/or increase the translation of encoded protein (e.g., Intl. Pub. Nos. WO2012110636 and WO2013123298. In some embodiments, the peptides can be those described in U.S. Pub. Nos. US20130129726, US20130137644 and US20130164219. Each of the references is herein incorporated by reference in its entirety.


l. Conjugates


In some embodiments, the compositions or formulations of the present disclosure comprise the polynucleotides described herein (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide) that is covalently linked to a carrier or targeting group, or including two encoding regions that together produce a fusion protein (e.g., bearing a targeting group and therapeutic protein or peptide) as a conjugate. The conjugate can be a peptide that selectively directs the nanoparticle to neurons in a tissue or organism, or assists in crossing the blood-brain barrier.


The conjugates include a naturally occurring substance, such as a protein (e.g., human serum albumin (HSA), low-density lipoprotein (LDL), high-density lipoprotein (HDL), or globulin); an carbohydrate (e.g., a dextran, pullulan, chitin, chitosan, inulin, cyclodextrin or hyaluronic acid); or a lipid. The ligand can also be a recombinant or synthetic molecule, such as a synthetic polymer, e.g., a synthetic polyamino acid, an oligonucleotide (e.g., an aptamer). Examples of polyamino acids include polyamino acid is a polylysine (PLL), poly L-aspartic acid, poly L-glutamic acid, styrene-maleic acid anhydride copolymer, poly(L-lactide-co-glycolied) copolymer, divinyl ether-maleic anhydride copolymer, N-(2-hydroxypropyl)methacrylamide copolymer (HMPA), polyethylene glycol (PEG), polyvinyl alcohol (PVA), polyurethane, poly(2-ethylacryllic acid), N-isopropylacrylamide polymers, or polyphosphazine. Example of polyamines include: polyethylenimine, polylysine (PLL), spermine, spermidine, polyamine, pseudopeptide-polyamine, peptidomimetic polyamine, dendrimer polyamine, arginine, amidine, protamine, cationic lipid, cationic porphyrin, quaternary salt of a polyamine, or an alpha helical peptide.


In some embodiments, the conjugate can function as a carrier for the polynucleotide disclosed herein. The conjugate can comprise a cationic polymer such as, but not limited to, polyamine, polylysine, polyalkylenimine, and polyethylenimine that can be grafted to with poly(ethylene glycol). Exemplary conjugates and their preparations are described in U.S. Pat. No. 6,586,524 and U.S. Pub. No. US20130211249, each of which herein is incorporated by reference in its entirety.


The conjugates can also include targeting groups, e.g., a cell or tissue targeting agent, e.g., a lectin, glycoprotein, lipid or protein, e.g., an antibody, that binds to a specified cell type such as a kidney cell. A targeting group can be a thyrotropin, melanotropin, lectin, glycoprotein, surfactant protein A, Mucin carbohydrate, multivalent lactose, multivalent galactose, N-acetyl-galactosamine, N-acetyl-glucosamine multivalent mannose, multivalent fucose, glycosylated polyaminoacids, multivalent galactose, transferrin, bisphosphonate, polyglutamate, polyaspartate, a lipid, cholesterol, a steroid, bile acid, folate, vitamin B12, biotin, an RGD peptide, an RGD peptide mimetic or an aptamer.


Targeting groups can be proteins, e.g., glycoproteins, or peptides, e.g., molecules having a specific affinity for a co-ligand, or antibodies e.g., an antibody, that binds to a specified cell type such as a cancer cell, endothelial cell, or bone cell. Targeting groups can also include hormones and hormone receptors. They can also include non-peptidic species, such as lipids, lectins, carbohydrates, vitamins, cofactors, multivalent lactose, multivalent galactose, N-acetyl-galactosamine, N-acetyl-glucosamine multivalent mannose, multivalent frucose, or aptamers. The ligand can be, for example, a lipopolysaccharide, or an activator of p38 MAP kinase.


The targeting group can be any ligand that is capable of targeting a specific receptor. Examples include, without limitation, folate, GalNAc, galactose, mannose, mannose-6P, apatamers, integrin receptor ligands, chemokine receptor ligands, transferrin, biotin, serotonin receptor ligands, PSMA, endothelin, GCPII, somatostatin, LDL, and HDL ligands. In particular embodiments, the targeting group is an aptamer. The aptamer can be unmodified or have any combination of modifications disclosed herein. As a non-limiting example, the targeting group can be a glutathione receptor (GR)-binding conjugate for targeted delivery across the blood-central nervous system barrier as described in, e.g., U.S. Pub. No. US2013021661012 (herein incorporated by reference in its entirety).


In some embodiments, the conjugate can be a synergistic biomolecule-polymer conjugate, which comprises a long-acting continuous-release system to provide a greater therapeutic efficacy. The synergistic biomolecule-polymer conjugate can be those described in U.S. Pub. No. US20130195799. In some embodiments, the conjugate can be an aptamer conjugate as described in Intl. Pat. Pub. No. W02012040524. In some embodiments, the conjugate can be an amine containing polymer conjugate as described in U.S. Pat. No. 8,507,653. Each of the references is herein incorporated by reference in its entirety. In some embodiments, the polynucleotides can be conjugated to SMARTT POLYMER TECHNOLOGY® (PHASERX®, Inc. Seattle, Wash.).


In some embodiments, the polynucleotides described herein are covalently conjugated to a cell penetrating polypeptide, which can also include a signal sequence or a targeting sequence. The conjugates can be designed to have increased stability, and/or increased cell transfection; and/or altered the biodistribution (e.g., targeted to specific tissues or cell types).


In some embodiments, the polynucleotides described herein can be conjugated to an agent to enhance delivery. In some embodiments, the agent can be a monomer or polymer such as a targeting monomer or a polymer having targeting blocks as described in Intl. Pub. No. WO2011062965. In some embodiments, the agent can be a transport agent covalently coupled to a polynucleotide as described in, e.g., U.S. Pat. Nos. 6,835.393 and 7,374,778. In some embodiments, the agent can be a membrane barrier transport enhancing agent such as those described in U.S. Pat. Nos. 7,737,108 and 8,003,129. Each of the references is herein incorporated by reference in its entirety.


Methods of Use


The polynucleotides, pharmaceutical compositions and formulations described herein are used in the preparation, manufacture and therapeutic use of to treat and/or prevent Factor VIII-related diseases, disorders or conditions. In some embodiments, the polynucleotides, compositions and formulations of the present disclosure are used to treat and/or prevent Hemophilia A.


In some embodiments, the polynucleotides, pharmaceutical compositions and formulations of the present disclosure are used in methods for preventing bleeding in a subject in need thereof. For instance, one aspect of the present disclosure provides a method of alleviating the signs and symptoms of Hemophilia A in a subject comprising the administration of a composition or formulation comprising a polynucleotide encoding Factor VIII to that subject (e.g, an mRNA encoding a Factor VIII polypeptide).


In some embodiments, the administration of an effective amount of a polynucleotide, pharmaceutical composition or formulation of the present disclosure reduces the levels of a biomarker of Hemophilia A. In some embodiments, the administration of the polynucleotide, pharmaceutical composition or formulation of the present disclosure results in reduction in the level of one or more biomarkers of Hemophilia A, such as functional biomarkers e.g. clotting rate, within a short period of time after administration of the polynucleotide, pharmaceutical composition or formulation of the present disclosure.


Replacement therapy is a potential treatment for Hemophilia A. Thus, in certain aspects of the present disclosure, the polynucleotides, e.g., mRNA, disclosed herein comprise one or more sequences encoding a Factor VIII polypeptide that is suitable for use in gene replacement therapy for Hemophilia A. In some embodiments, the present disclosure treats a lack of Factor VIII or Factor VIII activity, or decreased or abnornal Factor VIII activity in a subject by providing a polynucleotide, e.g., mRNA, that encodes a Factor VIII polypeptide to the subject. In some embodiments, the polynucleotide is sequence-optimized. In some embodiments, the polynucleotide (e.g., an mRNA) comprises a nucleic acid sequence (e.g., an ORF) encoding a Factor VIII polypeptide, wherein the nucleic acid is sequence-optimized, e.g., by modifying its G/C, uridine, or thymidine content, and/or the polynucleotide comprises at least one chemically modified nucleoside. In some embodiments, the polynucleotide comprises a miRNA binding site, e.g., a miRNA binding site that binds miRNA-142.


In some embodiments, the administration of a composition or formulation comprising polynucleotide, pharmaceutical composition or formulation of the present disclosure to a subject results in a decrease in bleeding to a level at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or to 100% lower than the level observed prior to the administration of the composition or formulation.


In some embodiments, the administration of the polynucleotide, pharmaceutical composition or formulation of the present disclosure results in expression of Factor VIII in cells of the subject. In some embodiments, administering the polynucleotide, pharmaceutical composition or formulation of the present disclosure results in prevention of bleeding in the subject. For example, in some embodiments, the polynucleotides of the present disclosure are used in methods of administering a composition or formulation comprising an mRNA encoding a Factor VIII polypeptide to a subject, wherein the method results in a decrease in bleeding in a subject.


In some embodiments, the administration of a composition or formulation comprising an mRNA encoding a Factor VIII polypeptide to a subject results in a decrease in bleeding in a subject to a level at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or to 100% or more of the activity level expected in a normal subject, e.g., a human not suffering from Hemophilia A.


In some embodiments, the administration of the polynucleotide, pharmaceutical composition or formulation of the present disclosure results in expression of Factor VIII protein in at least some of the cells of a subject that persists for a period of time sufficient to allow reduction in bleeding levels or susceptibility to occur.


In some embodiments, the expression of the encoded polypeptide is increased. In some embodiments, the polynucleotide increases Factor VIII expression levels in cells when introduced into those cells, e.g., by at least 10%, at least 15%, at least 20%, at least 25%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or to 100% with respect to the Factor VIII expression level in the cells before the polypeptide is introduced in the cells.


In some embodiments, the method or use comprises administering a polynucleotide, e.g., mRNA, comprising a nucleotide sequence having sequence similarity to a polynucleotide of SEQ ID NO: 3, 4, 127-135, or 166-169, wherein the polynucleotide encodes a Factor VIII polypeptide.


Compositions and Formulations for Use


Certain aspects of the present disclosure are directed to compositions or formulations comprising any of the polynucleotides disclosed above.


In some embodiments, the composition or formulation comprises:


(i) a polynucleotide (e.g., a RNA, e.g., an mRNA) comprising a sequence-optimized nucleotide sequence (e.g., an ORF) encoding a Factor VIII polypeptide (e.g., the wild-type sequence, functional fragment, or variant thereof), wherein the polynucleotide comprises at least one chemically modified nucleobase, e.g., modified uracil(e.g., wherein at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or 100% of the uracils are 5-methoxyuracils), and wherein the polynucleotide further comprises a miRNA binding site, e.g., a miRNA binding site that binds to miR-142 (e.g., a miR-142-3p or miR-142-5p binding site); and


(ii) a delivery agent comprising a compound having Formula (X), e.g., any of Compounds 1-232 (e.g., Compound 18, 25, 26 or 48).


In some embodiments, the uracil or thymine content of the ORF relative to the theoretical minimum uracil or thymine content of a nucleotide sequence encoding the Factor VIII polypeptide (% UTM or % TTM), is between about 100% and about 150%.


In some embodiments, the polynucleotides, compositions or formulations above are used to treat and/or prevent a Factor VIII-related diseases, disorders or conditions, e.g., Hemophilia A.


Forms of Administration


The polynucleotides, pharmaceutical compositions and formulations of the present disclosure described above can be administered by any route that results in a therapeutically effective outcome. These include, but are not limited to enteral (into the intestine), gastroenteral, epidural (into the dura matter), oral (by way of the mouth), transdermal, peridural, intracerebral (into the cerebrum), intracerebroventricular (into the cerebral ventricles), epicutaneous (application onto the skin), intradermal, (into the skin itself), subcutaneous (under the skin), nasal administration (through the nose), intravenous (into a vein), intravenous bolus, intravenous drip, intraarterial (into an artery), intramuscular (into a muscle), intracardiac (into the heart), intraosseous infusion (into the bone marrow), intrathecal (into the spinal canal), intraperitoneal, (infusion or injection into the peritoneum), intravesical infusion, intravitreal, (through the eye), intracavernous injection (into a pathologic cavity) intracavitary (into the base of the penis), intravaginal administration, intrauterine, extra-amniotic administration, transdermal (diffusion through the intact skin for systemic distribution), transmucosal (diffusion through a mucous membrane), transvaginal, insufflation (snorting), sublingual, sublabial, enema, eye drops (onto the conjunctiva), in ear drops, auricular (in or by way of the ear), buccal (directed toward the cheek), conjunctival, cutaneous, dental (to a tooth or teeth), electro-osmosis, endocervical, endosinusial, endotracheal, extracorporeal, hemodialysis, infiltration, interstitial, intra-abdominal, intra-amniotic, intra-articular, intrabiliary, intrabronchial, intrabursal, intracartilaginous (within a cartilage), intracaudal (within the cauda equine), intracisternal (within the cisterna magna cerebellomedularis), intracorneal (within the cornea), dental intracornal, intracoronary (within the coronary arteries), intracorporus cavernosum (within the dilatable spaces of the corporus cavernosa of the penis), intradiscal (within a disc), intraductal (within a duct of a gland), intraduodenal (within the duodenum), intradural (within or beneath the dura), intraepidermal (to the epidermis), intraesophageal (to the esophagus), intragastric (within the stomach), intragingival (within the gingivae), intraileal (within the distal portion of the small intestine), intralesional (within or introduced directly to a localized lesion), intraluminal (within a lumen of a tube), intralymphatic (within the lymph), intramedullary (within the marrow cavity of a bone), intrameningeal (within the meninges), intraocular (within the eye), intraovarian (within the ovary), intrapericardial (within the pericardium), intrapleural (within the pleura), intraprostatic (within the prostate gland), intrapulmonary (within the lungs or its bronchi), intrasinal (within the nasal or periorbital sinuses), intraspinal (within the vertebral column), intrasynovial (within the synovial cavity of a joint), intratendinous (within a tendon), intratesticular (within the testicle), intrathecal (within the cerebrospinal fluid at any level of the cerebrospinal axis), intrathoracic (within the thorax), intratubular (within the tubules of an organ), intratumor (within a tumor), intratympanic (within the aurus media), intravascular (within a vessel or vessels), intraventricular (within a ventricle), iontophoresis (by means of electric current where ions of soluble salts migrate into the tissues of the body), irrigation (to bathe or flush open wounds or body cavities), laryngeal (directly upon the larynx), nasogastric (through the nose and into the stomach), occlusive dressing technique (topical route administration that is then covered by a dressing that occludes the area), ophthalmic (to the external eye), oropharyngeal (directly to the mouth and pharynx), parenteral, percutaneous, periarticular, peridural, perineural, periodontal, rectal, respiratory (within the respiratory tract by inhaling orally or nasally for local or systemic effect), retrobulbar (behind the pons or behind the eyeball), intramyocardial (entering the myocardium), soft tissue, subarachnoid, subconjunctival, submucosal, topical, transplacental (through or across the placenta), transtracheal (through the wall of the trachea), transtympanic (across or through the tympanic cavity), ureteral (to the ureter), urethral (to the urethra), vaginal, caudal block, diagnostic, nerve block, biliary perfusion, cardiac perfusion, photopheresis or spinal. In specific embodiments, compositions can be administered in a way that allows them cross the blood-brain barrier, vascular barrier, or other epithelial barrier. In some embodiments, a formulation for a route of administration can include at least one inactive ingredient.


The polynucleotides of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide or a functional fragment or variant thereof) can be delivered to a cell naked. As used herein in, “naked” refers to delivering polynucleotides free from agents that promote transfection. The naked polynucleotides can be delivered to the cell using routes of administration known in the art and described herein.


The polynucleotides of the present disclosure (e.g., a polynucleotide comprising a nucleotide sequence encoding a Factor VIII polypeptide or a functional fragment or variant thereof) can be formulated, using the methods described herein. The formulations can contain polynucleotides that can be modified and/or unmodified. The formulations can further include, but are not limited to, cell penetration agents, a pharmaceutically acceptable carrier, a delivery agent, a bioerodible or biocompatible polymer, a solvent, and a sustained-release delivery depot. The formulated polynucleotides can be delivered to the cell using routes of administration known in the art and described herein.


A pharmaceutical composition for parenteral administration can comprise at least one inactive ingredient. Any or none of the inactive ingredients used can have been approved by the US Food and Drug Administration (FDA). A non-exhaustive list of inactive ingredients for use in pharmaceutical compositions for parenteral administration includes hydrochloric acid, mannitol, nitrogen, sodium acetate, sodium chloride and sodium hydroxide.


Injectable preparations, for example, sterile injectable aqueous or oleaginous suspensions can be formulated according to the known art using suitable dispersing agents, wetting agents, and/or suspending agents. Sterile injectable preparations can be sterile injectable solutions, suspensions, and/or emulsions in nontoxic parenterally acceptable diluents and/or solvents, for example, as a solution in 1,3-butanediol. Among the acceptable vehicles and solvents that can be employed are water, Ringer's solution, U.S.P., and isotonic sodium chloride solution. Sterile, fixed oils are conventionally employed as a solvent or suspending medium. For this purpose any bland fixed oil can be employed including synthetic mono- or diglycerides. Fatty acids such as oleic acid can be used in the preparation of injectables. The sterile formulation can also comprise adjuvants such as local anesthetics, preservatives and buffering agents.


Injectable formulations can be sterilized, for example, by filtration through a bacterial-retaining filter, and/or by incorporating sterilizing agents in the form of sterile solid compositions that can be dissolved or dispersed in sterile water or other sterile injectable medium prior to use.


Injectable formulations can be for direct injection into a region of a tissue, organ and/or subject. As a non-limiting example, a tissue, organ and/or subject can be directly injected a formulation by intramyocardial injection into the ischemic region. (See, e.g., Zangi et al. Nature Biotechnology 2013; the contents of which are herein incorporated by reference in its entirety).


In order to prolong the effect of an active ingredient, it is often desirable to slow the absorption of the active ingredient from subcutaneous or intramuscular injection. This can be accomplished by the use of a liquid suspension of crystalline or amorphous material with poor water solubility. The rate of absorption of the drug then depends upon its rate of dissolution which, in turn, can depend upon crystal size and crystalline form. Alternatively, delayed absorption of a parenterally administered drug form is accomplished by dissolving or suspending the drug in an oil vehicle. Injectable depot forms are made by forming microencapsule matrices of the drug in biodegradable polymers such as polylactide-polyglycolide. Depending upon the ratio of drug to polymer and the nature of the particular polymer employed, the rate of drug release can be controlled. Examples of other biodegradable polymers include poly(orthoesters) and poly(anhydrides). Depot injectable formulations are prepared by entrapping the drug in liposomes or microemulsions that are compatible with body tissues.


Kits and Devices


a. Kits


The present disclosure provides a variety of kits for conveniently and/or effectively using the claimed nucleotides of the present disclosure. Typically kits will comprise sufficient amounts and/or numbers of components to allow a user to perform multiple treatments of a subject(s) and/or to perform multiple experiments.


In one aspect, the present disclosure provides kits comprising the molecules (polynucleotides) of the present disclosure.


Said kits can be for protein production, comprising a first polynucleotides comprising a translatable region. The kit can further comprise packaging and instructions and/or a delivery agent to form a formulation composition. The delivery agent can comprise a saline, a buffered solution, or any delivery agent disclosed herein.


In some embodiments, the buffer solution can include sodium chloride, calcium chloride, phosphate and/or EDTA. In another embodiment, the buffer solution can include, but is not limited to, saline, saline with 2 mM calcium, 5% sucrose, 5% sucrose with 2 mM calcium, 5% Mannitol, 5% Mannitol with 2 mM calcium, Ringer's lactate, sodium chloride, sodium chloride with 2 mM calcium and mannose (See, e.g., U.S. Pub. No. 20120258046; herein incorporated by reference in its entirety). In a further embodiment, the buffer solutions can be precipitated or it can be lyophilized. The amount of each component can be varied to enable consistent, reproducible higher concentration saline or simple buffer formulations. The components can also be varied in order to increase the stability of modified RNA in the buffer solution over a period of time and/or under a variety of conditions. In one aspect, the present disclosure provides kits for protein production, comprising: a polynucleotide comprising a translatable region, provided in an amount effective to produce a desired amount of a protein encoded by the translatable region when introduced into a target cell; a second polynucleotide comprising an inhibitory nucleic acid, provided in an amount effective to substantially inhibit the innate immune response of the cell; and packaging and instructions.


In one aspect, the present disclosure provides kits for protein production, comprising a polynucleotide comprising a translatable region, wherein the polynucleotide exhibits reduced degradation by a cellular nuclease, and packaging and instructions.


In one aspect, the present disclosure provides kits for protein production, comprising a polynucleotide comprising a translatable region, wherein the polynucleotide exhibits reduced degradation by a cellular nuclease, and a mammalian cell suitable for translation of the translatable region of the first nucleic acid.


b. Devices


The present disclosure provides for devices that can incorporate polynucleotides that encode polypeptides of interest. These devices contain in a stable formulation the reagents to synthesize a polynucleotide in a formulation available to be immediately delivered to a subject in need thereof, such as a human patient


Devices for administration can be employed to deliver the polynucleotides of the present disclosure according to single, multi- or split-dosing regimens taught herein. Such devices are taught in, for example, International Application Publ. No. WO2013151666, the contents of which are incorporated herein by reference in their entirety.


Method and devices known in the art for multi-administration to cells, organs and tissues are contemplated for use in conjunction with the methods and compositions disclosed herein as embodiments of the present disclosure. These include, for example, those methods and devices having multiple needles, hybrid devices employing for example lumens or catheters as well as devices utilizing heat, electric current or radiation driven mechanisms.


According to the present disclosure, these multi-administration devices can be utilized to deliver the single, multi- or split doses contemplated herein. Such devices are taught for example in, International Application Publ. No. WO2013151666, the contents of which are incorporated herein by reference in their entirety.


In some embodiments, the polynucleotide is administered subcutaneously or intramuscularly via at least 3 needles to three different, optionally adjacent, sites simultaneously, or within a 60 minutes period (e.g., administration to 4, 5, 6, 7, 8, 9, or 10 sites simultaneously or within a 60 minute period).


c. Methods and Devices Utilizing Catheters and/or Lumens


Methods and devices using catheters and lumens can be employed to administer the polynucleotides of the present disclosure on a single, multi- or split dosing schedule. Such methods and devices are described in International Application Publication No. WO2013151666, the contents of which are incorporated herein by reference in their entirety.


d. Methods and Devices Utilizing Electrical Current


Methods and devices utilizing electric current can be employed to deliver the polynucleotides of the present disclosure according to the single, multi- or split dosing regimens taught herein. Such methods and devices are described in International Application Publication No. WO2013151666, the contents of which are incorporated herein by reference in their entirety.


In order that the present disclosure can be more readily understood, certain terms are first defined. As used in this application, except as otherwise expressly provided herein, each of the following terms shall have the meaning set forth below. Additional definitions are set forth throughout the application.


The present disclosure includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The present disclosure includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.


In this specification and the appended claims, the singular forms “a”, “an” and “the” include plural referents unless the context clearly dictates otherwise. The terms “a” (or “an”), as well as the terms “one or more,” and “at least one” can be used interchangeably herein. In certain aspects, the term “a” or “an” means “single.” In other aspects, the term “a” or “an” includes “two or more” or “multiple.”


Furthermore, “and/or” where used herein is to be taken as specific disclosure of each of the two specified features or components with or without the other. Thus, the term “and/or” as used in a phrase such as “A and/or B” herein is intended to include “A and B,” “A or B,” “A” (alone), and “B” (alone). Likewise, the term “and/or” as used in a phrase such as “A, B, and/or C” is intended to encompass each of the following aspects: A, B, and C; A, B, or C; A or C; A or B; B or C; A and C; A and B; B and C; A (alone); B (alone); and C (alone).


Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure is related. For example, the Concise Dictionary of Biomedicine and Molecular Biology, Juo, Pei-Show, 2nd ed., 2002, CRC Press; The Dictionary of Cell and Molecular Biology, 3rd ed., 1999, Academic Press; and the Oxford Dictionary Of Biochemistry And Molecular Biology, Revised, 2000, Oxford University Press, provide one of skill with a general dictionary of many of the terms used in this disclosure.


Wherever aspects are described herein with the language “comprising,” otherwise analogous aspects described in terms of “consisting of” and/or “consisting essentially of” are also provided.


Units, prefixes, and symbols are denoted in their Systeme International de Unites (SI) accepted form. Numeric ranges are inclusive of the numbers defining the range. Where a range of values is recited, it is to be understood that each intervening integer value, and each fraction thereof, between the recited upper and lower limits of that range is also specifically disclosed, along with each subrange between such values. The upper and lower limits of any range can independently be included in or excluded from the range, and each range where either, neither or both limits are included is also encompassed within the present disclosure. Where a value is explicitly recited, it is to be understood that values which are about the same quantity or amount as the recited value are also within the scope of the present disclosure. Where a combination is disclosed, each subcombination of the elements of that combination is also specifically disclosed and is within the scope of the present disclosure. Conversely, where different elements or groups of elements are individually disclosed, combinations thereof are also disclosed. Where any element of an present disclosure is disclosed as having a plurality of alternatives, examples of that present disclosure in which each alternative is excluded singly or in any combination with the other alternatives are also hereby disclosed; more than one element of an present disclosure can have such exclusions, and all combinations of elements having such exclusions are hereby disclosed.


Nucleotides are referred to by their commonly accepted single-letter codes. Unless otherwise indicated, nucleic acids are written left to right in 5′ to 3′ orientation. Nucleobases are referred to herein by their commonly known one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Accordingly, A represents adenine, C represents cytosine, G represents guanine, T represents thymine, U represents uracil.


Amino acids are referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Unless otherwise indicated, amino acid sequences are written left to right in amino to carboxy orientation.


About: The term “about” as used in connection with a numerical value throughout the specification and the claims denotes an interval of accuracy, familiar and acceptable to a person skilled in the art. Such interval of accuracy is ±10%.


Where ranges are given, endpoints are included. Furthermore, unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or subrange within the stated ranges in different embodiments of the present disclosure, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.


Administered in combination: As used herein, the term “administered in combination” or “combined administration” means that two or more agents are administered to a subject at the same time or within an interval such that there can be an overlap of an effect of each agent on the patient. In some embodiments, they are administered within about 60, 30, 15, 10, 5, or 1 minute of one another. In some embodiments, the administrations of the agents are spaced sufficiently closely together such that a combinatorial (e.g., a synergistic) effect is achieved.


Amino acid substitution: The term “amino acid substitution” refers to replacing an amino acid residue present in a parent or reference sequence (e.g., a wild type Factor VIII sequence) with another amino acid residue. An amino acid can be substituted in a parent or reference sequence (e.g., a wild type Factor VIII polypeptide sequence), for example, via chemical peptide synthesis or through recombinant methods known in the art. Accordingly, a reference to a “substitution at position X” refers to the substitution of an amino acid present at position X with an alternative amino acid residue. In some aspects, substitution patterns can be described according to the schema AnY, wherein A is the single letter code corresponding to the amino acid naturally or originally present at position n, and Y is the substituting amino acid residue. In other aspects, substitution patterns can be described according to the schema An(YZ), wherein A is the single letter code corresponding to the amino acid residue substituting the amino acid naturally or originally present at position X, and Y and Z are alternative substituting amino acid residue, i.e.,


In the context of the present disclosure, substitutions (even when they referred to as amino acid substitution) are conducted at the nucleic acid level, i.e., substituting an amino acid residue with an alternative amino acid residue is conducted by substituting the codon encoding the first amino acid with a codon encoding the second amino acid.


Animal: As used herein, the term “animal” refers to any member of the animal kingdom. In some embodiments, “animal” refers to humans at any stage of development. In some embodiments, “animal” refers to non-human animals at any stage of development. In certain embodiments, the non-human animal is a mammal (e.g., a rodent, a mouse, a rat, a rabbit, a monkey, a dog, a cat, a sheep, cattle, a primate, or a pig). In some embodiments, animals include, but are not limited to, mammals, birds, reptiles, amphibians, fish, and worms. In some embodiments, the animal is a transgenic animal, genetically-engineered animal, or a clone.


Approximately: As used herein, the term “approximately,” as applied to one or more values of interest, refers to a value that is similar to a stated reference value. In certain embodiments, the term “approximately” refers to a range of values that fall within 25%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, or less in either direction (greater than or less than) of the stated reference value unless otherwise stated or otherwise evident from the context (except where such number would exceed 100% of a possible value).


Associated with: As used herein with respect to a disease, the term “associated with” means that the symptom, measurement, characteristic, or status in question is linked to the diagnosis, development, presence, or progression of that disease. As association can, but need not, be causatively linked to the disease. For example, signs and symptoms, sequelae, or any effects causing a decrease in the quality of life of a patient of Hemophilia A are considered associated with Hemophilia A and in some embodiments of the present disclosure can be treated, ameliorated, or prevented by administering the polynucleotides of the present disclosure to a subject in need thereof.


When used with respect to two or more moieties, the terms “associated with,” “conjugated,” “linked,” “attached,” and “tethered,” when used with respect to two or more moieties, means that the moieties are physically associated or connected with one another, either directly or via one or more additional moieties that serves as a linking agent, to form a structure that is sufficiently stable so that the moieties remain physically associated under the conditions in which the structure is used, e.g., physiological conditions. An “association” need not be strictly through direct covalent chemical bonding. It can also suggest ionic or hydrogen bonding or a hybridization based connectivity sufficiently stable such that the “associated” entities remain physically associated.


Bifunctional: As used herein, the term “bifunctional” refers to any substance, molecule or moiety that is capable of or maintains at least two functions. The functions can affect the same outcome or a different outcome. The structure that produces the function can be the same or different. For example, bifunctional modified RNAs of the present disclosure can encode a Factor VIII peptide (a first function) while those nucleosides that comprise the encoding RNA are, in and of themselves, capable of extending the half-life of the RNA (second function). In this example, delivery of the bifunctional modified RNA to a subject suffereing from a protein defficiency would produce not only a peptide or protein molecule that can ameliorate or treat a disease or conditions, but would also maintain a population modified RNA present in the subject for a prolonged period of time. In other aspects, a bifunction modified mRNA can be a chimeric or quimeric molecule comprising, for example, an RNA encoding a Factor VIII peptide (a first function) and a second protein either fused to first protein or co-expressed with the first protein.


Biocompatible: As used herein, the term “biocompatible” means compatible with living cells, tissues, organs or systems posing little to no risk of injury, toxicity or rejection by the immune system.


Biodegradable: As used herein, the term “biodegradable” means capable of being broken down into innocuous products by the action of living things.


Biologically active: As used herein, the phrase “biologically active” refers to a characteristic of any substance that has activity in a biological system and/or organism. For instance, a substance that, when administered to an organism, has a biological effect on that organism, is considered to be biologically active. In particular embodiments, a polynucleotide of the present disclosure can be considered biologically active if even a portion of the polynucleotide is biologically active or mimics an activity considered biologically relevant.


Chimera: As used herein, “chimera” is an entity having two or more incongruous or heterogeneous parts or regions. For example, a chimeric molecule can comprise a first part comprising a Factor VIII polypeptide, and a second part (e.g., genetically fused to the first part) comprising a second therapeutic protein (e.g., a protein with a distinct enzymatic activity, an antigen binding moiety, or a moiety capable of extending the plasma half life of Factor VIII, for example, an Fc region of an antibody).


Sequence Optimization: The term “sequence optimization” refers to a process or series of processes by which nucleobases in a reference nucleic acid sequence are replaced with alternative nucleobases, resulting in a nucleic acid sequence with improved properties, e.g., improved protein expression or decreased immunogenicity.


In general, the goal in sequence optimization is to produce a synonymous nucleotide sequence than encodes the same polypeptide sequence encoded by the reference nucleotide sequence. Thus, there are no amino acid substitutions (as a result of codon optimization) in the polypeptide encoded by the codon optimized nucleotide sequence with respect to the polypeptide encoded by the reference nucleotide sequence.


Codon substitution: The terms “codon substitution” or “codon replacement” in the context of sequence optimization refer to replacing a codon present in a reference nucleic acid sequence with another codon. A codon can be substituted in a reference nucleic acid sequence, for example, via chemical peptide synthesis or through recombinant methods known in the art. Accordingly, references to a “substitution” or “replacement” at a certain location in a nucleic acid sequence (e.g., an mRNA) or within a certain region or subsequence of a nucleic acid sequence (e.g., an mRNA) refer to the substitution of a codon at such location or region with an alternative codon.


As used herein, the terms “coding region” and “region encoding” and grammatical variants thereof, refer to an Open Reading Frame (ORF) in a polynucleotide that upon expression yields a polypeptide or protein.


Compound: As used herein, the term “compound,” is meant to include all stereoisomers and isotopes of the structure depicted. As used herein, the term “stereoisomer” means any geometric isomer (e.g., cis- and trans- isomer), enantiomer, or diastereomer of a compound. The present disclosure encompasses any and all stereoisomers of the compounds described herein, including stereomerically pure forms (e.g., geometrically pure, enantiomerically pure, or diastereomerically pure) and enantiomeric and stereoisomeric mixtures, e.g., racemates. Enantiomeric and stereomeric mixtures of compounds and means of resolving them into their component enantiomers or stereoisomers are well-known. “Isotopes” refers to atoms having the same atomic number but different mass numbers resulting from a different number of neutrons in the nuclei. For example, isotopes of hydrogen include tritium and deuterium. Further, a compound, salt, or complex of the present disclosure can be prepared in combination with solvent or water molecules to form solvates and hydrates by routine methods.


Contacting: As used herein, the term “contacting” means establishing a physical connection between two or more entities. For example, contacting a mammalian cell with a nanoparticle composition means that the mammalian cell and a nanoparticle are made to share a physical connection. Methods of contacting cells with external entities both in vivo and ex vivo are well known in the biological arts. For example, contacting a nanoparticle composition and a mammalian cell disposed within a mammal can be performed by varied routes of administration (e.g., intravenous, intramuscular, intradermal, and subcutaneous) and can involve varied amounts of nanoparticle compositions. Moreover, more than one mammalian cell can be contacted by a nanoparticle composition.


Conservative amino acid substitution: A “conservative amino acid substitution” is one in which the amino acid residue in a protein sequence is replaced with an amino acid residue having a similar side chain. Families of amino acid residues having similar side chains have been defined in the art, including basic side chains (e.g., lysine, arginine, or histidine), acidic side chains (e.g., aspartic acid or glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, or cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, or tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine) and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, or histidine). Thus, if an amino acid in a polypeptide is replaced with another amino acid from the same side chain family, the amino acid substitution is considered to be conservative. In another aspect, a string of amino acids can be conservatively replaced with a structurally similar string that differs in order and/or composition of side chain family members.


Non-conservative amino acid substitution: Non-conservative amino acid substitutions include those in which (i) a residue having an electropositive side chain (e.g., Arg, His or Lys) is substituted for, or by, an electronegative residue (e.g., Glu or Asp), (ii) a hydrophilic residue (e.g., Ser or Thr) is substituted for, or by, a hydrophobic residue (e.g., Ala, Leu, Ile, Phe or Val), (iii) a cysteine or proline is substituted for, or by, any other residue, or (iv) a residue having a bulky hydrophobic or aromatic side chain (e.g., Val, His, Ile or Trp) is substituted for, or by, one having a smaller side chain (e.g., Ala or Ser) or no side chain (e.g., Gly).


Other amino acid substitutions can be readily identified by workers of ordinary skill. For example, for the amino acid alanine, a substitution can be taken from any one of D-alanine, glycine, beta-alanine, L-cysteine and D-cysteine. For lysine, a replacement can be any one of D-lysine, arginine, D-arginine, homo-arginine, methionine, D-methionine, ornithine, or D-ornithine. Generally, substitutions in functionally important regions that can be expected to induce changes in the properties of isolated polypeptides are those in which (i) a polar residue, e.g., serine or threonine, is substituted for (or by) a hydrophobic residue, e.g., leucine, isoleucine, phenylalanine, or alanine; (ii) a cysteine residue is substituted for (or by) any other residue; (iii) a residue having an electropositive side chain, e.g., lysine, arginine or histidine, is substituted for (or by) a residue having an electronegative side chain, e.g., glutamic acid or aspartic acid; or (iv) a residue having a bulky side chain, e.g., phenylalanine, is substituted for (or by) one not having such a side chain, e.g., glycine. The likelihood that one of the foregoing non-conservative substitutions can alter functional properties of the protein is also correlated to the position of the substitution with respect to functionally important regions of the protein: some non-conservative substitutions can accordingly have little or no effect on biological properties.


Conserved: As used herein, the term “conserved” refers to nucleotides or amino acid residues of a polynucleotide sequence or polypeptide sequence, respectively, that are those that occur unaltered in the same position of two or more sequences being compared. Nucleotides or amino acids that are relatively conserved are those that are conserved amongst more related sequences than nucleotides or amino acids appearing elsewhere in the sequences.


In some embodiments, two or more sequences are said to be “completely conserved” if they are 100% identical to one another. In some embodiments, two or more sequences are said to be “highly conserved” if they are at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be “highly conserved” if they are about 70% identical, about 80% identical, about 90% identical, about 95%, about 98%, or about 99% identical to one another. In some embodiments, two or more sequences are said to be “conserved” if they are at least 30% identical, at least 40% identical, at least 50% identical, at least 60% identical, at least 70% identical, at least 80% identical, at least 90% identical, or at least 95% identical to one another. In some embodiments, two or more sequences are said to be “conserved” if they are about 30% identical, about 40% identical, about 50% identical, about 60% identical, about 70% identical, about 80% identical, about 90% identical, about 95% identical, about 98% identical, or about 99% identical to one another. Conservation of sequence can apply to the entire length of an polynucleotide or polypeptide or can apply to a portion, region or feature thereof.


Controlled Release: As used herein, the term “controlled release” refers to a pharmaceutical composition or compound release profile that conforms to a particular pattern of release to effect a therapeutic outcome.


Cyclic or Cyclized: As used herein, the term “cyclic” refers to the presence of a continuous loop. Cyclic molecules need not be circular, only joined to form an unbroken chain of subunits. Cyclic molecules such as the engineered RNA or mRNA of the present disclosure can be single units or multimers or comprise one or more components of a complex or higher order structure.


Cytotoxic: As used herein, “cytotoxic” refers to killing or causing injurious, toxic, or deadly effect on a cell (e.g., a mammalian cell (e.g., a human cell)), bacterium, virus, fungus, protozoan, parasite, prion, or a combination thereof


Delivering: As used herein, the term “delivering” means providing an entity to a destination. For example, delivering a polynucleotide to a subject can involve administering a nanoparticle composition including the polynucleotide to the subject (e.g., by an intravenous, intramuscular, intradermal, or subcutaneous route). Administration of a nanoparticle composition to a mammal or mammalian cell can involve contacting one or more cells with the nanoparticle composition.


Delivery Agent: As used herein, “delivery agent” refers to any substance that facilitates, at least in part, the in vivo, in vitro, or ex vivo delivery of a polynucleotide to targeted cells.


Destabilized: As used herein, the term “destable,” “destabilize,” or “destabilizing region” means a region or molecule that is less stable than a starting, wild-type or native form of the same region or molecule.


Diastereomer: As used herein, the term “diastereomer,” means stereoisomers that are not mirror images of one another and are non-superimposable on one another.


Digest: As used herein, the term “digest” means to break apart into smaller pieces or components. When referring to polypeptides or proteins, digestion results in the production of peptides.


Distal: As used herein, the term “distal” means situated away from the center or away from a point or region of interest.


Domain: As used herein, when referring to polypeptides, the term “domain” refers to a motif of a polypeptide having one or more identifiable structural or functional characteristics or properties (e.g., binding capacity, serving as a site for protein-protein interactions).


Dosing regimen: As used herein, a “dosing regimen” or a “dosing regimen” is a schedule of administration or physician determined regimen of treatment, prophylaxis, or palliative care.


Effective Amount: As used herein, the term “effective amount” of an agent is that amount sufficient to effect beneficial or desired results, for example, clinical results, and, as such, an “effective amount” depends upon the context in which it is being applied. For example, in the context of administering an agent that treats a protein deficiency (e.g., a Factor VIII deficiency), an effective amount of an agent is, for example, an amount of mRNA expressing sufficient Factor VIII to ameliorate, reduce, eliminate, or prevent the signs and symptoms associated with the Factor VIII deficiency, as compared to the severity of the symptom observed without administration of the agent. The term “effective amount” can be used interchangeably with “effective dose,” “therapeutically effective amount,” or “therapeutically effective dose.”


Enantiomer: As used herein, the term “enantiomer” means each individual optically active form of a compound of the present disclosure, having an optical purity or enantiomeric excess (as determined by methods standard in the art) of at least 80% (i.e., at least 90% of one enantiomer and at most 10% of the other enantiomer), at least 90%, or at least 98%.


Encapsulate: As used herein, the term “encapsulate” means to enclose, surround or encase.


Encapsulation Efficiency: As used herein, “encapsulation efficiency” refers to the amount of a polynucleotide that becomes part of a nanoparticle composition, relative to the initial total amount of polynucleotide used in the preparation of a nanoparticle composition. For example, if 97 mg of polynucleotide are encapsulated in a nanoparticle composition out of a total 100 mg of polynucleotide initially provided to the composition, the encapsulation efficiency can be given as 97%. As used herein, “encapsulation” can refer to complete, substantial, or partial enclosure, confinement, surrounding, or encasement.


Encoded protein cleavage signal: As used herein, “encoded protein cleavage signal” refers to the nucleotide sequence that encodes a protein cleavage signal.


Engineered: As used herein, embodiments of the present disclosure are “engineered” when they are designed to have a feature or property, whether structural or chemical, that varies from a starting point, wild type or native molecule.


Enhanced Delivery: As used herein, the term “enhanced delivery” means delivery of more (e.g., at least 1.5 fold more, at least 2-fold more, at least 3-fold more, at least 4-fold more, at least 5-fold more, at least 6-fold more, at least 7-fold more, at least 8-fold more, at least 9-fold more, at least 10-fold more) of a polynucleotide by a nanoparticle to a target tissue of interest (e.g., mammalian liver) compared to the level of delivery of a polynucleotide by a control nanoparticle to a target tissue of interest (e.g., MC3, KC2, or DLinDMA). The level of delivery of a nanoparticle to a particular tissue can be measured by comparing the amount of protein produced in a tissue to the weight of said tissue, comparing the amount of polynucleotide in a tissue to the weight of said tissue, comparing the amount of protein produced in a tissue to the amount of total protein in said tissue, or comparing the amount of polynucleotide in a tissue to the amount of total polynucleotide in said tissue. It will be understood that the enhanced delivery of a nanoparticle to a target tissue need not be determined in a subject being treated, it can be determined in a surrogate such as an animal model (e.g., a rat model).


Exosome: As used herein, “exosome” is a vesicle secreted by mammalian cells or a complex involved in RNA degradation.


Expression: As used herein, “expression” of a nucleic acid sequence refers to one or more of the following events: (1) production of an mRNA template from a DNA sequence (e.g., by transcription); (2) processing of an mRNA transcript (e.g., by splicing, editing, 5′ cap formation, and/or 3′ end processing); (3) translation of an mRNA into a polypeptide or protein; and (4) post-translational modification of a polypeptide or protein.


Ex Vivo: As used herein, the term “ex vivo” refers to events that occur outside of an organism (e.g., animal, plant, or microbe or cell or tissue thereof). Ex vivo events can take place in an environment minimally altered from a natural (e.g., in vivo) environment.


Feature: As used herein, a “feature” refers to a characteristic, a property, or a distinctive element. When referring to polypeptides, “features” are defined as distinct amino acid sequence-based components of a molecule. Features of the polypeptides encoded by the polynucleotides of the present disclosure include surface manifestations, local conformational shape, folds, loops, half-loops, domains, half-domains, sites, termini or any combination thereof.


Formulation: As used herein, a “formulation” includes at least a polynucleotide and one or more of a carrier, an excipient, and a delivery agent.


Fragment: A “fragment,” as used herein, refers to a portion. For example, fragments of proteins can comprise polypeptides obtained by digesting full-length protein isolated from cultured cells. In some embodiments, a fragment is a subsequences of a full length protein (e.g., Factor VIII) wherein N-terminal, and/or C-terminal, and/or internal subsequences have been deleted. In some preferred aspects of the present disclosure, the fragments of a protein of the present disclosure are functional fragments.


Functional: As used herein, a “functional” biological molecule is a biological molecule in a form in which it exhibits a property and/or activity by which it is characterized. Thus, a functional fragment of a polynucleotide of the present disclosure is a polynucleotide capable of expressing a functional Factor VIII fragment. As used herein, a functional fragment of Factor VIII refers to a fragment of wild type Factor VIII (i.e., a fragment of any of its naturally occurring isoforms), or a mutant or variant thereof, wherein the fragment retains a least about 10%, at least about 15%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least about 95% of the biological activity of the corresponding full length protein.


Helper Lipid: As used herein, the term “helper lipid” refers to a compound or molecule that includes a lipidic moiety (for insertion into a lipid layer, e.g., lipid bilayer) and a polar moiety (for interaction with physiologic solution at the surface of the lipid layer). Typically the helper lipid is a phospholipid. A function of the helper lipid is to “complement” the amino lipid and increase the fusogenicity of the bilayer and/or to help facilitate endosomal escape, e.g., of nucleic acid delivered to cells. Helper lipids are also believed to be a key structural component to the surface of the LNP.


Homology: As used herein, the term “homology” refers to the overall relatedness between polymeric molecules, e.g. between nucleic acid molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Generally, the term “homology” implies an evolutionary relationship between two molecules. Thus, two molecules that are homologous will have a common evolutionary ancestor. In the context of the present disclosure, the term homology encompasses both to identity and similarity.


In some embodiments, polymeric molecules are considered to be “homologous” to one another if at least 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 99% of the monomers in the molecule are identical (exactly the same monomer) or are similar (conservative substitutions). The term “homologous” necessarily refers to a comparison between at least two sequences (polynucleotide or polypeptide sequences).


Identity: As used herein, the term “identity” refers to the overall monomer conservation between polymeric molecules, e.g., between polynucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of the percent identity of two polynucleotide sequences, for example, can be performed by aligning the two sequences for optimal comparison purposes (e.g., gaps can be introduced in one or both of a first and a second nucleic acid sequences for optimal alignment and non-identical sequences can be disregarded for comparison purposes). In certain embodiments, the length of a sequence aligned for comparison purposes is at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or 100% of the length of the reference sequence. The nucleotides at corresponding nucleotide positions are then compared. When a position in the first sequence is occupied by the same nucleotide as the corresponding position in the second sequence, then the molecules are identical at that position. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences, taking into account the number of gaps, and the length of each gap, which needs to be introduced for optimal alignment of the two sequences. The comparison of sequences and determination of percent identity between two sequences can be accomplished using a mathematical algorithm. When comparing DNA and RNA, thymine (T) and uracil (U) can be considered equivalent.


Suitable software programs are available from various sources, and for alignment of both protein and nucleotide sequences. One suitable program to determine percent sequence identity is bl2seq, part of the BLAST suite of program available from the U.S. government's National Center for Biotechnology Information BLAST web site (blast.ncbi.nlm.nih.gov). Bl2seq performs a comparison between two sequences using either the BLASTN or BLASTP algorithm. BLASTN is used to compare nucleic acid sequences, while BLASTP is used to compare amino acid sequences. Other suitable programs are, e.g., Needle, Stretcher, Water, or Matcher, part of the EMBOSS suite of bioinformatics programs and also available from the European Bioinformatics Institute (EBI) at www.ebi.ac.uk/Tools/psa.


Sequence alignments can be conducted using methods known in the art such as MAFFT, Clustal (ClustalW, Clustal X or Clustal Omega), MUSCLE, etc.


Different regions within a single polynucleotide or polypeptide target sequence that aligns with a polynucleotide or polypeptide reference sequence can each have their own percent sequence identity. It is noted that the percent sequence identity value is rounded to the nearest tenth. For example, 80.11, 80.12, 80.13, and 80.14 are rounded down to 80.1, while 80.15, 80.16, 80.17, 80.18, and 80.19 are rounded up to 80.2. It also is noted that the length value will always be an integer.


In certain aspects, the percentage identity “%ID” of a first amino acid sequence (or nucleic acid sequence) to a second amino acid sequence (or nucleic acid sequence) is calculated as %ID =100 x (Y/Z), where Y is the number of amino acid residues (or nucleobases) scored as identical matches in the alignment of the first and second sequences (as aligned by visual inspection or a particular sequence alignment program) and Z is the total number of residues in the second sequence. If the length of a first sequence is longer than the second sequence, the percent identity of the first sequence to the second sequence will be higher than the percent identity of the second sequence to the first sequence.


One skilled in the art will appreciate that the generation of a sequence alignment for the calculation of a percent sequence identity is not limited to binary sequence-sequence comparisons exclusively driven by primary sequence data. It will also be appreciated that sequence alignments can be generated by integrating sequence data with data from heterogeneous sources such as structural data (e.g., crystallographic protein structures), functional data (e.g., location of mutations), or phylogenetic data. A suitable program that integrates heterogeneous data to generate a multiple sequence alignment is T-Coffee, available at www.tcoffee.org, and alternatively available, e.g., from the EBI. It will also be appreciated that the final alignment used to calculate percent sequence identity can be curated either automatically or manually.


Immune response: The term “immune response” refers to the action of, for example, lymphocytes, antigen presenting cells, phagocytic cells, granulocytes, and soluble macromolecules produced by the above cells or the liver (including antibodies, cytokines, and complement) that results in selective damage to, destruction of, or elimination from the human body of invading pathogens, cells or tissues infected with pathogens, cancerous cells, or, in cases of autoimmunity or pathological inflammation, normal human cells or tissues. In some cases, the administration of a nanoparticle comprising a lipid component and an encapsulated therapeutic agent can trigger an immune response, which can be caused by (i) the encapsulated therapeutic agent (e.g., an mRNA), (ii) the expression product of such encapsulated therapeutic agent (e.g., a polypeptide encoded by the mRNA), (iii) the lipid component of the nanoparticle, or (iv) a combination thereof.


Inflammatory response: “Inflammatory response” refers to immune responses involving specific and non-specific defense systems. A specific defense system reaction is a specific immune system reaction to an antigen. Examples of specific defense system reactions include antibody responses. A non-specific defense system reaction is an inflammatory response mediated by leukocytes generally incapable of immunological memory, e.g., macrophages, eosinophils and neutrophils. In some aspects, an immune response includes the secretion of inflammatory cytokines, resulting in elevated inflammatory cytokine levels.


Inflammatory cytokines: The term “inflammatory cytokine” refers to cytokines that are elevated in an inflammatory response. Examples of inflammatory cytokines include interleukin-6 (IL-6), CXCL1 (chemokine (C-X-C motif) ligand 1; also known as GROa, interferon-y (IFNy), tumor necrosis factor a (TNFa), interferon y-induced protein 10 (IP-10), or granulocyte-colony stimulating factor (G-CSF). The term inflammatory cytokines includes also other cytokines associated with inflammatory responses known in the art, e.g., interleukin-1 (IL-1), interleukin-8 (IL-8), interleukin-12 (IL-12), interleukin-13 (I1-13), interferon a (IFN-a), etc.


In Vitro: As used herein, the term “in vitro” refers to events that occur in an artificial environment, e.g., in a test tube or reaction vessel, in cell culture, in a Petri dish, etc., rather than within an organism (e.g., animal, plant, or microbe).


In Vivo: As used herein, the term “in vivo” refers to events that occur within an organism (e.g., animal, plant, or microbe or cell or tissue thereof).


Insertional and deletional variants: “Insertional variants” when referring to polypeptides are those with one or more amino acids inserted immediately adjacent to an amino acid at a particular position in a native or starting sequence. “Immediately adjacent” to an amino acid means connected to either the alpha-carboxy or alpha-amino functional group of the amino acid. “Deletional variants” when referring to polypeptides are those with one or more amino acids in the native or starting amino acid sequence removed. Ordinarily, deletional variants will have one or more amino acids deleted in a particular region of the molecule.


Intact: As used herein, in the context of a polypeptide, the term “intact” means retaining an amino acid corresponding to the wild type protein, e.g., not mutating or substituting the wild type amino acid. Conversely, in the context of a nucleic acid, the term “intact” means retaining a nucleobase corresponding to the wild type nucleic acid, e.g., not mutating or substituting the wild type nucleobase.


Ionizable amino lipid: The term “ionizable amino lipid” includes those lipids having one, two, three, or more fatty acid or fatty alkyl chains and a pH-titratable amino head group (e.g., an alkylamino or dialkylamino head group). An ionizable amino lipid is typically protonated (i.e., positively charged) at a pH below the pKa of the amino head group and is substantially not charged at a pH above the pKa. Such ionizable amino lipids include, but are not limited to DLin-MC3-DMA (MC3) and (13Z,165Z)-N,N-dimethyl-3-nonydocosa-13-16-dien-1-amine (L608).


Isolated: As used herein, the term “isolated” refers to a substance or entity that has been separated from at least some of the components with which it was associated (whether in nature or in an experimental setting). Isolated substances (e.g., polynucleotides or polypeptides) can have varying levels of purity in reference to the substances from which they have been isolated. Isolated substances and/or entities can be separated from at least about 10%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%, about 90%, or more of the other components with which they were initially associated. In some embodiments, isolated substances are more than about 80%, about 85%, about 90%, about 91%, about 92%, about 93%, about 94%, about 95%, about 96%, about 97%, about 98%, about 99%, or more than about 99% pure. As used herein, a substance is “pure” if it is substantially free of other components.


Substantially isolated: By “substantially isolated” is meant that the compound is substantially separated from the environment in which it was formed or detected. Partial separation can include, for example, a composition enriched in the compound of the present disclosure. Substantial separation can include compositions containing at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 97%, or at least about 99% by weight of the compound of the present disclosure, or salt thereof.


A polynucleotide, vector, polypeptide, cell, or any composition disclosed herein which is “isolated” is a polynucleotide, vector, polypeptide, cell, or composition which is in a form not found in nature. Isolated polynucleotides, vectors, polypeptides, or compositions include those which have been purified to a degree that they are no longer in a form in which they are found in nature. In some aspects, a polynucleotide, vector, polypeptide, or composition which is isolated is substantially pure.


Isomer: As used herein, the term “isomer” means any tautomer, stereoisomer, enantiomer, or diastereomer of any compound of the present disclosure. It is recognized that the compounds of the present disclosure can have one or more chiral centers and/or double bonds and, therefore, exist as stereoisomers, such as double-bond isomers (i.e., geometric E/Z isomers) or diastereomers (e.g., enantiomers (i.e., (+) or (−)) or cis/trans isomers). According to the present disclosure, the chemical structures depicted herein, and therefore the compounds of the present disclosure, encompass all of the corresponding stereoisomers, that is, both the stereomerically pure form (e.g., geometrically pure, enantiomerically pure, or diastereomerically pure) and enantiomeric and stereoisomeric mixtures, e.g., racemates. Enantiomeric and stereoisomeric mixtures of compounds of the present disclosure can typically be resolved into their component enantiomers or stereoisomers by well-known methods, such as chiral-phase gas chromatography, chiral-phase high performance liquid chromatography, crystallizing the compound as a chiral salt complex, or crystallizing the compound in a chiral solvent. Enantiomers and stereoisomers can also be obtained from stereomerically or enantiomerically pure intermediates, reagents, and catalysts by well-known asymmetric synthetic methods.


Linker: As used herein, a “linker” refers to a group of atoms, e.g., 10-1,000 atoms, and can be comprised of the atoms or groups such as, but not limited to, carbon, amino, alkylamino, oxygen, sulfur, sulfoxide, sulfonyl, carbonyl, and imine. The linker can be attached to a modified nucleoside or nucleotide on the nucleobase or sugar moiety at a first end, and to a payload, e.g., a detectable or therapeutic agent, at a second end. The linker can be of sufficient length as to not interfere with incorporation into a nucleic acid sequence. The linker can be used for any useful purpose, such as to form polynucleotide multimers (e.g., through linkage of two or more chimeric polynucleotides molecules or IVT polynucleotides) or polynucleotides conjugates, as well as to administer a payload, as described herein. Examples of chemical groups that can be incorporated into the linker include, but are not limited to, alkyl, alkenyl, alkynyl, amido, amino, ether, thioether, ester, alkylene, heteroalkylene, aryl, or heterocyclyl, each of which can be optionally substituted, as described herein. Examples of linkers include, but are not limited to, unsaturated alkanes, polyethylene glycols (e.g., ethylene or propylene glycol monomeric units, e.g., diethylene glycol, dipropylene glycol, triethylene glycol, tripropylene glycol, tetraethylene glycol, or tetraethylene glycol), and dextran polymers and derivatives thereof, Other examples include, but are not limited to, cleavable moieties within the linker, such as, for example, a disulfide bond (—S—S—) or an azo bond (—N═N—), which can be cleaved using a reducing agent or photolysis. Non-limiting examples of a selectively cleavable bond include an amido bond can be cleaved for example by the use of tris(2-carboxyethyl)phosphine (TCEP), or other reducing agents, and/or photolysis, as well as an ester bond can be cleaved for example by acidic or basic hydrolysis.


Linkers and Cleavable Peptides: In certain embodiments, the mRNAs of the disclosure encode more than one peptide, referred to herein as multimer constructs. In certain embodiments of the multimer constructs, the mRNA further encodes a linker located between each domain. The linker can be, for example, a cleavable linker or protease-sensitive linker. In certain embodiments, the linker is selected from the group consisting of F2A linker, P2A linker, T2A linker, E2A linker, and combinations thereof This family of self-cleaving peptide linkers, referred to as 2A peptides, has been described in the art (see for example, Kim, J.H. et al. (2011) PLoS ONE6:e18556). In certain embodiments, the linker is an F2A linker. In certain embodiments, the linker is a GGGS linker. In certain embodiments, the multimer construct contains three domains with intervening linkers, having the structure: domain-linker-domain-linker-domain. The skilled artisan will likewise appreciate that other multicistronic constructs may be suitable for use in the invention. In exemplary embodiments, the construct design yields approximately equimolar amounts of intrabody and/or domain thereof encoded by the constructs of the invention. In one embodiment, the self-cleaving peptide may be, but is not limited to, a 2A peptide. A variety of 2A peptides are known and available in the art and may be used, including e.g., the foot and mouth disease virus (FMDV) 2A peptide, the equine rhinitis A virus 2A peptide, the Thosea asigna virus 2A peptide, and the porcine teschovirus-1 2A peptide. 2A peptides are used by several viruses to generate two proteins from one transcript by ribosome-skipping, such that a normal peptide bond is impaired at the 2A peptide sequence, resulting in two discontinuous proteins being produced from one translation event. As a non-limiting example, the 2A peptide may have the protein sequence: GSGATNFSLLKQAGDVEENPGP (SEQ ID NO: 71), fragments or variants thereof. In one embodiment, the 2A peptide cleaves between the last glycine and last proline. The polynucleotide sequence of the 2A peptide may be modified or codon optimized by the methods described herein and/or are known in the art.


Methods of Administration: As used herein, “methods of administration” can include intravenous, intramuscular, intradermal, subcutaneous, or other methods of delivering a composition to a subject. A method of administration can be selected to target delivery (e.g., to specifically deliver) to a specific region or system of a body.


Modified: As used herein “modified” or “modification” refers to a changed state or a change in composition or structure of a polynucleotide (e.g., mRNA). Polynucleotides may be modified in various ways including chemically, structurally, and/or functionally. For example, polynucleotides may be structurally modified by the incorporation of one or more RNA elements, wherein the RNA element comprises a sequence and/or an RNA secondary structure(s) that provides one or more functions (e.g., translational regulatory activity). Accordingly, polynucleotides of the disclosure may be comprised of one or more modifications (e.g., may include one or more chemical, structural, or functional modifications, including any combination thereof).


Mucus: As used herein, “mucus” refers to the natural substance that is viscous and comprises mucin glycoproteins.


Nanoparticle Composition: As used herein, a “nanoparticle composition” is a composition comprising one or more lipids. Nanoparticle compositions are typically sized on the order of micrometers or smaller and can include a lipid bilayer. Nanoparticle compositions encompass lipid nanoparticles (LNPs), liposomes (e.g., lipid vesicles), and lipoplexes. For example, a nanoparticle composition can be a liposome having a lipid bilayer with a diameter of 500 nm or less.


Naturally occurring: As used herein, “naturally occurring” means existing in nature without artificial aid.


Non-human vertebrate: As used herein, a “non-human vertebrate” includes all vertebrates except Homo sapiens, including wild and domesticated species. Examples of non-human vertebrates include, but are not limited to, mammals, such as alpaca, banteng, bison, camel, cat, cattle, deer, dog, donkey, gayal, goat, guinea pig, horse, llama, mule, pig, rabbit, reindeer, sheep water buffalo, and yak.


Nucleic acid sequence: The terms “nucleic acid sequence,” “nucleotide sequence,” or “polynucleotide sequence” are used interchangeably and refer to a contiguous nucleic acid sequence. The sequence can be either single stranded or double stranded DNA or RNA, e.g., an mRNA.


The term “nucleic acid,” in its broadest sense, includes any compound and/or substance that comprises a polymer of nucleotides. These polymers are often referred to as polynucleotides. Exemplary nucleic acids or polynucleotides of the present disclosure include, but are not limited to, ribonucleic acids (RNAs), deoxyribonucleic acids (DNAs), threose nucleic acids (TNAs), glycol nucleic acids (GNAs), peptide nucleic acids (PNAs), locked nucleic acids (LNAs, including LNA having a (3-D-ribo configuration, a-LNA having an a-L-ribo configuration (a diastereomer of LNA), 2′-amino-LNA having a 2′-amino functionalization, and 2′-amino- a-LNA having a 2′-amino functionalization), ethylene nucleic acids (ENA), cyclohexenyl nucleic acids (CeNA) or hybrids or combinations thereof.


The phrase “nucleotide sequence encoding” refers to the nucleic acid (e.g., an mRNA or DNA molecule) coding sequence which encodes a polypeptide. The coding sequence can further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to which the nucleic acid is administered. The coding sequence can further include sequences that encode signal peptides.


Off-target: As used herein, “off target” refers to any unintended effect on any one or more target, gene, or cellular transcript.


Open reading frame: As used herein, “open reading frame” or “ORF” refers to a sequence which does not contain a stop codon in a given reading frame.


Operably linked: As used herein, the phrase “operably linked” refers to a functional connection between two or more molecules, constructs, transcripts, entities, moieties or the like.


Optionally substituted: Herein a phrase of the form “optionally substituted X” (e.g., optionally substituted alkyl) is intended to be equivalent to “X, wherein X is optionally substituted” (e.g., “alkyl, wherein said alkyl is optionally substituted”). It is not intended to mean that the feature “X” (e.g., alkyl) per se is optional.


Part: As used herein, a “part” or “region” of a polynucleotide is defined as any portion of the polynucleotide that is less than the entire length of the polynucleotide.


Patient: As used herein, “patient” refers to a subject who can seek or be in need of treatment, requires treatment, is receiving treatment, will receive treatment, or a subject who is under care by a trained professional for a particular disease or condition.


Factor VIII Associated Disease: As use herein the terms “Factor VIII-associated disease” or “Factor VIII-associated disorder” refer to diseases or disorders, respectively, which result from aberrant Factor VIII activity (e.g., decreased activity or increased activity). As a non-limiting example, Hemophilia A is a Factor VIII associated disease. Numerous clinical variants of Hemophilia A are know in the art. See, e.g., www.omim.org/entry/118450.


The terms “Factor VIII binding activity,” and “Factor VIII activity,” are used interchangeably in the present disclosure and refer to Factor VIII's ability to function as a cofactor in the intrinsic pathway of blood coagulation. Accordingly, a fragment or variant retaining or having Factor VIII activity or Factor VIII activity refers to a fragment or variant that has measurable ability to function as a cofactor in the intrinsic pathway of blood coagulation, ultimately reducing susceptibility to bleeding in a subject.


Pharmaceutically acceptable: The phrase “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and/or dosage forms that are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.


Pharmaceutically acceptable excipients: The phrase “pharmaceutically acceptable excipient,” as used herein, refers any ingredient other than the compounds described herein (for example, a vehicle capable of suspending or dissolving the active compound) and having the properties of being substantially nontoxic and non-inflammatory in a patient. Excipients can include, for example: antiadherents, antioxidants, binders, coatings, compression aids, disintegrants, dyes (colors), emollients, emulsifiers, fillers (diluents), film formers or coatings, flavors, fragrances, glidants (flow enhancers), lubricants, preservatives, printing inks, sorbents, suspensing or dispersing agents, sweeteners, and waters of hydration. Exemplary excipients include, but are not limited to: butylated hydroxytoluene (BHT), calcium carbonate, calcium phosphate (dibasic), calcium stearate, croscarmellose, crosslinked polyvinyl pyrrolidone, citric acid, crospovidone, cysteine, ethylcellulose, gelatin, hydroxypropyl cellulose, hydroxypropyl methylcellulose, lactose, magnesium stearate, maltitol, mannitol, methionine, methylcellulose, methyl paraben, microcrystalline cellulose, polyethylene glycol, polyvinyl pyrrolidone, povidone, pregelatinized starch, propyl paraben, retinyl palmitate, shellac, silicon dioxide, sodium carboxymethyl cellulose, sodium citrate, sodium starch glycolate, sorbitol, starch (corn), stearic acid, sucrose, talc, titanium dioxide, vitamin A, vitamin E, vitamin C, and xylitol.


Pharmaceutically acceptable salts: The present disclosure also includes pharmaceutically acceptable salts of the compounds described herein. As used herein, “pharmaceutically acceptable salts” refers to derivatives of the disclosed compounds wherein the parent compound is modified by converting an existing acid or base moiety to its salt form (e.g., by reacting the free base group with a suitable organic acid). Examples of pharmaceutically acceptable salts include, but are not limited to, mineral or organic acid salts of basic residues such as amines; alkali or organic salts of acidic residues such as carboxylic acids; and the like. Representative acid addition salts include acetate, acetic acid, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzene sulfonic acid, benzoate, bisulfate, borate, butyrate, camphorate, camphorsulfonate, citrate, cyclopentanepropionate, digluconate, dodecylsulfate, ethanesulfonate, fumarate, glucoheptonate, glycerophosphate, hemisulfate, heptonate, hexanoate, hydrobromide, hydrochloride, hydroiodide, 2-hydroxy-ethanesulfonate, lactobionate, lactate, laurate, lauryl sulfate, malate, maleate, malonate, methanesulfonate, 2-naphthalenesulfonate, nicotinate, nitrate, oleate, oxalate, palmitate, pamoate, pectinate, persulfate, 3-phenylpropionate, phosphate, picrate, pivalate, propionate, stearate, succinate, sulfate, tartrate, thiocyanate, toluenesulfonate, undecanoate, valerate salts, and the like. Representative alkali or alkaline earth metal salts include sodium, lithium, potassium, calcium, magnesium, and the like, as well as nontoxic ammonium, quaternary ammonium, and amine cations, including, but not limited to ammonium, tetramethylammonium, tetraethylammonium, methylamine, dimethylamine, trimethylamine, triethylamine, ethylamine, and the like. The pharmaceutically acceptable salts of the present disclosure include the conventional non-toxic salts of the parent compound formed, for example, from non-toxic inorganic or organic acids. The pharmaceutically acceptable salts of the present disclosure can be synthesized from the parent compound that contains a basic or acidic moiety by conventional chemical methods. Generally, such salts can be prepared by reacting the free acid or base forms of these compounds with a stoichiometric amount of the appropriate base or acid in water or in an organic solvent, or in a mixture of the two; generally, nonaqueous media like ether, ethyl acetate, ethanol, isopropanol, or acetonitrile are used. Lists of suitable salts are found in Remington's Pharmaceutical Sciences, 17th ed., Mack Publishing Company, Easton, Pa., 1985, p. 1418, Pharmaceutical Salts: Properties, Selection, and Use, P. H. Stahl and C. G. Wermuth (eds.), Wiley-VCH, 2008, and Berge et al., Journal of Pharmaceutical Science, 66, 1-19 (1977), each of which is incorporated herein by reference in its entirety.


Pharmaceutically acceptable solvate: The term “pharmaceutically acceptable solvate,” as used herein, means a compound of the present disclosure wherein molecules of a suitable solvent are incorporated in the crystal lattice. A suitable solvent is physiologically tolerable at the dosage administered. For example, solvates can be prepared by crystallization, recrystallization, or precipitation from a solution that includes organic solvents, water, or a mixture thereof. Examples of suitable solvents are ethanol, water (for example, mono-, di-, and tri-hydrates), N-methylpyrrolidinone (NMP), dimethyl sulfoxide (DMSO), N,N′-dimethylformamide (DMF), N,N′-dimethylacetamide (DMAC), 1,3-dimethyl-2-imidazolidinone (DMEU), 1,3-dimethyl-3,4,5,6-tetrahydro-2-(1H)-pyrimidinone (DMPU), acetonitrile (ACN), propylene glycol, ethyl acetate, benzyl alcohol, 2-pyrrolidone, benzyl benzoate, and the like. When water is the solvent, the solvate is referred to as a “hydrate.”


Pharmacokinetic: As used herein, “pharmacokinetic” refers to any one or more properties of a molecule or compound as it relates to the determination of the fate of substances administered to a living organism. Pharmacokinetics is divided into several areas including the extent and rate of absorption, distribution, metabolism and excretion. This is commonly referred to as ADME where: (A) Absorption is the process of a substance entering the blood circulation; (D) Distribution is the dispersion or dissemination of substances throughout the fluids and tissues of the body; (M) Metabolism (or Biotransformation) is the irreversible transformation of parent compounds into daughter metabolites; and (E) Excretion (or Elimination) refers to the elimination of the substances from the body. In rare cases, some drugs irreversibly accumulate in body tissue.


Physicochemical: As used herein, “physicochemical” means of or relating to a physical and/or chemical property.


Polynucleotide: The term “polynucleotide” as used herein refers to polymers of nucleotides of any length, including ribonucleotides, deoxyribonucleotides, analogs thereof, or mixtures thereof This term refers to the primary structure of the molecule. Thus, the term includes triple-, double- and single-stranded deoxyribonucleic acid (“DNA”), as well as triple-, double- and single-stranded ribonucleic acid (“RNA”). It also includes modified, for example by alkylation, and/or by capping, and unmodified forms of the polynucleotide. More particularly, the term “polynucleotide” includes polydeoxyribonucleotides (containing 2-deoxy-D-ribose), polyribonucleotides (containing D-ribose), including tRNA, rRNA, hRNA, siRNA and mRNA, whether spliced or unspliced, any other type of polynucleotide which is an N- or C-glycoside of a purine or pyrimidine base, and other polymers containing normucleotidic backbones, for example, polyamide (e.g., peptide nucleic acids “PNAs”) and polymorpholino polymers, and other synthetic sequence-specific nucleic acid polymers providing that the polymers contain nucleobases in a configuration which allows for base pairing and base stacking, such as is found in DNA and RNA. In particular aspects, the polynucleotide comprises an mRNA. In other aspect, the mRNA is a synthetic mRNA. In some aspects, the synthetic mRNA comprises at least one unnatural nucleobase. In some aspects, all nucleobases of a certain class have been replaced with unnatural nucleobases (e.g., all uridines in a polynucleotide disclosed herein can be replaced with an unnatural nucleobase, e.g., 5-methoxyuridine). In some aspects, the polynucleotide (e.g., a synthetic RNA or a synthetic DNA) comprises only natural nucleobases, i.e., A (adenosine), G (guanosine), C (cytidine), and T (thymidine) in the case of a synthetic DNA, or A, C, G, and U (uridine) in the case of a synthetic RNA.


The skilled artisan will appreciate that the T bases in the codon maps disclosed herein are present in DNA, whereas the T bases would be replaced by U bases in corresponding RNAs. For example, a codon-nucleotide sequence disclosed herein in DNA form, e.g., a vector or an in-vitro translation (IVT) template, would have its T bases transcribed as U based in its corresponding transcribed mRNA. In this respect, both codon-optimized DNA sequences (comprising T) and their corresponding mRNA sequences (comprising U) are considered codon-optimized nucleotide sequence of the present disclosure. A skilled artisan would also understand that equivalent codon-maps can be generated by replaced one or more bases with non-natural bases. Thus, e.g., a TTC codon (DNA map) would correspond to a UUC codon (RNA map), which in turn would correspond to a ΨΨC codon (RNA map in which U has been replaced with pseudouridine).


Standard A-T and G-C base pairs form under conditions which allow the formation of hydrogen bonds between the N3—H and C4-oxy of thymidine and the N1 and C6—NH2, respectively, of adenosine and between the C2-oxy, N3 and C4—NH2, of cytidine and the C2—NH2, N′—H and C6-oxy, respectively, of guanosine. Thus, for example, guanosine (2-amino-6-oxy-9-β-D-ribofuranosyl-purine) can be modified to form isoguanosine (2-oxy-6-amino-9-β-D-ribofuranosyl-purine). Such modification results in a nucleoside base which will no longer effectively form a standard base pair with cytosine. However, modification of cytosine (1-β-D-ribofuranosyl-2-oxy-4-amino-pyrimidine) to form isocytosine (1-β-D-ribofuranosyl-2-amino-4-oxy-pyrimidine-) results in a modified nucleotide which will not effectively base pair with guanosine but will form a base pair with isoguanosine (U.S. Pat. No. 5,681,702 to Collins et al.). Isocytosine is available from Sigma Chemical Co. (St. Louis, Mo.); isocytidine can be prepared by the method described by Switzer et al. (1993) Biochemistry 32:10489-10496 and references cited therein; 2′-deoxy-5-methyl-isocytidine can be prepared by the method of Tor et al., 1993, J. Am. Chem. Soc. 115:4461-4467 and references cited therein; and isoguanine nucleotides can be prepared using the method described by Switzer et al., 1993, supra, and Mantsch et al., 1993, Biochem. 14:5593-5601, or by the method described in U.S. Pat. No. 5,780,610 to Collins et al. Other nonnatural base pairs can be synthesized by the method described in Piccirilli et al., 1990, Nature 343:33-37, for the synthesis of 2,6-diaminopyrimidine and its complement (1-methylpyrazolo-[4,3]pyrimidine-5,7-(4H,6H)-dione. Other such modified nucleotide units which form unique base pairs are known, such as those described in Leach et al. (1992) J. Am. Chem. Soc. 114:3675-3683 and Switzer et al., supra.


Polypeptide: The terms “polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to polymers of amino acids of any length. The polymer can comprise modified amino acids. The terms also encompass an amino acid polymer that has been modified naturally or by intervention; for example, disulfide bond formation, glycosylation, lipidation, acetylation, phosphorylation, or any other manipulation or modification, such as conjugation with a labeling component. Also included within the definition are, for example, polypeptides containing one or more analogs of an amino acid (including, for example, unnatural amino acids such as homocysteine, ornithine, p-acetylphenylalanine, D-amino acids, and creatine), as well as other modifications known in the art.


The term, as used herein, refers to proteins, polypeptides, and peptides of any size, structure, or function. Polypeptides include encoded polynucleotide products, naturally occurring polypeptides, synthetic polypeptides, homologs, orthologs, paralogs, fragments and other equivalents, variants, and analogs of the foregoing. A polypeptide can be a monomer or can be a multi-molecular complex such as a dimer, trimer or tetramer. They can also comprise single chain or multichain polypeptides. Most commonly disulfide linkages are found in multichain polypeptides. The term polypeptide can also apply to amino acid polymers in which one or more amino acid residues are an artificial chemical analogue of a corresponding naturally occurring amino acid. In some embodiments, a “peptide” can be less than or equal to 50 amino acids long, e.g., about 5, 10, 15, 20, 25, 30, 35, 40, 45, or 50 amino acids long.


Polypeptide variant: As used herein, the term “polypeptide variant” refers to molecules that differ in their amino acid sequence from a native or reference sequence. The amino acid sequence variants can possess substitutions, deletions, and/or insertions at certain positions within the amino acid sequence, as compared to a native or reference sequence. Ordinarily, variants will possess at least about 50% identity, at least about 60% identity, at least about 70% identity, at least about 80% identity, at least about 90% identity, at least about 95% identity, at least about 99% identity to a native or reference sequence. In some embodiments, they will be at least about 80%, or at least about 90% identical to a native or reference sequence.


Polypeptide per unit drug (PUD): As used herein, a PUD or product per unit drug, is defined as a subdivided portion of total daily dose, usually 1 mg, pg, kg, etc., of a product (such as a polypeptide) as measured in body fluid or tissue, usually defined in concentration such as pmol/mL, mmol/mL, etc. divided by the measure in the body fluid.


Preventing: As used herein, the term “preventing” refers to partially or completely delaying onset of an infection, disease, disorder and/or condition; partially or completely delaying onset of one or more signs and symptoms, features, or clinical manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying onset of one or more signs and symptoms, features, or manifestations of a particular infection, disease, disorder, and/or condition; partially or completely delaying progression from an infection, a particular disease, disorder and/or condition; and/or decreasing the risk of developing pathology associated with the infection, the disease, disorder, and/or condition.


Proliferate: As used herein, the term “proliferate” means to grow, expand or increase or cause to grow, expand or increase rapidly. “Proliferative” means having the ability to proliferate. “Anti-proliferative” means having properties counter to or inapposite to proliferative properties.


Prophylactic: As used herein, “prophylactic” refers to a therapeutic or course of action used to prevent the spread of disease.


Prophylaxis: As used herein, a “prophylaxis” refers to a measure taken to maintain health and prevent the spread of disease. An “immune prophylaxis” refers to a measure to produce active or passive immunity to prevent the spread of disease.


Protein cleavage site: As used herein, “protein cleavage site” refers to a site where controlled cleavage of the amino acid chain can be accomplished by chemical, enzymatic or photochemical means.


Protein cleavage signal: As used herein “protein cleavage signal” refers to at least one amino acid that flags or marks a polypeptide for cleavage.


Protein of interest: As used herein, the terms “proteins of interest” or “desired proteins” include those provided herein and fragments, mutants, variants, and alterations thereof.


Proximal: As used herein, the term “proximal” means situated nearer to the center or to a point or region of interest.


Pseudouridine: As used herein, pseudouridine (w) refers to the C-glycoside isomer of the nucleoside uridine. A “pseudouridine analog” is any modification, variant, isoform or derivative of pseudouridine. For example, pseudouridine analogs include but are not limited to 1-carboxymethyl-pseudouridine, 1-propynyl-pseudouridine, 1-taurinomethyl-pseudouridine, 1-taurinomethyl-4-thio-pseudouridine, 1-methylpseudouridine 1-methyl-4-thio-pseudouridine (m1s4ψ), 4-thio-1-methyl-pseudouridine, 3-methyl-pseudouridine (m3ψ), 2-thio-1-methyl-pseudouridine, 1-methyl-1-deaza-pseudouridine, 2-thio-1-methyl-1-deaza-pseudouridine, dihydropseudouridine, 2-thio-dihydropseudouridine, 2-methoxyuridine, 2-methoxy-4-thio-uridine, 4-methoxy-pseudouridine, 4-methoxy-2-thio-pseudouridine, N1-methyl-pseudouridine, 1-methyl-3-(3-amino-3-carboxypropyl)pseudouridine (acp3 ψ), and 2′-O-methyl-pseudouridine (ψm).


Purified: As used herein, “purify,” “purified,” “purification” means to make substantially pure or clear from unwanted components, material defilement, admixture or imperfection.


Reference Nucleic Acid Sequence: The term “reference nucleic acid sequence” or “reference nucleic acid” or “reference nucleotide sequence” or “reference sequence” refers to a starting nucleic acid sequence (e.g., a RNA, e.g., an mRNA sequence) that can be sequence optimized. In some embodiments, the reference nucleic acid sequence is a wild type nucleic acid sequence, a fragement or a variant thereof. In some embodiments, the reference nucleic acid sequence is a previously sequence optimized nucleic acid sequence.


Salts: In some aspects, the pharmaceutical composition for intratumoral delivery disclosed herein and comprises salts of some of their lipid constituents. The term “salt” includes any anionic and cationic complex. Non-limiting examples of anions include inorganic and organic anions, e.g., fluoride, chloride, bromide, iodide, oxalate (e.g., hemioxalate), phosphate, phosphonate, hydrogen phosphate, dihydrogen phosphate, oxide, carbonate, bicarbonate, nitrate, nitrite, nitride, bisulfate, sulfide, sulfite, bisulfate, sulfate, thiosulfate, hydrogen sulfate, borate, formate, acetate, benzoate, citrate, tartrate, lactate, acrylate, polyacrylate, fumarate, maleate, itaconate, glycolate, gluconate, malate, mandelate, tiglate, ascorbate, salicylate, polymethacrylate, perchlorate, chlorate, chlorite, hypochlorite, bromate, hypobromite, iodate, an alkylsulfonate, an arylsulfonate, arsenate, arsenite, chromate, dichromate, cyanide, cyanate, thiocyanate, hydroxide, peroxide, permanganate, and mixtures thereof.


Sample: As used herein, the term “sample” or “biological sample” refers to a subset of its tissues, cells or component parts (e.g., body fluids, including but not limited to blood, mucus, lymphatic fluid, synovial fluid, cerebrospinal fluid, saliva, amniotic fluid, amniotic cord blood, urine, vaginal fluid and semen). A sample further can include a homogenate, lysate or extract prepared from a whole organism or a subset of its tissues, cells or component parts, or a fraction or portion thereof, including but not limited to, for example, plasma, serum, spinal fluid, lymph fluid, the external sections of the skin, respiratory, intestinal, and genitourinary tracts, tears, saliva, milk, blood cells, tumors, organs. A sample further refers to a medium, such as a nutrient broth or gel, which can contain cellular components, such as proteins or nucleic acid molecule.


Signal Sequence: As used herein, the phrases “signal sequence,” “signal peptide,” and “transit peptide” are used interchangeably and refer to a sequence that can direct the transport or localization of a protein to a certain organelle, cell compartment, or extracellular export. The term encompasses both the signal sequence polypeptide and the nucleic acid sequence encoding the signal sequence. Thus, references to a signal sequence in the context of a nucleic acid refer in fact to the nucleic acid sequence encoding the signal sequence polypeptide.


Signal transduction pathway: A “signal transduction pathway” refers to the biochemical relationship between a variety of signal transduction molecules that play a role in the transmission of a signal from one portion of a cell to another portion of a cell. As used herein, the phrase “cell surface receptor” includes, for example, molecules and complexes of molecules capable of receiving a signal and the transmission of such a signal across the plasma membrane of a cell.


Similarity: As used herein, the term “similarity” refers to the overall relatedness between polymeric molecules, e.g. between polynucleotide molecules (e.g. DNA molecules and/or RNA molecules) and/or between polypeptide molecules. Calculation of percent similarity of polymeric molecules to one another can be performed in the same manner as a calculation of percent identity, except that calculation of percent similarity takes into account conservative substitutions as is understood in the art.


Single unit dose: As used herein, a “single unit dose” is a dose of any therapeutic administered in one dose/at one time/single route/single point of contact, i.e., single administration event.


Split dose: As used herein, a “split dose” is the division of single unit dose or total daily dose into two or more doses.


Specific delivery: As used herein, the term “specific delivery,” “specifically deliver,” or “specifically delivering” means delivery of more (e.g., at least 1.5 fold more, at least 2-fold more, at least 3-fold more, at least 4-fold more, at least 5-fold more, at least 6-fold more, at least 7-fold more, at least 8-fold more, at least 9-fold more, at least 10-fold more) of a polynucleotide by a nanoparticle to a target tissue of interest (e.g., mammalian liver) compared to an off-target tissue (e.g., mammalian spleen). The level of delivery of a nanoparticle to a particular tissue can be measured by comparing the amount of protein produced in a tissue to the weight of said tissue, comparing the amount of polynucleotide in a tissue to the weight of said tissue, comparing the amount of protein produced in a tissue to the amount of total protein in said tissue, or comparing the amount of polynucleotide in a tissue to the amount of total polynucleotide in said tissue. For example, for renovascular targeting, a polynucleotide is specifically provided to a mammalian kidney as compared to the liver and spleen if 1.5, 2-fold, 3-fold, 5-fold, 10-fold, 15 fold, or 20 fold more polynucleotide per 1 g of tissue is delivered to a kidney compared to that delivered to the liver or spleen following systemic administration of the polynucleotide. It will be understood that the ability of a nanoparticle to specifically deliver to a target tissue need not be determined in a subject being treated, it can be determined in a surrogate such as an animal model (e.g., a rat model).


Stable: As used herein “stable” refers to a compound that is sufficiently robust to survive isolation to a useful degree of purity from a reaction mixture, and in some cases capable of formulation into an efficacious therapeutic agent.


Stabilized: As used herein, the term “stabilize,” “stabilized,” “stabilized region” means to make or become stable.


Stereoisomer: As used herein, the term “stereoisomer” refers to all possible different isomeric as well as conformational forms that a compound can possess (e.g., a compound of any formula described herein), in particular all possible stereochemically and conformationally isomeric forms, all diastereomers, enantiomers and/or conformers of the basic molecular structure. Some compounds of the present disclosure can exist in different tautomeric forms, all of the latter being included within the scope of the present disclosure.


Subject: By “subject” or “individual” or “animal” or “patient” or “mammal,” is meant any subject, particularly a mammalian subject, for whom diagnosis, prognosis, or therapy is desired. Mammalian subjects include, but are not limited to, humans, domestic animals, farm animals, zoo animals, sport animals, pet animals such as dogs, cats, guinea pigs, rabbits, rats, mice, horses, cattle, cows; primates such as apes, monkeys, orangutans, and chimpanzees; canids such as dogs and wolves; felids such as cats, lions, and tigers; equids such as horses, donkeys, and zebras; bears, food animals such as cows, pigs, and sheep; ungulates such as deer and giraffes; rodents such as mice, rats, hamsters and guinea pigs; and so on. In certain embodiments, the mammal is a human subject. In other embodiments, a subject is a human patient. In a particular embodiment, a subject is a human patient in need of treatment.


Substantially: As used herein, the term “substantially” refers to the qualitative condition of exhibiting total or near-total extent or degree of a characteristic or property of interest. One of ordinary skill in the biological arts will understand that biological and chemical characteristics rarely, if ever, go to completion and/or proceed to completeness or achieve or avoid an absolute result. The term “substantially” is therefore used herein to capture the potential lack of completeness inherent in many biological and chemical characteristics.


Substantially equal: As used herein as it relates to time differences between doses, the term means plus/minus 2%.


Substantially simultaneous: As used herein and as it relates to plurality of doses, the term means within 2 seconds.


Suffering from: An individual who is “suffering from” a disease, disorder, and/or condition has been diagnosed with or displays one or more signs and symptoms of the disease, disorder, and/or condition.


Susceptible to: An individual who is “susceptible to” a disease, disorder, and/or condition has not been diagnosed with and/or can not exhibit signs and symptoms of the disease, disorder, and/or condition but harbors a propensity to develop a disease or its signs and symptoms. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition (for example, cancer) can be characterized by one or more of the following: (1) a genetic mutation associated with development of the disease, disorder, and/or condition; (2) a genetic polymorphism associated with development of the disease, disorder, and/or condition; (3) increased and/or decreased expression and/or activity of a protein and/or nucleic acid associated with the disease, disorder, and/or condition; (4) habits and/or lifestyles associated with development of the disease, disorder, and/or condition; (5) a family history of the disease, disorder, and/or condition; and (6) exposure to and/or infection with a microbe associated with development of the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will develop the disease, disorder, and/or condition. In some embodiments, an individual who is susceptible to a disease, disorder, and/or condition will not develop the disease, disorder, and/or condition.


Sustained release: As used herein, the term “sustained release” refers to a pharmaceutical composition or compound release profile that conforms to a release rate over a specific period of time.


Synthetic: The term “synthetic” means produced, prepared, and/or manufactured by the hand of man. Synthesis of polynucleotides or other molecules of the present disclosure can be chemical or enzymatic.


Targeted Cells: As used herein, “targeted cells” refers to any one or more cells of interest. The cells can be found in vitro, in vivo, in situ or in the tissue or organ of an organism. The organism can be an animal, for example a mammal, a human, a subject or a patient.


Target tissue: As used herein “target tissue” refers to any one or more tissue types of interest in which the delivery of a polynucleotide would result in a desired biological and/or pharmacological effect. Examples of target tissues of interest include specific tissues, organs, and systems or groups thereof. In particular applications, a target tissue can be a kidney, a lung, a spleen, vascular endothelium in vessels. An “off-target tissue” refers to any one or more tissue types in which the expression of the encoded protein does not result in a desired biological and/or pharmacological effect. In particular applications, off-target tissues can include the liver and the spleen.


The presence of a therapeutic agent in an off-target issue can be the result of: (i) leakage of a polynucleotide from the administration site to peripheral tissue or distant off-target tissue (e.g., liver) via diffusion or through the bloodstream (e.g., a polynucleotide intended to express a polypeptide in a certain tissue would reach the liver and the polypeptide would be expressed in the liver); or (ii) leakage of an polypeptide after administration of a polynucleotide encoding such polypeptide to peripheral tissue or distant off-target tissue (e.g., liver) via diffusion or through the bloodstream (e.g., a polynucleotide would expressed a polypeptide in the target tissue, and the polypeptide would diffuse to peripheral tissue).


Targeting sequence: As used herein, the phrase “targeting sequence” refers to a sequence that can direct the transport or localization of a protein or polypeptide.


Terminus: As used herein the terms “termini” or “terminus,” when referring to polypeptides, refers to an extremity of a peptide or polypeptide. Such extremity is not limited only to the first or final site of the peptide or polypeptide but can include additional amino acids in the terminal regions. The polypeptide based molecules of the present disclosure can be characterized as having both an N-terminus (terminated by an amino acid with a free amino group (NH2)) and a C-terminus (terminated by an amino acid with a free carboxyl group (COOH)). Proteins of the present disclosure are in some cases made up of multiple polypeptide chains brought together by disulfide bonds or by non-covalent forces (multimers, oligomers). These sorts of proteins will have multiple N- and C-termini. Alternatively, the termini of the polypeptides can be modified such that they begin or end, as the case can be, with a non-polypeptide based moiety such as an organic conjugate.


Therapeutic Agent: The term “therapeutic agent” refers to an agent that, when administered to a subject, has a therapeutic, diagnostic, and/or prophylactic effect and/or elicits a desired biological and/or pharmacological effect. For example, in some embodiments, an mRNA encoding a Factor VIII polypeptide can be a therapeutic agent.


Therapeutically effective amount: As used herein, the term “therapeutically effective amount” means an amount of an agent to be delivered (e.g., nucleic acid, drug, therapeutic agent, diagnostic agent, prophylactic agent, etc.) that is sufficient, when administered to a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve signs and symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.


Therapeutically effective outcome: As used herein, the term “therapeutically effective outcome” means an outcome that is sufficient in a subject suffering from or susceptible to an infection, disease, disorder, and/or condition, to treat, improve signs and symptoms of, diagnose, prevent, and/or delay the onset of the infection, disease, disorder, and/or condition.


Total daily dose: As used herein, a “total daily dose” is an amount given or prescribed in 24 hr. period. The total daily dose can be administered as a single unit dose or a split dose.


Transcription factor: As used herein, the term “transcription factor” refers to a DNA-binding protein that regulates transcription of DNA into RNA, for example, by activation or repression of transcription. Some transcription factors effect regulation of transcription alone, while others act in concert with other proteins. Some transcription factor can both activate and repress transcription under certain conditions. In general, transcription factors bind a specific target sequence or sequences highly similar to a specific consensus sequence in a regulatory region of a target gene. Transcription factors can regulate transcription of a target gene alone or in a complex with other molecules.


Transcription: As used herein, the term “transcription” refers to methods to produce mRNA (e.g., an mRNA sequence or template) from DNA (e.g., a DNA template or sequence).


Transfection: As used herein, “transfection” refers to the introduction of a polynucleotide into a cell wherein a polypeptide encoded by the polynucleotide is expressed (e.g., mRNA) or the polypeptide modulates a cellular function (e.g., siRNA, miRNA). As used herein, “expression” of a nucleic acid sequence refers to translation of a polynucleotide (e.g., an mRNA) into a polypeptide or protein and/or post-translational modification of a polypeptide or protein.


Treating, treatment, therapy: As used herein, the term “treating” or “treatment” or “therapy” refers to partially or completely alleviating, ameliorating, improving, relieving, delaying onset of, inhibiting progression of, reducing severity of, and/or reducing incidence of one or more signs and symptoms or features of a disease, e.g., Hemophilia A. For example, “treating” Hemophilia A can refer to diminishing signs and symptoms associated with the disease, prolong the lifespan (increase the survival rate) of patients, reducing the severity of the disease, preventing or delaying the onset of the disease, etc. Treatment can be administered to a subject who does not exhibit signs of a disease, disorder, and/or condition and/or to a subject who exhibits only early signs of a disease, disorder, and/or condition for the purpose of decreasing the risk of developing pathology associated with the disease, disorder, and/or condition.


Unmodified: As used herein, “unmodified” refers to any substance, compound or molecule prior to being changed in some way. Unmodified can, but does not always, refer to the wild type or native form of a biomolecule. Molecules can undergo a series of modifications whereby each modified molecule can serve as the “unmodified” starting molecule for a subsequent modification.


Uracil: Uracil is one of the four nucleobases in the nucleic acid of RNA, and it is represented by the letter U. Uracil can be attached to a ribose ring, or more specifically, a ribofuranose via a β-N1-glycosidic bond to yield the nucleoside uridine. The nucleoside uridine is also commonly abbreviated according to the one letter code of its nucleobase, i.e., U. Thus, in the context of the present disclosure, when a monomer in a polynucleotide sequence is U, such U is designated interchangeably as a “uracil” or a “uridine.”


Uridine Content: The terms “uridine content” or “uracil content” are interchangeable and refer to the amount of uracil or uridine present in a certain nucleic acid sequence. Uridine content or uracil content can be expressed as an absolute value (total number of uridine or uracil in the sequence) or relative (uridine or uracil percentage respect to the total number of nucleobases in the nucleic acid sequence).


Uridine-Modified Sequence: The terms “uridine-modified sequence” refers to a sequence optimized nucleic acid (e.g., a synthetic mRNA sequence) with a different overall or local uridine content (higher or lower uridine content) or with different uridine patterns (e.g., gradient distribution or clustering) with respect to the uridine content and/or uridine patterns of a candidate nucleic acid sequence. In the content of the present disclosure, the terms “uridine-modified sequence” and “uracil-modified sequence” are considered equivalent and interchangeable.


A “high uridine codon” is defined as a codon comprising two or three uridines, a “low uridine codon” is defined as a codon comprising one uridine, and a “no uridine codon” is a codon without any uridines. In some embodiments, a uridine-modified sequence comprises substitutions of high uridine codons with low uridine codons, substitutions of high uridine codons with no uridine codons, substitutions of low uridine codons with high uridine codons, substitutions of low uridine codons with no uridine codons, substitution of no uridine codons with low uridine codons, substitutions of no uridine codons with high uridine codons, and combinations thereof. In some embodiments, a high uridine codon can be replaced with another high uridine codon. In some embodiments, a low uridine codon can be replaced with another low uridine codon. In some embodiments, a no uridine codon can be replaced with another no uridine codon. A uridine-modified sequence can be uridine enriched or uridine rarefied.


Uridine Enriched: As used herein, the terms “uridine enriched” and grammatical variants refer to the increase in uridine content (expressed in absolute value or as a percentage value) in an sequence optimized nucleic acid (e.g., a synthetic mRNA sequence) with respect to the uridine content of the corresponding candidate nucleic acid sequence. Uridine enrichment can be implemented by substituting codons in the candidate nucleic acid sequence with synonymous codons containing less uridine nucleobases. Uridine enrichment can be global (i.e., relative to the entire length of a candidate nucleic acid sequence) or local (i.e., relative to a subsequence or region of a candidate nucleic acid sequence).


Uridine Rarefied: As used herein, the terms “uridine rarefied” and grammatical variants refer to a decrease in uridine content (expressed in absolute value or as a percentage value) in an sequence optimized nucleic acid (e.g., a synthetic mRNA sequence) with respect to the uridine content of the corresponding candidate nucleic acid sequence. Uridine rarefication can be implemented by substituting codons in the candidate nucleic acid sequence with synonymous codons containing less uridine nucleobases. Uridine rarefication can be global (i.e., relative to the entire length of a candidate nucleic acid sequence) or local (i.e., relative to a subsequence or region of a candidate nucleic acid sequence).


Variant: The term variant as used in present disclosure refers to both natural variants (e.g, polymorphisms, isoforms, etc) and artificial variants in which at least one amino acid residue in a native or starting sequence (e.g., a wild type sequence) has been removed and a different amino acid inserted in its place at the same position. These variants can de described as “substitutional variants.” The substitutions can be single, where only one amino acid in the molecule has been substituted, or they can be multiple, where two or more amino acids have been substituted in the same molecule. If amino acids are inserted or deleted, the resulting variant would be an “insertional variant” or a “deletional variant” respectively.


GC-rich: As used herein, the term “GC-rich” refers to the nucleobase composition of a polynucleotide (e.g., mRNA), or any portion thereof (e.g., an RNA element), comprising guanine (G) and/or cytosine (C) nucleobases, or derivatives or analogs thereof, wherein the GC-content is greater than about 50%. The term “GC-rich” refers to all, or to a portion, of a polynucleotide, including, but not limited to, a gene, a non-coding region, a 5′ UTR, a 3′ UTR, an open reading frame, an RNA element, a sequence motif, or any discrete sequence, fragment, or segment thereof which comprises about 50% GC-content. In some embodiments of the disclosure, GC-rich polynucleotides, or any portions thereof, are exclusively comprised of guanine (G) and/or cytosine (C) nucleobases.


GC-content: As used herein, the term “GC-content” refers to the percentage of nucleobases in a polynucleotide (e.g., mRNA), or a portion thereof (e.g., an RNA element), that are either guanine (G) and cytosine (C) nucleobases, or derivatives or analogs thereof, (from a total number of possible nucleobases, including adenine (A) and thymine (T) or uracil (U), and derivatives or analogs thereof, in DNA and in RNA). The term “GC-content” refers to all, or to a portion, of a polynucleotide, including, but not limited to, a gene, a non-coding region, a 5′ or 3′ UTR, an open reading frame, an RNA element, a sequence motif, or any discrete sequence, fragment, or segment thereof.


Initiation Codon: As used herein, the term “initiation codon”, used interchangeably with the term “start codon”, refers to the first codon of an open reading frame that is translated by the ribosome and is comprised of a triplet of linked adenine-uracil-guanine nucleobases. The initiation codon is depicted by the first letter codes of adenine (A), uracil (U), and guanine (G) and is often written simply as “AUG”. Although natural mRNAs may use codons other than AUG as the initiation codon, which are referred to herein as “alternative initiation codons”, the initiation codons of polynucleotides described herein use the AUG codon. During the process of translation initiation, the sequence comprising the initiation codon is recognized via complementary base-pairing to the anticodon of an initiator tRNA (Met-tRNAiMet) bound by the ribosome. Open reading frames may contain more than one AUG initiation codon, which are referred to herein as “alternate initiation codons”.


The initiation codon plays a critical role in translation initiation. The initiation codon is the first codon of an open reading frame that is translated by the ribosome. Typically, the initiation codon comprises the nucleotide triplet AUG, however, in some instances translation initiation can occur at other codons comprised of distinct nucleotides. The initiation of translation in eukaryotes is a multistep biochemical process that involves numerous protein-protein, protein-RNA, and RNA-RNA interactions between messenger RNA molecules (mRNAs), the 40S ribosomal subunit, other components of the translation machinery (e.g., eukaryotic initiation factors; elFs). The current model of mRNA translation initiation postulates that the pre-initiation complex (alternatively “43S pre-initiation complex”; abbreviated as “PIC”) translocates from the site of recruitment on the mRNA (typically the 5′ cap) to the initiation codon by scanning nucleotides in a 5′ to 3′ direction until the first AUG codon that resides within a specific translation-promotive nucleotide context (the Kozak sequence) is encountered (Kozak (1989) J Cell Biol 108:229-241). Scanning by the PIC ends upon complementary base-pairing between nucleotides comprising the anticodon of the initiator Met-tRNAiMet transfer RNA and nucleotides comprising the initiation codon of the mRNA. Productive base-pairing between the AUG codon and the Met-tRNAiMet anticodon elicits a series of structural and biochemical events that culminate in the joining of the large 60S ribosomal subunit to the PIC to form an active ribosome that is competent for translation elongation.


Kozak Sequence: The term “Kozak sequence” (also referred to as “Kozak consensus sequence”) refers to a translation initiation enhancer element to enhance expression of a gene or open reading frame, and which in eukaryotes, is located in the 5′ UTR. The Kozak consensus sequence was originally defined as the sequence GCCRCC, where R=a purine, following an analysis of the effects of single mutations surrounding the initiation codon (AUG) on translation of the preproinsulin gene (Kozak (1986) Cell 44:283-292). Polynucleotides disclosed herein comprise a Kozak consensus sequence, or a derivative or modification thereof (Examples of translational enhancer compositions and methods of use thereof, see U.S. Pat. No. 5,807,707 to Andrews et al., incorporated herein by reference in its entirety; U.S. Pat. No. 5,723,332 to Chernajovsky, incorporated herein by reference in its entirety; U.S. Pat. No. 5,891,665 to Wilson, incorporated herein by reference in its entirety.)


Leaky scanning: A phenomenon known as “leaky scanning” can occur whereby the PIC bypasses the initiation codon and instead continues scanning downstream until an alternate or alternative initiation codon is recognized. Depending on the frequency of occurrence, the bypass of the initiation codon by the PIC can result in a decrease in translation efficiency. Furthermore, translation from this downstream AUG codon can occur, which will result in the production of an undesired, aberrant translation product that may not be capable of eliciting the desired therapeutic response. In some cases, the aberrant translation product may in fact cause a deleterious response (Kracht et al., (2017) Nat Med 23(4):501-507).


Nucleic Acid Structure: As used herein, the term “nucleic acid structure” (used interchangeably with “polynucleotide structure”) refers to the arrangement or organization of atoms, chemical constituents, elements, motifs, and/or sequence of linked nucleotides, or derivatives or analogs thereof, that comprise a nucleic acid (e.g., an mRNA). The term also refers to the two-dimensional or three-dimensional state of a nucleic acid. Accordingly, the term “RNA structure” refers to the arrangement or organization of atoms, chemical constituents, elements, motifs, and/or sequence of linked nucleotides, or derivatives or analogs thereof, comprising an RNA molecule (e.g., an mRNA) and/or refers to a two-dimensional and/or three dimensional state of an RNA molecule. Nucleic acid structure can be further demarcated into four organizational categories referred to herein as “molecular structure”, “primary structure”, “secondary structure”, and “tertiary structure” based on increasing organizational complexity.


Open Reading Frame: As used herein, the term “open reading frame”, abbreviated as “ORF”, refers to a segment or region of an mRNA molecule that encodes a polypeptide. The ORF comprises a continuous stretch of non-overlapping, in-frame codons, beginning with the initiation codon and ending with a stop codon, and is translated by the ribosome.


Pre-Initiation Complex (PIC): As used herein, the term “pre-initiation complex” (alternatively “43S pre-initiation complex”; abbreviated as “PIC”) refers to a ribonucleoprotein complex comprising a 40S ribosomal subunit, eukaryotic initiation factors (eIF1, eIF1A, eIF3, eIF5), and the eIF2-GTP-Met-tRNAiMet ternary complex, that is intrinsically capable of attachment to the 5′ cap of an mRNA molecule and, after attachment, of performing ribosome scanning of the 5′ UTR.


RNA element: As used herein, the term “RNA element” refers to a portion, fragment, or segment of an RNA molecule that provides a biological function and/or has biological activity (e.g., translational regulatory activity). Modification of a polynucleotide by the incorporation of one or more RNA elements, such as those described herein, provides one or more desirable functional properties to the modified polynucleotide. RNA elements, as described herein, can be naturally-occurring, non-naturally occurring, synthetic, engineered, or any combination thereof. For example, naturally-occurring RNA elements that provide a regulatory activity include elements found throughout the transcriptomes of viruses, prokaryotic and eukaryotic organisms (e.g., humans). RNA elements in particular eukaryotic mRNAs and translated viral RNAs have been shown to be involved in mediating many functions in cells. Exemplary natural RNA elements include, but are not limited to, translation initiation elements (e.g., internal ribosome entry site (IRES), see Kieft et al., (2001) RNA 7(2):194-206), translation enhancer elements (e.g., the APP mRNA translation enhancer element, see Rogers et al., (1999) J Biol Chem 274(10):6421-6431), mRNA stability elements (e.g., AU-rich elements (AREs), see Garneau et al., (2007) Nat Rev Mol Cell Biol 8(2):113-126), translational repression element (see e.g., Blumer et al., (2002) Mech Dev 110(1-2):97-112), protein-binding RNA elements (e.g., iron-responsive element, see Selezneva et al., (2013) J Mol Biol 425(18):3301-3310), cytoplasmic polyadenylation elements (Villalba et al., (2011) Curr Opin Genet Dev 21(4):452-457), and catalytic RNA elements (e.g., ribozymes, see Scott et al., (2009) Biochim Biophys Acta 1789(9-10): 634-641).


Residence time: As used herein, the term “residence time” refers to the time of occupancy of a pre-initiation complex (PIC) or a ribosome at a discrete position or location along an mRNA molecule.


Translational Regulatory Activity: As used herein, the term “translational regulatory activity” (used interchangeably with “translational regulatory function”) refers to a biological function, mechanism, or process that modulates (e.g., regulates, influences, controls, varies) the activity of the translational apparatus, including the activity of the PIC and/or ribosome. In some aspects, the desired translation regulatory activity promotes and/or enhances the translational fidelity of mRNA translation. In some aspects, the desired translational regulatory activity reduces and/or inhibits leaky scanning.


Translation of a polynucleotide comprising an open reading frame encoding a polypeptide can be controlled and regulated by a variety of mechanisms that are provided by various cis-acting nucleic acid structures. For example, naturally-occurring, cis-acting RNA elements that form hairpins or other higher-order (e.g., pseudoknot) intramolecular mRNA secondary structures can provide a translational regulatory activity to a polynucleotide, wherein the RNA element influences or modulates the initiation of polynucleotide translation, particularly when the RNA element is positioned in the 5′ UTR close to the 5′-cap structure (Pelletier and Sonenberg (1985) Cell 40(3):515-526; Kozak (1986) Proc Natl Acad Sci 83:2850-2854). Cis-acting RNA elements can also affect translation elongation, being involved in numerous frameshifting events (Namy et al., (2004) Mol Cell 13(2):157-168). Internal ribosome entry sequences (IRES) represent another type of cis-acting RNA element that are typically located in 5′ UTRs, but have also been reported to be found within the coding region of naturally-occurring mRNAs (Holcik et al. (2000) Trends Genet 16(10):469-473). In cellular mRNAs, IRES often coexist with the 5′-cap structure and provide mRNAs with the functional capacity to be translated under conditions in which cap-dependent translation is compromised (Gebauer et al., (2012) Cold Spring Harb Perspect Biol 4(7):a012245). Another type of naturally-occurring cis-acting RNA element comprises upstream open reading frames (uORFs). Naturally-occurring uORFs occur singularly or multiply within the 5′ UTRs of numerous mRNAs and influence the translation of the downstream major ORF, usually negatively (with the notable exception of GCN4 mRNA in yeast and ATF4 mRNA in mammals, where uORFs serve to promote the translation of the downstream major ORF under conditions of increased eIF2 phosphorylation (Hinnebusch (2005) Annu Rev Microbiol 59:407-450)). Additional exemplary translational regulatory activities provided by components, structures, elements, motifs, and/or specific sequences comprising polynucleotides (e.g., mRNA) include, but are not limited to, mRNA stabilization or destabilization (Baker & Parker (2004) Curr Opin Cell Biol 16(3):293-299), translational activation (Villalba et al., (2011) Curr Opin Genet Dev 21(4):452-457), and translational repression (Blumer et al., (2002) Mech Dev 110(1-2):97-112). Studies have shown that naturally-occurring, cis-acting RNA elements can confer their respective functions when used to modify, by incorporation into, heterologous polynucleotides (Goldberg-Cohen et al., (2002) J Biol Chem 277(16):13635-13640).


Equivalents and Scope


Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments in accordance with the present disclosure described herein. The scope of the present disclosure is not intended to be limited to the above Description, but rather is as set forth in the appended claims.


In the claims, articles such as “a,” “an,” and “the” can mean one or more than one unless indicated to the contrary or otherwise evident from the context. Claims or descriptions that include “or” between one or more members of a group are considered satisfied if one, more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process unless indicated to the contrary or otherwise evident from the context. The present disclosure includes embodiments in which exactly one member of the group is present in, employed in, or otherwise relevant to a given product or process. The present disclosure includes embodiments in which more than one, or all of the group members are present in, employed in, or otherwise relevant to a given product or process.


It is also noted that the term “comprising” is intended to be open and permits but does not require the inclusion of additional elements or steps. When the term “comprising” is used herein, the term “consisting of” is thus also encompassed and disclosed.


Where ranges are given, endpoints are included. Furthermore, it is to be understood that unless otherwise indicated or otherwise evident from the context and understanding of one of ordinary skill in the art, values that are expressed as ranges can assume any specific value or subrange within the stated ranges in different embodiments of the present disclosure, to the tenth of the unit of the lower limit of the range, unless the context clearly dictates otherwise.


In addition, it is to be understood that any particular embodiment of the present disclosure that falls within the prior art can be explicitly excluded from any one or more of the claims. Since such embodiments are deemed to be known to one of ordinary skill in the art, they can be excluded even if the exclusion is not set forth explicitly herein. Any particular embodiment of the compositions of the present disclosure (e.g., any nucleic acid or protein encoded thereby; any method of production; any method of use; etc.) can be excluded from any one or more claims, for any reason, whether or not related to the existence of prior art.


All cited sources, for example, references, publications, databases, database entries, and art cited herein, are incorporated into this application by reference, even if not expressly stated in the citation. In case of conflicting statements of a cited source and the instant application, the statement in the instant application shall control.


Section and table headings are not intended to be limiting.









TABLE 12







ORFs of mRNA Constructs








SEQ ID NO:
ORF mRNA Construct





127
AUGCAAAUAGAGCUCUCCACCUGCUUCUUUCUGUGCCUUUUGCGAUUCUGCUUUAGUGCCACCAGAAGAUACU



ACCUGGGUGCAGUGGAACUGUCCUGGGACUAUAUGCAAAGUGAUCUCGGUGAGCUGCCUGUGGACGCAAGAUU



UCCUCCUAGAGUGCCCAAGUCUUUUCCAUUCAACACCUCAGUCGUGUACAAGAAGACUCUGUUUGUAGAAUUC



ACGGAUCACCUUUUCAACAUCGCUAAGCCAAGGCCACCCUGGAUGGGUCUGCUAGGUCCUACCAUCCAGGCUG



AGGUUUACGAUACAGUGGUCAUUACACUUAAGAACAUGGCUUCCCAUCCUGUCAGUCUUCACGCUGUUGGUGU



AUCCUACUGGAAAGCUUCUGAGGGAGCUGAAUACGACGAUCAGACCAGUCAAAGGGAGAAAGAAGACGAUAAA



GUCUUCCCUGGUGGAAGCCAUACAUACGUCUGGCAGGUCCUGAAAGAGAACGGUCCAAUGGCCUCUGACCCAC



UGUGCCUUACCUACUCAUAUCUUUCUCACGUGGACCUGGUCAAGGACUUGAAUUCAGGCCUCAUUGGAGCCCU



ACUAGUGUGUAGAGAAGGGAGUCUGGCCAAGGAGAAGACACAGACCUUGCACAAAUUUAUACUACUUUUCGCU



GUAUUUGACGAAGGGAAGAGUUGGCACUCAGAAACAAAGAACUCCUUGAUGCAGGAUAGGGACGCUGCAUCUG



CUCGGGCCUGGCCUAAGAUGCACACAGUCAACGGUUACGUAAACAGGUCCCUGCCAGGUCUGAUUGGCUGCCA



CAGGAAAUCAGUCUAUUGGCACGUGAUUGGAAUGGGCACCACUCCUGAAGUGCACUCAAUAUUCCUCGAAGGU



CACACAUUUCUUGUGAGGAACCAUCGCCAGGCGUCCUUGGAAAUCUCGCCAAUAACUUUCCUUACUGCUCAAA



CACUCUUGAUGGACCUUGGACAGUUUCUACUGUUUUGUCAUAUCUCUUCCCACCAACACGACGGCAUGGAAGC



UUACGUCAAAGUAGACAGCUGUCCAGAGGAACCCCAACUACGAAUGAAGAAUAACGAAGAAGCGGAAGACUAC



GACGACGAUCUUACUGAUUCUGAAAUGGACGUGGUCAGGUUUGACGACGACAACUCUCCUUCCUUUAUCCAAA



UUCGCUCAGUUGCCAAGAAGCAUCCUAAGACUUGGGUACAUUACAUUGCUGCUGAAGAGGAGGACUGGGACUA



CGCUCCCUUAGUCCUCGCCCCUGACGACAGAAGUUAUAAGAGUCAAUAUUUGAACAACGGCCCUCAGCGGAUU



GGUAGGAAGUACAAGAAAGUCCGAUUUAUGGCAUACACAGACGAAACCUUUAAGACUCGUGAAGCUAUUCAGC



ACGAAUCAGGAAUCUUGGGACCUUUACUUUACGGGGAAGUUGGAGACACACUGUUGAUUAUAUUUAAGAAUCA



AGCAAGCAGACCAUAUAACAUCUACCCUCACGGAAUCACUGACGUCCGUCCUUUGUAUUCAAGGAGAUUACCC



AAGGGUGUCAAGCAUUUGAAGGAUUUUCCAAUUCUGCCAGGAGAAAUAUUCAAAUAUAAGUGGACAGUGACUG



UAGAAGACGGGCCAACUAAAUCAGAUCCUCGGUGCCUGACCCGCUAUUACUCUAGUUUCGUUAAUAUGGAGAG



AGAUCUAGCUUCAGGACUCAUUGGCCCUCUCCUCAUCUGCUACAAAGAAUCUGUAGAUCAAAGAGGAAACCAG



AUAAUGUCAGACAAGAGGAACGUCAUCCUGUUCAGCGUCUUCGACGAGAACAGGAGCUGGUACCUCACAGAGA



AUAUACAACGCUUUCUCCCCAAUCCAGCUGGAGUGCAGCUUGAGGAUCCAGAGUUCCAAGCCUCCAACAUCAU



GCACAGCAUCAACGGCUACGUGUUCGAUAGUUUGCAGUUGUCAGUUUGUUUGCACGAGGUGGCAUACUGGUAC



AUUCUAAGCAUUGGAGCACAGACUGACUUCCUGAGCGUGUUCUUCAGCGGCUACACCUUCAAACACAAGAUGG



UCUACGAAGACACACUCACCCUAUUCCCAUUCUCAGGAGAAACUGUCUUCAUGUCGAUGGAGAACCCAGGUCU



GUGGAUUCUGGGGUGCCACAACUCAGACUUUCGGAACAGAGGCAUGACCGCCUUACUGAAGGUUUCUAGUUGU



GACAAGAACACUGGUGAUUAUUACGAGGACAGUUACGAAGAUAUUUCAGCAUACUUGCUGAGUAAGAACAACG



CCAUUGAACCAAGAAGCUUCUCCCAGAAUUCAAGACACCCUAGCACUAGGCAGAAGCAAUUUAACGCCACCAC



AAUUCCAGAGAACGACAUAGAGAAGACUGACCCUUGGUUUGCACACAGAACACCUAUGCCUAAGAUACAGAAC



GUCUCCUCUAGUGAUUUGUUGAUGCUCUUGCGACAGAGUCCUACUCCACACGGGCUAUCCUUAUCUGAUCUCC



AAGAAGCCAAAUACGAGACAUUCUCUGACGAUCCAUCACCUGGAGCAAUAGACAGUAAUAACAGCCUGUCUGA



AAUGACACACUUCAGGCCACAGCUCCAUCACAGUGGGGACAUGGUAUUUACCCCUGAGUCAGGCCUCCAAUUA



AGAUUAAACGAGAAACUGGGGACAACUGCAGCAACAGAGUUGAAGAAACUUGAUUUCAAAGUUUCUAGUACAU



CAAAUAACCUGAUCUCCACCAUCCCCAGCGACAAUUUGGCAGCAGGUACUGAUAAUACAAGUUCCUUAGGACC



ACCAAGUAUGCCAGUUCAUUACGAUAGUCAAUUAGAUACCACUCUAUUUGGCAAGAAGUCAUCUCCCCUUACU



GAGUCUGGUGGACCUCUGAGCUUGAGUGAAGAGAACAACGACUCCAAACUGCUGGAAUCCGGCUUAAUGAAUA



GCCAAGAAAGUAGCUGGGGCAAGAACGUAUCGUCAACAGAGAGUGGUAGGUUAUUUAAAGGGAAGAGAGCUCA



CGGACCUGCUUUGUUGACUAAAGAUAACGCCUUAUUCAAAGUUAGCAUCUCUUUGUUAAAGACAAACAAGACU



UCCAAUAAUUCAGCAACUAAUAGAAAGACUCACAUUGACGGCCCAUCAUUAUUAAUUGAGAAUAGUCCAUCAG



UCUGGCAGAAUAUAUUAGAAAGUGACACUGAGUUCAAGAAGGUGACCCCGCUGAUACACGACAGAAUGCUUAU



GGACAAGAACGCUACAGCUUUGAGGCUAAAUCAUAUGUCAAAUAAGACUACUUCCAGCAAGAACAUGGAGAUG



GUGCAACAGAAGAAAGAGGGCCCCAUUCCACCCGACGCUCAGAACCCCGAUAUGUCGUUCUUUAAGAUGCUAU



UCUUGCCAGAAUCAGCAAGGUGGAUACAAAGGACUCACGGAAAGAACUCUCUGAACUCUGGGCAAGGCCCCAG



UCCAAAGCAAUUAGUGAGCCUGGGGCCCGAGAAGUCCGUGGAGGGUCAGAACUUCCUCAGCGAGAAGAAUAAG



GUAGUGGUAGGAAAGGGUGAAUUCACAAAGGACGUGGGCCUCAAGGAGAUGGUGUUCCCAAGCAGCAGAAACC



UAUUUCUUACUAACUUGGAUAAUUUACACGAGAAUAAUACACACAAUCAAGAGAAGAAGAUUCAGGAAGAAAU



AGAGAAGAAGGAAACAUUAAUCCAAGAGAACGUAGUUUUGCCUCAGAUACAUACAGUGACUGGCACUAAGAAU



UUCAUGAAGAACCUGUUUCUGCUGAGCACCCGGCAGAACGUAGAGGGUUCAUACGACGGGGCAUACGCUCCAG



UACUUCAAGAUUUUAGGUCCCUGAACGACAGCACAAAUAGGACCAAGAAACACACAGCUCAUUUCAGCAAGAA



AGGGGAGGAAGAGAACUUGGAAGGCUUGGGAAAUCAAACCAAGCAAAUUGUAGAGAAAUACGCCUGCACCACA



AGGAUAUCUCCUAAUACAAGCCAGCAGAAUUUUGUCACGCAACGUAGUAAGAGAGCUUUGAAACAAUUCAGAC



UCCCACUAGAAGAAACAGAACUUGAGAAGAGGAUAAUUGUGGACGACACCUCAACCCAGUGGUCCAAGAACAU



GAAACAUUUGACCCCGAGCACCCUCACACAGAUAGACUACAACGAGAAGGAGAAAGGGGCCAUUACUCAGUCU



CCCUUAUCAGAUUGCCUUACGAGGAGUCAUAGCAUCCCUCAAGCAAAUAGAUCUCCAUUACCCAUUGCAAAGG



UAUCAUCAUUUCCAUCUAUUAGACCUAUAUAUCUGACCAGGGUCCUAUUCCAAGACAACUCUUCUCAUCUUCC



AGCAGCCAGCUACAGAAAGAAGGAUUCAGGGGUGCAAGAAAGCAGUCAUUUCUUACAAGGAGCCAAGAAGAAU



AACCUUUCUUUAGCCAUUCUAACCUUGGAGAUGACUGGUGAUCAAAGAGAGGUUGGAUCCCUGGGAACUUCCG



CCACAAAUUCCGUCACCUACAAGAAGGUGGAGAAUACCGUGCUCCCGAAACCAGACUUGCCCAAGACAUCUGG



CAAAGUUGAAUUGCUUCCGAAGGUUCACAUUUAUCAGAAGGACCUAUUCCCUACGGAAACUAGCAACGGCAGC



CCUGGCCAUCUGGAUCUCGUGGAAGGGAGCCUUCUUCAGGGAACAGAGGGAGCGAUUAAGUGGAACGAAGCAA



ACAGGCCCGGCAAGGUGCCCUUCCUGCGCGUGGCAACAGAAAGCUCUGCAAAGACUCCCUCCAAGCUAUUGGA



UCCUCUUGCUUGGGAUAACCACUACGGUACUCAGAUACCCAAAGAAGAGUGGAAAUCCCAAGAGAAGUCACCA



GAGAAGACAGCUUUUAAGAAGAAGGAUACCAUUUUGUCCCUGAACGCUUGUGAAAGCAAUCACGCAAUAGCAG



CAAUAAACGAGGGACAGAAUAAGCCCGAAAUAGAAGUCACCUGGGCAAAGCAAGGUAGGACUGAAAGGCUGUG



CUCUCAGAACCCACCAGUCUUGAAACGCCAUCAACGGGAAAUAACUCGUACUACUCUUCAGUCAGAUCAAGAG



GAAAUUGACUACGACGAUACCAUAUCAGUUGAAAUGAAGAAGGAAGAUUUUGACAUUUACGACGAGGACGAGA



AUCAGUCACCCCGCAGCUUUCAGAAGAAGACACGACACUAUUUCAUCGCCGCCGUGGAGAGGCUGUGGGAUUA



CGGGAUGAGUAGCUCCCCACACGUUCUAAGAAACAGGGCUCAGAGUGGCAGUGUCCCUCAGUUCAAGAAAGUU



GUUUUCCAGGAAUUUACUGACGGCUCCUUUACUCAGCCCUUAUACCGUGGAGAACUAAACGAACAUUUGGGAC



UCCUGGGGCCAUAUAUAAGAGCAGAAGUUGAAGAUAAUAUCAUGGUAACUUUCAGAAAUCAGGCCUCUCGUCC



CUAUUCCUUCUAUUCUAGCCUGAUCAGCUACGAGGAGGACCAGCGCCAGGGAGCAGAACCUAGAAAGAACUUU



GUCAAGCCUAACGAAACCAAGACUUACUUUUGGAAAGUGCAACAUCAUAUGGCACCCACUAAAGACGAGUUUG



ACUGCAAAGCCUGGGCUUAUUUCUCUGACGUUGACCUGGAGAAAGACGUGCACUCAGGCCUGAUUGGACCCCU



UCUGGUCUGCCACACUAACACACUGAACCCUGCUCACGGGAGACAAGUGACAGUACAGGAAUUUGCUCUGUUC



UUCACCAUCUUUGACGAAACCAAGUCCUGGUACUUCACCGAGAAUAUGGAAAGAAACUGCAGGGCUCCCUGCA



AUAUCCAGAUGGAAGAUCCCACUUUUAAAGAGAAUUAUCGCUUCCACGCAAUCAACGGCUACAUAAUGGAUAC



ACUACCUGGCUUAGUAAUGGCUCAGGAUCAAAGGAUUAGGUGGUAUCUGCUCAGCAUGGGCAGCAACGAGAAC



AUCCAUUCUAUUCAUUUCAGUGGACACGUGUUCACUGUACGGAAGAAAGAGGAGUAUAAGAUGGCACUGUACA



AUCUCUAUCCAGGUGUGUUCGAGACAGUGGAAAUGUUACCAUCCAAAGCUGGAAUUUGGCGGGUGGAGUGCCU



UAUUGGCGAGCAUCUACACGCUGGGAUGAGCACACUGUUCCUGGUGUACAGCAAUAAGUGUCAGACUCCCCUG



GGAAUGGCUUCUGGACACAUUAGAGAUUUUCAGAUUACAGCUUCAGGACAAUACGGACAGUGGGCCCCAAAGC



UGGCCAGACUUCAUUAUUCCGGAUCAAUCAACGCCUGGUCCACCAAGGAGCCCUUCAGCUGGAUCAAGGUGGA



UCUGUUGGCACCAAUGAUUAUUCACGGCAUCAAGACCCAGGGUGCCCGUCAGAAGUUCUCCAGCCUCUACAUC



UCUCAGUUUAUCAUCAUGUAUAGUCUUGACGGGAAGAAGUGGCAGACUUAUCGAGGAAAUUCCACUGGAACCU



UAAUGGUCUUCUUUGGCAACGUGGAUUCAUCUGGGAUCAAGCACAAUAUCUUCAACCCUCCAAUUAUUGCUCG



AUACAUCCGUUUGCACCCAACUCAUUAUAGCAUUCGCAGCACUCUUCGCAUGGAGUUGAUGGGCUGUGAUUUA



AAUAGUUGCAGCAUGCCAUUGGGAAUGGAGAGUAAAGCAAUAUCAGACGCACAGAUUACUGCUUCAUCCUACU



UUACCAAUAUGUUUGCCACCUGGUCCCCUUCCAAGGCUCGACUUCACCUCCAAGGGAGGAGUAACGCCUGGAG



GCCUCAGGUGAAUAAUCCGAAGGAGUGGCUGCAAGUGGACUUCCAGAAGACAAUGAAAGUCACAGGAGUAACU



ACUCAGGGAGUCAAGUCUCUGCUUACCAGCAUGUACGUGAAGGAGUUCCUCAUCUCCAGCAGUCAAGACGGCC



AUCAGUGGACUCUCUUCUUUCAGAACGGCAAAGUAAAGGUGUUUCAGGGAAAUCAAGACUCCUUCACACCUGU



GGUGAACAGCCUGGACCCACCGUUACUGACUCGCUACCUUCGAAUUCAUCCGCAGUCCUGGGUGCACCAGAUC



GCCCUCAGGAUGGAGGUUCUGGGCUGCGAGGCACAGGACCUCUAC





128
AUGCAAAUAGAGCUCUCCACCUGCUUCUUUCUGUGCCUUUUGCGAUUCUGCUUUAGUGCCACCAGAAGAUACU



ACCUGGGUGCAGUGGAACUGUCCUGGGACUAUAUGCAAAGUGAUCUCGGUGAGCUGCCUGUGGACGCAAGAUU



UCCUCCUAGAGUGCCCAAGUCUUUUCCAUUCAACACCUCAGUCGUGUACAAGAAGACUCUGUUUGUAGAAUUC



ACGGAUCACCUUUUCAACAUCGCUAAGCCAAGGCCACCCUGGAUGGGUCUGCUAGGUCCUACCAUCCAGGCUG



AGGUUUACGAUACAGUGGUCAUUACACUUAAGAACAUGGCUUCCCAUCCUGUCAGUCUUCACGCUGUUGGUGU



AUCCUACUGGAAAGCUUCUGAGGGAGCUGAAUACGACGAUCAGACCAGUCAAAGGGAGAAAGAAGACGAUAAA



GUCUUCCCUGGUGGAAGCCAUACAUACGUCUGGCAGGUCCUGAAAGAGAACGGUCCAAUGGCCUCUGACCCAC



UGUGCCUUACCUACUCAUAUCUUUCUCACGUGGACCUGGUCAAGGACUUGAAUUCAGGCCUCAUUGGAGCCCU



ACUAGUGUGUAGAGAAGGGAGUCUGGCCAAGGAGAAGACACAGACCUUGCACAAAUUUAUACUACUUUUCGCU



GUAUUUGACGAAGGGAAGAGUUGGCACUCAGAAACAAAGAACUCCUUGAUGCAGGAUAGGGACGCUGCAUCUG



CUCGGGCCUGGCCUAAGAUGCACACAGUCAACGGUUACGUAAACAGGUCCCUGCCAGGUCUGAUUGGCUGCCA



CAGGAAAUCAGUCUAUUGGCACGUGAUUGGAAUGGGCACCACUCCUGAAGUGCACUCAAUAUUCCUCGAAGGU



CACACAUUUCUUGUGAGGAACCAUCGCCAGGCGUCCUUGGAAAUCUCGCCAAUAACUUUCCUUACUGCUCAAA



CACUCUUGAUGGACCUUGGACAGUUUCUACUGUCUUGUCAUAUCUCUUCCCACCAACACGACGGCAUGGAAGC



UUACGUCAAAGUAGACAGCUGUCCAGAGGAACCCCAACUACGAAUGAAGAAUAACGAAGAAGCGGAAGACUAC



GACGACGAUCUUACUGAUUCUGAAAUGGACGUGGUCAGGUUUGACGACGACAACUCUCCUUCCUUUAUCCAAA



UUCGCUCAGUUGCCAAGAAGCAUCCUAAGACUUGGGUACAUUACAUUGCUGCUGAAGAGGAGGACUGGGACUA



CGCUCCCUUAGUCCUCGCCCCUGACGACAGAAGUUAUAAGAGUCAAUAUUUGAACAACGGCCCUCAGCGGAUU



GGUAGGAAGUACAAGAAAGUCCGAUUUAUGGCAUACACAGACGAAACCUUUAAGACUCGUGAAGCUAUUCAGC



ACGAAUCAGGAAUCUUGGGACCUUUACUUUACGGGGAAGUUGGAGACACACUGUUGAUUAUAUUUAAGAAUCA



AGCAAGCAGACCAUAUAACAUCUACCCUCACGGAAUCACUGACGUCCGUCCUUUGUAUUCAAGGAGAUUACCC



AAGGGUGUCAAGCAUUUGAAGGAUUUUCCAAUUCUGCCAGGAGAAAUAUUCAAAUAUAAGUGGACAGUGACUG



UAGAAGACGGGCCAACUAAAUCAGAUCCUCGGUGCCUGACCCGCUAUUACUCUAGUUUCGUUAAUAUGGAGAG



AGAUCUAGCUUCAGGACUCAUUGGCCCUCUCCUCAUCUGCUACAAAGAAUCUGUAGAUCAAAGAGGAAACCAG



AUAAUGUCAGACAAGAGGAACGUCAUCCUGUUCAGCGUCUUCGACGAGAACAGGAGCUGGUACCUCACAGAGA



AUAUACAACGCUUUCUCCCCAAUCCAGCUGGAGUGCAGCUUGAGGAUCCAGAGUUCCAAGCCUCCAACAUCAU



GCACAGCAUCAACGGCUACGUGUUCGAUAGUUUGCAGUUGUCAGUUUGUUUGCACGAGGUGGCAUACUGGUAC



AUUCUAAGCAUUGGAGCACAGACUGACUUCCUGAGCGUGUUCUUCAGCGGCUACACCUUCAAACACAAGAUGG



UCUACGAAGACACACUCACCCUAUUCCCAUUCUCAGGAGAAACUGUCUUCAUGUCGAUGGAGAACCCAGGUCU



GUGGAUUCUGGGGUGCCACAACUCAGACUUUCGGAACAGAGGCAUGACCGCCUUACUGAAGGUUUCUAGUUGU



GACAAGAACACUGGUGAUUAUUACGAGGACAGUUACGAAGAUAUUUCAGCAUACUUGCUGAGUAAGAACAACG



CCAUUGAACCAAGAAGCUUCUCCCAGAAUUCAAGACACCCUAGCACUAGGCAGAAGCAAUUUAACGCCACCAC



AAUUCCAGAGAACGACAUAGAGAAGACUGACCCUUGGUUUGCACACAGAACACCUAUGCCUAAGAUACAGAAC



GUCUCCUCUAGUGAUUUGUUGAUGCUCUUGCGACAGAGUCCUACUCCACACGGGCUAUCCUUAUCUGAUCUCC



AAGAAGCCAAAUACGAGACAUUCUCUGACGAUCCAUCACCUGGAGCAAUAGACAGUAAUAACAGCCUGUCUGA



AAUGACACACUUCAGGCCACAGCUCCAUCACAGUGGGGACAUGGUAUUUACCCCUGAGUCAGGCCUCCAAUUA



AGAUUAAACGAGAAACUGGGGACAACUGCAGCAACAGAGUUGAAGAAACUUGAUUUCAAAGUUUCUAGUACAU



CAAAUAACCUGAUCUCCACCAUCCCCAGCGACAAUUUGGCAGCAGGUACUGAUAAUACAAGUUCCUUAGGACC



ACCAAGUAUGCCAGUUCAUUACGAUAGUCAAUUAGAUACCACUCUAUUUGGCAAGAAGUCAUCUCCCCUUACU



GAGUCUGGUGGACCUCUGAGCUUGAGUGAAGAGAACAACGACUCCAAACUGCUGGAAUCCGGCUUAAUGAAUA



GCCAAGAAAGUAGCUGGGGCAAGAACGUAUCGUCAACAGAGAGUGGUAGGUUAUUUAAAGGGAAGAGAGCUCA



CGGACCUGCUUUGUUGACUAAAGAUAACGCCUUAUUCAAAGUUAGCAUCUCUUUGUUAAAGACAAACAAGACU



UCCAAUAAUUCAGCAACUAAUAGAAAGACUCACAUUGACGGCCCAUCAUUAUUAAUUGAGAAUAGUCCAUCAG



UCUGGCAGAAUAUAUUAGAAAGUGACACUGAGUUCAAGAAGGUGACCCCGCUGAUACACGACAGAAUGCUUAU



GGACAAGAACGCUACAGCUUUGAGGCUAAAUCAUAUGUCAAAUAAGACUACUUCCAGCAAGAACAUGGAGAUG



GUGCAACAGAAGAAAGAGGGCCCCAUUCCACCCGACGCUCAGAACCCCGAUAUGUCGUUCUUUAAGAUGCUAU



UCUUGCCAGAAUCAGCAAGGUGGAUACAAAGGACUCACGGAAAGAACUCUCUGAACUCUGGGCAAGGCCCCAG



UCCAAAGCAAUUAGUGAGCCUGGGGCCCGAGAAGUCCGUGGAGGGUCAGAACUUCCUCAGCGAGAAGAAUAAG



GUAGUGGUAGGAAAGGGUGAAUUCACAAAGGACGUGGGCCUCAAGGAGAUGGUGUUCCCAAGCAGCAGAAACC



UAUUUCUUACUAACUUGGAUAAUUUACACGAGAAUAAUACACACAAUCAAGAGAAGAAGAUUCAGGAAGAAAU



AGAGAAGAAGGAAACAUUAAUCCAAGAGAACGUAGUUUUGCCUCAGAUACAUACAGUGACUGGCACUAAGAAU



UUCAUGAAGAACCUGUUUCUGCUGAGCACCCGGCAGAACGUAGAGGGUUCAUACGACGGGGCAUACGCUCCAG



UACUUCAAGAUUUUAGGUCCCUGAACGACAGCACAAAUAGGACCAAGAAACACACAGCUCAUUUCAGCAAGAA



AGGGGAGGAAGAGAACUUGGAAGGCUUGGGAAAUCAAACCAAGCAAAUUGUAGAGAAAUACGCCUGCACCACA



AGGAUAUCUCCUAAUACAAGCCAGCAGAAUUUUGUCACGCAACGUAGUAAGAGAGCUUUGAAACAAUUCAGAC



UCCCACUAGAAGAAACAGAACUUGAGAAGAGGAUAAUUGUGGACGACACCUCAACCCAGUGGUCCAAGAACAU



GAAACAUUUGACCCCGAGCACCCUCACACAGAUAGACUACAACGAGAAGGAGAAAGGGGCCAUUACUCAGUCU



CCCUUAUCAGAUUGCCUUACGAGGAGUCAUAGCAUCCCUCAAGCAAAUAGAUCUCCAUUACCCAUUGCAAAGG



UAUCAUCAUUUCCAUCUAUUAGACCUAUAUAUCUGACCAGGGUCCUAUUCCAAGACAACUCUUCUCAUCUUCC



AGCAGCCAGCUACAGAAAGAAGGAUUCAGGGGUGCAAGAAAGCAGUCAUUUCUUACAAGGAGCCAAGAAGAAU



AACCUUUCUUUAGCCAUUCUAACCUUGGAGAUGACUGGUGAUCAAAGAGAGGUUGGAUCCCUGGGAACUUCCG



CCACAAAUUCCGUCACCUACAAGAAGGUGGAGAAUACCGUGCUCCCGAAACCAGACUUGCCCAAGACAUCUGG



CAAAGUUGAAUUGCUUCCGAAGGUUCACAUUUAUCAGAAGGACCUAUUCCCUACGGAAACUAGCAACGGCAGC



CCUGGCCAUCUGGAUCUCGUGGAAGGGAGCCUUCUUCAGGGAACAGAGGGAGCGAUUAAGUGGAACGAAGCAA



ACAGGCCCGGCAAGGUGCCCUUCCUGCGCGUGGCAACAGAAAGCUCUGCAAAGACUCCCUCCAAGCUAUUGGA



UCCUCUUGCUUGGGAUAACCACUACGGUACUCAGAUACCCAAAGAAGAGUGGAAAUCCCAAGAGAAGUCACCA



GAGAAGACAGCUUUUAAGAAGAAGGAUACCAUUUUGUCCCUGAACGCUUGUGAAAGCAAUCACGCAAUAGCAG



CAAUAAACGAGGGACAGAAUAAGCCCGAAAUAGAAGUCACCUGGGCAAAGCAAGGUAGGACUGAAAGGCUGUG



CUCUCAGAACCCACCAGUCUUGAAACGCCAUCAACGGGAAAUAACUCGUACUACUCUUCAGUCAGAUCAAGAG



GAAAUUGACUACGACGAUACCAUAUCAGUUGAAAUGAAGAAGGAAGAUUUUGACAUUUACGACGAGGACGAGA



AUCAGUCACCCCGCAGCUUUCAGAAGAAGACACGACACUAUUUCAUCGCCGCCGUGGAGAGGCUGUGGGAUUA



CGGGAUGAGUAGCUCCCCACACGUUCUAAGAAACAGGGCUCAGAGUGGCAGUGUCCCUCAGUUCAAGAAAGUU



GUUUUCCAGGAAUUUACUGACGGCUCCUUUACUCAGCCCUUAUACCGUGGAGAACUAAACGAACAUUUGGGAC



UCCUGGGGCCAUAUAUAAGAGCAGAAGUUGAAGAUAAUAUCAUGGUAACUUUCAGAAAUCAGGCCUCUCGUCC



CUAUUCCUUCUAUUCUAGCCUGAUCAGCUACGAGGAGGACCAGCGCCAGGGAGCAGAACCUAGAAAGAACUUU



GUCAAGCCUAACGAAACCAAGACUUACUUUUGGAAAGUGCAACAUCAUAUGGCACCCACUAAAGACGAGUUUG



ACUGCAAAGCCUGGGCUUAUUUCUCUGACGUUGACCUGGAGAAAGACGUGCACUCAGGCCUGAUUGGACCCCU



UCUGGUCUGCCACACUAACACACUGAACCCUGCUCACGGGAGACAAGUGACAGUACAGGAAUUUGCUCUGUUC



UUCACCAUCUUUGACGAAACCAAGUCCUGGUACUUCACCGAGAAUAUGGAAAGAAACUGCAGGGCUCCCUGCA



AUAUCCAGAUGGAAGAUCCCACUUUUAAAGAGAAUUAUCGCUUCCACGCAAUCAACGGCUACAUAAUGGAUAC



ACUACCUGGCUUAGUAAUGGCUCAGGAUCAAAGGAUUAGGUGGUAUCUGCUCAGCAUGGGCAGCAACGAGAAC



AUCCAUUCUAUUCAUUUCAGUGGACACGUGUUCACUGUACGGAAGAAAGAGGAGUAUAAGAUGGCACUGUACA



AUCUCUAUCCAGGUGUGUUCGAGACAGUGGAAAUGUUACCAUCCAAAGCUGGAAUUUGGCGGGUGGAGUGCCU



UAUUGGCGAGCAUCUACACGCUGGGAUGAGCACACUGUUCCUGGUGUACAGCAAUAAGUGUCAGACUCCCCUG



GGAAUGGCUUCUGGACACAUUAGAGAUUUUCAGAUUACAGCUUCAGGACAAUACGGACAGUGGGCCCCAAAGC



UGGCCAGACUUCAUUAUUCCGGAUCAAUCAACGCCUGGUCCACCAAGGAGCCCUUCAGCUGGAUCAAGGUGGA



UCUGUUGGCACCAAUGAUUAUUCACGGCAUCAAGACCCAGGGUGCCCGUCAGAAGUUCUCCAGCCUCUACAUC



UCUCAGUUUAUCAUCAUGUAUAGUCUUGACGGGAAGAAGUGGCAGACUUAUCGAGGAAAUUCCACUGGAACCU



UAAUGGUCUUCUUUGGCAACGUGGAUUCAUCUGGGAUCAAGCACAAUAUCUUCAACCCUCCAAUUAUUGCUCG



AUACAUCCGUUUGCACCCAACUCAUUAUAGCAUUCGCAGCACUCUUCGCAUGGAGUUGAUGGGCUGUGAUUUA



AAUAGUUGCAGCAUGCCAUUGGGAAUGGAGAGUAAAGCAAUAUCAGACGCACAGAUUACUGCUUCAUCCUACU



UUACCAAUAUGUUUGCCACCUGGUCCCCUUCCAAGGCUCGACUUCACCUCCAAGGGAGGAGUAACGCCUGGAG



GCCUCAGGUGAAUAAUCCGAAGGAGUGGCUGCAAGUGGACUUCCAGAAGACAAUGAAAGUCACAGGAGUAACU



ACUCAGGGAGUCAAGUCUCUGCUUACCAGCAUGUACGUGAAGGAGUUCCUCAUCUCCAGCAGUCAAGACGGCC



AUCAGUGGACUCUCUUCUUUCAGAACGGCAAAGUAAAGGUGUUUCAGGGAAAUCAAGACUCCUUCACACCUGU



GGUGAACAGCCUGGACCCACCGUUACUGACUCGCUACCUUCGAAUUCAUCCGCAGUCCUGGGUGCACCAGAUC



GCCCUCAGGAUGGAGGUUCUGGGCUGCGAGGCACAGGACCUCUAC





129
AUGCAAAUAGAGCUCUCCACCUGCUUCUUUCUGUGCCUUUUGCGAUUCUGCUUUAGUGCCACCAGAAGAUACU



ACCUGGGUGCAGUGGAACUGUCCUGGGACUAUAUGCAAAGUGAUCUCGGUGAGCUGCCUGUGGACGCAAGAUU



UCCUCCUAGAGUGCCCAAGUCUUUUCCAUUCAACACCUCAGUCGUGUACAAGAAGACUCUGUUUGUAGAAUUC



ACGGAUCACCUUUUCAACAUCGCUAAGCCAAGGCCACCCUGGAUGGGUCUGCUAGGUCCUACCAUCCAGGCUG



AGGUUUACGAUACAGUGGUCAUUACACUUAAGAACAUGGCUUCCCAUCCUGUCAGUCUUCACGCUGUUGGUGU



AUCCUACUGGAAAGCUUCUGAGGGAGCUGAAUACGACGAUCAGACCAGUCAAAGGGAGAAAGAAGACGAUAAA



GUCUUCCCUGGUGGAAGCCAUACAUACGUCUGGCAGGUCCUGAAAGAGAACGGUCCAAUGGCCUCUGACCCAC



UGUGCCUUACCUACUCAUAUCUUUCUCACGUGGACCUGGUCAAGGACUUGAAUUCAGGCCUCAUUGGAGCCCU



ACUAGUGUGUAGAGAAGGGAGUCUGGCCAAGGAGAAGACACAGACCUUGCACAAAUUUAUACUACUUUUCGCU



GUAUUUGACGAAGGGAAGAGUUGGCACUCAGAAACAAAGAACUCCUUGAUGCAGGAUAGGGACGCUGCAUCUG



CUCGGGCCUGGCCUAAGAUGCACACAGUCAACGGUUACGUAAACAGGUCCCUGCCAGGUCUGAUUGGCUGCCA



CAGGAAAUCAGUCUAUUGGCACGUGAUUGGAAUGGGCACCACUCCUGAAGUGCACUCAAUAUUCCUCGAAGGU



CACACAUUUCUUGUGAGGAACCAUCGCCAGGCGUCCUUGGAAAUCUCGCCAAUAACUUUCCUUACUGCUCAAA



CACUCUUGAUGGACCUUGGACAGUUUCUACUGUCUUGUCAUAUCUCUUCCCACCAACACGACGGCAUGGAAGC



UUACGUCAAAGUAGACAGCUGUCCAGAGGAACCCCAACUACGAAUGAAGAAUAACGAAGAAGCGGAAGACUAC



GACGACGAUCUUACUGAUUCUGAAAUGGACGUGGUCAGGUUUGACGACGACAACUCUCCUUCCUUUAUCCAAA



UUCGCUCAGUUGCCAAGAAGCAUCCUAAGACUUGGGUACAUUACAUUGCUGCUGAAGAGGAGGACUGGGACUA



CGCUCCCUUAGUCCUCGCCCCUGACGACAGAAGUUAUAAGAGUCAAUAUUUGAACAACGGCCCUCAGCGGAUU



GGUAGGAAGUACAAGAAAGUCCGAUUUAUGGCAUACACAGACGAAACCUUUAAGACUCGUGAAGCUAUUCAGC



ACGAAUCAGGAAUCUUGGGACCUUUACUUUACGGGGAAGUUGGAGACACACUGUUGAUUAUAUUUAAGAAUCA



AGCAAGCAGACCAUAUAACAUCUACCCUCACGGAAUCACUGACGUCCGUCCUUUGUAUUCAAGGAGAUUACCC



AAGGGUGUCAAGCAUUUGAAGGAUUUUCCAAUUCUGCCAGGAGAAAUAUUCAAAUAUAAGUGGACAGUGACUG



UAGAAGACGGGCCAACUAAAUCAGAUCCUCGGUGCCUGACCCGCUAUUACUCUAGUUUCGUUAAUAUGGAGAG



AGAUCUAGCUUCAGGACUCAUUGGCCCUCUCCUCAUCUGCUACAAAGAAUCUGUAGAUCAAAGAGGAAACCAG



AUAAUGUCAGACAAGAGGAACGUCAUCCUGUUCAGCGUCUUCGACGAGAACAGGAGCUGGUACCUCACAGAGA



AUAUACAACGCUUUCUCCCCAAUCCAGCUGGAGUGCAGCUUGAGGAUCCAGAGUUCCAAGCCUCCAACAUCAU



GCACAGCAUCAACGGCUACGUGUUCGAUAGUUUGCAGUUGUCAGUUUGUUUGCACGAGGUGGCAUACUGGUAC



AUUCUAAGCAUUGGAGCACAGACUGACUUCCUGAGCGUGUUCUUCAGCGGCUACACCUUCAAACACAAGAUGG



UCUACGAAGACACACUCACCCUAUUCCCAUUCUCAGGAGAAACUGUCUUCAUGUCGAUGGAGAACCCAGGUCU



GUGGAUUCUGGGGUGCCACAACUCAGACUUUCGGAACAGAGGCAUGACCGCCUUACUGAAGGUUUCUAGUUGU



GACAAGAACACUGGUGAUUAUUACGAGGACAGUUACGAAGAUAUUUCAGCAUACUUGCUGAGUAAGAACAACG



CCAUUGAACCAAGAAGCUUCUCCCAGAAUUCAAGACACCCUAGCACUAGGCAGAAGCAAUUUAACGCCACCAC



AAUUCCAGAGAACGACAUAGAGAAGACUGACCCUUGGUUUGCACACAGAACACCUAUGCCUAAGAUACAGAAC



GUCUCCUCUAGUGAUUUGUUGAUGCUCUUGCGACAGAGUCCUACUCCACACGGGCUAUCCUUAUCUGAUCUCC



AAGAAGCCAAAUACGAGACAUUCUCUGACGAUCCAUCACCUGGAGCAAUAGACAGUAAUAACAGCCUGUCUGA



AAUGACACACUUCAGGCCACAGCUCCAUCACAGUGGGGACAUGGUAUUUACCCCUGAGUCAGGCCUCCAAUUA



AGAUUAAACGAGAAACUGGGGACAACUGCAGCAACAGAGUUGAAGAAACUUGAUUUCAAAGUUUCUAGUACAU



CAAAUAACCUGAUCUCCACCAUCCCCAGCGACAAUUUGGCAGCAGGUACUGAUAAUACAAGUUCCUUAGGACC



ACCAAGUAUGCCAGUUCAUUACGAUAGUCAAUUAGAUACCACUCUAUUUGGCAAGAAGUCAUCUCCCCUUACU



GAGUCUGGUGGACCUCUGAGCUUGAGUGAAGAGAACAACGACUCCAAACUGCUGGAAUCCGGCUUAAUGAAUA



GCCAAGAAAGUAGCUGGGGCAAGAACGUAUCGUCACAACGGGAAAUAACUCGUACUACUCUUCAGUCAGAUCA



AGAGGAAAUUGACUACGACGAUACCAUAUCAGUUGAAAUGAAGAAGGAAGAUUUUGACAUUUACGACGAGGAC



GAGAAUCAGUCACCCCGCAGCUUUCAGAAGAAGACACGACACUAUUUCAUCGCCGCCGUGGAGAGGCUGUGGG



AUUACGGGAUGAGUAGCUCCCCACACGUUCUAAGAAACAGGGCUCAGAGUGGCAGUGUCCCUCAGUUCAAGAA



AGUUGUUUUCCAGGAAUUUACUGACGGCUCCUUUACUCAGCCCUUAUACCGUGGAGAACUAAACGAACAUUUG



GGACUCCUGGGGCCAUAUAUAAGAGCAGAAGUUGAAGAUAAUAUCAUGGUAACUUUCAGAAAUCAGGCCUCUC



GUCCCUAUUCCUUCUAUUCUAGCCUGAUCAGCUACGAGGAGGACCAGCGCCAGGGAGCAGAACCUAGAAAGAA



CUUUGUCAAGCCUAACGAAACCAAGACUUACUUUUGGAAAGUGCAACAUCAUAUGGCACCCACUAAAGACGAG



UUUGACUGCAAAGCCUGGGCUUAUUUCUCUGACGUUGACCUGGAGAAAGACGUGCACUCAGGCCUGAUUGGAC



CCCUUCUGGUCUGCCACACUAACACACUGAACCCUGCUCACGGGAGACAAGUGACAGUACAGGAAUUUGCUCU



GUUCUUCACCAUCUUUGACGAAACCAAGUCCUGGUACUUCACCGAGAAUAUGGAAAGAAACUGCAGGGCUCCC



UGCAAUAUCCAGAUGGAAGAUCCCACUUUUAAAGAGAAUUAUCGCUUCCACGCAAUCAACGGCUACAUAAUGG



AUACACUACCUGGCUUAGUAAUGGCUCAGGAUCAAAGGAUUAGGUGGUAUCUGCUCAGCAUGGGCAGCAACGA



GAACAUCCAUUCUAUUCAUUUCAGUGGACACGUGUUCACUGUACGGAAGAAAGAGGAGUAUAAGAUGGCACUG



UACAAUCUCUAUCCAGGUGUGUUCGAGACAGUGGAAAUGUUACCAUCCAAAGCUGGAAUUUGGCGGGUGGAGU



GCCUUAUUGGCGAGCAUCUACACGCUGGGAUGAGCACACUGUUCCUGGUGUACAGCAAUAAGUGUCAGACUCC



CCUGGGAAUGGCUUCUGGACACAUUAGAGAUUUUCAGAUUACAGCUUCAGGACAAUACGGACAGUGGGCCCCA



AAGCUGGCCAGACUUCAUUAUUCCGGAUCAAUCAACGCCUGGUCCACCAAGGAGCCCUUCAGCUGGAUCAAGG



UGGAUCUGUUGGCACCAAUGAUUAUUCACGGCAUCAAGACCCAGGGUGCCCGUCAGAAGUUCUCCAGCCUCUA



CAUCUCUCAGUUUAUCAUCAUGUAUAGUCUUGACGGGAAGAAGUGGCAGACUUAUCGAGGAAAUUCCACUGGA



ACCUUAAUGGUCUUCUUUGGCAACGUGGAUUCAUCUGGGAUCAAGCACAAUAUCUUCAACCCUCCAAUUAUUG



CUCGAUACAUCCGUUUGCACCCAACUCAUUAUAGCAUUCGCAGCACUCUUCGCAUGGAGUUGAUGGGCUGUGA



UUUAAAUAGUUGCAGCAUGCCAUUGGGAAUGGAGAGUAAAGCAAUAUCAGACGCACAGAUUACUGCUUCAUCC



UACUUUACCAAUAUGUUUGCCACCUGGUCCCCUUCCAAGGCUCGACUUCACCUCCAAGGGAGGAGUAACGCCU



GGAGGCCUCAGGUGAAUAAUCCGAAGGAGUGGCUGCAAGUGGACUUCCAGAAGACAAUGAAAGUCACAGGAGU



AACUACUCAGGGAGUCAAGUCUCUGCUUACCAGCAUGUACGUGAAGGAGUUCCUCAUCUCCAGCAGUCAAGAC



GGCCAUCAGUGGACUCUCUUCUUUCAGAACGGCAAAGUAAAGGUGUUUCAGGGAAAUCAAGACUCCUUCACAC



CUGUGGUGAACAGCCUGGACCCACCGUUACUGACUCGCUACCUUCGAAUUCAUCCGCAGUCCUGGGUGCACCA



GAUCGCCCUCAGGAUGGAGGUUCUGGGCUGCGAGGCACAGGACCUCUAC





130
AUGCAGAUCGAGCUGAGCACCUGCUUCUUCCUGUGCCUGCUGAGAUUCUGCUUCAGCGCCACCAGAAGAUACU



ACCUGGGCGCCGUGGAGCUGAGCUGGGACUACAUGCAGAGCGACCUGGGCGAGCUGCCUGUGGACGCCAGAUU



CCCUCCUAGAGUGCCUAAGAGCUUCCCUUUCAACACCAGCGUGGUGUACAAGAAGACCCUGUUCGUGGAGUUC



ACCGACCACCUGUUCAACAUCGCCAAGCCUAGACCUCCUUGGAUGGGCCUGCUGGGCCCUACCAUCCAGGCCG



AGGUGUACGACACCGUGGUGAUCACCCUGAAGAACAUGGCCAGCCACCCUGUGAGCCUGCACGCCGUGGGCGU



GAGCUACUGGAAGGCCAGCGAGGGCGCCGAGUACGACGACCAGACCAGCCAGAGAGAGAAGGAGGACGACAAG



GUGUUCCCUGGCGGCAGCCACACCUACGUGUGGCAGGUGCUGAAGGAGAACGGCCCUAUGGCCAGCGACCCUC



UGUGCCUGACCUACAGCUACCUGAGCCACGUGGACCUGGUGAAGGACCUGAACUCAGGCCUGAUCGGCGCGCU



GCUGGUUUGCAGAGAGGGCAGCCUGGCCAAGGAGAAGACCCAGACCCUGCACAAGUUCAUCCUGCUGUUCGCC



GUGUUCGACGAGGGCAAGAGCUGGCACAGCGAGACGAAGAACAGCCUGAUGCAGGACAGAGACGCCGCCAGCG



CCAGAGCCUGGCCUAAGAUGCACACCGUGAACGGCUACGUGAACAGAAGCCUGCCCGGCCUCAUUGGUUGCCA



CCGCAAGUCCGUGUACUGGCACGUGAUCGGCAUGGGCACCACCCCUGAGGUGCACAGCAUCUUCCUGGAGGGC



CACACCUUCCUGGUGAGAAACCACAGACAGGCCAGCCUGGAGAUCAGCCCUAUCACCUUCCUGACCGCCCAGA



CCCUCCUGAUGGACCUGGGCCAAUUCCUGCUGUCCUGUCACAUCUCUAGCCACCAGCACGACGGCAUGGAGGC



CUACGUGAAGGUGGACAGCUGCCCUGAGGAGCCUCAGCUGAGAAUGAAGAACAACGAGGAGGCCGAGGACUAC



GACGACGACCUGACCGACAGCGAGAUGGACGUGGUGAGAUUCGACGACGACAACAGCCCUAGCUUCAUCCAGA



UCAGAAGCGUGGCCAAGAAGCACCCUAAGACCUGGGUGCACUACAUCGCCGCCGAGGAGGAGGACUGGGACUA



CGCCCCUCUGGUGCUGGCCCCUGACGACAGAAGCUACAAGAGCCAGUACCUGAACAACGGCCCUCAGAGAAUC



GGCAGAAAGUACAAGAAGGUGAGAUUCAUGGCCUACACCGACGAGACUUUCAAGACCAGAGAGGCCAUCCAGC



ACGAGAGCGGCAUCCUGGGCCCUCUGCUGUACGGCGAGGUGGGCGACACCCUGCUGAUCAUCUUCAAGAACCA



AGCCAGCAGACCCUACAACAUCUACCCUCACGGCAUCACCGACGUGCGGCCUCUGUACAGCAGAAGACUGCCU



AAGGGCGUGAAGCACCUGAAGGACUUCCCUAUCCUGCCUGGCGAGAUCUUCAAGUACAAGUGGACCGUGACCG



UGGAGGACGGCCCUACCAAGAGCGACCCUAGGUGCCUGACCAGAUACUACAGCAGCUUCGUGAACAUGGAGCG



GGACCUGGCCUCCGGGCUGAUCGGGCCACUGCUGAUCUGCUACAAGGAGAGCGUGGAUCAGCGCGGAAACCAG



AUCAUGAGCGACAAGAGAAACGUGAUCCUGUUCUCAGUGUUCGACGAGAACAGAAGCUGGUACCUGACCGAGA



ACAUCCAGAGAUUCCUGCCUAACCCCGCCGGUGUCCAGCUGGAGGACCCCGAGUUCCAGGCCAGCAACAUCAU



GCACAGCAUCAACGGCUACGUCUUCGACAGCCUGCAGCUGAGCGUGUGCCUGCACGAGGUGGCCUACUGGUAC



AUCCUGAGCAUCGGCGCCCAGACCGACUUCUUAAGCGUCUUCUUUAGCGGGUACACCUUCAAACACAAGAUGG



UGUACGAGGACACCCUGACCCUGUUCCCUUUCAGCGGCGAAACCGUGUUCAUGAGCAUGGAGAACCCUGGCCU



GUGGAUCCUGGGCUGCCACAACAGCGACUUCAGAAACAGAGGCAUGACCGCCCUGCUGAAGGUGAGCAGCUGC



GACAAGAACACCGGCGACUACUACGAGGACAGCUACGAAGACAUCAGCGCCUACCUGCUGAGCAAGAACAACG



CCAUCGAGCCUAGAAGCUUCAGCCAGAACAGCAGACACCCUAGCACCAGACAGAAGCAGUUCAACGCCACCAC



CAUCCCUGAGAACGACAUCGAGAAGACCGACCCUUGGUUCGCCCACAGAACCCCUAUGCCUAAGAUCCAGAAC



GUGAGCAGCAGCGACCUGCUGAUGCUGCUGAGACAGAGCCCUACCCCUCACGGCCUGAGCCUGAGCGACCUGC



AGGAGGCCAAGUACGAAACUUUCAGCGACGACCCUAGCCCUGGCGCCAUCGACUCCAACAACAGCCUGUCCGA



GAUGACGCACUUUAGACCUCAGCUGCACCACAGCGGCGACAUGGUGUUCACCCCUGAGAGCGGACUGCAGCUG



AGACUGAACGAGAAGCUGGGCACCACCGCCGCCACCGAGCUGAAGAAGCUGGACUUCAAGGUUUCGUCUACGA



GCAACAACCUGAUCAGCACCAUCCCUAGCGACAACCUGGCCGCCGGCACCGACAACACCAGCUCGCUGGGCCC



GCCCAGCAUGCCUGUGCACUACGACAGCCAGCUGGACACCACCCUGUUCGGCAAGAAGUCCAGCCCUCUGACC



GAGUCCGGCGGUCCCCUGUCCCUGUCCGAGGAGAACAACGACAGCAAGCUGCUGGAGAGCGGUCUGAUGAACA



GCCAGGAGAGCAGCUGGGGCAAGAACGUCAGCAGCCAGAGAGAGAUCACCAGAACCACCCUGCAAAGCGAUCA



GGAAGAAAUCGAUUACGACGAUACCAUCAGCGUGGAGAUGAAGAAGGAGGACUUCGACAUCUACGACGAGGAC



GAGAACCAGAGCCCAAGGUCUUUCCAGAAGAAGACCAGACACUACUUCAUCGCCGCCGUGGAGAGACUGUGGG



ACUACGGGAUGAGCAGCAGCCCUCACGUGCUGAGAAACAGAGCCCAGAGCGGCAGCGUGCCUCAAUUCAAGAA



GGUUGUGUUCCAGGAGUUCACUGACGGCAGCUUCACCCAACCUCUAUACAGAGGCGAGCUGAACGAGCAUCUC



GGCCUGCUGGGACCCUACAUCAGAGCCGAGGUGGAGGACAACAUCAUGGUGACCUUCAGAAACCAGGCCAGCA



GACCUUACAGCUUCUACAGCAGCCUGAUCAGCUACGAGGAGGACCAGAGACAGGGCGCCGAGCCUAGAAAGAA



CUUCGUAAAGCCUAACGAGACAAAGACCUACUUCUGGAAGGUGCAGCACCACAUGGCCCCUACCAAGGACGAG



UUCGACUGCAAGGCCUGGGCCUACUUCAGCGACGUCGAUCUGGAGAAGGACGUGCACAGCGGCCUCAUCGGCC



CUCUGUUAGUCUGUCACACCAACACCCUGAACCCUGCCCACGGCAGACAGGUGACCGUGCAGGAGUUCGCCCU



GUUCUUCACCAUCUUCGACGAGACUAAGAGCUGGUACUUCACCGAGAAUAUGGAGAGAAACUGCAGAGCCCCU



UGCAACAUCCAGAUGGAGGACCCUACCUUCAAGGAGAACUACAGAUUCCACGCUAUCAACGGUUAUAUCAUGG



ACACCCUGCCUGGGCUGGUGAUGGCCCAGGACCAGAGAAUCCGGUGGUAUCUCCUUUCCAUGGGCAGCAACGA



GAACAUUCACAGCAUCCACUUCAGCGGCCACGUGUUCACCGUGAGAAAGAAGGAGGAGUACAAGAUGGCCCUG



UACAACCUGUACCCUGGCGUGUUCGAAACCGUGGAGAUGCUGCCUAGCAAGGCCGGCAUCUGGAGAGUGGAGU



GCCUGAUCGGAGAGCACCUGCACGCCGGCAUGAGCACCCUGUUCCUGGUGUACAGCAACAAGUGCCAGACACC



UCUGGGUAUGGCUAGCGGCCACAUCCGGGACUUCCAAAUCACGGCCAGCGGGCAAUACGGCCAGUGGGCCCCU



AAGCUGGCCAGACUGCACUACAGCGGCAGCAUCAACGCCUGGAGCACCAAGGAGCCUUUCAGCUGGAUCAAGG



UGGACCUGCUGGCCCCUAUGAUCAUCCACGGAAUCAAGACCCAGGGCGCCAGACAGAAGUUCAGCAGCCUGUA



CAUCAGCCAGUUCAUCAUCAUGUACAGCCUGGACGGCAAGAAGUGGCAGACCUACAGAGGCAACAGCACCGGC



ACCCUGAUGGUGUUCUUCGGCAACGUGGACAGCAGCGGCAUCAAGCACAACAUCUUCAACCCUCCUAUCAUCG



CCAGAUACAUCAGACUGCACCCUACCCACUACAGCAUCAGAUCCACCCUGAGGAUGGAGCUCAUGGGCUGUGA



CCUGAACAGCUGCAGCAUGCCUCUGGGCAUGGAGAGCAAGGCCAUCAGCGACGCCCAGAUCACCGCCAGCAGC



UACUUCACCAACAUGUUCGCCACCUGGAGCCCUAGCAAGGCGCGGUUGCACCUGCAGGGCAGGAGCAACGCUU



GGAGGCCUCAGGUGAACAACCCUAAGGAGUGGCUGCAGGUGGACUUCCAGAAGACCAUGAAGGUGACCGGCGU



GACCACCCAGGGCGUCAAGUCCCUGCUGACCAGCAUGUACGUGAAGGAGUUCCUGAUCAGCAGCAGCCAGGAC



GGCCACCAGUGGACCCUGUUCUUCCAGAACGGCAAGGUGAAGGUGUUCCAGGGCAACCAGGACAGCUUCACCC



CUGUGGUGAACAGCCUGGACCCUCCUCUGCUGACAAGAUACCUGAGAAUCCACCCUCAGAGCUGGGUGCACCA



GAUCGCCCUGAGAAUGGAGGUGCUGGGCUGCGAGGCCCAGGACCUGUAC





131
AUGCAGAUCGAGCUGAGCACCUGCUUCUUCCUGUGCCUGCUGAGAUUCUGCUUCAGCGCCACCAGAAGAUACU



ACCUGGGAGCCGUGGAGCUGUCUUGGGACUACAUGCAGAGCGACCUGGGCGAGCUGCCUGUGGACGCCAGAUU



CCCUCCUAGAGUGCCUAAGAGCUUCCCUUUCAACACCAGCGUGGUGUACAAGAAGACCCUGUUCGUGGAGUUC



ACCGACCACCUGUUCAACAUCGCCAAGCCUAGACCUCCUUGGAUGGGCCUGCUGGGCCCUACCAUCCAGGCCG



AGGUGUACGACACCGUGGUGAUCACCCUGAAGAACAUGGCCAGCCACCCUGUGAGCCUGCACGCCGUGGGCGU



GAGCUACUGGAAGGCCAGCGAGGGCGCCGAGUACGACGACCAGACCAGCCAGAGAGAGAAGGAGGACGACAAG



GUGUUCCCUGGCGGCAGCCACACCUACGUGUGGCAGGUGCUGAAGGAGAACGGCCCUAUGGCCAGCGACCCUC



UGUGCCUGACCUACAGCUACCUGAGCCACGUGGACCUGGUGAAGGACCUGAACAGCGGCCUGAUCGGCGCACU



CCUGGUCUGCAGGGAGGGGAGCCUGGCCAAGGAGAAGACGCAGACCCUGCACAAGUUCAUCCUGCUGUUCGCC



GUGUUCGACGAGGGCAAGAGCUGGCACAGCGAAACCAAGAACAGCCUGAUGCAGGACAGAGACGCCGCCAGCG



CCAGAGCCUGGCCUAAGAUGCACACCGUGAACGGCUACGUGAACAGAAGCCUGCCUGGCCUCAUUGGCUGCCA



CAGAAAGAGCGUGUACUGGCACGUGAUCGGCAUGGGCACCACCCCUGAGGUGCACAGCAUCUUCCUGGAGGGC



CACACCUUCCUGGUGAGAAACCACAGACAGGCCAGCCUGGAGAUCAGCCCUAUCACCUUCCUGACAGCCCAGA



CCCUCCUCAUGGACCUGGGCCAGUUCCUCCUGUCCUGUCACAUCAGCAGCCACCAGCACGACGGCAUGGAGGC



CUACGUGAAGGUGGACAGCUGCCCUGAGGAGCCUCAGCUGAGAAUGAAGAACAACGAGGAGGCCGAGGACUAC



GACGACGACCUGACCGACAGCGAGAUGGACGUGGUGAGAUUCGACGACGACAACAGCCCUAGCUUCAUCCAGA



UCAGAAGCGUGGCCAAGAAGCACCCUAAGACCUGGGUGCACUACAUCGCCGCCGAGGAGGAGGACUGGGACUA



CGCCCCACUGGUGCUGGCCCCUGACGACAGAAGCUACAAGAGCCAGUACCUGAACAACGGCCCUCAGAGAAUC



GGCAGAAAGUACAAGAAGGUGAGAUUCAUGGCCUACACCGACGAAACCUUCAAGACCAGAGAGGCCAUCCAGC



ACGAGUCCGGAAUCCUGGGUCCCCUGCUGUACGGCGAGGUGGGCGACACCCUGCUGAUCAUCUUCAAGAACCA



GGCCAGCAGACCUUACAACAUCUACCCUCACGGCAUCACCGACGUUAGACCUCUGUACAGCAGAAGACUGCCU



AAGGGCGUGAAGCACCUGAAGGACUUCCCUAUCCUGCCUGGCGAGAUCUUCAAGUACAAGUGGACCGUGACCG



UGGAGGACGGCCCUACCAAGAGCGACCCUAGGUGCCUGACCAGAUACUACAGCAGCUUCGUGAACAUGGAGCG



GGACCUGGCCUCUGGACUGAUUGGACCACUGCUUAUCUGCUACAAGGAGAGCGUGGACCAGCGGGGAAACCAG



AUCAUGAGCGACAAGAGAAACGUGAUCCUGUUCUCAGUUUUCGACGAGAACAGAAGCUGGUACCUGACCGAGA



ACAUCCAGAGAUUCCUGCCCAACCCUGCCGGCGUGCAGCUGGAGGAUCCUGAGUUCCAGGCUUCCAACAUCAU



GCACUCGAUCAACGGAUACGUUUUCGACAGCCUGCAGCUGAGCGUGUGCCUGCACGAGGUGGCCUACUGGUAC



AUCCUGAGCAUCGGCGCCCAGACCGACUUCCUCAGCGUGUUCUUUAGCGGAUACACAUUCAAGCACAAGAUGG



UGUACGAGGACACCCUUACUCUGUUCCCUUUCAGCGGCGAAACCGUGUUCAUGAGCAUGGAGAACCCUGGCCU



GUGGAUCCUGGGCUGCCACAACAGCGACUUCAGAAACAGAGGCAUGACCGCCCUGCUGAAGGUGAGCAGCUGC



GACAAGAACACCGGCGACUACUACGAGGACAGCUACGAGGACAUCAGCGCCUACCUGCUGAGCAAGAACAACG



CCAUCGAGCCUAGAAGCUUCAGCCAGAACAGCAGACACCCUAGCACCAGACAGAAGCAGUUCAACGCCACCAC



CAUCCCUGAGAACGACAUCGAGAAGACCGACCCUUGGUUCGCCCACAGAACCCCUAUGCCUAAGAUCCAGAAC



GUGUCCAGCUCCGACCUCCUGAUGCUGCUUAGACAGAGCCCUACCCCUCACGGCCUGAGCCUGAGCGACCUGC



AGGAGGCCAAGUACGAGACAUUCAGCGACGACCCUAGCCCCGGGGCCAUAGAUUCCAACAACAGCCUGAGCGA



GAUGACCCACUUCAGACCUCAGCUGCACCACAGCGGCGACAUGGUGUUCACCCCUGAGAGCGGCCUUCAAUUG



AGACUGAACGAGAAGCUGGGCACCACCGCCGCCACCGAGCUGAAGAAGCUGGACUUCAAGGUAAGCUCAACCA



GCAACAACCUGAUCAGCACCAUCCCUAGCGACAACCUGGCCGCCGGCACCGACAAUACCAGCAGCCUGGGGCC



UCCUAGCAUGCCUGUGCACUACGACAGCCAGCUGGACACCACCCUGUUCGGCAAGAAGUCCAGCCCUCUGACC



GAGAGCGGCGGCCCUCUUAGCCUCUCUGAAGAGAACAACGACAGCAAGCUGCUGGAAUCGGGACUCAUGAACA



GCCAGGAGAGCAGCUGGGGCAAGAACGUGAGUUCAACCGAAAGUGGUAGACUGUUCAAGGGUAAGAGGGCCCA



CGGCCCCGCCCUCCUCACCAAGGACAACGCCCUGUUCAAGGUGAGUAUCAGCCUGCUGAAGACCAACAAGACA



AGCAAUAACAGCGCCACCAACAGAAAGACCCACAUCGACGGUCCCAGCCUCCUCAUCGAGAACUCACCCUCUG



UGUGGCAGAACAUCCUGGAGAGCGACACCGAGUUCAAGAAGGUGACCCCUCUGAUCCACGACAGAAUGCUGAU



GGACAAGAACGCCACCGCCUUGCGCCUGAAUCACAUGAGCAACAAGACCACCAGCAGCAAGAACAUGGAGAUG



GUCCAGCAGAAGAAGGAGGGCCCUAUCCCUCCUGACGCCCAGAACCCUGACAUGAGCUUCUUCAAGAUGCUGU



UCCUGCCUGAGAGCGCCAGGUGGAUCCAGAGAACCCACGGCAAGAAUUCCCUGAAUUCGGGCCAGGGCCCUAG



CCCUAAGCAGCUGGUGUCUCUCGGCCCUGAGAAGAGUGUGGAGGGCCAGAAUUUCUUAUCUGAGAAGAACAAG



GUGGUGGUGGGCAAGGGCGAGUUCACCAAGGACGUGGGCCUGAAGGAGAUGGUGUUCCCCAGCUCCCGCAACC



UGUUCCUGACCAACCUGGACAACCUGCACGAGAACAACACCCACAACCAGGAGAAGAAGAUCCAGGAGGAGAU



CGAGAAGAAGGAGACUCUGAUCCAGGAGAACGUGGUGCUGCCUCAGAUCCACACCGUGACCGGCACCAAGAAC



UUCAUGAAGAACCUGUUCCUCCUGAGUACCAGGCAGAACGUGGAGGGCAGCUACGACGGCGCCUACGCCCCUG



UGCUUCAGGACUUCAGGAGCCUGAACGACUCCACCAACAGAACCAAGAAGCACACCGCCCACUUCAGCAAGAA



GGGCGAGGAGGAGAACCUGGAGGGCCUGGGCAACCAGACCAAGCAGAUCGUGGAGAAGUACGCCUGCACCACC



AGAAUCAGCCCUAACACCAGCCAGCAGAACUUCGUGACCCAGAGAAGCAAGCGCGCCCUCAAACAGUUCCGCC



UGCCUCUGGAGGAAACCGAGCUGGAGAAGAGAAUCAUCGUGGACGACACCAGCACCCAGUGGAGUAAGAACAU



GAAGCAUCUGACCCCUAGCACCCUGACCCAGAUCGACUACAACGAGAAGGAGAAGGGCGCCAUCACCCAGAGC



CCUCUGAGCGACUGUUUGACGCGGUCCCAUUCGAUACCCCAGGCCAACCGCAGCCCUCUGCCUAUCGCUAAGG



UGAGCUCCUUCCCUAGCAUCAGACCUAUCUACCUGACCAGAGUGCUGUUCCAGGACAACAGCAGCCACCUGCC



UGCCGCCAGCUACAGAAAGAAGGACAGCGGCGUGCAAGAGUCCAGUCACUUCCUGCAGGGCGCCAAGAAGAAC



AACCUGAGCCUGGCCAUCCUGACCCUGGAGAUGACCGGCGACCAGAGAGAGGUGGGCAGCCUGGGCACCUCUG



CAACCAAUAGCGUGACCUAUAAGAAGGUCGAGAACACCGUGCUGCCUAAGCCUGACCUGCCUAAGACCAGCGG



CAAGGUGGAGCUGCUGCCCAAAGUGCACAUCUACCAGAAGGACCUGUUCCCUACCGAAACAAGCAACGGCAGC



CCCGGCCACCUGGACCUGGUCGAGGGCUCCCUUCUGCAGGGCACCGAGGGCGCAAUCAAGUGGAACGAGGCCA



ACAGACCUGGCAAGGUGCCUUUCCUGAGAGUGGCCACCGAGAGCAGCGCCAAGACCCCUUCCAAGUUGCUUGA



CCCUCUGGCCUGGGACAACCACUACGGCACCCAGAUCCCUAAGGAGGAGUGGAAGUCCCAGGAGAAGAGUCCA



GAGAAGACCGCCUUCAAGAAGAAGGACACCAUCCUGAGCCUGAACGCCUGCGAGAGCAACCACGCCAUCGCCG



CCAUCAACGAAGGACAGAACAAGCCUGAGAUCGAGGUGACCUGGGCCAAGCAGGGCCGGACCGAGAGGCUGUG



CAGCCAGAACCCUCCUGUGCUGAAGAGACACCAGAGAGAGAUCACCAGAACCACCCUGCAGUCUGACCAGGAG



GAAAUCGACUACGACGACACCAUCAGCGUGGAGAUGAAGAAGGAGGACUUCGACAUCUACGACGAGGACGAGA



ACCAGAGCCCUAGAAGUUUCCAGAAGAAGACCAGACACUACUUCAUCGCCGCCGUGGAGAGACUGUGGGACUA



CGGCAUGAGCAGCAGCCCUCACGUGCUGAGAAACAGAGCCCAGAGCGGCAGCGUGCCUCAAUUCAAGAAGGUA



GUGUUCCAGGAAUUCACCGACGGAUCCUUUACACAGCCCCUGUACCGCGGGGAGCUGAACGAGCACCUAGGAC



UGCUUGGCCCUUACAUCAGAGCCGAGGUGGAGGACAACAUCAUGGUGACCUUCAGAAACCAGGCAUCCCGCCC



UUACAGCUUCUACAGCAGCCUGAUCAGUUACGAAGAGGACCAGAGGCAAGGCGCCGAACCCCGCAAGAAUUUC



GUCAAGCCUAACGAAACCAAGACCUACUUCUGGAAGGUGCAGCACCACAUGGCCCCUACCAAGGACGAGUUCG



ACUGCAAGGCCUGGGCCUACUUCAGCGACGUGGAUCUGGAGAAGGACGUGCAUAGCGGAUUGAUCGGCCCGUU



GUUAGUGUGCCACACCAACACCCUGAACCCUGCCCACGGCAGACAGGUGACCGUCCAGGAGUUCGCUCUGUUC



UUCACCAUCUUCGACGAAACAAAGAGCUGGUACUUCACCGAGAACAUGGAGCGAAACUGCAGAGCCCCUUGCA



ACAUCCAGAUGGAGGACCCUACCUUCAAGGAGAACUACAGAUUCCACGCUAUCAACGGAUACAUCAUGGACAC



ACUGCCGGGCUUGGUGAUGGCCCAGGACCAGAGAAUCCGCUGGUAUCUACUUUCCAUGGGCAGCAACGAGAAC



AUCCACAGCAUCCACUUCUCCGGCCACGUGUUCACCGUGAGAAAGAAGGAGGAGUACAAGAUGGCCCUGUACA



ACCUGUACCCUGGCGUGUUCGAGACAGUGGAGAUGCUGCCUAGCAAGGCCGGCAUCUGGAGAGUGGAGUGUCU



AAUCGGAGAGCACCUCCACGCAGGCAUGUCCACACUGUUCCUGGUGUACAGCAACAAGUGCCAGACCCCUCUG



GGCAUGGCAUCCGGUCACAUCAGAGACUUCCAGAUCACCGCCAGCGGCCAGUACGGCCAGUGGGCCCCUAAGC



UGGCCAGACUGCACUACAGCGGCAGCAUCAACGCCUGGAGCACCAAGGAGCCUUUCAGCUGGAUCAAGGUGGA



CCUGCUGGCCCCUAUGAUCAUCCACGGCAUCAAGACCCAGGGCGCCAGACAGAAGUUCAGCAGCCUGUACAUC



AGCCAGUUCAUCAUCAUGUACAGCCUGGACGGCAAGAAGUGGCAGACCUACAGAGGCAACAGCACCGGCACCC



UGAUGGUGUUCUUCGGCAACGUGGACAGCAGCGGCAUCAAGCACAACAUCUUCAACCCUCCUAUCAUCGCCAG



AUACAUCAGACUGCACCCUACCCACUACAGCAUCAGAAGCACCCUGAGAAUGGAGCUGAUGGGCUGCGACCUC



AAUAGUUGCAGCAUGCCACUCGGAAUGGAGAGCAAGGCCAUCAGCGACGCACAGAUCACAGCAUCCAGCUACU



UCACCAACAUGUUCGCCACCUGGAGCCCAAGCAAGGCCCGGCUGCACCUGCAGGGCAGGAGCAACGCGUGGAG



GCCUCAGGUGAACAACCCUAAGGAGUGGCUGCAGGUAGACUUCCAGAAGACCAUGAAGGUAACCGGCGUGACC



ACCCAGGGCGUCAAGUCCCUGCUGACCAGCAUGUACGUGAAGGAGUUCCUGAUCAGCAGCAGCCAGGACGGCC



ACCAGUGGACCCUGUUCUUCCAGAACGGCAAGGUGAAGGUGUUCCAGGGCAACCAGGACAGCUUCACCCCUGU



GGUGAACAGCCUGGACCCUCCUCUGCUGACACGCUACCUGAGAAUCCACCCUCAGAGCUGGGUGCACCAGAUC



GCUUUGAGGAUGGAGGUGCUGGGCUGCGAGGCCCAGGACCUGUAC





132
AUGCAGAUCGAGCUGAGCACCUGCUUCUUCCUGUGCCUGCUGAGAUUCUGCUUCAGCGCCACCAGAAGAUACU



ACCUGGGCGCCGUGGAGCUGAGCUGGGACUACAUGCAGAGCGACCUGGGCGAGCUGCCUGUGGACGCCAGAUU



CCCUCCUAGAGUGCCUAAGAGCUUCCCUUUCAACACCAGCGUGGUGUACAAGAAGACCCUGUUCGUGGAGUUC



ACCGACCACCUGUUCAACAUCGCCAAGCCUAGACCUCCUUGGAUGGGCCUGCUGGGCCCUACCAUCCAGGCCG



AGGUGUACGACACCGUGGUGAUCACCCUGAAGAACAUGGCCAGCCACCCUGUGAGCCUGCACGCCGUGGGCGU



GAGCUACUGGAAGGCCAGCGAGGGCGCCGAGUACGACGACCAGACCAGCCAGAGAGAGAAGGAGGACGACAAG



GUGUUCCCUGGCGGCAGCCACACCUACGUGUGGCAGGUGCUGAAGGAGAACGGCCCUAUGGCCAGCGACCCUC



UGUGCCUGACCUACAGCUACCUGAGCCACGUGGACCUGGUGAAGGACCUGAACUCCGGGCUGAUCGGAGCCCU



GCUGGUGUGCAGAGAGGGCAGCCUGGCCAAGGAGAAGACCCAGACCCUGCACAAGUUCAUCCUGCUGUUCGCC



GUGUUCGACGAGGGCAAGAGCUGGCACAGCGAGACAAAGAACAGCCUGAUGCAGGACAGAGACGCCGCCAGCG



CCAGAGCCUGGCCUAAGAUGCACACCGUGAACGGCUACGUGAACAGAAGCCUGCCUGGCCUGAUCGGCUGCCA



CAGAAAGAGCGUGUACUGGCACGUGAUCGGCAUGGGCACCACCCCUGAGGUGCACAGCAUCUUCCUGGAGGGC



CACACCUUCCUGGUGAGAAACCACAGACAGGCCAGCCUGGAGAUCAGCCCUAUCACCUUCCUGACCGCCCAGA



CCCUCCUGAUGGACCUGGGCCAGUUUCUCCUGUCCUGCCACAUCAGCAGCCAUCAGCACGACGGCAUGGAGGC



CUACGUGAAGGUGGACAGCUGCCCUGAGGAGCCUCAGCUGAGAAUGAAGAACAACGAGGAGGCCGAGGACUAC



GACGACGACCUGACCGACAGCGAGAUGGACGUGGUGAGAUUCGACGACGACAACAGCCCUAGCUUCAUCCAGA



UCAGAAGCGUGGCCAAGAAGCACCCUAAGACCUGGGUGCACUACAUCGCCGCCGAGGAGGAGGACUGGGACUA



CGCCCCUCUGGUGCUGGCCCCUGACGACAGAAGCUACAAGAGCCAGUACCUGAACAACGGCCCUCAGAGAAUC



GGCAGAAAGUACAAGAAGGUGAGAUUCAUGGCCUACACCGACGAAACCUUCAAGACCAGAGAGGCCAUCCAGC



ACGAGAGCGGCAUCCUGGGCCCUCUGCUGUACGGCGAGGUGGGCGACACCCUGCUGAUCAUCUUCAAGAACCA



AGCCAGCAGACCCUACAACAUCUACCCUCACGGCAUCACCGACGUGAGGCCUCUGUACAGCAGAAGACUGCCU



AAGGGCGUGAAGCACCUGAAGGACUUCCCUAUCCUGCCUGGCGAGAUCUUCAAGUACAAGUGGACCGUGACCG



UGGAGGACGGCCCUACCAAGAGCGACCCUCGCUGCCUGACCAGAUACUACAGCAGCUUCGUGAACAUGGAACG



GGACCUGGCCAGCGGGCUCAUCGGUCCCCUGCUCAUCUGCUACAAGGAGAGCGUGGACCAGAGAGGCAACCAG



AUCAUGAGCGACAAGAGAAACGUGAUCCUGUUCAGCGUGUUCGACGAGAACAGAAGCUGGUACCUGACCGAGA



ACAUCCAGAGAUUCCUGCCUAACCCUGCCGGCGUGCAGCUGGAGGACCCUGAGUUCCAGGCCAGCAACAUCAU



GCAUAGCAUCAACGGCUACGUGUUUGACAGCCUGCAGCUGAGCGUGUGCCUGCACGAGGUGGCCUACUGGUAC



AUCCUGAGCAUCGGCGCCCAGACCGACUUCCUCAGCGUCUUCUUCAGCGGCUACACCUUCAAGCACAAGAUGG



UGUACGAGGACACCCUGACCCUGUUCCCUUUCAGCGGCGAAACCGUGUUCAUGAGCAUGGAGAACCCUGGCCU



GUGGAUCCUGGGCUGCCACAACAGCGACUUCAGAAACAGAGGCAUGACCGCCCUGCUGAAGGUGAGCAGCUGC



GACAAGAACACCGGCGACUAUUACGAAGAUUCCUACGAGGACAUCAGCGCCUACCUGCUGAGCAAGAACAACG



CCAUCGAGCCUAGAAGCUUCAGCCAGAACAGCAGACACCCUAGCACCAGACAGAAGCAGUUCAACGCCACCAC



CAUCCCUGAGAACGACAUCGAGAAGACCGACCCUUGGUUCGCCCACAGAACCCCUAUGCCUAAGAUCCAGAAC



GUGAGCUCAAGCGACCUGCUGAUGCUGCUGCGUCAGAGCCCUACCCCUCACGGCCUGAGCCUCAGCGACCUGC



AGGAGGCCAAGUACGAGACUUUCAGCGACGACCCUAGCCCUGGCGCGAUCGACUCCAAUAAUAGCCUCAGCGA



GAUGACCCACUUCAGACCUCAGCUGCACCACAGCGGCGACAUGGUGUUCACGCCAGAGUCCGGCCUGCAGCUG



CGGCUGAACGAGAAGCUGGGCACCACCGCCGCCACCGAGCUGAAGAAGCUGGACUUCAAGGUGAGCAGCACCA



GCAACAACCUGAUCAGCACCAUCCCUAGCGACAACCUGGCCGCCGGCACCGACAACACCAGCAGCCUCGGGCC



UCCUAGCAUGCCUGUGCACUACGACAGCCAGCUGGACACCACCCUGUUCGGCAAGAAAUCCAGCCCUCUGACC



GAGAGCGGUGGUCCCCUGAGCCUGAGCGAGGAGAACAACGACAGCAAGCUGCUGGAGAGCGGCCUGAUGAACA



GCCAGGAGAGCAGCUGGGGCAAGAACGUGAGCAGCACCGAGAGCGGGAGACUGUUCAAGGGCAAGAGAGCCCA



CGGCCCUGCCCUGCUGACCAAGGACAACGCCCUGUUCAAGGUGAGCAUCAGCCUGCUGAAGACCAACAAGACC



AGCAACAACAGCGCCACCAACAGAAAGACCCACAUCGACGGCCCUAGCCUGCUGAUCGAGAACAGCCCUAGCG



UGUGGCAGAACAUCCUGGAGAGCGACACCGAGUUCAAGAAGGUGACCCCUCUGAUCCACGACAGAAUGCUGAU



GGACAAGAACGCCACCGCCCUGAGACUGAACCACAUGAGCAACAAGACCACCAGCAGCAAGAACAUGGAGAUG



GUGCAGCAGAAGAAGGAGGGCCCUAUCCCUCCUGACGCCCAGAACCCUGACAUGAGCUUCUUCAAGAUGCUGU



UCCUGCCUGAGAGCGCCCGGUGGAUCCAGAGAACCCACGGCAAGAACUCCCUGAACAGCGGACAGGGCCCUUC



CCCAAAGCAACUCGUGUCCCUGGGCCCUGAGAAGUCCGUGGAGGGCCAGAACUUCCUGAGCGAGAAGAACAAG



GUGGUGGUGGGCAAGGGCGAGUUCACCAAGGACGUCGGACUGAAAGAGAUGGUGUUCCCUAGCAGCAGAAACC



UGUUCCUGACCAACCUGGACAACCUGCACGAGAACAACACCCACAACCAGGAGAAGAAGAUCCAGGAGGAGAU



CGAGAAGAAGGAAACCCUGAUCCAGGAGAACGUGGUGCUGCCUCAGAUCCACACCGUGACCGGCACCAAGAAC



UUCAUGAAGAACCUGUUCCUGCUGAGCACCAGACAGAACGUGGAGGGCAGCUACGACGGCGCCUACGCCCCUG



UGCUGCAGGACUUCAGAAGCCUGAACGACAGCACCAACAGAACCAAGAAGCACACCGCCCACUUCAGCAAGAA



GGGCGAGGAGGAGAACCUGGAGGGCCUGGGCAACCAGACCAAGCAGAUCGUGGAGAAGUACGCCUGCACCACC



AGAAUCAGCCCUAACACCAGCCAGCAGAACUUCGUGACCCAGAGAAGCAAGAGAGCCCUGAAGCAGUUCAGAC



UGCCUCUGGAGGAGACAGAGCUGGAGAAGAGAAUCAUCGUGGACGACACCAGCACCCAGUGGAGCAAGAACAU



GAAGCACCUGACCCCUAGCACCCUGACCCAGAUCGACUACAACGAGAAGGAGAAGGGCGCCAUCACCCAGAGC



CCUCUGAGCGACUGCCUGACCAGAAGCCACAGCAUCCCUCAGGCCAACAGAAGCCCUCUGCCUAUCGCCAAGG



UGAGCAGCUUCCCUAGCAUCAGACCUAUCUACCUGACCAGAGUGCUGUUCCAGGACAACAGCAGCCACCUGCC



UGCCGCCAGCUACAGAAAGAAGGAUAGCGGCGUGCAAGAGUCCAGCCACUUCCUGCAGGGCGCCAAGAAGAAC



AACCUGAGCCUGGCCAUCCUGACCCUGGAGAUGACCGGCGACCAGAGAGAGGUGGGCAGCCUGGGCACCAGCG



CCACCAACAGCGUGACCUACAAGAAGGUGGAGAACACCGUGCUGCCUAAGCCUGACCUGCCUAAGACGUCCGG



CAAAGUCGAGCUGCUGCCCAAGGUGCACAUCUACCAGAAGGACCUGUUCCCUACCGAGACAAGCAACGGCAGC



CCUGGCCACCUGGACCUGGUGGAGGGCAGCCUGCUGCAAGGCACCGAGGGCGCCAUCAAGUGGAACGAGGCCA



ACAGACCUGGCAAGGUGCCUUUCCUGAGAGUGGCCACCGAGAGCAGCGCCAAGACUCCCAGCAAGCUGCUCGA



CCCACUGGCUUGGGACAACCACUACGGCACCCAGAUCCCUAAGGAGGAGUGGAAGUCCCAGGAGAAGUCCCCU



GAGAAGACCGCCUUCAAGAAGAAGGACACCAUCCUGAGCCUGAACGCCUGCGAGAGCAACCACGCCAUCGCCG



CCAUCAACGAGGGCCAGAACAAGCCUGAGAUCGAGGUGACCUGGGCCAAGCAGGGCAGAACCGAGAGACUGUG



CAGCCAGAACCCUCCUGUGCUGAAGAGACACCAGAGAGAGAUCACCAGAACCACCCUGCAGAGCGACCAGGAG



GAGAUCGACUACGACGACACCAUCAGCGUGGAGAUGAAGAAGGAGGACUUCGACAUCUACGACGAGGACGAGA



ACCAGAGCCCUAGAAGCUUCCAGAAGAAGACCAGACACUACUUCAUCGCCGCCGUGGAGAGACUGUGGGACUA



CGGCAUGAGCAGCAGCCCUCACGUGCUGAGAAACAGAGCCCAGAGCGGCAGCGUGCCUCAGUUCAAGAAGGUG



GUGUUCCAGGAGUUCACCGACGGCAGCUUCACCCAGCCUCUGUACCGGGGCGAGUUGAACGAGCAUCUGGGGU



UGCUGGGCCCUUACAUCAGAGCCGAGGUGGAGGACAACAUCAUGGUGACCUUCAGAAACCAGGCCAGCAGACC



UUACAGCUUCUACAGCAGCCUGAUCAGCUACGAGGAGGACCAGAGACAGGGCGCCGAGCCUAGAAAGAACUUC



GUGAAGCCUAACGAGACAAAGACCUACUUCUGGAAGGUGCAGCACCACAUGGCCCCUACCAAGGACGAGUUCG



ACUGCAAGGCCUGGGCCUACUUCAGCGACGUGGACCUGGAGAAGGACGUGCACUCCGGCCUGAUAGGGCCUCU



GCUGGUGUGUCACACCAACACCCUGAACCCUGCCCACGGCAGACAGGUGACCGUGCAGGAGUUCGCCCUGUUC



UUCACCAUCUUCGACGAAACCAAGAGCUGGUACUUCACCGAGAACAUGGAGAGAAACUGCAGAGCCCCUUGCA



ACAUCCAGAUGGAGGACCCUACCUUCAAGGAGAACUACAGAUUCCACGCCAUCAACGGCUACAUCAUGGACAC



CCUGCCUGGCCUGGUGAUGGCCCAGGACCAGAGAAUCAGGUGGUACCUGCUGAGCAUGGGCAGCAACGAGAAC



AUCCACAGCAUCCACUUCAGCGGCCACGUGUUCACCGUGAGAAAGAAGGAGGAGUACAAGAUGGCCCUGUACA



ACCUGUACCCUGGCGUGUUCGAGACGGUGGAGAUGCUGCCUAGCAAGGCCGGCAUCUGGAGAGUGGAGUGCCU



GAUCGGCGAGCACCUGCACGCCGGUAUGUCAACCCUGUUCCUGGUGUACAGCAACAAGUGCCAGACCCCUCUG



GGCAUGGCCAGCGGCCACAUCCGGGACUUCCAGAUCACCGCUUCCGGACAGUACGGCCAGUGGGCCCCUAAGC



UGGCCAGACUGCACUACAGCGGCAGCAUCAACGCCUGGAGCACCAAGGAGCCUUUCAGCUGGAUCAAGGUGGA



CCUGCUGGCCCCUAUGAUCAUCCACGGCAUCAAGACCCAGGGCGCCAGACAGAAGUUCAGCAGCCUGUACAUC



AGCCAGUUCAUCAUCAUGUACAGCCUGGACGGCAAGAAGUGGCAGACCUACAGAGGCAACAGCACCGGCACCC



UGAUGGUGUUCUUCGGCAACGUGGACAGCAGCGGCAUCAAGCACAACAUCUUCAACCCUCCUAUCAUCGCCAG



AUACAUCAGACUGCACCCUACCCACUACAGCAUCAGAAGCACCCUGCGGAUGGAGCUAAUGGGGUGCGACCUG



AACAGCUGCAGCAUGCCUCUGGGCAUGGAGAGCAAGGCCAUCAGCGACGCCCAGAUCACCGCCAGCAGCUACU



UCACCAACAUGUUCGCCACCUGGAGCCCAUCUAAGGCCCGCCUGCAUCUCCAGGGGAGAAGCAACGCCUGGCG



GCCUCAGGUGAACAACCCUAAGGAGUGGCUGCAGGUGGACUUCCAGAAGACCAUGAAGGUGACCGGCGUGACG



ACCCAGGGCGUGAAAUCCCUGCUGACCAGCAUGUACGUGAAGGAGUUCCUGAUCAGCAGCAGCCAGGACGGCC



ACCAGUGGACCCUGUUCUUCCAGAACGGCAAGGUGAAGGUGUUCCAGGGCAACCAGGACAGCUUCACCCCUGU



GGUGAACAGCCUGGACCCUCCUCUGCUGACCAGAUACCUGAGAAUCCACCCUCAGAGCUGGGUGCACCAGAUC



GCCCUGAGAAUGGAGGUGCUGGGCUGCGAGGCCCAGGACCUGUAC





133
AUGCAGAUCGAGCUGAGCACCUGCUUCUUCCUGUGCCUGCUGCGGUUCUGCUUCAGCGCCACCCGGCGGUACU



ACCUGGGCGCCGUGGAGCUCUCCUGGGACUACAUGCAGUCCGACCUCGGCGAGCUCCCCGUCGACGCCCGCUU



UCCGCCCCGCGUCCCCAAGUCCUUCCCCUUCAACACCUCCGUCGUCUACAAGAAGACCCUCUUCGUCGAGUUC



ACCGACCACCUCUUCAACAUCGCCAAGCCCCGACCGCCCUGGAUGGGCCUCCUCGGCCCCACCAUCCAGGCCG



AGGUCUACGACACCGUCGUCAUCACCCUCAAGAACAUGGCCUCCCACCCCGUCUCCCUCCACGCCGUCGGCGU



CUCCUACUGGAAGGCCUCCGAGGGCGCCGAGUACGACGACCAGACCUCCCAGCGCGAGAAGGAGGACGACAAG



GUCUUCCCCGGCGGCUCCCACACCUACGUCUGGCAGGUCCUCAAGGAGAACGGCCCUAUGGCUAGCGAUCCAC



UCUGCCUCACCUACUCCUACCUCUCCCACGUCGACCUCGUCAAGGACCUCAACUCCGGCCUCAUCGGCGCCCU



CCUCGUCUGCCGCGAGGGCUCCCUCGCUAAGGAGAAGACACAGACCCUCCACAAGUUCAUCCUCCUCUUCGCC



GUCUUCGACGAGGGCAAGUCCUGGCACUCCGAGACUAAGAACUCCCUCAUGCAGGACCGCGACGCCGCCUCCG



CCCGCGCCUGGCCCAAGAUGCACACCGUCAACGGCUACGUCAACCGCUCCCUCCCUGGCCUCAUUGGGUGCCA



CCGCAAGUCCGUCUACUGGCACGUCAUCGGCAUGGGCACCACCCCUGAGGUCCACUCCAUCUUCCUCGAGGGC



CACACCUUCCUCGUCCGCAACCACCGCCAGGCCUCCCUCGAGAUCUCCCCGAUUACAUUCCUGACCGCGCAGA



CUCUGCUCAUGGACCUAGGACAGUUCUUGCUGUCUUGCCACAUCAGCUCACACCAGCACGACGGCAUGGAGGC



CUACGUUAAGGUCGACUCCUGCCCCGAGGAGCCCCAGCUCCGCAUGAAGAACAACGAGGAGGCCGAAGACUAC



GACGACGAUCUCACCGACUCAGAGAUGGACGUCGUCCGGUUCGACGACGAUAACAGUCCCUCCUUCAUCCAGA



UCCGCUCCGUCGCCAAGAAGCACCCCAAGACCUGGGUCCACUACAUCGCCGCCGAGGAGGAGGACUGGGAUUA



CGCCCCACUCGUCCUCGCUCCCGACGACCGCUCCUACAAGUCCCAGUACCUCAACAACGGGCCUCAGCGCAUC



GGCCGCAAGUAUAAGAAAGUCAGAUUCAUGGCCUACACCGACGAGACAUUCAAGACCCGCGAGGCCAUUCAGC



ACGAGUCCGGCAUCCUUGGUCCGCUCCUCUACGGCGAGGUCGGCGACACCCUCCUUAUCAUCUUCAAGAACCA



GGCUAGUCGCCCCUACAACAUCUACCCGCACGGCAUCACCGACGUCAGGCCGCUCUACUCCCGACGGCUUCCC



AAGGGCGUCAAGCACCUCAAAGACUUCCCCAUCCUGCCAGGUGAGAUAUUCAAAUACAAGUGGACCGUCACCG



UCGAGGACGGUCCCACCAAAUCCGACCCUCGGUGUUUAACCCGCUACUACUCCUCCUUCGUCAACAUGGAGCG



CGACCUCGCAUCGGGACUGAUCGGGCCCUUGUUAAUCUGCUACAAGGAGUCCGUCGACCAGCGCGGCAACCAG



AUCAUGUCCGACAAGCGCAACGUCAUCUUGUUUUCUGUGUUUGACGAGAAUAGAAGUUGGUACCUUACGGAGA



ACAUCCAGCGCUUCCUGCCAAACCCCGCCGGCGUCCAGCUCGAGGACCCCGAGUUUCAGGCGAGCAACAUCAU



GCAUAGUAUCAACGGUUACGUGUUCGAUUCCCUACAGCUCAGCGUUUGCCUCCACGAGGUCGCCUACUGGUAC



AUCCUCUCGAUCGGAGCCCAAACCGACUUCUUGUCAGUCUUCUUCUCCGGCUACACCUUCAAACACAAGAUGG



UAUACGAGGAUACACUGACAUUAUUUCCCUUCUCUGGGGAAACCGUCUUCAUGUCCAUGGAGAAUCCAGGACU



UUGGAUACUGGGCUGCCACAACAGCGACUUCAGAAAUCGCGGCAUGACCGCCCUGUUGAAAGUGUCCUCCUGC



GACAAGAACACCGGCGACUACUACGAAGAUAGCUACGAAGAUAUCUCCGCCUACCUCCUGUCCAAGAACAACG



CCAUCGAGCCCCGCUCCUUCUCCCAGAACAGUCGGCACCCCUCCACCCGCCAGAAGCAGUUCAACGCCACCAC



CAUACCCGAGAACGACAUCGAGAAGACCGACCCCUGGUUCGCCCACCGCACUCCGAUGCCCAAGAUCCAGAAC



GUGUCUUCCAGCGACCUGUUGAUGCUCCUCCGCCAGUCUCCAACUCCACACGGACUCUCCCUAUCAGAUCUGC



AGGAGGCCAAGUACGAGACAUUUUCGGACGAUCCCAGCCCCGGUGCUAUCGACUCCAACAACUCCCUGUCCGA



GAUGACCCACUUCAGACCUCAGCUGCACCAUAGUGGAGACAUGGUCUUUACCCCGGAGUCCGGUCUGCAAUUA



AGACUCAACGAGAAGCUCGGAACAACCGCGGCCACCGAGCUCAAGAAACUGGACUUCAAGGUGUCCUCUACUU



CUAACAACCUCAUCUCAACAAUUCCCUCCGACAACUUAGCAGCUGGCACCGAUAACACCAGCUCACUCGGGCC



UCCAUCCAUGCCCGUUCACUACGACUCCCAACUCGACACUACGCUGUUUGGCAAGAAGUCCUCCCCGCUAACC



GAGAGCGGCGGACCUCUAUCCCUGUCUGAGGAGAACAACGACAGCAAGCUCCUUGAGAGCGGGUUGAUGAACU



CCCAGGAGUCCUCCUGGGGCAAGAACGUCAGCUCCACCGAAAGCGGCAGACUGUUUAAGGGCAAGCGCGCCCA



CGGACCCGCGUUACUAACCAAGGACAACGCCCUGUUCAAGGUAAGCAUCAGUUUGCUGAAGACCAACAAGACA



UCUAAUAACAGCGCAACAAACCGCAAGACCCACAUCGACGGCCCCUCCCUUCUGAUCGAGAACAGCCCGAGCG



UGUGGCAGAAUAUCCUGGAGUCAGACACCGAGUUCAAGAAAGUAACACCGCUGAUCCACGACCGCAUGUUGAU



GGAUAAGAACGCCACAGCCCUGAGGCUGAACCACAUGUCUAACAAGACUACUUCAUCUAAGAAUAUGGAGAUG



GUCCAGCAGAAGAAAGAAGGCCCCAUCCCACCAGACGCCCAGAACCCUGACAUGUCCUUCUUUAAGAUGUUAU



UCCUGCCUGAAUCCGCCCGGUGGAUCCAGAGAACACACGGUAAGAAUUCUCUGAAUUCCGGGCAGGGUCCAUC



ACCCAAGCAACUCGUCUCAUUAGGCCCUGAGAAAUCUGUGGAGGGGCAGAAUUUCCUCUCAGAGAAGAACAAG



GUCGUCGUCGGCAAGGGCGAGUUUACGAAGGACGUCGGCUUGAAAGAAAUGGUGUUUCCUUCUAGUCGCAACC



UCUUCUUAACUAACCUCGACAAUCUGCACGAGAAUAAUACCCACAACCAAGAGAAGAAGAUUCAGGAGGAGAU



UGAGAAGAAAGAAACACUGAUACAGGAGAACGUCGUACUACCCCAGAUCCACACCGUUACCGGCACCAAGAAU



UUUAUGAAGAAUCUCUUCCUGCUCAGUACAAGACAGAACGUGGAAGGGUCGUACGACGGCGCAUACGCCCCUG



UCCUGCAGGAUUUUAGAUCACUGAACGAUUCAACCAAUCGGACUAAGAAGCAUACUGCGCACUUCUCCAAGAA



GGGUGAAGAGGAGAAUCUGGAGGGCCUGGGCAAUCAGACCAAGCAGAUCGUCGAGAAGUACGCCUGCACUACA



CGCAUUAGUCCAAAUACAUCACAACAGAACUUUGUCACCCAGCGCAGCAAACGGGCCCUCAAACAAUUUCGCC



UGCCCCUCGAGGAGACUGAGCUCGAGAAGCGCAUCAUCGUCGACGACACAAGCACGCAGUGGAGCAAGAAUAU



GAAGCACCUUACACCAUCUACCUUGACACAGAUCGACUAUAACGAGAAGGAGAAGGGAGCCAUAACCCAGUCA



CCCUUAAGUGACUGCUUAACACGAUCCCACAGCAUCCCGCAGGCUAAUAGGUCGCCACUUCCAAUCGCCAAGG



UGAGCUCUUUCCCGUCCAUUCGCCCCAUCUACUUGACUCGCGUUCUCUUCCAGGAUAAUAGUAGCCAUCUGCC



UGCCGCAUCCUAUAGGAAGAAGGACUCCGGAGUACAGGAGAGCAGUCACUUCUUGCAGGGCGCGAAGAAGAAU



AAUCUUUCCUUAGCAAUACUCACCCUUGAAAUGACCGGAGAUCAGAGAGAGGUCGGGUCAUUGGGCACCUCGG



CCACCAACUCCGUCACGUAUAAGAAAGUUGAGAAUACCGUACUGCCUAAACCCGACCUACCCAAGACGUCGGG



UAAAGUAGAGCUCCUCCCUAAAGUCCACAUUUAUCAGAAGGAUUUGUUUCCGACCGAGACUAGCAACGGUUCC



CCAGGCCACCUCGAUCUGGUGGAGGGCUCGCUUCUUCAGGGCACCGAAGGCGCAAUCAAGUGGAACGAGGCCA



ACCGGCCUGGGAAGGUGCCCUUCCUCCGCGUGGCCACAGAAAGCAGCGCUAAGACUCCCUCUAAGCUGCUCGA



UCCUCUUGCCUGGGACAACCACUACGGAACCCAAAUCCCAAAGGAGGAGUGGAAGAGUCAGGAGAAAUCUCCU



GAGAAGACCGCCUUCAAGAAGAAGGACACAAUCCUGUCAUUAAACGCCUGCGAGUCCAACCACGCAAUUGCUG



CCAUUAACGAGGGCCAGAAUAAGCCCGAAAUCGAAGUCACCUGGGCCAAGCAGGGCCGCACCGAGCGCCUCUG



UUCACAGAACCCACCGGUCCUUAAGCGGCAUCAGAGGGAGAUCACCCGCACGACCUUGCAGAGUGAUCAGGAA



GAGAUCGAUUACGACGACACUAUAUCCGUGGAGAUGAAGAAGGAAGAUUUCGACAUAUACGACGAGGACGAGA



ACCAGUCGCCUAGGUCAUUCCAGAAGAAGACUAGACAUUACUUCAUUGCCGCUGUCGAGAGGCUGUGGGACUA



CGGGAUGAGCAGCAGCCCACACGUACUGCGUAACCGGGCCCAGUCCGGCUCCGUGCCCCAGUUUAAGAAGGUC



GUAUUCCAGGAGUUCACGGACGGCUCCUUUACUCAGCCACUAUACAGAGGUGAGCUGAACGAGCAUCUCGGGC



UUUUGGGGCCAUAUAUCCGAGCCGAAGUGGAGGACAACAUUAUGGUGACAUUUAGGAACCAAGCCAGCCGACC



CUACUCAUUCUACAGCAGUCUGAUAAGUUACGAAGAGGAUCAAAGGCAGGGUGCUGAACCUAGGAAGAAUUUC



GUGAAGCCCAACGAAACUAAGACUUACUUCUGGAAAGUGCAGCACCACAUGGCGCCGACCAAGGACGAGUUCG



ACUGCAAAGCCUGGGCUUAUUUUAGCGACGUAGACCUAGAGAAGGACGUGCACAGUGGCUUAAUCGGACCCCU



CCUGGUGUGUCAUACCAAUACCCUGAACCCAGCCCACGGACGCCAGGUCACCGUGCAAGAGUUUGCCUUGUUC



UUCACCAUAUUUGACGAAACUAAGAGCUGGUAUUUCACCGAGAACAUGGAACGGAACUGCCGCGCACCGUGCA



AUAUCCAAAUGGAGGAUCCUACAUUCAAAGAGAACUACCGCUUUCACGCUAUAAACGGAUAUAUCAUGGACAC



ACUCCCCGGGCUGGUCAUGGCUCAGGAUCAGCGGAUCCGCUGGUACCUGCUAUCCAUGGGCUCCAACGAGAAU



AUACACUCAAUCCAUUUCUCUGGCCACGUCUUUACUGUCCGUAAGAAAGAGGAGUACAAGAUGGCUCUCUACA



ACCUGUACCCCGGGGUAUUUGAGACUGUAGAAAUGCUCCCCAGUAAGGCCGGCAUCUGGCGCGUCGAGUGUCU



GAUUGGGGAGCACUUGCACGCAGGCAUGUCAACUCUGUUUCUCGUUUAUUCCAAUAAGUGCCAGACUCCUCUG



GGCAUGGCAAGUGGACAUAUCAGAGACUUCCAGAUCACGGCCUCAGGUCAGUACGGCCAGUGGGCCCCGAAGC



UCGCCCGCCUCCACUACUCCGGCUCAAUCAACGCUUGGAGCACUAAGGAGCCCUUCAGCUGGAUUAAAGUUGA



UCUCCUUGCACCCAUGAUCAUUCACGGGAUCAAGACACAGGGUGCCAGACAGAAGUUCUCAAGUCUGUAUAUC



UCGCAGUUUAUCAUCAUGUAUUCACUGGACGGCAAGAAGUGGCAGACUUACCGAGGAAAUUCCACAGGAACCC



UCAUGGUUUUCUUUGGCAACGUGGACUCCUCAGGCAUCAAACAUAACAUCUUUAACCCACCUAUUAUCGCCCG



CUACAUUAGGCUUCACCCAACACACUAUAGUAUUCGCUCUACCCUUAGAAUGGAGCUCAUGGGCUGCGAUCUG



AACUCGUGUUCCAUGCCUCUCGGAAUGGAAUCUAAGGCUAUCUCCGACGCCCAGAUUACCGCCUCUUCCUAUU



UUACUAACAUGUUCGCCACCUGGUCGCCUAGCAAGGCCCGGCUGCACCUACAGGGACGGAGCAACGCCUGGCG



CCCUCAGGUAAACAACCCUAAAGAGUGGCUCCAGGUUGACUUUCAGAAGACCAUGAAGGUCACAGGUGUCACC



ACCCAGGGAGUGAAGUCCUUAUUAACAUCCAUGUACGUGAAAGAGUUCUUGAUCUCAUCCAGCCAGGACGGAC



AUCAGUGGACACUCUUCUUCCAGAACGGGAAGGUCAAAGUGUUCCAGGGAAACCAGGACUCUUUCACACCUGU



GGUCAAUAGUCUCGAUCCACCAUUGCUCACGCGAUACCUUCGCAUACAUCCCCAGUCUUGGGUUCACCAGAUU



GCGCUGCGCAUGGAAGUAUUGGGGUGCGAAGCCCAGGACCUGUAC





134
AUGCAGAUCGAGCUGAGCACCUGCUUCUUCCUGUGCCUGCUGAGAUUCUGCUUCAGCGCCACCAGAAGAUACU



ACCUGGGCGCCGUGGAGCUGAGCUGGGACUACAUGCAGAGCGACCUGGGCGAGCUGCCUGUGGACGCCAGAUU



CCCUCCUAGAGUGCCUAAGAGCUUCCCUUUCAACACCAGCGUGGUGUACAAGAAGACCCUGUUCGUGGAGUUC



ACCGACCACCUGUUCAACAUCGCCAAGCCUAGACCUCCUUGGAUGGGCCUGCUGGGCCCUACCAUCCAGGCCG



AGGUGUACGACACCGUGGUGAUCACCCUGAAGAACAUGGCCAGCCACCCUGUGAGCCUGCACGCCGUGGGCGU



GAGCUACUGGAAGGCCAGCGAGGGCGCCGAGUACGACGACCAGACCAGCCAGAGAGAGAAGGAGGACGACAAG



GUGUUCCCUGGCGGCAGCCACACCUACGUGUGGCAGGUGCUGAAGGAGAACGGCCCUAUGGCCAGCGACCCUC



UGUGCCUGACCUACAGCUACCUGAGCCACGUGGACCUGGUGAAGGACCUGAACUCCGGGCUGAUCGGAGCCCU



GCUGGUGUGCAGAGAGGGCAGCCUGGCCAAGGAGAAGACCCAGACCCUGCACAAGUUCAUCCUGCUGUUCGCC



GUGUUCGACGAGGGCAAGAGCUGGCACAGCGAGACAAAGAACAGCCUGAUGCAGGACAGAGACGCCGCCAGCG



CCAGAGCCUGGCCUAAGAUGCACACCGUGAACGGCUACGUGAACAGAAGCCUGCCUGGCCUGAUCGGCUGCCA



CAGAAAGAGCGUGUACUGGCACGUGAUCGGCAUGGGCACCACCCCUGAGGUGCACAGCAUCUUCCUGGAGGGC



CACACCUUCCUGGUGAGAAACCACAGACAGGCCAGCCUGGAGAUCAGCCCUAUCACCUUCCUGACCGCCCAGA



CCCUCCUGAUGGACCUGGGCCAGUUUCUCCUGUCCUGCCACAUCAGCAGCCAUCAGCACGACGGCAUGGAGGC



CUACGUGAAGGUGGACAGCUGCCCUGAGGAGCCUCAGCUGAGAAUGAAGAACAACGAGGAGGCCGAGGACUAC



GACGACGACCUGACCGACAGCGAGAUGGACGUGGUGAGAUUCGACGACGACAACAGCCCUAGCUUCAUCCAGA



UCAGAAGCGUGGCCAAGAAGCACCCUAAGACCUGGGUGCACUACAUCGCCGCCGAGGAGGAGGACUGGGACUA



CGCCCCUCUGGUGCUGGCCCCUGACGACAGAAGCUACAAGAGCCAGUACCUGAACAACGGCCCUCAGAGAAUC



GGCAGAAAGUACAAGAAGGUGAGAUUCAUGGCCUACACCGACGAAACCUUCAAGACCAGAGAGGCCAUCCAGC



ACGAGAGCGGCAUCCUGGGCCCUCUGCUGUACGGCGAGGUGGGCGACACCCUGCUGAUCAUCUUCAAGAACCA



AGCCAGCAGACCCUACAACAUCUACCCUCACGGCAUCACCGACGUGAGGCCUCUGUACAGCAGAAGACUGCCU



AAGGGCGUGAAGCACCUGAAGGACUUCCCUAUCCUGCCUGGCGAGAUCUUCAAGUACAAGUGGACCGUGACCG



UGGAGGACGGCCCUACCAAGAGCGACCCUCGCUGCCUGACCAGAUACUACAGCAGCUUCGUGAACAUGGAACG



GGACCUGGCCAGCGGGCUCAUCGGUCCCCUGCUCAUCUGCUACAAGGAGAGCGUGGAUCAGCGGGGAAACCAG



AUCAUGAGCGACAAGAGAAACGUGAUCCUGUUCUCCGUAUUCGACGAGAACAGAAGCUGGUACCUGACCGAGA



ACAUCCAGAGAUUCCUGCCUAACCCUGCCGGCGUGCAGCUGGAGGACCCUGAGUUCCAGGCCAGCAACAUCAU



GCAUAGCAUCAACGGUUACGUGUUUGACAGCCUGCAGCUGAGCGUGUGCCUGCACGAGGUGGCCUACUGGUAC



AUCCUGAGCAUCGGCGCCCAGACCGACUUCCUCAGCGUCUUCUUCAGCGGCUACACCUUCAAGCACAAGAUGG



UGUACGAGGACACCCUGACCCUGUUCCCUUUCAGCGGCGAAACCGUGUUCAUGAGCAUGGAGAACCCUGGCCU



GUGGAUCCUGGGCUGCCACAACAGCGACUUCAGAAACAGAGGCAUGACCGCCCUGCUGAAGGUGAGCAGCUGC



GACAAGAACACCGGCGACUAUUACGAAGAUUCCUACGAGGACAUCAGCGCCUACCUGCUGAGCAAGAACAACG



CCAUCGAGCCUAGAAGCUUCAGCCAGAACAGCAGACACCCUAGCACCAGACAGAAGCAGUUCAACGCCACCAC



CAUCCCUGAGAACGACAUCGAGAAGACCGACCCUUGGUUCGCCCACAGAACCCCUAUGCCUAAGAUCCAGAAC



GUGAGCUCAAGCGACCUGCUGAUGCUGCUGCGUCAGAGCCCUACCCCUCACGGCCUGAGCCUCAGCGACCUGC



AGGAGGCCAAGUACGAGACUUUCAGCGACGACCCUAGCCCUGGCGCGAUCGACUCCAAUAAUAGCCUCAGCGA



GAUGACCCACUUCAGACCUCAGCUGCACCACAGCGGCGACAUGGUGUUCACGCCAGAGUCCGGCCUGCAGCUG



CGGCUGAACGAGAAGCUGGGCACCACCGCCGCCACCGAGCUGAAGAAGCUGGACUUCAAGGUUUCAAGUACCA



GCAACAACCUGAUCAGCACCAUCCCUAGCGACAACCUGGCCGCCGGCACCGACAACACCAGCAGCCUCGGGCC



UCCUAGCAUGCCUGUGCACUACGACAGCCAGCUGGACACCACCCUGUUCGGCAAGAAAUCCAGCCCUCUGACC



GAGAGCGGUGGUCCCCUGAGCCUGAGCGAGGAGAACAACGACAGCAAGCUGCUGGAGAGCGGCCUGAUGAACA



GCCAGGAGAGCAGCUGGGGCAAGAACGUAAGUUCUACUGAGAGCGGGAGACUGUUCAAGGGCAAGAGAGCCCA



CGGCCCUGCCCUGCUGACCAAGGACAACGCCCUGUUCAAGGUGUCAAUCAGCCUGCUGAAGACCAACAAGACA



UCUAACAAUAGCGCCACCAACAGAAAGACCCACAUCGACGGCCCUAGCCUGCUGAUCGAGAAUUCUCCGUCAG



UGUGGCAGAACAUCCUGGAGAGCGACACCGAGUUCAAGAAGGUGACCCCUCUGAUCCACGACAGAAUGCUGAU



GGACAAGAACGCCACCGCCCUGAGACUGAACCACAUGAGCAACAAGACCACCAGCAGCAAGAACAUGGAGAUG



GUGCAGCAGAAGAAGGAGGGCCCUAUCCCUCCUGACGCCCAGAACCCUGACAUGAGCUUCUUCAAGAUGCUGU



UCCUGCCUGAGAGCGCCCGGUGGAUCCAGAGAACCCACGGCAAGAACUCCCUGAACAGCGGACAGGGCCCUUC



CCCAAAGCAACUCGUGUCCCUGGGCCCUGAGAAGUCCGUGGAGGGCCAGAACUUCCUGAGCGAGAAGAACAAG



GUGGUGGUGGGCAAGGGCGAGUUCACCAAGGACGUCGGACUGAAAGAGAUGGUGUUCCCUAGCAGCAGAAACC



UGUUCCUGACCAACCUGGACAACCUGCACGAGAACAACACCCACAACCAGGAGAAGAAGAUCCAGGAGGAGAU



CGAGAAGAAGGAAACCCUGAUCCAGGAGAACGUGGUGCUGCCUCAGAUCCACACCGUGACCGGCACCAAGAAC



UUCAUGAAGAACCUCUUCCUGCUGUCGACCAGACAGAACGUGGAGGGCAGCUACGACGGCGCCUACGCCCCUG



UGCUGCAGGACUUCAGAAGCCUGAACGACAGCACCAACAGAACCAAGAAGCACACCGCCCACUUCAGCAAGAA



GGGCGAGGAGGAGAACCUGGAGGGCCUGGGCAACCAGACCAAGCAGAUCGUGGAGAAGUACGCCUGCACCACC



AGAAUCAGCCCUAACACCAGCCAGCAGAACUUCGUGACCCAGAGAUCAAAGCGGGCCCUGAAGCAGUUCAGAC



UGCCUCUGGAGGAGACAGAGCUGGAGAAGAGAAUCAUCGUGGACGACACCAGCACCCAGUGGAGCAAGAAUAU



GAAGCAUCUGACCCCUAGCACCCUGACCCAGAUCGACUACAACGAGAAGGAGAAGGGCGCCAUCACCCAGAGC



CCUCUGAGCGAUUGUCUUACUAGAAGCCACAGCAUCCCUCAGGCCAACAGAAGCCCUCUGCCUAUCGCCAAGG



UGUCUAGCUUCCCUAGCAUCAGACCUAUCUACCUGACCAGAGUGCUGUUCCAGGACAACAGCAGCCACCUGCC



UGCCGCCAGCUACAGAAAGAAGGAUAGCGGCGUGCAAGAGUCCAGCCACUUCCUGCAGGGCGCCAAGAAGAAC



AACCUGAGCCUGGCCAUCCUGACCCUGGAGAUGACCGGCGACCAGAGAGAGGUGGGCAGCCUGGGCACAUCAG



CCACUAAUAGCGUGACCUACAAGAAGGUCGAGAACACCGUGCUGCCUAAGCCUGACCUGCCUAAGACGUCCGG



CAAAGUCGAGCUGCUGCCCAAGGUGCACAUCUACCAGAAGGACCUGUUCCCUACCGAGACAAGCAACGGCAGC



CCUGGCCACCUGGACCUGGUGGAAGGCAGUCUCCUGCAAGGCACCGAAGGAGCAAUUAAGUGGAACGAGGCCA



ACAGACCUGGCAAGGUGCCUUUCCUGAGAGUGGCCACCGAGAGCAGCGCCAAGACUCCAUCUAAGCUUCUCGA



CCCACUGGCUUGGGACAACCACUACGGCACCCAGAUCCCUAAGGAGGAGUGGAAGUCCCAGGAGAAGUCCCCU



GAGAAGACCGCCUUCAAGAAGAAGGACACCAUCCUGAGCCUGAACGCCUGCGAGAGCAACCACGCCAUCGCCG



CCAUCAACGAGGGACAGAACAAGCCUGAGAUCGAGGUGACCUGGGCCAAGCAGGGCAGAACCGAGAGACUGUG



CAGCCAGAACCCUCCUGUGCUGAAGAGACACCAGAGAGAGAUCACCAGAACCACCCUUCAGUCUGACCAAGAA



GAGAUAGAUUACGACGAUACCAUCAGCGUGGAGAUGAAGAAGGAGGACUUCGACAUCUACGACGAGGACGAGA



ACCAGAGCCCUCGGAGCUUCCAGAAGAAGACCAGACACUACUUCAUCGCCGCCGUGGAGAGACUGUGGGACUA



CGGCAUGAGCAGCAGCCCUCACGUGCUGAGAAACAGAGCCCAGAGCGGCAGCGUGCCUCAAUUCAAGAAGGUA



GUGUUCCAGGAGUUCACUGACGGCAGCUUCACCCAGCCUCUGUACCGGGGCGAGUUGAACGAGCAUCUGGGGU



UGCUGGGCCCUUACAUCAGAGCCGAGGUGGAGGACAACAUCAUGGUGACCUUCAGAAACCAGGCCAGCAGACC



UUACAGCUUCUACAGCAGCCUGAUCAGCUACGAGGAGGACCAGAGACAGGGCGCCGAGCCUAGAAAGAAUUUC



GUGAAGCCUAACGAGACAAAGACCUACUUCUGGAAGGUGCAGCACCACAUGGCCCCUACCAAGGACGAGUUCG



ACUGCAAGGCCUGGGCCUACUUCAGCGACGUCGAUCUGGAGAAGGACGUGCACUCCGGCCUGAUAGGGCCUCU



GCUGGUGUGUCACACCAACACCCUGAACCCUGCCCACGGCAGACAGGUGACCGUGCAGGAGUUCGCCCUGUUC



UUCACCAUCUUCGACGAAACCAAGAGCUGGUACUUCACCGAGAAUAUGGAAAGAAACUGCAGAGCCCCUUGCA



ACAUCCAGAUGGAGGACCCUACCUUCAAGGAGAACUACAGAUUCCACGCAAUCAACGGAUACAUCAUGGACAC



CCUGCCAGGCCUGGUGAUGGCCCAGGACCAGAGAAUCAGGUGGUACUUACUAAGCAUGGGCAGCAACGAGAAC



AUUCACAGCAUCCACUUCAGCGGCCACGUGUUCACCGUGAGAAAGAAGGAGGAGUACAAGAUGGCCCUGUACA



ACCUGUACCCUGGCGUGUUCGAGACGGUGGAGAUGCUGCCUAGCAAGGCCGGCAUCUGGAGAGUGGAGUGCCU



GAUCGGCGAGCACCUGCACGCCGGUAUGUCAACCCUGUUCCUGGUGUACAGCAACAAGUGCCAGACCCCUCUG



GGCAUGGCCAGCGGCCACAUCCGGGACUUCCAGAUCACCGCUUCCGGACAGUACGGCCAGUGGGCCCCUAAGC



UGGCCAGACUGCACUACAGCGGCAGCAUCAACGCCUGGAGCACCAAGGAGCCUUUCAGCUGGAUCAAGGUGGA



CCUGCUGGCCCCUAUGAUCAUCCACGGCAUCAAGACCCAGGGCGCCAGACAGAAGUUCAGCAGCCUGUACAUC



AGCCAGUUCAUCAUCAUGUACAGCCUGGACGGCAAGAAGUGGCAGACCUACAGAGGCAACAGCACCGGCACCC



UGAUGGUGUUCUUCGGCAACGUGGACAGCAGCGGCAUCAAGCACAACAUCUUCAACCCUCCUAUCAUCGCCAG



AUACAUCAGACUGCACCCUACCCACUACAGCAUCAGAAGCACCCUGCGGAUGGAGCUAAUGGGGUGCGACCUG



AACAGCUGCAGCAUGCCAUUAGGCAUGGAGAGCAAGGCCAUCAGCGACGCCCAAAUUACCGCCAGCAGCUACU



UCACCAACAUGUUCGCCACCUGGAGCCCAUCUAAGGCCCGCCUGCAUCUCCAGGGGAGAAGCAACGCCUGGCG



GCCUCAGGUGAACAACCCUAAGGAGUGGCUGCAGGUGGACUUCCAGAAGACCAUGAAGGUGACCGGCGUGACG



ACCCAGGGCGUGAAAUCGUUGCUGACCAGCAUGUACGUGAAGGAGUUCCUGAUCAGCAGCAGCCAGGACGGCC



ACCAGUGGACCCUGUUCUUCCAGAACGGCAAGGUGAAGGUGUUCCAGGGCAACCAGGACAGCUUCACCCCUGU



GGUGAACAGCCUGGACCCUCCUCUGCUCACCAGAUACCUGAGAAUCCACCCUCAGAGCUGGGUGCACCAGAUC



GCCCUGAGAAUGGAGGUGCUGGGCUGCGAGGCCCAGGACCUGUAC





135
AUGCAGAUCGAGCUGAGCACCUGCUUCUUCCUGUGCCUGCUGCGGUUCUGCUUCAGCGCCACCCGGCGGUACU



ACCUGGGCGCCGUGGAACUUUCGUGGGACUACAUGCAGAGCGAUCUGGGCGAGCUGCCCGUGGACGCCCGGUU



CCCUCCCCGGGUGCCCAAGAGCUUCCCCUUCAACACCAGCGUGGUGUACAAGAAGACCCUGUUCGUGGAGUUC



ACCGACCACCUGUUCAACAUCGCCAAGCCCCGGCCUCCCUGGAUGGGCCUGCUGGGCCCCACCAUCCAGGCCG



AGGUGUACGACACCGUGGUGAUCACCCUGAAGAACAUGGCCAGCCACCCCGUGAGCCUGCACGCCGUGGGCGU



GAGCUACUGGAAGGCCAGCGAGGGCGCCGAGUACGACGACCAGACCAGCCAGCGGGAGAAGGAGGACGACAAG



GUGUUCCCCGGCGGCAGCCACACCUACGUGUGGCAGGUGCUGAAGGAGAACGGCCCAAUGGCAUCAGACCCUC



UCUGCCUCACCUACAGCUACCUGAGCCACGUGGACCUGGUGAAGGACCUGAACAGCGGCCUGAUCGGCGCCCU



GCUGGUGUGCCGGGAGGGCAGCCUGGCCAAGGAGAAGACACAGACCCUGCACAAGUUCAUCCUGCUGUUCGCC



GUGUUCGACGAGGGCAAGAGCUGGCACAGCGAGACUAAGAACAGCCUGAUGCAGGACCGGGACGCCGCCAGCG



CCCGGGCCUGGCCCAAGAUGCACACCGUGAACGGCUACGUGAACCGGAGCCUGCCAGGCCUCAUUGGCUGCCA



CCGAAAGUCAGUGUACUGGCACGUGAUCGGCAUGGGCACCACUCCUGAGGUGCACAGCAUCUUCCUGGAGGGG



CACACCUUCCUGGUGCGGAACCACCGGCAGGCCAGCCUGGAGAUCAGCCCCAUAACUUUCCUGACCGCCCAGA



CAUUGCUGAUGGACCUUGGCCAGUUCCUUCUGUCCUGCCACAUCAGCAGCCACCAGCACGACGGCAUGGAGGC



CUACGUCAAGGUGGACAGCUGCCCCGAGGAGCCCCAGCUGCGGAUGAAGAAUAACGAGGAGGCCGAAGACUAC



GACGACGAUCUGACCGACAGUGAGAUGGACGUGGUGAGAUUCGACGACGAUAACUCACCAUCCUUCAUCCAGA



UCCGGAGCGUGGCCAAGAAGCACCCCAAGACCUGGGUGCACUACAUCGCCGCCGAGGAGGAGGAUUGGGAUUA



CGCCCCUCUCGUGCUGGCGCCCGACGACCGGAGCUACAAGAGCCAGUACCUCAAUAACGGACCACAGCGGAUC



GGCCGGAAAUAUAAGAAAGUGCGCUUUAUGGCCUACACCGACGAGACGUUCAAGACCCGGGAGGCCAUCCAGC



ACGAGAGCGGCAUCCUGGGCCCUCUGCUGUACGGCGAGGUGGGCGACACCUUGCUCAUCAUCUUCAAGAACCA



AGCUUCUCGGCCCUACAACAUCUACCCGCACGGCAUCACCGACGUGCGGCCCCUGUACAGCCGGCGGCUGCCC



AAGGGCGUGAAGCACCUGAAGGACUUCCCCAUACUGCCCGGAGAGAUCUUUAAAUACAAGUGGACCGUGACCG



UGGAGGACGGGCCAACCAAAUCCGAUCCCAGGUGUCUGACACGUUACUACAGCAGCUUCGUGAACAUGGAGCG



GGACCUAGCGUCCGGGCUGAUUGGGCCUCUACUGAUUUGCUACAAGGAGAGCGUGGACCAGCGGGGCAACCAG



AUCAUGAGCGACAAGCGGAACGUGAUCCUGUUCUCUGUGUUUGACGAGAACCGUUCUUGGUACCUGACGGAGA



ACAUCCAGCGGUUCCUGCCCAACCCCGCCGGCGUGCAGCUGGAGGACCCCGAGUUUCAGGCGUCAAACAUCAU



GCAUAGUAUAAACGGGUACGUGUUUGAUAGCCUGCAGCUGAGCGUGUGUCUUCACGAGGUGGCCUACUGGUAC



AUCCUGAGCAUCGGCGCACAGACGGACUUCCUGUCAGUAUUCUUCAGCGGCUACACCUUCAAACACAAGAUGG



UAUACGAGGAUACACUGACUCUGUUCCCCUUCUCGGGCGAGACAGUGUUCAUGAGCAUGGAGAACCCCGGACU



GUGGAUCCUUGGUUGCCACAACAGCGACUUCCGGAACCGGGGCAUGACCGCCCUGCUGAAAGUGAGCAGCUGC



GACAAGAACACCGGCGACUACUACGAGGACUCAUACGAAGAUAUCAGCGCCUACCUGCUGAGCAAGAACAACG



CCAUCGAGCCCCGGAGCUUCAGCCAGAAUUCCCGGCACCCCAGCACCCGGCAGAAGCAGUUCAACGCCACAAC



CAUUCCCGAGAACGACAUCGAGAAGACCGACCCCUGGUUCGCCCACCGGACUCCAAUGCCUAAGAUCCAGAAC



GUAUCAAGCUCUGACCUGCUCAUGCUGCUGAGGCAGAGCCCCACCCCUCACGGGCUGAGCCUUAGCGACUUAC



AGGAGGCCAAGUACGAAACGUUCAGCGACGACCCCAGUCCCGGGGCCAUAGACAGCAAUAACUCGCUGUCUGA



GAUGACCCACUUCCGUCCCCAGCUACACCACUCUGGCGACAUGGUGUUCACGCCUGAAUCUGGCCUGCAACUC



CGCCUGAACGAGAAGUUAGGAACCACAGCCGCCACCGAGCUGAAGAAGCUUGACUUCAAAGUCUCCUCAACCU



CAAACAAUCUGAUCAGCACUAUCCCCAGCGACAACCUGGCCGCGGGCACGGACAAUACCAGCAGCCUUGGGCC



ACCCAGCAUGCCCGUUCACUACGACAGCCAGCUGGACACCACAUUGUUCGGCAAGAAGUCGAGCCCACUGACA



GAGUCUGGUGGUCCCCUCAGCCUCUCGGAAGAGAACAACGACAGCAAGCUGCUGGAGUCUGGACUCAUGAACA



GCCAGGAGUCAAGUUGGGGCAAGAACGUGUCUAGUACAGAGAGCGGUCGGCUGUUCAAGGGCAAGCGGGCCCA



CGGUCCUGCGCUGCUUACCAAGGACAACGCUCUGUUUAAAGUGUCCAUCUCAUUACUGAAGACCAACAAGACA



AGUAAUAACAGCGCAACAAAUCGGAAGACCCACAUCGACGGACCGAGCCUCCUUAUCGAGAAUUCCCCAUCUG



UCUGGCAGAAUAUACUUGAGUCAGACACCGAGUUCAAGAAGGUCACCCCGCUGAUCCACGAUCGUAUGCUCAU



GGACAAGAACGCUACGGCCCUCCGGCUGAACCACAUGUCUAACAAGACUACUAGCAGCAAGAAUAUGGAGAUG



GUGCAGCAGAAGAAAGAGGGCCCCAUCCCACCAGACGCCCAGAAUCCCGACAUGAGCUUCUUCAAGAUGCUGU



UUCUACCGGAAUCAGCUCGCUGGAUACAGCGUACCCACGGAAAGAAUUCACUGAACUCCGGGCAGGGCCCAAG



UCCCAAGCAGCUGGUUUCACUGGGUCCAGAGAAAUCAGUCGAGGGCCAGAACUUCUUGUCCGAGAAGAACAAG



GUGGUGGUGGGCAAGGGCGAGUUCACGAAAGACGUGGGAUUGAAGGAAAUGGUGUUUCCCAGCUCACGGAACC



UGUUCUUAACUAACCUGGACAACCUACACGAGAACAACACCCACAAUCAAGAGAAGAAGAUCCAAGAGGAGAU



UGAGAAGAAAGAAACUCUAAUCCAGGAGAACGUCGUGCUGCCCCAGAUCCACACAGUAACAGGCACCAAGAAC



UUCAUGAAGAACCUGUUUCUGCUUAGCACACGCCAGAACGUUGAGGGAAGCUACGACGGCGCCUACGCUCCUG



UGCUGCAAGACUUCCGCAGUCUCAACGACUCAACUAAUAGGACAAAGAAACACACCGCCCACUUCUCAAAGAA



AGGAGAGGAGGAGAACCUAGAAGGCCUGGGUAACCAGACGAAGCAGAUCGUGGAGAAGUACGCCUGCACCACA



CGAAUCAGCCCUAAUACUAGCCAACAGAACUUUGUGACGCAGAGAAGUAAGCGAGCAUUAAAGCAAUUCCGCC



UGCCCCUGGAGGAGACAGAGCUUGAGAAGCGGAUCAUCGUGGACGACACUAGUACUCAGUGGUCAAAGAAUAU



GAAGCAUCUUACACCAUCAACUCUGACCCAGAUCGACUACAACGAGAAAGAGAAAGGGGCGAUCACCCAGUCU



CCACUGAGCGAUUGCCUGACUCGCAGCCACUCCAUUCCCCAGGCCAAUAGAUCUCCCCUCCCGAUCGCGAAGG



UUUCUUCAUUCCCUUCAAUCCGGCCCAUCUACCUCACACGCGUGCUUUUCCAGGAUAACUCCUCCCACCUGCC



AGCUGCUUCAUAUCGGAAGAAGGACUCCGGGGUUCAGGAGUCCUCACACUUCCUGCAGGGCGCUAAGAAGAAC



AAUCUCUCACUUGCAAUCCUGACCCUCGAAAUGACAGGCGACCAGAGGGAGGUCGGAUCCCUGGGGACUUCUG



CUACUAACAGCGUGACUUACAAGAAGGUGGAGAACACAGUACUCCCCAAACCCGACUUGCCUAAGACCUCGGG



CAAGGUUGAGCUCCUGCCUAAAGUCCACAUCUAUCAGAAAGACCUCUUUCCUACCGAGACAUCUAACGGCUCU



CCAGGUCACUUGGAUCUGGUGGAGGGAUCACUGCUACAGGGAACCGAGGGCGCAAUCAAGUGGAACGAGGCAA



ACCGGCCAGGGAAAGUGCCCUUCCUGCGGGUGGCCACAGAAAGCUCUGCCAAGACUCCCUCCAAGCUCCUCGA



CCCACUGGCCUGGGACAACCACUACGGCACGCAGAUCCCCAAGGAGGAGUGGAAAUCACAGGAGAAGAGUCCC



GAGAAGACAGCCUUUAAGAAGAAGGAUACCAUCUUAAGCCUCAACGCCUGCGAGAGCAACCACGCCAUUGCCG



CUAUAAACGAGGGACAGAAUAAGCCCGAGAUUGAGGUCACCUGGGCAAAGCAGGGCCGGACAGAGCGGCUGUG



CAGCCAGAACCCACCCGUGCUCAAGAGACACCAAAGGGAGAUCACCCGGACCACCCUGCAGUCGGAUCAGGAA



GAGAUAGAUUACGACGACACAAUCUCCGUGGAGAUGAAGAAAGAGGACUUCGACAUAUACGACGAGGACGAGA



AUCAGUCACCCCGGUCCUUCCAGAAGAAGACUCGCCACUACUUUAUUGCUGCUGUUGAGAGAUUGUGGGACUA



CGGAAUGAGCUCCUCUCCUCACGUGUUGCGCAAUAGAGCUCAGAGUGGGAGCGUGCCCCAGUUCAAGAAAGUC



GUGUUCCAAGAGUUUACGGACGGCAGCUUCACACAGCCCCUCUAUCGGGGAGAGCUUAACGAACAUCUGGGGC



UUCUGGGUCCUUACAUCAGGGCAGAAGUCGAGGACAACAUAAUGGUGACUUUUCGUAACCAGGCUAGCCGUCC



GUACAGUUUCUAUUCAAGCCUCAUCUCUUACGAGGAAGAUCAGAGGCAGGGUGCCGAGCCAAGGAAGAACUUC



GUUAAGCCCAACGAAACCAAGACUUACUUCUGGAAGGUACAGCACCACAUGGCUCCAACCAAGGACGAGUUCG



ACUGCAAAGCCUGGGCCUACUUCUCAGACGUGGACUUAGAGAAAGACGUGCAUUCAGGCCUUAUCGGGCCCCU



UUUGGUCUGUCACACCAACACUUUGAAUCCCGCUCACGGCCGGCAGGUGACGGUGCAGGAAUUUGCGCUGUUC



UUUACAAUUUUCGACGAGACUAAGUCCUGGUAUUUCACCGAGAAUAUGGAAAGGAACUGUAGAGCUCCCUGCA



AUAUUCAAAUGGAAGAUCCUACUUUUAAGGAGAAUUACCGGUUCCACGCCAUUAACGGCUACAUUAUGGACAC



CCUCCCUGGCUUAGUGAUGGCCCAGGAUCAACGGAUACGGUGGUAUCUGCUAUCAAUGGGAUCUAACGAGAAC



AUCCAUAGUAUCCAUUUCUCAGGGCACGUCUUUACUGUGCGCAAGAAGGAAGAGUACAAGAUGGCGCUUUACA



ACCUGUACCCCGGAGUUUUCGAGACAGUUGAAAUGCUGCCGAGCAAAGCCGGCAUCUGGCGGGUGGAGUGCCU



AAUCGGGGAACAUCUCCACGCGGGCAUGUCCACCCUAUUCCUCGUGUAUAGUAACAAGUGCCAGACACCCCUG



GGCAUGGCAUCCGGGCACAUUCGGGACUUCCAGAUCACGGCGUCAGGACAGUACGGCCAGUGGGCGCCCAAGC



UGGCCCGGUUACACUACUCAGGGUCCAUUAACGCCUGGUCUACAAAGGAGCCCUUUAGUUGGAUUAAAGUGGA



UCUGUUGGCCCCAAUGAUCAUUCACGGUAUUAAGACACAAGGCGCUCGCCAGAAGUUUAGUUCCUUAUACAUC



AGCCAGUUCAUCAUCAUGUAUAGUUUGGACGGGAAGAAGUGGCAGACCUAUCGUGGUAACAGCACAGGAACGC



UGAUGGUCUUCUUUGGCAACGUGGACUCCUCAGGCAUUAAACAUAAUAUCUUCAACCCUCCCAUCAUCGCCAG



GUACAUUAGAUUACAUCCCACCCACUACAGUAUUCGUAGCACACUCCGGAUGGAGCUGAUGGGUUGCGACUUG



AACAGCUGUUCUAUGCCUUUGGGUAUGGAGAGUAAGGCUAUUUCCGACGCGCAGAUCACAGCCUCUAGCUACU



UUACCAACAUGUUCGCUACGUGGUCACCGAGCAAGGCUCGUUUGCAUCUGCAGGGUCGGUCAAACGCUUGGCG



CCCUCAGGUGAACAACCCCAAAGAGUGGCUGCAGGUAGAUUUUCAGAAGACCAUGAAAGUCACAGGGGUGACC



ACUCAAGGAGUGAAAUCAUUACUUACAAGCAUGUACGUGAAGGAGUUUCUUAUCUCAAGUUCACAGGACGGUC



AUCAGUGGACCCUCUUCUUUCAGAACGGCAAGGUCAAGGUCUUCCAAGGAAAUCAAGAUAGCUUUACUCCCGU



AGUGAACAGUCUGGAUCCUCCACUGCUCACUAGAUACUUGCGGAUCCACCCGCAGUCCUGGGUUCACCAGAUC



GCGCUUCGAAUGGAAGUGCUGGGCUGUGAGGCUCAGGACUUGUAC





136
AUGCGGGCACCCACCGUGUACCCCGUGCUGCUGUUCCUGUGGUUCACCGGCGCCAUCUGCGACAUCCAGAUGA



CCCAGAGCCCCAGCAGCCUGCCCGCCAGCCUGGGCGACCGGGUGACCAUCAACUGCCAGGCCAGCCAGGACAU



CAGCAACUACCUGAACUGGUACCAGCAGAAGCCCGGCAAGGCACCCAAGCUGCUGAUCUACUACACCAACAAG



CUGGCCGACGGCGUGCCCAGCCGGUUCAGCGGCAGCGGCAGCGGCCGGGACAGCAGCUUCACCAUCAGCAGCC



UGGAGAGCGAGGACAUCGGCAGCUACUACUGCCAGCAGUACUACAACUACCCCUGGACCUUCGGCCCCGGCAC



CAAGCUGGAGAUCAAGGGCGGCGGCGGCAGCGGCGGCGGCGGCAGCGGCGGCGGCGGCAGCGAGGUGCAGCUG



GUGGAGAGCGGCGGCGGCCUGGUGCAGCCCGGCAAGAGCCUGAAGCUGAGCUGCGAGGCCAGCGGCUUCACCU



UCAGCGGCUACGGCAUGCACUGGGUGCGGCAGGCACCCGGCCGGGGCCUGGAGAGCGUGGCCUACAUCACCAG



CAGCAGCAUCAACAUCAAGUACGCCGACGCCGUGAAGGGCCGGUUCACCGUGAGCCGGGACAACGCCAAGAAC



CUGCUGUUCCUGCAGAUGAACAUCCUGAAGAGCGAGGACACCGCCAUGUACUACUGCGCCCGGUUCGACUGGG



ACAAGAACUACUGGGGCCAGGGCACCAUGGUGACCGUGAGCAGCCCACGGAUCCCCAAGCCCAGCACCCCACC



CGGCAGCAGCUGCCCACCCGGCAACAUCCUGGGCGGCCCCAGCGUGUUCAUCUUCCCACCCAAGCCCAAGGAC



GCCCUGAUGAUCAGCCUGACACCCAAGGUGACCUGCGUGGUGGUGGACGUGAGCGAGGACGACCCCGACGUGC



ACGUGAGCUGGUUCGUGGACAACAAGGAGGUGCACACCGCCUGGACCCAGCCCCGGGAGGCCCAGUACAACAG



CACCUUCCGGGUGGUGAGCGCCCUGCCCAUCCAGCACCAGGACUGGAUGCGGGGCAAGGAGUUCAAGUGCAAG



GUGAACAACAAGGCCCUGCCCGCACCCAUCGAGCGGACCAUCAGCAAGCCCAAGGGCCGGGCCCAGACACCCC



AGGUGUACACCAUCCCACCGCCCCGGGAGCAGAUGAGCAAGAAGAAGGUGAGCCUGACCUGCCUGGUGACCAA



CUUCUUCAGCGAGGCCAUCAGCGUGGAGUGGGAGCGGAACGGCGAGCUGGAGCAGGACUACAAGAACACCCCA



CCCAUCCUGGACAGCGACGGCACCUACUUCCUGUACAGCAAGCUGACCGUGGACACCGACAGCUGGCUGCAGG



GCGAGAUCUUCACCUGCAGCGUGGUGCACGAGGCCCUGCACAACCACCACACCCAGAAGAACCUGAGCCGGAG



CCCCGGCAAGGACUACAAGGACGACGACGACAAG





137
AUGAACAGCGGCCUGCAGCUGGUGUUCUUCGUGCUGACCCUGAAGGGCAUCCAGGGCGAGGUGCAGCUGGUGG



AGAGCGGCGGCGGCCUGGUGCAGCCCGGCAAGAGCCUGAAGCUGAGCUGCGAGGCCAGCGGCUUCACCUUCAG



CGGCUACGGCAUGCACUGGGUGCGGCAGGCACCCGGCCGGGGCCUGGAGAGCGUGGCCUACAUCACCAGCAGC



AGCAUCAACAUCAAGUACGCCGACGCCGUGAAGGGCCGGUUCACCGUGAGCCGGGACAACGCCAAGAACCUGC



UGUUCCUGCAGAUGAACAUCCUGAAGAGCGAGGACACCGCCAUGUACUACUGCGCCCGGUUCGACUGGGACAA



GAACUACUGGGGCCAGGGCACCAUGGUGACCGUGAGCAGCGGCGGCGGCGGCAGCGGCGGCGGCGGCAGCGGC



GGCGGCGGCAGCGACAUCCAGAUGACCCAGAGCCCCAGCAGCCUGCCCGCCAGCCUGGGCGACCGGGUGACCA



UCAACUGCCAGGCCAGCCAGGACAUCAGCAACUACCUGAACUGGUACCAGCAGAAGCCCGGCAAGGCACCCAA



GCUGCUGAUCUACUACACCAACAAGCUGGCCGACGGCGUGCCCAGCCGGUUCAGCGGCAGCGGCAGCGGCCGG



GACAGCAGCUUCACCAUCAGCAGCCUGGAGAGCGAGGACAUCGGCAGCUACUACUGCCAGCAGUACUACAACU



ACCCCUGGACCUUCGGCCCCGGCACCAAGCUGGAGAUCAAGCCCCGGAUCCCCAAGCCCAGCACCCCACCCGG



CAGCAGCUGCCCACCCGGCAACAUCCUGGGCGGCCCCAGCGUGUUCAUCUUCCCACCCAAGCCCAAGGACGCC



CUGAUGAUCAGCCUGACACCCAAGGUGACCUGCGUGGUGGUGGACGUGAGCGAGGACGACCCCGACGUGCACG



UGAGCUGGUUCGUGGACAACAAGGAGGUGCACACCGCCUGGACCCAGCCCCGGGAGGCCCAGUACAACAGCAC



CUUCCGGGUGGUGAGCGCCCUGCCCAUCCAGCACCAGGACUGGAUGCGGGGCAAGGAGUUCAAGUGCAAGGUG



AACAACAAGGCCCUGCCCGCACCCAUCGAGCGGACCAUCAGCAAGCCCAAGGGCCGGGCCCAGACACCCCAGG



UGUACACCAUCCCACCGCCCCGGGAGCAGAUGAGCAAGAAGAAGGUGAGCCUGACCUGCCUGGUGACCAACUU



CUUCAGCGAGGCCAUCAGCGUGGAGUGGGAGCGGAACGGCGAGCUGGAGCAGGACUACAAGAACACACCACCC



AUCCUGGACAGCGACGGCACCUACUUCCUGUACAGCAAGCUGACCGUGGACACCGACAGCUGGCUGCAGGGCG



AGAUCUUCACCUGCAGCGUGGUGCACGAGGCCCUGCACAACCACCACACCCAGAAGAACCUGAGCCGGAGCCC



CGGCAAGGACUACAAGGACGACGACGACAAG





138
AUGCGGGCACCCACCGUGUACCCCGUGCUGCUGUUCCUGUGGUUCACCGGCGCCAUCUGCGACAUCCAGAUGA



CCCAGAGCCCCAGCAGCCUCCCUGCCAGCCUGGGCGACCGGGUGACCAUCAACUGCCAGGCCAGCCAGGACAU



CAGCAACUACCUGAACUGGUACCAGCAGAAGCCCGGCAAGGCUCCCAAGCUGCUGAUCUACUACACCAACAAG



CUGGCCGACGGCGUGCCCAGCCGGUUCAGCGGCAGCGGAAGCGGGCGGGACAGCUCUUUCACCAUCAGCAGCC



UGGAAAGCGAGGACAUCGGCAGCUACUACUGCCAGCAGUACUACAACUACCCCUGGACCUUCGGGCCCGGAAC



CAAGCUGGAGAUCAAGGGCGGCGGAGGCUCCGGAGGUGGCGGUAGUGGAGGCGGCGGCUCUGAGGUGCAGCUG



GUGGAGAGCGGCGGCGGUCUGGUGCAACCCGGCAAGAGCCUGAAGCUGAGCUGCGAGGCCAGCGGCUUCACCU



UCAGCGGCUACGGCAUGCACUGGGUGCGGCAGGCCCCGGGCAGAGGGCUCGAGAGCGUGGCCUACAUCACCAG



CAGCAGCAUCAACAUCAAGUACGCCGACGCCGUGAAGGGCCGCUUUACCGUGAGCCGGGACAACGCCAAGAAC



CUCCUGUUCUUACAGAUGAACAUCCUGAAGUCCGAGGACACCGCCAUGUACUACUGCGCCCGGUUCGACUGGG



ACAAGAACUACUGGGGCCAGGGCACCAUGGUGACCGUGAGCAGCCCUCGGAUCCCCAAGCCCAGCACGCCUCC



CGGCAGCAGCUGCCCUCCCGGCAACAUUCUGGGCGGCCCCAGCGUGUUCAUCUUCCCACCGAAGCCCAAGGAC



GCCCUGAUGAUCAGCCUGACCCCUAAGGUGACCUGCGUGGUGGUGGACGUGAGCGAGGACGACCCCGACGUGC



ACGUGAGCUGGUUCGUGGACAACAAGGAGGUGCACACCGCCUGGACCCAGCCCAGAGAGGCCCAGUACAACAG



CACCUUCCGGGUGGUGAGCGCCCUGCCCAUCCAGCACCAGGACUGGAUGCGGGGCAAGGAGUUCAAGUGCAAG



GUGAACAACAAGGCACUCCCCGCCCCGAUCGAGCGGACCAUCAGCAAGCCCAAAGGGAGAGCCCAGACCCCAC



AGGUGUACACCAUCCCGCCUCCCCGGGAGCAGAUGAGCAAGAAGAAGGUGAGCCUGACCUGCCUGGUGACCAA



CUUCUUCAGCGAGGCCAUCAGCGUGGAGUGGGAGCGGAACGGCGAGCUGGAGCAGGACUACAAGAACACCCCA



CCCAUCCUGGACAGCGACGGCACCUACUUCCUGUACAGCAAGCUGACCGUGGACACCGACAGCUGGCUGCAGG



GCGAGAUCUUCACCUGCAGCGUGGUGCACGAGGCCCUGCACAACCACCACACCCAGAAGAACCUGUCCAGAAG



CCCCGGAAAGGACUACAAGGACGACGACGACAAG





139
AUGAACAGCGGCCUGCAGCUGGUGUUCUUCGUGCUGACCCUGAAGGGCAUCCAGGGCGAGGUGCAACUGGUGG



AGAGCGGCGGCGGUCUGGUCCAGCCAGGCAAGAGCCUGAAGCUGAGCUGCGAGGCCAGCGGAUUUACCUUCAG



CGGCUACGGCAUGCACUGGGUGAGGCAGGCCCCGGGCAGAGGUCUGGAGUCCGUGGCCUACAUCACCAGCAGC



AGCAUCAACAUCAAGUACGCCGACGCCGUGAAGGGCCGGUUCACCGUGAGCCGGGACAACGCCAAGAACCUGC



UGUUCCUGCAGAUGAACAUCCUCAAGAGCGAGGACACCGCCAUGUACUACUGCGCCCGGUUCGACUGGGACAA



GAACUACUGGGGCCAGGGCACCAUGGUGACUGUGAGCAGCGGAGGCGGAGGUUCCGGCGGUGGCGGUUCUGGA



GGCGGCGGAAGCGACAUCCAGAUGACCCAGAGCCCCAGCAGCCUGCCCGCCAGCCUGGGCGACCGGGUGACCA



UCAACUGCCAGGCCUCCCAGGACAUCAGCAACUACCUGAACUGGUACCAGCAGAAGCCCGGCAAGGCCCCUAA



GCUGCUGAUCUACUACACCAACAAGCUGGCCGACGGAGUGCCCAGCCGGUUCUCAGGCAGCGGCAGCGGGAGA



GACAGCAGCUUCACCAUCAGCUCCCUGGAGUCAGAGGACAUCGGCAGCUAUUACUGCCAGCAGUACUACAACU



ACCCCUGGACUUUCGGACCCGGAACGAAGCUGGAGAUCAAGCCCCGGAUCCCAAAGCCCAGCACUCCACCUGG



AAGCUCCUGCCCACCCGGCAACAUACUGGGCGGCCCCUCAGUGUUCAUCUUUCCUCCCAAGCCCAAGGACGCC



CUGAUGAUCAGCCUGACCCCGAAGGUGACCUGCGUGGUGGUGGACGUGAGCGAAGACGACCCCGACGUGCACG



UGAGCUGGUUCGUGGACAACAAGGAGGUGCACACCGCCUGGACCCAGCCCAGAGAAGCCCAGUACAACAGCAC



CUUCAGAGUGGUGAGCGCCCUGCCCAUCCAGCACCAGGACUGGAUGCGGGGCAAGGAGUUCAAGUGCAAGGUG



AACAAUAAGGCCCUCCCCGCCCCGAUCGAGCGGACUAUUAGCAAACCCAAGGGAAGGGCGCAGACUCCCCAGG



UGUACACCAUCCCUCCUCCGCGGGAGCAGAUGAGCAAGAAGAAGGUGAGCUUAACUUGCCUGGUGACCAACUU



CUUCUCUGAGGCUAUCAGCGUGGAGUGGGAGCGGAACGGCGAGCUGGAGCAGGACUACAAGAACACCCCACCC



AUCCUGGACAGCGACGGCACCUACUUCCUGUACAGCAAGCUGACCGUGGACACGGACAGCUGGCUCCAAGGCG



AGAUCUUCACCUGCAGCGUGGUGCACGAGGCCCUGCACAACCACCACACCCAGAAGAAUCUCAGCAGGAGCCC



UGGAAAGGAUUACAAGGACGACGACGAUAAG





140
AUGAACAGCGGCCUGCAGCUGGUGUUCUUCGUGCUGACCCUGAAGGGCAUCCAGGGCGAGGUGCAGCUGGUGG



AGAGCGGCGGCGGCCUGGUGCAGCCCGGCAAGAGCCUGAAGCUGAGCUGCGAGGCCAGCGGCUUCACCUUCAG



CGGCUACGGCAUGCACUGGGUGCGGCAGGCACCCGGCCGGGGCCUGGAGAGCGUGGCCUACAUCACCAGCAGC



AGCAUCAACAUCAAGUACGCCGACGCCGUGAAGGGCCGGUUCACCGUGAGCCGGGACAACGCCAAGAACCUGC



UGUUCCUGCAGAUGAACAUCCUGAAGAGCGAGGACACCGCCAUGUACUACUGCGCCCGGUUCGACUGGGACAA



GAACUACUGGGGCCAGGGCACCAUGGUGACCGUGAGCAGCGCACCCAGCGUGUACCCACUGGUGCCCGGCUGC



GGCGACACCAGCGGCAGCAGCGUGACCCUGGGCUGCCUGGUGAAGGGCUACUUCCCCGAGCCCGUGACCGUGA



AGUGGAACUACGGCGCCCUGAGCAGCGGCGUGCGGACCGUGAGCAGCGUGCUGCAGAGCGGCUUCUACAGCCU



GAGCAGCCUGGUGACCGUGCCCAGCAGCACCUGGCCCAGCCAGACCGUGAUCUGCAACGUGGCCCACCCCGCC



AGCAAGACCGAGCUGAUCAAGCGGAUCGAGCCCCGGAUCCCCAAGCCCAGCACCCCACCCGGCAGCAGCUGCC



CACCCGACUACAAGGACGACGACGACAAG





141
AUGCGGGCCCCCACCGUGUACCCCGUGCUGCUGUUCCUGUGGUUCACCGGCGCCAUCUGCGACAUCCAGAUGA



CCCAGAGCCCCAGCAGCCUGCCCGCCAGCCUGGGCGACCGGGUGACCAUCAACUGCCAGGCCAGCCAGGACAU



CAGCAACUACCUGAACUGGUACCAGCAGAAGCCCGGCAAGGCCCCCAAGCUGCUGAUCUACUACACCAACAAG



CUGGCCGACGGCGUGCCCAGCCGGUUCAGCGGCAGCGGCAGCGGCCGGGACAGCAGCUUCACCAUCAGCAGCC



UGGAGAGCGAGGACAUCGGCAGCUACUACUGCCAGCAGUACUACAACUACCCCUGGACCUUCGGCCCCGGCAC



CAAGCUGGAGAUCAAGCGGGCCGACGCCGCCCCCACCGUGAGCAUCUUCCCACCCAGCAGCGAGCAGCUGACC



AGCGGCGGCGCCAGCGUGGUGUGCUUCCUGAACAACUUCUACCCCAAGGACAUCAACGUGAAGUGGAAGAUCG



ACGGCAGCGAGCGGCAGAACGGCGUGCUGAACAGCUGGACCGACCAGGACAGCAAGGACAGCACCUACAGCAU



GAGCAGCACCCUGACCCUGACCAAGGACGAGUACGAGCGGCACAACAGCUACACCUGCGAGGCCACCCACAAG



ACCAGCACCAGCCCCAUCGUGAAGAGCUUCAACCGGAACGAGUGCGGCAAGCCCAUCCCCAACCCCCUGCUGG



GCCUGGACAGCACC





142
AUGAGAGCCCCUACCGUGUACCCUGUGCUGCUGUUCCUGUGGUUCACCGGCGCCAUCUGCGACAUCCAGAUGA



CCCAGAGCCCUAGCAGUCUGCCCGCCAGCCUGGGCGACAGAGUGACCAUCAACUGCCAGGCCUCCCAAGACAU



CAGCAACUACCUGAACUGGUACCAGCAGAAGCCUGGCAAGGCCCCUAAGCUGCUGAUCUACUACACCAACAAG



CUGGCCGACGGGGUGCCGAGCAGAUUCAGCGGGAGCGGAUCCGGCAGAGACAGCAGCUUCACCAUCAGCAGCC



UGGAGAGCGAGGACAUCGGCAGCUACUACUGCCAGCAGUACUACAACUACCCUUGGACCUUCGGCCCUGGCAC



CAAGCUGGAGAUCAAGAGAGCCGACGCCGCGCCCACCGUGAGCAUCUUCCCUCCUAGCAGCGAGCAGCUGACC



AGCGGUGGGGCCAGCGUGGUGUGCUUCCUGAACAACUUCUACCCUAAGGACAUCAACGUGAAGUGGAAGAUCG



ACGGCAGCGAGAGACAGAACGGCGUGCUGAACAGCUGGACCGACCAGGACAGCAAGGAUAGCACCUACAGCAU



GAGCAGCACCCUGACCCUGACCAAGGACGAGUACGAGAGACACAACAGCUACACCUGCGAGGCCACCCACAAG



ACCAGCACCAGCCCUAUCGUCAAGAGCUUCAACAGAAACGAGUGCGGCAAGCCUAUCCCUAACCCUCUGCUGG



GCCUGGACAGCACC





143
AUGAACAGCGGCCUGCAGCUGGUGUUCUUCGUGCUGACCCUGAAGGGCAUCCAGGGCGAGGUGCAGCUGGUGG



AGAGCGGCGGCGGCCUGGUGCAGCCCGGCAAGAGCCUGAAGCUGAGCUGCGAGGCCAGCGGCUUCACCUUCAG



CGGCUACGGCAUGCACUGGGUGCGGCAGGCCCCCGGCCGGGGCCUGGAGAGCGUGGCCUACAUCACCAGCAGC



AGCAUCAACAUCAAGUACGCCGACGCCGUGAAGGGCCGGUUCACCGUGAGCCGGGACAACGCCAAGAACCUGC



UGUUCCUGCAGAUGAACAUCCUGAAGAGCGAGGACACCGCCAUGUACUACUGCGCCCGGUUCGACUGGGACAA



GAACUACUGGGGCCAGGGCACCAUGGUGACCGUGAGCAGCGCCAAGACCACCCCACCCAGCGUGUACCCCCUG



GCCCCCGGCAGCGCCGCCCAGACCAACAGCAUGGUGACCCUGGGCUGCCUGGUGAAGGGCUACUUCCCCGAGC



CCGUGACCGUGACCUGGAACAGCGGCAGCCUGAGCAGCGGCGUGCACACCUUCCCCGCCGUGCUGCAGAGCGA



CCUGUACACCCUGAGCAGCAGCGUGACCGUGCCCAGCAGCACCUGGCCCAGCGAGACCGUGACCUGCAACGUG



GCCCACCCCGCCAGCAGCACCAAGGUGGACAAGAAGAUCGUGCCCCGGGACUGCGGCUGCAAGCCCUGCAUCU



GCACCGUGCCCGAGGUGAGCAGCGUGUUCAUCUUCCCACCCAAGCCCAAGGACGUGCUGACCAUCACCCUGAC



CCCCAAGGUGACCUGCGUGGUGGUGGCCAUCAGCAAGGACGACCCCGAGGUGCAGUUCAGCUGGUUCGUGGAC



GACGUGGAGGUGCACACCGCCCAGACCCAGCCCCGGGAGGAGCAGUUCAACAGCACCUUCCGGAGCGUGAGCG



AGCUGCCCAUCAUGCACCAGGACUGGCUGAACGGCAAGGAGUUCAAGUGCCGGGUGAACAGCGCCGCCUUCCC



CGCCCCCAUCGAGAAGACCAUCAGCAAGACCAAGGGCCGGCCCAAGGCCCCCCAGGUGUACACCAUCCCACCC



CCCAAGGAGCAGAUGGCCAAGGACAAGGUGAGCCUGACCUGCAUGAUCACCGACUUCUUCCCCGAGGACAUCA



CCGUGGAGUGGCAGUGGAACGGCCAGCCCGCCGAGAACUACAAGAACACCCAGCCCAUCAUGGACACCGACGG



CAGCUACUUCGUGUACAGCAAGCUGAACGUGCAGAAGAGCAACUGGGAGGCCGGCAACACCUUCACCUGCAGC



GUGCUGCACGAGGGCCUGCACAACCACCACACCGAGAAGAGCCUGAGCCACAGCCCCGGCAAGGACUACAAGG



ACGACGACGACAAG





144
AUGAACAGCGGCCUGCAGCUGGUGUUCUUCGUACUGACCCUGAAAGGCAUCCAGGGCGAAGUGCAACUCGUGG



AGUCCGGAGGUGGGCUGGUGCAGCCUGGCAAGAGCCUGAAGCUGAGCUGCGAGGCCAGCGGUUUCACAUUCUC



CGGCUACGGCAUGCACUGGGUGAGACAAGCCCCUGGCAGAGGCCUGGAGAGCGUGGCCUACAUCACCAGCAGC



AGCAUCAACAUCAAGUACGCCGACGCCGUCAAGGGGAGAUUCACCGUGAGCAGAGACAACGCCAAGAACCUGC



UGUUCCUGCAGAUGAACAUCCUCAAGUCCGAGGACACCGCCAUGUACUACUGCGCCAGAUUCGACUGGGACAA



GAACUACUGGGGCCAGGGAACCAUGGUGACCGUCUCUAGUGCCAAGACCACCCCUCCUAGCGUGUACCCUCUG



GCACCCGGAUCGGCCGCCCAGACCAACAGCAUGGUCACCCUGGGCUGCCUGGUGAAGGGCUACUUCCCCGAAC



CAGUGACCGUGACCUGGAAUUCUGGGAGCCUCAGCAGCGGCGUGCACACCUUCCCUGCCGUGCUGCAGAGCGA



CCUGUACACCCUGAGCUCCAGCGUGACUGUGCCUAGCAGCACCUGGCCUAGCGAAACGGUCACCUGUAACGUG



GCCCACCCUGCCAGCAGCACCAAGGUGGACAAGAAGAUCGUGCCUAGAGACUGCGGCUGCAAGCCUUGCAUCU



GCACCGUGCCUGAGGUGAGCAGCGUGUUCAUCUUCCCUCCUAAGCCUAAGGACGUGCUGACCAUCACCCUGAC



CCCUAAGGUGACCUGUGUCGUGGUGGCCAUUAGCAAAGACGACCCCGAGGUGCAGUUCAGCUGGUUCGUGGAC



GACGUGGAAGUGCAUACUGCCCAAACCCAGCCUAGAGAGGAGCAGUUCAACAGCACCUUCAGAAGCGUGAGCG



AGCUGCCUAUCAUGCACCAGGACUGGCUGAACGGCAAGGAGUUCAAGUGCAGAGUGAAUAGCGCCGCUUUCCC



CGCCCCUAUCGAGAAGACCAUCAGCAAGACCAAGGGCAGACCUAAGGCCCCUCAGGUGUACACCAUCCCUCCU



CCUAAGGAGCAGAUGGCCAAGGACAAGGUGAGCCUGACCUGCAUGAUCACCGACUUCUUCCCUGAGGACAUCA



CCGUGGAGUGGCAGUGGAACGGCCAGCCUGCCGAGAACUACAAGAACACACAGCCCAUCAUGGACACCGACGG



CAGCUACUUCGUGUACAGCAAGCUGAACGUGCAGAAGUCGAACUGGGAGGCCGGCAACACCUUCACCUGCUCC



GUCCUGCACGAGGGCCUGCACAACCACCACACCGAGAAGAGUCUGAGCCACAGCCCCGGUAAGGACUACAAGG



ACGACGACGACAAG





145
AUGCGGGCACCCACCGUGUACCCCGUGCUGCUGUUCCUGUGGUUCACCGGCGCCAUCUGCGACAUCCAGAUGA



CCCAGAGCCCCAGCAGCCUGCCCGCCAGCCUGGGCGACCGGGUGACCAUCAACUGCCAGGCCAGCCAGGACAU



CAGCAACUACCUGAACUGGUACCAGCAGAAGCCCGGCAAGGCACCCAAGCUGCUGAUCUACUACACCAACAAG



CUGGCCGACGGCGUGCCCAGCCGGUUCAGCGGCAGCGGCAGCGGCCGGGACAGCAGCUUCACCAUCAGCAGCC



UGGAGAGCGAGGACAUCGGCAGCUACUACUGCCAGCAGUACUACAACUACCCCUGGACCUUCGGCCCCGGCAC



CAAGCUGGAGAUCAAGCGGGCCGACGCCAAGCCCACCGUGAGCAUCUUCCCACCCAGCAGCGAGCAGCUGGGC



ACCGGCAGCGCCACCCUGGUGUGCUUCGUGAACAACUUCUACCCCAAGGACAUCAACGUGAAGUGGAAGGUGG



ACGGCAGCGAGAAGCGGGACGGCGUGCUGCAGAGCGUGACCGACCAGGACAGCAAGGACAGCACCUACAGCCU



GAGCAGCACCCUGAGCCUGACCAAGGCCGACUACGAGCGGCACAACCUGUACACCUGCGAGGUGACCCACAAG



ACCAGCACCGCCGCCAUCGUGAAGACCCUGAACCGGAACGAGUGCGGCAAGCCCAUCCCCAACCCACUGCUGG



GCCUGGACAGCACC





166
AUGCAGAUCGAGCUGAGCACCUGCUUCUUCCUGUGCCUGCUGAGAUUCUGCUUCAGCGCCACCAGAAGAUACU



ACCUGGGCGCCGUGGAGCUGAGCUGGGACUACAUGCAGAGCGACCUGGGCGAGCUGCCUGUGGACGCCAGAUU



CCCUCCUAGAGUGCCUAAGAGCUUCCCUUUCAACACCAGCGUGGUGUACAAGAAGACCCUGUUCGUGGAGUUC



ACCGACCACCUGUUCAACAUCGCCAAGCCUAGACCUCCUUGGAUGGGCCUGCUGGGCCCUACCAUCCAGGCCG



AGGUGUACGACACCGUGGUGAUCACCCUGAAGAACAUGGCCAGCCACCCUGUGAGCCUGCACGCCGUGGGCGU



GAGCUACUGGAAGGCCAGCGAGGGCGCCGAGUACGACGACCAGACCAGCCAGAGAGAGAAGGAGGACGACAAG



GUGUUCCCUGGCGGCAGCCACACCUACGUGUGGCAGGUGCUGAAGGAGAACGGCCCUAUGGCCAGCGACCCUC



UGUGCCUGACCUACAGCUACCUGAGCCACGUGGACCUGGUGAAGGACCUGAACUCAGGCCUGAUCGGCGCGCU



GCUGGUUUGCAGAGAGGGCAGCCUGGCCAAGGAGAAGACCCAGACCCUGCACAAGUUCAUCCUGCUGUUCGCC



GUGUUCGACGAGGGCAAGAGCUGGCACAGCGAGACGAAGAACAGCCUGAUGCAGGACAGAGACGCCGCCAGCG



CCAGAGCCUGGCCUAAGAUGCACACCGUGAACGGCUACGUGAACAGAAGCCUGCCCGGCCUCAUUGGUUGCCA



CCGCAAGUCCGUGUACUGGCACGUGAUCGGCAUGGGCACCACCCCUGAGGUGCACAGCAUCUUCCUGGAGGGC



CACACCUUCCUGGUGAGAAACCACAGACAGGCCAGCCUGGAGAUCAGCCCUAUCACCUUCCUGACCGCCCAGA



CCCUCCUGAUGGACCUGGGCCAAUUCCUGCUGUUCUGUCACAUCUCUAGCCACCAGCACGACGGCAUGGAGGC



CUACGUGAAGGUGGACAGCUGCCCUGAGGAGCCUCAGCUGAGAAUGAAGAACAACGAGGAGGCCGAGGACUAC



GACGACGACCUGACCGACAGCGAGAUGGACGUGGUGAGAUUCGACGACGACAACAGCCCUAGCUUCAUCCAGA



UCAGAAGCGUGGCCAAGAAGCACCCUAAGACCUGGGUGCACUACAUCGCCGCCGAGGAGGAGGACUGGGACUA



CGCCCCUCUGGUGCUGGCCCCUGACGACAGAAGCUACAAGAGCCAGUACCUGAACAACGGCCCUCAGAGAAUC



GGCAGAAAGUACAAGAAGGUGAGAUUCAUGGCCUACACCGACGAGACUUUCAAGACCAGAGAGGCCAUCCAGC



ACGAGAGCGGCAUCCUGGGCCCUCUGCUGUACGGCGAGGUGGGCGACACCCUGCUGAUCAUCUUCAAGAACCA



AGCCAGCAGACCCUACAACAUCUACCCUCACGGCAUCACCGACGUGCGGCCUCUGUACAGCAGAAGACUGCCU



AAGGGCGUGAAGCACCUGAAGGACUUCCCUAUCCUGCCUGGCGAGAUCUUCAAGUACAAGUGGACCGUGACCG



UGGAGGACGGCCCUACCAAGAGCGACCCUAGGUGCCUGACCAGAUACUACAGCAGCUUCGUGAACAUGGAGCG



GGACCUGGCCUCCGGGCUGAUCGGGCCACUGCUGAUCUGCUACAAGGAGAGCGUGGAUCAGCGCGGAAACCAG



AUCAUGAGCGACAAGAGAAACGUGAUCCUGUUCUCAGUGUUCGACGAGAACAGAAGCUGGUACCUGACCGAGA



ACAUCCAGAGAUUCCUGCCUAACCCCGCCGGUGUCCAGCUGGAGGACCCCGAGUUCCAGGCCAGCAACAUCAU



GCACAGCAUCAACGGCUACGUCUUCGACAGCCUGCAGCUGAGCGUGUGCCUGCACGAGGUGGCCUACUGGUAC



AUCCUGAGCAUCGGCGCCCAGACCGACUUCUUAAGCGUCUUCUUUAGCGGGUACACCUUCAAACACAAGAUGG



UGUACGAGGACACCCUGACCCUGUUCCCUUUCAGCGGCGAAACCGUGUUCAUGAGCAUGGAGAACCCUGGCCU



GUGGAUCCUGGGCUGCCACAACAGCGACUUCAGAAACAGAGGCAUGACCGCCCUGCUGAAGGUGAGCAGCUGC



GACAAGAACACCGGCGACUACUACGAGGACAGCUACGAAGACAUCAGCGCCUACCUGCUGAGCAAGAACAACG



CCAUCGAGCCUAGAAGCUUCAGCCAGAACAGCAGACACCCUAGCACCAGACAGAAGCAGUUCAACGCCACCAC



CAUCCCUGAGAACGACAUCGAGAAGACCGACCCUUGGUUCGCCCACAGAACCCCUAUGCCUAAGAUCCAGAAC



GUGAGCAGCAGCGACCUGCUGAUGCUGCUGAGACAGAGCCCUACCCCUCACGGCCUGAGCCUGAGCGACCUGC



AGGAGGCCAAGUACGAAACUUUCAGCGACGACCCUAGCCCUGGCGCCAUCGACUCCAACAACAGCCUGUCCGA



GAUGACGCACUUUAGACCUCAGCUGCACCACAGCGGCGACAUGGUGUUCACCCCUGAGAGCGGACUGCAGCUG



AGACUGAACGAGAAGCUGGGCACCACCGCCGCCACCGAGCUGAAGAAGCUGGACUUCAAGGUUUCGUCUACGA



GCAACAACCUGAUCAGCACCAUCCCUAGCGACAACCUGGCCGCCGGCACCGACAACACCAGCUCGCUGGGCCC



GCCCAGCAUGCCUGUGCACUACGACAGCCAGCUGGACACCACCCUGUUCGGCAAGAAGUCCAGCCCUCUGACC



GAGUCCGGCGGUCCCCUGUCCCUGUCCGAGGAGAACAACGACAGCAAGCUGCUGGAGAGCGGUCUGAUGAACA



GCCAGGAGAGCAGCUGGGGCAAGAACGUCAGCAGCACCGAGAGCGGGAGACUCUUCAAGGGCAAGAGAGCCCA



CGGCCCCGCCCUCCUGACCAAGGACAACGCCCUGUUCAAGGUGUCAAUCAGCCUGCUGAAGACCAACAAGACC



AGCAACAACAGCGCCACCAACAGAAAGACCCACAUCGACGGCCCUAGCCUGCUGAUCGAGAAUUCCCCUUCCG



UGUGGCAGAACAUCCUGGAGAGCGACACCGAGUUCAAGAAGGUGACCCCUCUGAUCCACGACAGAAUGCUGAU



GGACAAGAACGCCACCGCCCUGAGGCUUAAUCACAUGAGCAACAAGACCACCAGCAGCAAGAACAUGGAGAUG



GUGCAGCAGAAGAAGGAGGGCCCUAUCCCUCCUGACGCCCAGAACCCUGACAUGAGCUUCUUCAAGAUGCUGU



UCCUGCCUGAGAGCGCCAGGUGGAUCCAGAGAACCCACGGCAAGAACUCCCUCAAUAGCGGCCAGGGCCCCAG



CCCUAAGCAGCUGGUGAGCCUGGGCCCUGAGAAAUCCGUGGAGGGCCAGAACUUCCUGAGCGAGAAGAACAAG



GUGGUGGUGGGCAAGGGCGAGUUCACCAAGGACGUGGGCCUGAAGGAGAUGGUGUUCCCUAGCAGCAGAAACC



UGUUCCUGACCAACCUGGACAACCUGCACGAGAACAACACCCACAACCAGGAGAAGAAGAUCCAGGAGGAGAU



CGAGAAGAAGGAAACCCUGAUCCAGGAGAACGUGGUGCUGCCUCAGAUCCACACCGUGACCGGCACCAAGAAC



UUCAUGAAGAACUUGUUCCUACUGAGCACACGUCAGAACGUGGAGGGCAGCUACGACGGCGCCUACGCCCCUG



UGCUGCAGGACUUCAGAAGCCUGAACGACAGCACCAACAGAACCAAGAAGCACACCGCCCACUUCAGCAAGAA



GGGCGAGGAGGAGAACCUGGAGGGCCUGGGCAACCAGACCAAGCAGAUCGUGGAGAAGUACGCCUGCACCACC



AGAAUCAGCCCUAACACCAGCCAGCAGAACUUCGUGACCCAGAGAUCCAAGCGAGCACUGAAGCAGUUCAGAC



UGCCUCUGGAGGAAACCGAGCUGGAGAAGAGAAUCAUCGUGGACGACACCAGCACCCAGUGGAGUAAGAACAU



GAAGCACCUAACCCCUAGCACCCUGACCCAGAUCGACUACAACGAGAAGGAGAAGGGCGCCAUCACCCAGAGC



CCUCUGAGCGACUGUUUGACUCGCAGCCACAGCAUCCCUCAGGCCAACAGAAGCCCUCUGCCUAUCGCCAAGG



UGAGCUCCUUCCCUAGCAUCAGACCUAUCUACCUGACCAGAGUGCUGUUCCAGGACAACAGCAGCCACCUGCC



UGCCGCCAGCUACAGAAAGAAGGACAGCGGUGUGCAGGAGUCUAGUCACUUCCUGCAGGGCGCCAAGAAGAAC



AACCUGAGCCUGGCCAUCCUGACCCUGGAGAUGACCGGCGACCAGAGAGAGGUGGGCAGCCUGGGCACUAGUG



CCACCAACAGCGUGACCUAUAAGAAGGUCGAGAACACCGUGCUGCCUAAGCCUGACCUGCCUAAGACCAGCGG



CAAGGUGGAGCUGCUGCCAAAGGUGCACAUCUACCAGAAGGACCUGUUCCCUACCGAGACGAGCAACGGCAGC



CCUGGCCACCUGGACCUCGUGGAGGGAAGCCUGCUGCAGGGCACCGAGGGAGCAAUCAAGUGGAACGAGGCCA



ACAGACCUGGCAAGGUGCCUUUCCUGAGAGUGGCCACCGAGAGCAGCGCCAAGACCCCUAGCAAGCUCCUCGA



CCCCUUAGCCUGGGACAACCACUACGGCACCCAGAUCCCUAAGGAGGAGUGGAAGUCCCAGGAGAAGUCCCCU



GAGAAGACCGCCUUCAAGAAGAAGGACACCAUCCUGAGCCUGAACGCCUGCGAGAGCAACCACGCCAUCGCCG



CCAUCAACGAAGGCCAGAACAAGCCUGAGAUCGAGGUUACCUGGGCCAAGCAGGGCAGAACCGAGAGACUGUG



CAGCCAGAACCCUCCUGUGCUGAAGAGACACCAGAGAGAGAUCACCAGAACCACCCUGCAAAGCGAUCAGGAA



GAAAUCGAUUACGACGAUACCAUCAGCGUGGAGAUGAAGAAGGAGGACUUCGACAUCUACGACGAGGACGAGA



ACCAGAGCCCAAGGUCUUUCCAGAAGAAGACCAGACACUACUUCAUCGCCGCCGUGGAGAGACUGUGGGACUA



CGGGAUGAGCAGCAGCCCUCACGUGCUGAGAAACAGAGCCCAGAGCGGCAGCGUGCCUCAAUUCAAGAAGGUU



GUGUUCCAGGAGUUCACUGACGGCAGCUUCACCCAACCUCUAUACAGAGGCGAGCUGAACGAGCAUCUCGGCC



UGCUGGGACCCUACAUCAGAGCCGAGGUGGAGGACAACAUCAUGGUGACCUUCAGAAACCAGGCCAGCAGACC



UUACAGCUUCUACAGCAGCCUGAUCAGCUACGAGGAGGACCAGAGACAGGGCGCCGAGCCUAGAAAGAACUUC



GUAAAGCCUAACGAGACAAAGACCUACUUCUGGAAGGUGCAGCACCACAUGGCCCCUACCAAGGACGAGUUCG



ACUGCAAGGCCUGGGCCUACUUCAGCGACGUCGAUCUGGAGAAGGACGUGCACAGCGGCCUCAUCGGCCCUCU



GUUAGUCUGUCACACCAACACCCUGAACCCUGCCCACGGCAGACAGGUGACCGUGCAGGAGUUCGCCCUGUUC



UUCACCAUCUUCGACGAGACUAAGAGCUGGUACUUCACCGAGAAUAUGGAGAGAAACUGCAGAGCCCCUUGCA



ACAUCCAGAUGGAGGACCCUACCUUCAAGGAGAACUACAGAUUCCACGCUAUCAACGGUUAUAUCAUGGACAC



CCUGCCUGGGCUGGUGAUGGCCCAGGACCAGAGAAUCCGGUGGUAUCUCCUUUCCAUGGGCAGCAACGAGAAC



AUUCACAGCAUCCACUUCAGCGGCCACGUGUUCACCGUGAGAAAGAAGGAGGAGUACAAGAUGGCCCUGUACA



ACCUGUACCCUGGCGUGUUCGAAACCGUGGAGAUGCUGCCUAGCAAGGCCGGCAUCUGGAGAGUGGAGUGCCU



GAUCGGAGAGCACCUGCACGCCGGCAUGAGCACCCUGUUCCUGGUGUACAGCAACAAGUGCCAGACACCUCUG



GGUAUGGCUAGCGGCCACAUCCGGGACUUCCAAAUCACGGCCAGCGGGCAAUACGGCCAGUGGGCCCCUAAGC



UGGCCAGACUGCACUACAGCGGCAGCAUCAACGCCUGGAGCACCAAGGAGCCUUUCAGCUGGAUCAAGGUGGA



CCUGCUGGCCCCUAUGAUCAUCCACGGAAUCAAGACCCAGGGCGCCAGACAGAAGUUCAGCAGCCUGUACAUC



AGCCAGUUCAUCAUCAUGUACAGCCUGGACGGCAAGAAGUGGCAGACCUACAGAGGCAACAGCACCGGCACCC



UGAUGGUGUUCUUCGGCAACGUGGACAGCAGCGGCAUCAAGCACAACAUCUUCAACCCUCCUAUCAUCGCCAG



AUACAUCAGACUGCACCCUACCCACUACAGCAUCAGAUCCACCCUGAGGAUGGAGCUCAUGGGCUGUGACCUG



AACAGCUGCAGCAUGCCUCUGGGCAUGGAGAGCAAGGCCAUCAGCGACGCCCAGAUCACCGCCAGCAGCUACU



UCACCAACAUGUUCGCCACCUGGAGCCCUAGCAAGGCGCGGUUGCACCUGCAGGGCAGGAGCAACGCUUGGAG



GCCUCAGGUGAACAACCCUAAGGAGUGGCUGCAGGUGGACUUCCAGAAGACCAUGAAGGUGACCGGCGUGACC



ACCCAGGGCGUCAAGUCCCUGCUGACCAGCAUGUACGUGAAGGAGUUCCUGAUCAGCAGCAGCCAGGACGGCC



ACCAGUGGACCCUGUUCUUCCAGAACGGCAAGGUGAAGGUGUUCCAGGGCAACCAGGACAGCUUCACCCCUGU



GGUGAACAGCCUGGACCCUCCUCUGCUGACAAGAUACCUGAGAAUCCACCCUCAGAGCUGGGUGCACCAGAUC



GCCCUGAGAAUGGAGGUGCUGGGCUGCGAGGCCCAGGACCUGUAC





167
AUGCAAAUAGAGCUCUCCACCUGCUUCUUUCUGUGCCUUUUGCGAUUCUGCUUUAGUGCCACCAGAAGAUACU



ACCUGGGUGCAGUGGAACUGUCCUGGGACUAUAUGCAAAGUGAUCUCGGUGAGCUGCCUGUGGACGCAAGAUU



UCCUCCUAGAGUGCCCAAGUCUUUUCCAUUCAACACCUCAGUCGUGUACAAGAAGACUCUGUUUGUAGAAUUC



ACGGAUCACCUUUUCAACAUCGCUAAGCCAAGGCCACCCUGGAUGGGUCUGCUAGGUCCUACCAUCCAGGCUG



AGGUUUACGAUACAGUGGUCAUUACACUUAAGAACAUGGCUUCCCAUCCUGUCAGUCUUCACGCUGUUGGUGU



AUCCUACUGGAAAGCUUCUGAGGGAGCUGAAUACGACGAUCAGACCAGUCAAAGGGAGAAAGAAGACGAUAAA



GUCUUCCCUGGUGGAAGCCAUACAUACGUCUGGCAGGUCCUGAAAGAGAACGGUCCAAUGGCCUCUGACCCAC



UGUGCCUUACCUACUCAUAUCUUUCUCACGUGGACCUGGUCAAGGACUUGAAUUCAGGCCUCAUUGGAGCCCU



ACUAGUGUGUAGAGAAGGGAGUCUGGCCAAGGAGAAGACACAGACCUUGCACAAAUUUAUACUACUUUUCGCU



GUAUUUGACGAAGGGAAGAGUUGGCACUCAGAAACAAAGAACUCCUUGAUGCAGGAUAGGGACGCUGCAUCUG



CUCGGGCCUGGCCUAAGAUGCACACAGUCAACGGUUACGUAAACAGGUCCCUGCCAGGUCUGAUUGGCUGCCA



CAGGAAAUCAGUCUAUUGGCACGUGAUUGGAAUGGGCACCACUCCUGAAGUGCACUCAAUAUUCCUCGAAGGU



CACACAUUUCUUGUGAGGAACCAUCGCCAGGCGUCCUUGGAAAUCUCGCCAAUAACUUUCCUUACUGCUCAAA



CACUCUUGAUGGACCUUGGACAGUUUCUACUGUCUUGUCAUAUCUCUUCCCACCAACACGACGGCAUGGAAGC



UUACGUCAAAGUAGACAGCUGUCCAGAGGAACCCCAACUACGAAUGAAGAAUAACGAAGAAGCGGAAGACUAC



GACGACGAUCUUACUGAUUCUGAAAUGGACGUGGUCAGGUUUGACGACGACAACUCUCCUUCCUUUAUCCAAA



UUCGCUCAGUUGCCAAGAAGCAUCCUAAGACUUGGGUACAUUACAUUGCUGCUGAAGAGGAGGACUGGGACUA



CGCUCCCUUAGUCCUCGCCCCUGACGACAGAAGUUAUAAGAGUCAAUAUUUGAACAACGGCCCUCAGCGGAUU



GGUAGGAAGUACAAGAAAGUCCGAUUUAUGGCAUACACAGACGAAACCUUUAAGACUCGUGAAGCUAUUCAGC



ACGAAUCAGGAAUCUUGGGACCUUUACUUUACGGGGAAGUUGGAGACACACUGUUGAUUAUAUUUAAGAAUCA



AGCAAGCAGACCAUAUAACAUCUACCCUCACGGAAUCACUGACGUCCGUCCUUUGUAUUCAAGGAGAUUACCC



AAGGGUGUCAAGCAUUUGAAGGAUUUUCCAAUUCUGCCAGGAGAAAUAUUCAAAUAUAAGUGGACAGUGACUG



UAGAAGACGGGCCAACUAAAUCAGAUCCUCGGUGCCUGACCCGCUAUUACUCUAGUUUCGUUAAUAUGGAGAG



AGAUCUAGCUUCAGGACUCAUUGGCCCUCUCCUCAUCUGCUACAAAGAAUCUGUAGAUCAAAGAGGAAACCAG



AUAAUGUCAGACAAGAGGAACGUCAUCCUGUUCAGCGUCUUCGACGAGAACAGGAGCUGGUACCUCACAGAGA



AUAUACAACGCUUUCUCCCCAAUCCAGCUGGAGUGCAGCUUGAGGAUCCAGAGUUCCAAGCCUCCAACAUCAU



GCACAGCAUCAACGGCUACGUGUUCGAUAGUUUGCAGUUGUCAGUUUGUUUGCACGAGGUGGCAUACUGGUAC



AUUCUAAGCAUUGGAGCACAGACUGACUUCCUGAGCGUGUUCUUCAGCGGCUACACCUUCAAACACAAGAUGG



UCUACGAAGACACACUCACCCUAUUCCCAUUCUCAGGAGAAACUGUCUUCAUGUCGAUGGAGAACCCAGGUCU



GUGGAUUCUGGGGUGCCACAACUCAGACUUUCGGAACAGAGGCAUGACCGCCUUACUGAAGGUUUCUAGUUGU



GACAAGAACACUGGUGAUUAUUACGAGGACAGUUACGAAGAUAUUUCAGCAUACUUGCUGAGUAAGAACAACG



CCAUUGAACCAAGAAGCUUCUCCCAGAAUUCAAGACACCCUAGCACUAGGCAGAAGCAAUUUAACGCCACCAC



AAUUCCAGAGAACGACAUAGAGAAGACUGACCCUUGGUUUGCACACAGAACACCUAUGCCUAAGAUACAGAAC



GUCUCCUCUAGUGAUUUGUUGAUGCUCUUGCGACAGAGUCCUACUCCACACGGGCUAUCCUUAUCUGAUCUCC



AAGAAGCCAAAUACGAGACAUUCUCUGACGAUCCAUCACCUGGAGCAAUAGACAGUAAUAACAGCCUGUCUGA



AAUGACACACUUCAGGCCACAGCUCCAUCACAGUGGGGACAUGGUAUUUACCCCUGAGUCAGGCCUCCAAUUA



AGAUUAAACGAGAAACUGGGGACAACUGCAGCAACAGAGUUGAAGAAACUUGAUUUCAAAGUUUCUAGUACAU



CAAAUAACCUGAUCUCCACCAUCCCCAGCGACAAUUUGGCAGCAGGUACUGAUAAUACAAGUUCCUUAGGACC



ACCAAGUAUGCCAGUUCAUUACGAUAGUCAAUUAGAUACCACUCUAUUUGGCAAGAAGUCAUCUCCCCUUACU



GAGUCUGGUGGACCUCUGAGCUUGAGUGAAGAGAACAACGACUCCAAACUGCUGGAAUCCGGCUUAAUGAAUA



GCCAAGAAAGUAGCUGGGGCAAGAACGUAUCGACGCGGGAAAUAACUCGUACUACUCUUCAGUCAGAUCAAGA



GGAAAUUGACUACGACGAUACCAUAUCAGUUGAAAUGAAGAAGGAAGAUUUUGACAUUUACGACGAGGACGAG



AAUCAGUCACCCCGCAGCUUUCAGAAGAAGACACGACACUAUUUCAUCGCCGCCGUGGAGAGGCUGUGGGAUU



ACGGGAUGAGUAGCUCCCCACACGUUCUAAGAAACAGGGCUCAGAGUGGCAGUGUCCCUCAGUUCAAGAAAGU



UGUUUUCCAGGAAUUUACUGACGGCUCCUUUACUCAGCCCUUAUACCGUGGAGAACUAAACGAACAUUUGGGA



CUCCUGGGGCCAUAUAUAAGAGCAGAAGUUGAAGAUAAUAUCAUGGUAACUUUCAGAAAUCAGGCCUCUCGUC



CCUAUUCCUUCUAUUCUAGCCUGAUCAGCUACGAGGAGGACCAGCGCCAGGGAGCAGAACCUAGAAAGAACUU



UGUCAAGCCUAACGAAACCAAGACUUACUUUUGGAAAGUGCAACAUCAUAUGGCACCCACUAAAGACGAGUUU



GACUGCAAAGCCUGGGCUUAUUUCUCUGACGUUGACCUGGAGAAAGACGUGCACUCAGGCCUGAUUGGACCCC



UUCUGGUCUGCCACACUAACACACUGAACCCUGCUCACGGGAGACAAGUGACAGUACAGGAAUUUGCUCUGUU



CUUCACCAUCUUUGACGAAACCAAGUCCUGGUACUUCACCGAGAAUAUGGAAAGAAACUGCAGGGCUCCCUGC



AAUAUCCAGAUGGAAGAUCCCACUUUUAAAGAGAAUUAUCGCUUCCACGCAAUCAACGGCUACAUAAUGGAUA



CACUACCUGGCUUAGUAAUGGCUCAGGAUCAAAGGAUUAGGUGGUAUCUGCUCAGCAUGGGCAGCAACGAGAA



CAUCCAUUCUAUUCAUUUCAGUGGACACGUGUUCACUGUACGGAAGAAAGAGGAGUAUAAGAUGGCACUGUAC



AAUCUCUAUCCAGGUGUGUUCGAGACAGUGGAAAUGUUACCAUCCAAAGCUGGAAUUUGGCGGGUGGAGUGCC



UUAUUGGCGAGCAUCUACACGCUGGGAUGAGCACACUGUUCCUGGUGUACAGCAAUAAGUGUCAGACUCCCCU



GGGAAUGGCUUCUGGACACAUUAGAGAUUUUCAGAUUACAGCUUCAGGACAAUACGGACAGUGGGCCCCAAAG



CUGGCCAGACUUCAUUAUUCCGGAUCAAUCAACGCCUGGUCCACCAAGGAGCCCUUCAGCUGGAUCAAGGUGG



AUCUGUUGGCACCAAUGAUUAUUCACGGCAUCAAGACCCAGGGUGCCCGUCAGAAGUUCUCCAGCCUCUACAU



CUCUCAGUUUAUCAUCAUGUAUAGUCUUGACGGGAAGAAGUGGCAGACUUAUCGAGGAAAUUCCACUGGAACC



UUAAUGGUCUUCUUUGGCAACGUGGAUUCAUCUGGGAUCAAGCACAAUAUCUUCAACCCUCCAAUUAUUGCUC



GAUACAUCCGUUUGCACCCAACUCAUUAUAGCAUUCGCAGCACUCUUCGCAUGGAGUUGAUGGGCUGUGAUUU



AAAUAGUUGCAGCAUGCCAUUGGGAAUGGAGAGUAAAGCAAUAUCAGACGCACAGAUUACUGCUUCAUCCUAC



UUUACCAAUAUGUUUGCCACCUGGUCCCCUUCCAAGGCUCGACUUCACCUCCAAGGGAGGAGUAACGCCUGGA



GGCCUCAGGUGAAUAAUCCGAAGGAGUGGCUGCAAGUGGACUUCCAGAAGACAAUGAAAGUCACAGGAGUAAC



UACUCAGGGAGUCAAGUCUCUGCUUACCAGCAUGUACGUGAAGGAGUUCCUCAUCUCCAGCAGUCAAGACGGC



CAUCAGUGGACUCUCUUCUUUCAGAACGGCAAAGUAAAGGUGUUUCAGGGAAAUCAAGACUCCUUCACACCUG



UGGUGAACAGCCUGGACCCACCGUUACUGACUCGCUACCUUCGAAUUCAUCCGCAGUCCUGGGUGCACCAGAU



CGCCCUCAGGAUGGAGGUUCUGGGCUGCGAGGCACAGGACCUCUAC





168
AUGCAAAUAGAGCUCUCCACCUGCUUCUUUCUGUGCCUUUUGCGAUUCUGCUUUAGUGCCACCAGAAGAUACU



ACCUGGGUGCAGUGGAACUGUCCUGGGACUAUAUGCAAAGUGAUCUCGGUGAGCUGCCUGUGGACGCAAGAUU



UCCUCCUAGAGUGCCCAAGUCUUUUCCAUUCAACACCUCAGUCGUGUACAAGAAGACUCUGUUUGUAGAAUUC



ACGGAUCACCUUUUCAACAUCGCUAAGCCAAGGCCACCCUGGAUGGGUCUGCUAGGUCCUACCAUCCAGGCUG



AGGUUUACGAUACAGUGGUCAUUACACUUAAGAACAUGGCUUCCCAUCCUGUCAGUCUUCACGCUGUUGGUGU



AUCCUACUGGAAAGCUUCUGAGGGAGCUGAAUACGACGAUCAGACCAGUCAAAGGGAGAAAGAAGACGAUAAA



GUCUUCCCUGGUGGAAGCCAUACAUACGUCUGGCAGGUCCUGAAAGAGAACGGUCCAAUGGCCUCUGACCCAC



UGUGCCUUACCUACUCAUAUCUUUCUCACGUGGACCUGGUCAAGGACUUGAAUUCAGGCCUCAUUGGAGCCCU



ACUAGUGUGUAGAGAAGGGAGUCUGGCCAAGGAGAAGACACAGACCUUGCACAAAUUUAUACUACUUUUCGCU



GUAUUUGACGAAGGGAAGAGUUGGCACUCAGAAACAAAGAACUCCUUGAUGCAGGAUAGGGACGCUGCAUCUG



CUCGGGCCUGGCCUAAGAUGCACACAGUCAACGGUUACGUAAACAGGUCCCUGCCAGGUCUGAUUGGCUGCCA



CAGGAAAUCAGUCUAUUGGCACGUGAUUGGAAUGGGCACCACUCCUGAAGUGCACUCAAUAUUCCUCGAAGGU



CACACAUUUCUUGUGAGGAACCAUCGCCAGGCGUCCUUGGAAAUCUCGCCAAUAACUUUCCUUACUGCUCAAA



CACUCUUGAUGGACCUUGGACAGUUUCUACUGUCUUGUCAUAUCUCUUCCCACCAACACGACGGCAUGGAAGC



UUACGUCAAAGUAGACAGCUGUCCAGAGGAACCCCAACUACGAAUGAAGAAUAACGAAGAAGCGGAAGACUAC



GACGACGAUCUUACUGAUUCUGAAAUGGACGUGGUCAGGUUUGACGACGACAACUCUCCUUCCUUUAUCCAAA



UUCGCUCAGUUGCCAAGAAGCAUCCUAAGACUUGGGUACAUUACAUUGCUGCUGAAGAGGAGGACUGGGACUA



CGCUCCCUUAGUCCUCGCCCCUGACGACAGAAGUUAUAAGAGUCAAUAUUUGAACAACGGCCCUCAGCGGAUU



GGUAGGAAGUACAAGAAAGUCCGAUUUAUGGCAUACACAGACGAAACCUUUAAGACUCGUGAAGCUAUUCAGC



ACGAAUCAGGAAUCUUGGGACCUUUACUUUACGGGGAAGUUGGAGACACACUGUUGAUUAUAUUUAAGAAUCA



AGCAAGCAGACCAUAUAACAUCUACCCUCACGGAAUCACUGACGUCCGUCCUUUGUAUUCAAGGAGAUUACCC



AAGGGUGUCAAGCAUUUGAAGGAUUUUCCAAUUCUGCCAGGAGAAAUAUUCAAAUAUAAGUGGACAGUGACUG



UAGAAGACGGGCCAACUAAAUCAGAUCCUCGGUGCCUGACCCGCUAUUACUCUAGUUUCGUUAAUAUGGAGAG



AGAUCUAGCUUCAGGACUCAUUGGCCCUCUCCUCAUCUGCUACAAAGAAUCUGUAGAUCAAAGAGGAAACCAG



AUAAUGUCAGACAAGAGGAACGUCAUCCUGUUCAGCGUCUUCGACGAGAACAGGAGCUGGUACCUCACAGAGA



AUAUACAACGCUUUCUCCCCAAUCCAGCUGGAGUGCAGCUUGAGGAUCCAGAGUUCCAAGCCUCCAACAUCAU



GCACAGCAUCAACGGCUACGUGUUCGAUAGUUUGCAGUUGUCAGUUUGUUUGCACGAGGUGGCAUACUGGUAC



AUUCUAAGCAUUGGAGCACAGACUGACUUCCUGAGCGUGUUCUUCAGCGGCUACACCUUCAAACACAAGAUGG



UCUACGAAGACACACUCACCCUAUUCCCAUUCUCAGGAGAAACUGUCUUCAUGUCGAUGGAGAACCCAGGUCU



GUGGAUUCUGGGGUGCCACAACUCAGACUUUCGGAACAGAGGCAUGACCGCCUUACUGAAGGUUUCUAGUUGU



GACAAGAACACUGGUGAUUAUUACGAGGACAGUUACGAAGAUAUUUCAGCAUACUUGCUGAGUAAGAACAACG



CCAUUGAACCAAGAAGCUUCUCCCAGAAUUCAAGACACCCUAGCACUAGGCAGAAGCAAUUUAACGCCACCAC



AAUUCCAGAGAACGACAUAGAGAAGACUGACCCUUGGUUUGCACACAGAACACCUAUGCCUAAGAUACAGAAC



GUCUCCUCUAGUGAUUUGUUGAUGCUCUUGCGACAGAGUCCUACUCCACACGGGCUAUCCUUAUCUGAUCUCC



AAGAAGCCAAAUACGAGACAUUCUCUGACGAUCCAUCACCUGGAGCAAUAGACAGUAAUAACAGCCUGUCUGA



AAUGACACACUUCAGGCCACAGCUCCAUCACAGUGGGGACAUGGUAUUUACCCCUGAGUCAGGCCUCCAAUUA



AGAUUAAACGAGAAACUGGGGACAACUGCAGCAACAGAGUUGAAGAAACUUGAUUUCAAAGUUUCUAGUACAU



CAAAUAACCUGAUCUCCACCAUCCCCAGCGACAAUUUGGCAGCAGGUACUGAUAAUACAAGUUCCUUAGGACC



ACCAAGUAUGCCAGUUCAUUACGAUAGUCAAUUAGAUACCACUCUAUUUGGCAAGAAGUCAUCUCCCCUUACU



GAGUCUGGUGGACCUCUGAGCUUGAGUGAAGAGAACAACGACUCCAAACUGCUGGAAUCCGGCUUAAUGAAUA



GCCAAGAAAGUAGCUGGGGCAAGAACGUAUCGACGCGUCCACCAGUCUUGAAACGCCAUCAACGGGAAAUAAC



UCGUACUACUCUUCAGUCAGAUCAAGAGGAAAUUGACUACGACGAUACCAUAUCAGUUGAAAUGAAGAAGGAA



GAUUUUGACAUUUACGACGAGGACGAGAAUCAGUCACCCCGCAGCUUUCAGAAGAAGACACGACACUAUUUCA



UCGCCGCCGUGGAGAGGCUGUGGGAUUACGGGAUGAGUAGCUCCCCACACGUUCUAAGAAACAGGGCUCAGAG



UGGCAGUGUCCCUCAGUUCAAGAAAGUUGUUUUCCAGGAAUUUACUGACGGCUCCUUUACUCAGCCCUUAUAC



CGUGGAGAACUAAACGAACAUUUGGGACUCCUGGGGCCAUAUAUAAGAGCAGAAGUUGAAGAUAAUAUCAUGG



UAACUUUCAGAAAUCAGGCCUCUCGUCCCUAUUCCUUCUAUUCUAGCCUGAUCAGCUACGAGGAGGACCAGCG



CCAGGGAGCAGAACCUAGAAAGAACUUUGUCAAGCCUAACGAAACCAAGACUUACUUUUGGAAAGUGCAACAU



CAUAUGGCACCCACUAAAGACGAGUUUGACUGCAAAGCCUGGGCUUAUUUCUCUGACGUUGACCUGGAGAAAG



ACGUGCACUCAGGCCUGAUUGGACCCCUUCUGGUCUGCCACACUAACACACUGAACCCUGCUCACGGGAGACA



AGUGACAGUACAGGAAUUUGCUCUGUUCUUCACCAUCUUUGACGAAACCAAGUCCUGGUACUUCACCGAGAAU



AUGGAAAGAAACUGCAGGGCUCCCUGCAAUAUCCAGAUGGAAGAUCCCACUUUUAAAGAGAAUUAUCGCUUCC



ACGCAAUCAACGGCUACAUAAUGGAUACACUACCUGGCUUAGUAAUGGCUCAGGAUCAAAGGAUUAGGUGGUA



UCUGCUCAGCAUGGGCAGCAACGAGAACAUCCAUUCUAUUCAUUUCAGUGGACACGUGUUCACUGUACGGAAG



AAAGAGGAGUAUAAGAUGGCACUGUACAAUCUCUAUCCAGGUGUGUUCGAGACAGUGGAAAUGUUACCAUCCA



AAGCUGGAAUUUGGCGGGUGGAGUGCCUUAUUGGCGAGCAUCUACACGCUGGGAUGAGCACACUGUUCCUGGU



GUACAGCAAUAAGUGUCAGACUCCCCUGGGAAUGGCUUCUGGACACAUUAGAGAUUUUCAGAUUACAGCUUCA



GGACAAUACGGACAGUGGGCCCCAAAGCUGGCCAGACUUCAUUAUUCCGGAUCAAUCAACGCCUGGUCCACCA



AGGAGCCCUUCAGCUGGAUCAAGGUGGAUCUGUUGGCACCAAUGAUUAUUCACGGCAUCAAGACCCAGGGUGC



CCGUCAGAAGUUCUCCAGCCUCUACAUCUCUCAGUUUAUCAUCAUGUAUAGUCUUGACGGGAAGAAGUGGCAG



ACUUAUCGAGGAAAUUCCACUGGAACCUUAAUGGUCUUCUUUGGCAACGUGGAUUCAUCUGGGAUCAAGCACA



AUAUCUUCAACCCUCCAAUUAUUGCUCGAUACAUCCGUUUGCACCCAACUCAUUAUAGCAUUCGCAGCACUCU



UCGCAUGGAGUUGAUGGGCUGUGAUUUAAAUAGUUGCAGCAUGCCAUUGGGAAUGGAGAGUAAAGCAAUAUCA



GACGCACAGAUUACUGCUUCAUCCUACUUUACCAAUAUGUUUGCCACCUGGUCCCCUUCCAAGGCUCGACUUC



ACCUCCAAGGGAGGAGUAACGCCUGGAGGCCUCAGGUGAAUAAUCCGAAGGAGUGGCUGCAAGUGGACUUCCA



GAAGACAAUGAAAGUCACAGGAGUAACUACUCAGGGAGUCAAGUCUCUGCUUACCAGCAUGUACGUGAAGGAG



UUCCUCAUCUCCAGCAGUCAAGACGGCCAUCAGUGGACUCUCUUCUUUCAGAACGGCAAAGUAAAGGUGUUUC



AGGGAAAUCAAGACUCCUUCACACCUGUGGUGAACAGCCUGGACCCACCGUUACUGACUCGCUACCUUCGAAU



UCAUCCGCAGUCCUGGGUGCACCAGAUCGCCCUCAGGAUGGAGGUUCUGGGCUGCGAGGCACAGGACCUCUAC





169
AUGCAAAUAGAGCUCUCCACCUGCUUCUUUCUGUGCCUUUUGCGAUUCUGCUUUAGUGCCACCAGAAGAUACU



ACCUGGGUGCAGUGGAACUGUCCUGGGACUAUAUGCAAAGUGAUCUCGGUGAGCUGCCUGUGGACGCAAGAUU



UCCUCCUAGAGUGCCCAAGUCUUUUCCAUUCAACACCUCAGUCGUGUACAAGAAGACUCUGUUUGUAGAAUUC



ACGGAUCACCUUUUCAACAUCGCUAAGCCAAGGCCACCCUGGAUGGGUCUGCUAGGUCCUACCAUCCAGGCUG



AGGUUUACGAUACAGUGGUCAUUACACUUAAGAACAUGGCUUCCCAUCCUGUCAGUCUUCACGCUGUUGGUGU



AUCCUACUGGAAAGCUUCUGAGGGAGCUGAAUACGACGAUCAGACCAGUCAAAGGGAGAAAGAAGACGAUAAA



GUCUUCCCUGGUGGAAGCCAUACAUACGUCUGGCAGGUCCUGAAAGAGAACGGUCCAAUGGCCUCUGACCCAC



UGUGCCUUACCUACUCAUAUCUUUCUCACGUGGACCUGGUCAAGGACUUGAAUUCAGGCCUCAUUGGAGCCCU



ACUAGUGUGUAGAGAAGGGAGUCUGGCCAAGGAGAAGACACAGACCUUGCACAAAUUUAUACUACUUUUCGCU



GUAUUUGACGAAGGGAAGAGUUGGCACUCAGAAACAAAGAACUCCUUGAUGCAGGAUAGGGACGCUGCAUCUG



CUCGGGCCUGGCCUAAGAUGCACACAGUCAACGGUUACGUAAACAGGUCCCUGCCAGGUCUGAUUGGCUGCCA



CAGGAAAUCAGUCUAUUGGCACGUGAUUGGAAUGGGCACCACUCCUGAAGUGCACUCAAUAUUCCUCGAAGGU



CACACAUUUCUUGUGAGGAACCAUCGCCAGGCGUCCUUGGAAAUCUCGCCAAUAACUUUCCUUACUGCUCAAA



CACUCUUGAUGGACCUUGGACAGUUUCUACUGUCUUGUCAUAUCUCUUCCCACCAACACGACGGCAUGGAAGC



UUACGUCAAAGUAGACAGCUGUCCAGAGGAACCCCAACUACGAAUGAAGAAUAACGAAGAAGCGGAAGACUAC



GACGACGAUCUUACUGAUUCUGAAAUGGACGUGGUCAGGUUUGACGACGACAACUCUCCUUCCUUUAUCCAAA



UUCGCUCAGUUGCCAAGAAGCAUCCUAAGACUUGGGUACAUUACAUUGCUGCUGAAGAGGAGGACUGGGACUA



CGCUCCCUUAGUCCUCGCCCCUGACGACAGAAGUUAUAAGAGUCAAUAUUUGAACAACGGCCCUCAGCGGAUU



GGUAGGAAGUACAAGAAAGUCCGAUUUAUGGCAUACACAGACGAAACCUUUAAGACUCGUGAAGCUAUUCAGC



ACGAAUCAGGAAUCUUGGGACCUUUACUUUACGGGGAAGUUGGAGACACACUGUUGAUUAUAUUUAAGAAUCA



AGCAAGCAGACCAUAUAACAUCUACCCUCACGGAAUCACUGACGUCCGUCCUUUGUAUUCAAGGAGAUUACCC



AAGGGUGUCAAGCAUUUGAAGGAUUUUCCAAUUCUGCCAGGAGAAAUAUUCAAAUAUAAGUGGACAGUGACUG



UAGAAGACGGGCCAACUAAAUCAGAUCCUCGGUGCCUGACCCGCUAUUACUCUAGUUUCGUUAAUAUGGAGAG



AGAUCUAGCUUCAGGACUCAUUGGCCCUCUCCUCAUCUGCUACAAAGAAUCUGUAGAUCAAAGAGGAAACCAG



AUAAUGUCAGACAAGAGGAACGUCAUCCUGUUCAGCGUCUUCGACGAGAACAGGAGCUGGUACCUCACAGAGA



AUAUACAACGCUUUCUCCCCAAUCCAGCUGGAGUGCAGCUUGAGGAUCCAGAGUUCCAAGCCUCCAACAUCAU



GCACAGCAUCAACGGCUACGUGUUCGAUAGUUUGCAGUUGUCAGUUUGUUUGCACGAGGUGGCAUACUGGUAC



AUUCUAAGCAUUGGAGCACAGACUGACUUCCUGAGCGUGUUCUUCAGCGGCUACACCUUCAAACACAAGAUGG



UCUACGAAGACACACUCACCCUAUUCCCAUUCUCAGGAGAAACUGUCUUCAUGUCGAUGGAGAACCCAGGUCU



GUGGAUUCUGGGGUGCCACAACUCAGACUUUCGGAACAGAGGCAUGACCGCCUUACUGAAGGUUUCUAGUUGU



GACAAGAACACUGGUGAUUAUUACGAGGACAGUUACGAAGAUAUUUCAGCAUACUUGCUGAGUAAGAACAACG



CCAUUGAACCAAGAAGCUUCUCCCAGAACCCACCAGUCUUGAAACGCCAUCAACGGGAAAUAACUCGUACUAC



UCUUCAGUCAGAUCAAGAGGAAAUUGACUACGACGAUACCAUAUCAGUUGAAAUGAAGAAGGAAGAUUUUGAC



AUUUACGACGAGGACGAGAAUCAGUCACCCCGCAGCUUUCAGAAGAAGACACGACACUAUUUCAUCGCCGCCG



UGGAGAGGCUGUGGGAUUACGGGAUGAGUAGCUCCCCACACGUUCUAAGAAACAGGGCUCAGAGUGGCAGUGU



CCCUCAGUUCAAGAAAGUUGUUUUCCAGGAAUUUACUGACGGCUCCUUUACUCAGCCCUUAUACCGUGGAGAA



CUAAACGAACAUUUGGGACUCCUGGGGCCAUAUAUAAGAGCAGAAGUUGAAGAUAAUAUCAUGGUAACUUUCA



GAAAUCAGGCCUCUCGUCCCUAUUCCUUCUAUUCUAGCCUGAUCAGCUACGAGGAGGACCAGCGCCAGGGAGC



AGAACCUAGAAAGAACUUUGUCAAGCCUAACGAAACCAAGACUUACUUUUGGAAAGUGCAACAUCAUAUGGCA



CCCACUAAAGACGAGUUUGACUGCAAAGCCUGGGCUUAUUUCUCUGACGUUGACCUGGAGAAAGACGUGCACU



CAGGCCUGAUUGGACCCCUUCUGGUCUGCCACACUAACACACUGAACCCUGCUCACGGGAGACAAGUGACAGU



ACAGGAAUUUGCUCUGUUCUUCACCAUCUUUGACGAAACCAAGUCCUGGUACUUCACCGAGAAUAUGGAAAGA



AACUGCAGGGCUCCCUGCAAUAUCCAGAUGGAAGAUCCCACUUUUAAAGAGAAUUAUCGCUUCCACGCAAUCA



ACGGCUACAUAAUGGAUACACUACCUGGCUUAGUAAUGGCUCAGGAUCAAAGGAUUAGGUGGUAUCUGCUCAG



CAUGGGCAGCAACGAGAACAUCCAUUCUAUUCAUUUCAGUGGACACGUGUUCACUGUACGGAAGAAAGAGGAG



UAUAAGAUGGCACUGUACAAUCUCUAUCCAGGUGUGUUCGAGACAGUGGAAAUGUUACCAUCCAAAGCUGGAA



UUUGGCGGGUGGAGUGCCUUAUUGGCGAGCAUCUACACGCUGGGAUGAGCACACUGUUCCUGGUGUACAGCAA



UAAGUGUCAGACUCCCCUGGGAAUGGCUUCUGGACACAUUAGAGAUUUUCAGAUUACAGCUUCAGGACAAUAC



GGACAGUGGGCCCCAAAGCUGGCCAGACUUCAUUAUUCCGGAUCAAUCAACGCCUGGUCCACCAAGGAGCCCU



UCAGCUGGAUCAAGGUGGAUCUGUUGGCACCAAUGAUUAUUCACGGCAUCAAGACCCAGGGUGCCCGUCAGAA



GUUCUCCAGCCUCUACAUCUCUCAGUUUAUCAUCAUGUAUAGUCUUGACGGGAAGAAGUGGCAGACUUAUCGA



GGAAAUUCCACUGGAACCUUAAUGGUCUUCUUUGGCAACGUGGAUUCAUCUGGGAUCAAGCACAAUAUCUUCA



ACCCUCCAAUUAUUGCUCGAUACAUCCGUUUGCACCCAACUCAUUAUAGCAUUCGCAGCACUCUUCGCAUGGA



GUUGAUGGGCUGUGAUUUAAAUAGUUGCAGCAUGCCAUUGGGAAUGGAGAGUAAAGCAAUAUCAGACGCACAG



AUUACUGCUUCAUCCUACUUUACCAAUAUGUUUGCCACCUGGUCCCCUUCCAAGGCUCGACUUCACCUCCAAG



GGAGGAGUAACGCCUGGAGGCCUCAGGUGAAUAAUCCGAAGGAGUGGCUGCAAGUGGACUUCCAGAAGACAAU



GAAAGUCACAGGAGUAACUACUCAGGGAGUCAAGUCUCUGCUUACCAGCAUGUACGUGAAGGAGUUCCUCAUC



UCCAGCAGUCAAGACGGCCAUCAGUGGACUCUCUUCUUUCAGAACGGCAAAGUAAAGGUGUUUCAGGGAAAUC



AAGACUCCUUCACACCUGUGGUGAACAGCCUGGACCCACCGUUACUGACUCGCUACCUUCGAAUUCAUCCGCA



GUCCUGGGUGCACCAGAUCGCCCUCAGGAUGGAGGUUCUGGGCUGCGAGGCACAGGACCUCUAC





170
AUGGAAGAUGCGAAGAACAUCAAGAAGGGACCUGCCCCGUUUUACCCUUUGGAGGACGGUACAGCAGGAGAAC



AGCUCCACAAGGCGAUGAAACGCUACGCCCUGGUCCCCGGAACGAUUGCGUUUACCGAUGCACAUAUUGAGGU



AGACAUCACAUACGCAGAAUACUUCGAAAUGUCGGUGAGGCUGGCGGAAGCGAUGAAGAGAUAUGGUCUUAAC



ACUAAUCACCGCAUCGUGGUGUGUUCGGAGAACUCAUUGCAGUUUUUCAUGCCGGUCCUUGGAGCACUUUUCA



UCGGGGUCGCAGUCGCGCCAGCGAACGACAUCUACAAUGAGCGGGAACUCUUGAAUAGCAUGGGAAUCUCCCA



GCCGACGGUCGUGUUUGUCUCCAAAAAGGGGCUGCAGAAAAUCCUCAACGUGCAGAAGAAGCUCCCCAUUAUU



CAAAAGAUCAUCAUUAUGGAUAGCAAGACAGAUUACCAAGGGUUCCAGUCGAUGUAUACCUUUGUGACAUCGC



AUUUGCCGCCAGGGUUUAACGAGUAUGACUUCGUCCCCGAGUCAUUUGACAGAGAUAAAACCAUCGCGCUGAU



UAUGAAUUCCUCGGGUAGCACCGGUUUGCCAAAGGGGGUGGCGUUGCCCCACCGCACUGCUUGUGUGCGGUUC



UCGCACGCUAGGGAUCCUAUCUUUGGUAAUCAGAUCAUUCCCGACACAGCAAUCCUGUCCGUGGUACCUUUUC



AUCACGGUUUUGGCAUGUUCACGACUCUCGGCUAUUUGAUUUGCGGUUUCAGGGUCGUACUUAUGUAUCGGUU



CGAGGAAGAACUGUUUUUGAGAUCCUUGCAAGAUUACAAGAUCCAGUCGGCCCUCCUUGUGCCAACGCUUUUC



UCAUUCUUUGCGAAAUCGACACUUAUUGAUAAGUAUGACCUUUCCAAUCUGCAUGAGAUUGCCUCAGGGGGAG



CGCCGCUUAGCAAGGAAGUCGGGGAGGCAGUGGCCAAGCGCUUCCACCUUCCCGGAAUUCGGCAGGGAUACGG



GCUCACGGAGACAACAUCCGCGAUCCUUAUCACGCCCGAGGGUGACGAUAAGCCGGGAGCCGUCGGAAAAGUG



GUCCCCUUCUUUGAAGCCAAGGUCGUAGACCUCGACACGGGAAAAACCCUCGGAGUGAACCAGAGGGGCGAGC



UCUGCGUGAGAGGGCCGAUGAUCAUGUCAGGUUACGUGAAUAACCCUGAAGCGACGAAUGCGCUGAUCGACAA



GGAUGGGUGGUUGCAUUCGGGAGACAUUGCCUAUUGGGAUGAGGAUGAGCACUUCUUUAUCGUAGAUCGACUU



AAGAGCUUGAUCAAAUACAAAGGCUAUCAGGUAGCGCCUGCCGAGCUCGAGUCAAUCCUGCUCCAGCACCCCA



ACAUUUUCGACGCCGGAGUGGCCGGGUUGCCCGAUGACGACGCGGGUGAGCUGCCAGCGGCCGUGGUAGUCCU



CGAACAUGGGAAAACAAUGACCGAAAAGGAGAUCGUGGACUACGUAGCAUCACAAGUGACGACUGCGAAGAAA



CUGAGGGGAGGGGUAGUCUUUGUGGACGAGGUCCCGAAAGGCUUGACUGGGAAGCUUGACGCUCGCAAAAUCC



GGGAAAUCCUGAUUAAGGCAAAGAAAGGCGGGAAAAUCGCUGUC
















TABLE 13







Amino Acid Sequences of Constructs








SEQ ID



NO
Amino Acid Sequence





147
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLFCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSSTESGRLFKGKRAHGPALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLI



ENSPSVWQNILESDTEFKKVTPLIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIP



PDAQNPDMSFFKMLFLPESARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKV



VVGKGEFTKDVGLKEMVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENVVLPQIH



TVTGTKNFMKNLFLLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEG



LGNQTKQIVEKYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNM



KHLTPSTLTQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNS



SHLPAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN



TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANRPG



KVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACESN



HAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMK



KEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQE



FTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPR



KNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPA



HGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPG



LVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGI



WRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSI



NAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLM



VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQIT



ASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLT



SMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIA



LRMEVLGCEAQDLY





148
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSSTESGRLFKGKRAHGPALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLI



ENSPSVWQNILESDTEFKKVTPLIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIP



PDAQNPDMSFFKMLFLPESARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKV



VVGKGEFTKDVGLKEMVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENVVLPQIH



TVTGTKNFMKNLFLLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEG



LGNQTKQIVEKYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNM



KHLTPSTLTQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNS



SHLPAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN



TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANRPG



KVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACESN



HAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMK



KEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQE



FTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPR



KNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPA



HGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPG



LVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGI



WRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSI



NAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLM



VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQIT



ASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLT



SMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIA



LRMEVLGCEAQDLY





149
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSSQREITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAA



VERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAE



VEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEF



DCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTEN



MERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFS



GHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQ



TPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQ



GARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPT



HYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNA



WRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKV



KVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY





150
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSSQREITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAA



VERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAE



VEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEF



DCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTEN



MERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFS



GHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQ



TPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQ



GARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPT



HYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNA



WRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKV



KVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY





151
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSSTESGRLFKGKRAHGPALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLI



ENSPSVWQNILESDTEFKKVTPLIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIP



PDAQNPDMSFFKMLFLPESARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKV



VVGKGEFTKDVGLKEMVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENVVLPQIH



TVTGTKNFMKNLFLLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEG



LGNQTKQIVEKYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNM



KHLTPSTLTQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNS



SHLPAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN



TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANRPG



KVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACESN



HAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMK



KEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQE



FTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPR



KNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPA



HGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPG



LVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGI



WRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSI



NAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLM



VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQIT



ASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLT



SMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIA



LRMEVLGCEAQDLY





152
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSSTESGRLFKGKRAHGPALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLI



ENSPSVWQNILESDTEFKKVTPLIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIP



PDAQNPDMSFFKMLFLPESARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKV



VVGKGEFTKDVGLKEMVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENVVLPQIH



TVTGTKNFMKNLFLLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEG



LGNQTKQIVEKYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNM



KHLTPSTLTQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNS



SHLPAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN



TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANRPG



KVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACESN



HAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMK



KEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQE



FTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPR



KNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPA



HGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPG



LVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGI



WRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSI



NAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLM



VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQIT



ASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLT



SMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIA



LRMEVLGCEAQDLY





153
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSSTESGRLFKGKRAHGPALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLI



ENSPSVWQNILESDTEFKKVTPLIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIP



PDAQNPDMSFFKMLFLPESARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKV



VVGKGEFTKDVGLKEMVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENVVLPQIH



TVTGTKNFMKNLFLLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEG



LGNQTKQIVEKYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNM



KHLTPSTLTQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNS



SHLPAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN



TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANRPG



KVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACESN



HAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMK



KEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQE



FTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPR



KNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPA



HGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPG



LVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGI



WRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSI



NAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLM



VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQIT



ASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLT



SMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIA



LRMEVLGCEAQDLY





154
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSSTESGRLFKGKRAHGPALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLI



ENSPSVWQNILESDTEFKKVTPLIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIP



PDAQNPDMSFFKMLFLPESARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKV



VVGKGEFTKDVGLKEMVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENVVLPQIH



TVTGTKNFMKNLFLLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEG



LGNQTKQIVEKYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNM



KHLTPSTLTQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNS



SHLPAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN



TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANRPG



KVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACESN



HAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMK



KEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQE



FTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPR



KNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPA



HGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPG



LVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGI



WRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSI



NAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLM



VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQIT



ASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLT



SMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIA



LRMEVLGCEAQDLY





155
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSL SEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSSTESGRLFKGKRAHGPALLTKDNALFKVSISLLKTNKTSNNSATNRKTHIDGPSLLI



ENSPSVWQNILESDTEFKKVTPLIHDRMLMDKNATALRLNHMSNKTTSSKNMEMVQQKKEGPIP



PDAQNPDMSFFKMLFLPESARWIQRTHGKNSLNSGQGPSPKQLVSLGPEKSVEGQNFLSEKNKV



VVGKGEFTKDVGLKEMVFPSSRNLFLTNLDNLHENNTHNQEKKIQEEIEKKETLIQENVVLPQIH



TVTGTKNFMKNLFLLSTRQNVEGSYDGAYAPVLQDFRSLNDSTNRTKKHTAHFSKKGEEENLEG



LGNQTKQIVEKYACTTRISPNTSQQNFVTQRSKRALKQFRLPLEETELEKRIIVDDTSTQWSKNM



KHLTPSTLTQIDYNEKEKGAITQSPLSDCLTRSHSIPQANRSPLPIAKVSSFPSIRPIYLTRVLFQDNS



SHLPAASYRKKDSGVQESSHFLQGAKKNNLSLAILTLEMTGDQREVGSLGTSATNSVTYKKVEN



TVLPKPDLPKTSGKVELLPKVHIYQKDLFPTETSNGSPGHLDLVEGSLLQGTEGAIKWNEANRPG



KVPFLRVATESSAKTPSKLLDPLAWDNHYGTQIPKEEWKSQEKSPEKTAFKKKDTILSLNACESN



HAIAAINEGQNKPEIEVTWAKQGRTERLCSQNPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMK



KEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQE



FTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPR



KNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPA



HGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPG



LVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGI



WRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSI



NAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLM



VFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQIT



ASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLT



SMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIA



LRMEVLGCEAQDLY





156
MRAPTVYPVLLFLWFTGAICDIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPK



LLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEIKGGGG



SGGGGSGGGGSEVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRGLESVAYITS



SSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWGQGTMVTVSS



PRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDNK



EVHTAWTQPREAQYNSTFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQTP



QVYTIPPPREQMSKKKVSLTCLVTNFFSEATSVEWERNGELEQDYKNTPPILDSDGTYFLYSKLTV



DTDSWLQGEIFTCSVVHEALHNHHTQKNLSRSPGKDYKDDDDK





157
MNSGLQLVFFVLTLKGIQGEVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRG



LESVAYITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWG



QGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKP



GKAPKLLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEI



KPRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDN



KEVHTAWTQPREAQYNSIFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQT



PQVYTIPPPREQMSKKKVSLTCLVTNFFSEATSVEWERNGELEQDYKNTPPILDSDGTYFLYSKLT



VDTDSWLQGEIFTCSVVHEALHNHHTQKNLSRSPGKDYKDDDDK





158
MRAPTVYPVLLFLWFTGAICDIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPK



LLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEIKGGGG



SGGGGSGGGGSEVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRGLESVAYITS



SSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWGQGTMVTVSS



PRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDNK



EVHTAWTQPREAQYNSTFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQTP



QVYTIPPPREQMSKKKVSLTCLVTNFFSEATSVEWERNGELEQDYKNTPPILDSDGTYFLYSKLTV



DTDSWLQGEIFTCSVVHEALHNHHTQKNLSRSPGKDYKDDDDK





159
MNSGLQLVFFVLTLKGIQGEVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRG



LESVAYITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWG



QGTMVTVSSGGGGSGGGGSGGGGSDIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKP



GKAPKLLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEI



KPRIPKPSTPPGSSCPPGNILGGPSVFIFPPKPKDALMISLTPKVTCVVVDVSEDDPDVHVSWFVDN



KEVHTAWTQPREAQYNSIFRVVSALPIQHQDWMRGKEFKCKVNNKALPAPIERTISKPKGRAQT



PQVYTIPPPREQMSKKKVSLTCLVTNFFSEATSVEWERNGELEQDYKNTPPILDSDGTYFLYSKLT



VDTDSWLQGEIFTCSVVHEALHNHHTQKNLSRSPGKDYKDDDDK





160
MNSGLQLVFFVLTLKGIQGEVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRG



LESVAYITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWG



QGTMVTVSSAPSVYPLVPGCGDTSGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQS



GFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPRIPKPSTPPGSSCPPDYKDDDDK





161
MRAPTVYPVLLFLWFTGAICDIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPK



LLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEIKRADA



APTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS



STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGKPIPNPLLGLDST





162
MRAPTVYPVLLFLWFTGAICDIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPK



LLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEIKRADA



APTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMS



STLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNECGKPIPNPLLGLDST





163
MNSGLQLVFFVLTLKGIQGEVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRG



LESVAYITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWG



QGTMVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPA



VLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPP



KPKDVLTITLTPKVTCVVVAISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMH



QDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPE



DITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHT



EKSLSHSPGKDYKDDDDK





164
MNSGLQLVFFVLTLKGIQGEVQLVESGGGLVQPGKSLKLSCEASGFTFSGYGMHWVRQAPGRG



LESVAYITSSSINIKYADAVKGRFTVSRDNAKNLLFLQMNILKSEDTAMYYCARFDWDKNYWG



QGTMVTVSSAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPA



VLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPRDCGCKPCICTVPEVSSVFIFPP



KPKDVLTITLTPKVTCVVVAISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSVSELPIMH



QDWLNGKEFKCRVNSAAFPAPIEKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPE



DITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHT



EKSLSHSPGKDYKDDDDK





165
MRAPTVYPVLLFLWFTGAICDIQMTQSPSSLPASLGDRVTINCQASQDISNYLNWYQQKPGKAPK



LLIYYTNKLADGVPSRFSGSGSGRDSSFTISSLESEDIGSYYCQQYYNYPWTFGPGTKLEIKRADA



KPTVSIFPPSSEQLGTGSATLVCFVNNFYPKDINVKWKVDGSEKRDGVLQSVTDQDSKDSTYSLS



STLSLTKADYERHNLYTCEVTHKTSTAAIVKTLNRNECGKPIPNPLLGLDST





171
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ES SWGKNVSTREITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAAV



ERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEV



EDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFD



CKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENM



ERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSG



HVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTP



LGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGA



RQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHY



SIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWR



PQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVF



QGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY





172
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNSRHPSTRQKQFNA



TTIPENDIEKTDPWFAHRTPMPKIQNVSSSDLLMLLRQSPTPHGLSLSDLQEAKYETFSDDPSPGAI



DSNNSLSEMTHFRPQLHHSGDMVFTPESGLQLRLNEKLGTTAATELKKLDFKVSSTSNNLISTIPS



DNLAAGTDNTSSLGPPSMPVHYDSQLDTTLFGKKSSPLTESGGPLSLSEENNDSKLLESGLMNSQ



ESSWGKNVSTRPPVLKRHQREITRTTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKK



TRHYFIAAVERLWDYGMSSSPHVLRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGL



LGPYIRAEVEDNIMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHH



MAPTKDEFDCKAWAYFSDVDLEKDVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDET



KSWYFTENMERNCRAPCNIQMEDPTFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGS



NENIHSIHFSGHVFTVRKKEEYKMALYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLF



LVYSNKCQTPLGMASGHIRDFQITASGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAP



MIIHGIKTQGARQKFSSLYISQFIIMYSLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPII



ARYIRLHPTHYSIRSTLRMELMGCDLNSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARL



HLQGRSNAWRPQVNNPKEWLQVDFQKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWT



LFFQNGKVKVFQGNQDSFTPVVNSLDPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY





173
MQIELSTCFFLCLLRFCFSATRRYYLGAVELSWDYMQSDLGELPVDARFPPRVPKSFPFNTSVVY



KKTLFVEFTDHLFNIAKPRPPWMGLLGPTIQAEVYDTVVITLKNMASHPVSLHAVGVSYWKASE



GAEYDDQTSQREKEDDKVFPGGSHTYVWQVLKENGPMASDPLCLTYSYLSHVDLVKDLNSGLI



GALLVCREGSLAKEKTQTLHKFILLFAVFDEGKSWHSETKNSLMQDRDAASARAWPKMHTVNG



YVNRSLPGLIGCHRKSVYWHVIGMGTTPEVHSIFLEGHTFLVRNHRQASLEISPITFLTAQTLLMD



LGQFLLSCHISSHQHDGMEAYVKVDSCPEEPQLRMKNNEEAEDYDDDLTDSEMDVVRFDDDNS



PSFIQIRSVAKKHPKTWVHYIAAEEEDWDYAPLVLAPDDRSYKSQYLNNGPQRIGRKYKKVRFM



AYTDETFKTREAIQHESGILGPLLYGEVGDTLLIIFKNQASRPYNIYPHGITDVRPLYSRRLPKGVK



HLKDFPILPGEIFKYKWTVTVEDGPTKSDPRCLTRYYSSFVNMERDLASGLIGPLLICYKESVDQR



GNQIMSDKRNVILFSVFDENRSWYLTENIQRFLPNPAGVQLEDPEFQASNIMHSINGYVFDSLQLS



VCLHEVAYWYILSIGAQTDFLSVFFSGYTFKHKMVYEDTLTLFPFSGETVFMSMENPGLWILGCH



NSDFRNRGMTALLKVSSCDKNTGDYYEDSYEDISAYLLSKNNAIEPRSFSQNPPVLKRHQREITR



TTLQSDQEEIDYDDTISVEMKKEDFDIYDEDENQSPRSFQKKTRHYFIAAVERLWDYGMSSSPHV



LRNRAQSGSVPQFKKVVFQEFTDGSFTQPLYRGELNEHLGLLGPYIRAEVEDNIMVTFRNQASRP



YSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQHHMAPTKDEFDCKAWAYFSDVDLEK



DVHSGLIGPLLVCHTNTLNPAHGRQVTVQEFALFFTIFDETKSWYFTENMERNCRAPCNIQMEDP



TFKENYRFHAINGYIMDTLPGLVMAQDQRIRWYLLSMGSNENIHSIHFSGHVFTVRKKEEYKMA



LYNLYPGVFETVEMLPSKAGIWRVECLIGEHLHAGMSTLFLVYSNKCQTPLGMASGHIRDFQITA



SGQYGQWAPKLARLHYSGSINAWSTKEPFSWIKVDLLAPMIIHGIKTQGARQKFSSLYISQFIIMY



SLDGKKWQTYRGNSTGTLMVFFGNVDSSGIKHNIFNPPIIARYIRLHPTHYSIRSTLRMELMGCDL



NSCSMPLGMESKAISDAQITASSYFTNMFATWSPSKARLHLQGRSNAWRPQVNNPKEWLQVDF



QKTMKVTGVTTQGVKSLLTSMYVKEFLISSSQDGHQWTLFFQNGKVKVFQGNQDSFTPVVNSL



DPPLLTRYLRIHPQSWVHQIALRMEVLGCEAQDLY





174
MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVDITYAEYFEMSVRLA



EAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMGISQPTVVFVS



KKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEYDFVPESFDRDKTIALIM



NSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSVVPFHHGFGMFTTLGYLICGFRVV



LMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGAPLSKEVGEAVAK



RFHLPGIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRG



PMIMSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILL



QHPNIFDAGVAGLPDDDAGELPAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEV



PKGLTGKLDARKIREILIKAKKGGKIAV
















TABLE 14







5′ UTRs of Constructs








SEQ ID



NO
5′ UTR





125
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAA



GAGCCACC





126
GGGAAAUAAGAGAGAAAAGAAGAGUAAGAAGAAAUAUAA



GACCCCGGCGCCGCCACC
















TABLE 15







3′ UTRs of Constructs








SEQ ID



NO
3′ UTR





146
UGAUAAUAGGCUGGAGCCUCGGUGGCCUAGCUUCUUGCC



CCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCAC



CCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCG



GC





175
UGAUAAUAGGCUGGAGCCUCGGUGGCCAUGCUUCUUGCC



CCUUGGGCCUCCCCCCAGCCCCUCCUCCCCUUCCUGCAC



CCGUACCCCCGUGGUCUUUGAAUAAAGUCUGAGUGGGCG



GC
















TABLE 16







mRNA Construct Sequences


By “G5” is meant that all uracils (U) in the mRNA are replaced by N1-methylpseudouracils.













ORF of mRNA

Amino Acid


Name
5′ UTR
Construct
3′ UTR
Sequence





F8FL_01-01_mod
SEQ ID
SEQ ID
SEQ ID
SEQ ID


(“F8-FL” as used in
NO: 125
NO: 127
NO: 146
NO: 147


Examples)






Cap: C1






Poly A tail: 100 nt






(G5)






F8FL_02-01_mod
SEQ ID
SEQ ID
SEQ ID
SEQ ID


(“F8-FL-F309S”
NO: 126
NO: 128
NO: 146
NO: 148


as used in Examples)






Cap: C1






Poly A tail: 100 nt






(G5)






F8N6_03-01_mod
SEQ ID
SEQ ID
SEQ ID
SEQ ID


(“F8-N6-SQR-F309S”
NO: 126
NO: 129
NO: 146
NO: 149


as used in Examples)






Cap: C1






Poly A tail: 100 nt






(G5)






F8N6_03-01_SE
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 126
NO: 130
NO: 146
NO: 150


Poly A tail: 100 nt






(G5)






F8FL_SE_02_01
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 126
NO: 131
NO: 146
NO: 151


Poly A tail: 100 nt






(G5)






F8FL_SE_04_01
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 126
NO: 132
NO: 146
NO: 152


Poly A tail: 100 nt






(G5)






F8FL_SE_06_01
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 126
NO: 133
NO: 146
NO: 153


Poly A tail: 100 nt






(G5)






F8FL_SE_03_01
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 126
NO: 134
NO: 146
NO: 154


Poly A tail: 100 nt






(G5)






F8FL_SE_05_01
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 126
NO: 135
NO: 146
NO: 155


Poly A tail: 100 nt






(G5)






m.aCD3e_scFv_02-01_CO3
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 125
NO: 136
NO: 146
NO: 156


Poly A tail: 100 nt






(G5)






m.aCD3e_scFv_01-01_CO3
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 125
NO: 137
NO: 146
NO: 157


Poly A tail: 100 nt






(G5)






m.aCD3e_scFv_02-01_SE
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 125
NO: 138
NO: 146
NO: 158


Poly A tail: 100 nt






(G5)






m.aCD3e_scFv_01-01_SE
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 125
NO: 139
NO: 146
NO: 159


Poly A tail: 100 nt






(G5)






m.aCD3e(Fab′)2_HC_01-
SEQ ID
SEQ ID
SEQ ID
SEQ ID


01_CO3
NO: 125
NO: 140
NO: 146
NO: 160


Cap: C1






Poly A tail: 100 nt






(G5)






m.aCD3e_mAb.LC_01-
SEQ ID
SEQ ID
SEQ ID
SEQ ID


01_CO3
NO: 125
NO: 141
NO: 146
NO: 161


Cap: C1






Poly A tail: 100 nt






(G5)






m.aCD3e_mAb.LC_02-
SEQ ID
SEQ ID
SEQ ID
SEQ ID


01_dvr
NO: 125
NO: 142
NO: 146
NO: 162


Cap: C1






Poly A tail: 100 nt






(G5)






m.aCD3e_mAb.HC_01-
SEQ ID
SEQ ID
SEQ ID
SEQ ID


01_CO3
NO: 125
NO: 143
NO: 146
NO: 163


Cap: C1






Poly A tail: 100 nt






(G5)






m.aCD3e_mAb.HC_02-
SEQ ID
SEQ ID
SEQ ID
SEQ ID


01_dvr
NO: 125
NO: 144
NO: 146
NO: 164


Cap: C1






Poly A tail: 100 nt






(G5)






m.aCD3e(Fab′)2_LC_01-
SEQ ID
SEQ ID
SEQ ID
SEQ ID


01_CO3
NO: 125
NO: 145
NO: 146
NO: 165


Cap: C1






Poly A tail: 100 nt






(G5)






F8FL_01-01_SE
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 125
NO: 166
NO: 146
NO: 147


Poly A tail: 100 nt






(G5)






F8N6_04-01_mod
SEQ ID
SEQ ID
SEQ ID
SEQ ID


(“F8-N6-TR-F309S”
NO: 126
NO: 167
NO: 146
NO: 171


as used in Examples)






Cap: Cl






PolyA tail: 100 nt






(G5)






F8N6_05-01_mod
SEQ ID
SEQ ID
SEQ ID
SEQ ID


(“F8-N6C-TR-F309S”
NO: 126
NO: 168
NO: 146
NO: 172


as used in Examples)






Cap: C1






Poly A tail: 100 nt






(G5)






F8BDD_01-01_mod
SEQ ID
SEQ ID
SEQ ID
SEQ ID


Cap: C1
NO: 126
NO: 169
NO: 146
NO: 173


Poly A tail: 100 nt






(G5)






Luciferase-for-PA
SEQ ID
SEQ ID
SEQ ID
SEQ ID


(“Luciferase as used in
NO: 125
NO: 170
NO: 175
NO: 174


Examples)






Cap: C1






Poly A tail: 100 nt






(G5)









EXAMPLES
Example 1: Chimeric Polynucleotide Synthesis

Triphosphate Route


Two regions or parts of a chimeric polynucleotide can be joined or ligated using triphosphate chemistry. According to this method, a first region or part of 100 nucleotides or less can be chemically synthesized with a 5′ monophosphate and terminal 3′desOH or blocked OH. If the region is longer than 80 nucleotides, it can be synthesized as two strands for ligation.


If the first region or part is synthesized as a non-positionally modified region or part using in vitro transcription (IVT), conversion the 5′monophosphate with subsequent capping of the 3′ terminus can follow. Monophosphate protecting groups can be selected from any of those known in the art.


The second region or part of the chimeric polynucleotide can be synthesized using either chemical synthesis or IVT methods. IVT methods can include an RNA polymerase that can utilize a primer with a modified cap. Alternatively, a cap of up to 80 nucleotides can be chemically synthesized and coupled to the IVT region or part.


It is noted that for ligation methods, ligation with DNA T4 ligase, followed by treatment with DNAse should readily avoid concatenation.


The entire chimeric polynucleotide need not be manufactured with a phosphate-sugar backbone. If one of the regions or parts encodes a polypeptide, then such region or part can comprise a phosphate-sugar backbone.


Ligation can then be performed using any known click chemistry, orthoclick chemistry, solulink, or other bioconjugate chemistries known to those in the art.


Synthetic Route


The chimeric polynucleotide can be made using a series of starting segments. Such segments include:


(a) Capped and protected 5′ segment comprising a normal 3′OH (SEG. 1)


(b) 5′ triphosphate segment which can include the coding region of a polypeptide and comprising a normal 3′OH (SEG. 2)


(c) 5′ monophosphate segment for the 3′ end of the chimeric polynucleotide (e.g., the tail) comprising cordycepin or no 3′OH (SEG. 3)


After synthesis (chemical or IVT), segment 3 (SEG. 3) can be treated with cordycepin and then with pyrophosphatase to create the 5′monophosphate.


Segment 2 (SEG. 2) can then be ligated to SEG. 3 using RNA ligase. The ligated polynucleotide can then be purified and treated with pyrophosphatase to cleave the diphosphate. The treated SEG.2-SEG. 3 construct is then purified and SEG. 1 is ligated to the 5′ terminus. A further purification step of the chimeric polynucleotide can be performed.


Where the chimeric polynucleotide encodes a polypeptide, the ligated or joined segments can be represented as: 5′UTR (SEG. 1), open reading frame or ORF (SEG. 2) and 3′UTR+PolyA (SEG. 3).


The yields of each step can be as much as 90-95%.


Example 2: PCR for cDNA Production

PCR procedures for the preparation of cDNA can be performed using 2× KAPA HIFI™ HotStart ReadyMix by Kapa Biosystems (Woburn, Mass.). This system includes 2× KAPA ReadyMix12.5 μl; Forward Primer (10 μM) 0.75 μl; Reverse Primer (10 μM) 0.75 μl; Template cDNA −100 ng; and dH20 diluted to 25.0 μl. The PCR reaction conditions can be: at 95° C. for 5 min. and 25 cycles of 98° C. for 20 sec, then 58° C. for 15 sec, then 72° C. for 45 sec, then 72° C. for 5 min. then 4° C. to termination.


The reverse primer of the present disclosure can incorporate a poly-T120 for a poly-A120 in the mRNA. Other reverse primers with longer or shorter poly(T) tracts can be used to adjust the length of the poly(A) tail in the polynucleotide mRNA.


The reaction can be cleaned up using Invitrogen's PURELINK™ PCR Micro Kit (Carlsbad, Calif.) per manufacturer's instructions (up to 5 μg). Larger reactions will require a cleanup using a product with a larger capacity. Following the cleanup, the cDNA can be quantified using the NANODROP™ and analyzed by agarose gel electrophoresis to confirm the cDNA is the expected size. The cDNA can then be submitted for sequencing analysis before proceeding to the in vitro transcription reaction.


Example 3: In Vitro Transcription (IVT)

The in vitro transcription reactions can generate polynucleotides containing uniformly modified polynucleotides. Such uniformly modified polynucleotides can comprise a region or part of the polynucleotides of the present disclosure. The input nucleotide triphosphate (NTP) mix can be made using natural and un-natural NTPs.


A typical in vitro transcription reaction can include the following:


Template cDNA—1.0 μg


10× transcription buffer (400 mM Tris-HCl pH 8.0, 190 mM MgCl2, 50 mM DTT, 10 mM Spermidine)—2.0 μl


Custom NTPs (25 mM each)—7.2 μl


RNase Inhibitor—20 U


T7 RNA polymerase—3000 U


dH20—Up to 20.0 μl and


Incubation at 37° C. for 3 hr-5 hrs.


The crude IVT mix can be stored at 4° C. overnight for cleanup the next day. 1 U of RNase-free DNase can then be used to digest the original template. After 15 minutes of incubation at 37° C., the mRNA can be purified using Ambion's MEGACLEAR™ Kit (Austin, Tex.) following the manufacturer's instructions. This kit can purify up to 500 μg of RNA. Following the cleanup, the RNA can be quantified using the NanoDrop and analyzed by agarose gel electrophoresis to confirm the RNA is the proper size and that no degradation of the RNA has occurred.


Example 4: Enzymatic Capping

Capping of a polynucleotide can be performed with a mixture includes: IVT RNA 60 μg-180 μg and dH20 up to 72 μl. The mixture can be incubated at 65° C. for 5 minutes to denature RNA, and then can be transferred immediately to ice.


The protocol can then involve the mixing of 10× Capping Buffer (0.5 M Tris-HCl (pH 8.0), 60 mM KCl, 12.5 mM MgCl2) (10.0 μl); 20 mM GTP (5.0 μl); 20 mM S-Adenosyl Methionine (2.5 μl); RNase Inhibitor (100 U); 2′-O-Methyltransferase (400U); Vaccinia capping enzyme (Guanylyl transferase) (40 U); dH20 (Up to 28 μl); and incubation at 37° C. for 30 minutes for 60 μg RNA or up to 2 hours for 180 μg of RNA.


The polynucleotide can then be purified using Ambion's MEGACLEAR™ Kit (Austin, Tex.) following the manufacturer's instructions. Following the cleanup, the RNA can be quantified using the NANODROP™ (ThermoFisher, Waltham, Mass.) and analyzed by agarose gel electrophoresis to confirm the RNA is the proper size and that no degradation of the RNA has occurred. The RNA product can also be sequenced by running a reverse-transcription-PCR to generate the cDNA for sequencing.


Example 5: PolyA Tailing Reaction

Without a poly-T in the cDNA, a poly-A tailing reaction must be performed before cleaning the final product. This can be done by mixing Capped IVT RNA (100 μl); RNase Inhibitor (20 U); 10× Tailing Buffer (0.5 M Tris-HCl (pH 8.0), 2.5 M NaCl, 100 mM MgCl2)(12.0 μl); 20 mM ATP (6.0 μl); Poly-A Polymerase (20 U); dH20 up to 123.5 μl and incubating at 37° C. for 30 min. If the poly-A tail is already in the transcript, then the tailing reaction can be skipped and proceed directly to cleanup with Ambion's MEGACLEAR™ kit (Austin, Tex.) (up to 500 μg). Poly-A Polymerase is, in some cases, a recombinant enzyme expressed in yeast.


It should be understood that the processivity or integrity of the polyA tailing reaction does not always result in an exact size polyA tail. Hence polyA tails of approximately between 40-200 nucleotides, e.g., about 40, 50, 60, 70, 80, 90, 91, 92, 93, 94, 95, 96, 97, 98, 99, 100, 101, 102, 103, 104, 105, 106, 107, 108, 109, 110, 150-165, 155, 156, 157, 158, 159, 160, 161, 162, 163, 164 or 165 are within the scope of the present disclosure.


Example 6: Natural 5′ Caps and 5′ Cap Analogues

5′-capping of polynucleotides can be completed concomitantly during the in vitro-transcription reaction using the following chemical RNA cap analogs to generate the 5′-guanosine cap structure according to manufacturer protocols: 3′-O-Me-m7G(5′)ppp(5′) G [the ARCA cap];G(5′)ppp(5′)A; G(5′)ppp(5′)G; m7G(5′)ppp(5′)A; m7G(5′)ppp(5′)G (New England BioLabs, Ipswich, Mass.). 5′-capping of modified RNA can be completed post-transcriptionally using a Vaccinia Virus Capping Enzyme to generate the “Cap 0” structure: m7G(5′)ppp(5′)G (New England BioLabs, Ipswich, Mass.). Cap 1 structure can be generated using both Vaccinia Virus Capping Enzyme and a 2′-O methyl-transferase to generate: m7G(5′)ppp(5′)G-2′-O-methyl. Cap 2 structure can be generated from the Cap 1 structure followed by the 2′-O-methylation of the 5′-antepenultimate nucleotide using a 2′-O methyl-transferase. Cap 3 structure can be generated from the Cap 2 structure followed by the 2′-O-methylation of the 5′-preantepenultimate nucleotide using a 2′-O methyl-transferase. Enzymes can be derived from a recombinant source.


When transfected into mammalian cells, the modified mRNAs can have a stability of between 12-18 hours or more than 18 hours, e.g., 24, 36, 48, 60, 72 or greater than 72 hours.


Example 7: Capping Assays

Protein Expression Assay


Polynucleotides encoding a polypeptide, containing any of the caps taught herein, can be transfected into cells at equal concentrations. After 6, 12, 24 and 36 hours post-transfection, the amount of protein secreted into the culture medium can be assayed by ELISA. Synthetic polynucleotides that secrete higher levels of protein into the medium would correspond to a synthetic polynucleotide with a higher translationally-competent Cap structure.


Purity Analysis Synthesis


Polynucleotides encoding a polypeptide, containing any of the caps taught herein, can be compared for purity using denaturing Agarose-Urea gel electrophoresis or HPLC analysis. Polynucleotides with a single, consolidated band by electrophoresis correspond to the higher purity product compared to polynucleotides with multiple bands or streaking bands. Synthetic polynucleotides with a single HPLC peak would also correspond to a higher purity product. The capping reaction with a higher efficiency would provide a more pure polynucleotide population.


Cytokine Analysis


Polynucleotides encoding a polypeptide, containing any of the caps taught herein, can be transfected into cells at multiple concentrations. After 6, 12, 24 and 36 hours post-transfection the amount of pro-inflammatory cytokines such as TNF-alpha and IFN-beta secreted into the culture medium can be assayed by ELISA. Polynucleotides resulting in the secretion of higher levels of pro-inflammatory cytokines into the medium would correspond to polynucleotides containing an immune-activating cap structure.


Capping Reaction Efficiency


Polynucleotides encoding a polypeptide, containing any of the caps taught herein, can be analyzed for capping reaction efficiency by LC-MS after nuclease treatment. Nuclease treatment of capped polynucleotides would yield a mixture of free nucleotides and the capped 5′-5-triphosphate cap structure detectable by LC-MS. The amount of capped product on the LC-MS spectra can be expressed as a percent of total polynucleotide from the reaction and would correspond to capping reaction efficiency. The cap structure with higher capping reaction efficiency would have a higher amount of capped product by LC-MS.


Example 8: Agarose Gel Electrophoresis of Modified RNA or RT PCR Products

Individual polynucleotides (200-400 ng in a 20 μl volume) or reverse transcribed PCR products (200-400 ng) can be loaded into a well on a non-denaturing 1.2% Agarose E-Gel (Invitrogen, Carlsbad, Calif.) and run for 12-15 minutes according to the manufacturer protocol.


Example 9: Nanodrop Modified RNA Quantification and UV Spectral Data

Modified polynucleotides in TE buffer (1 μl) can be used for Nanodrop UV absorbance readings to quantitate the yield of each polynucleotide from an chemical synthesis or in vitro transcription reaction.


Example 10: Formulation of Modified mRNA Using Lipidoids

Polynucleotides can be formulated for in vitro experiments by mixing the polynucleotides with the lipidoid at a set ratio prior to addition to cells. In vivo formulation can require the addition of extra ingredients to facilitate circulation throughout the body. To test the ability of these lipidoids to form particles suitable for in vivo work, a standard formulation process used for siRNA-lipidoid formulations can be used as a starting point. After formation of the particle, polynucleotide can be added and allowed to integrate with the complex. The encapsulation efficiency can be determined using a standard dye exclusion assays.


Example 11: Synthesis of Compounds According to Formula (X)

A. General Considerations


All solvents and reagents used were obtained commercially and used as such unless noted otherwise. 1H NMR spectra were recorded in CDCl3, at 300 K using a Bruker Ultrashield 300 MHz instrument. Chemical shifts are reported as parts per million (ppm) relative to TMS (0.00) for 1H. Silica gel chromatographies were performed on ISCO CombiFlash Rf+ Lumen Instruments using ISCO RediSep Rf Gold Flash Cartridges (particle size: 20-40 microns). Reverse phase chromatographies were performed on ISCO CombiFlash Rf+ Lumen Instruments using RediSep Rf Gold C18 High Performance columns. All final compounds were determined to be greater than 85% pure via analysis by reverse phase UPLC-MS (retention times, RT, in minutes) using Waters Acquity UPLC instrument with DAD and ELSD and a ZORBAX Rapid Resolution High Definition (RRHD) SB-C18 LC column, 2.1 mm, 50 mm, 1.8 μm, and a gradient of 65 to 100% acetonitrile in water with 0.1% TFA over 5 minutes at 1.2 mL/min. Injection volume was 5 μL and the column temperature was 80° C. Detection was based on electrospray ionization (ESI) in positive mode using Waters SQD mass spectrometer (Milford, Mass., USA) and evaporative light scattering detector.


The representative procedures described below are useful in the synthesis of Compounds 1-232.


The following abbreviations are employed herein:


THF: Tetrahydrofuran


DMAP: 4-Dimethylaminopyridine


LDA: Lithium Diisopropylamide


rt: Room Temperature


DME: 1,2-Dimethoxyethane


n-BuLi: n-Butyllithium


B. Compound 2: Heptadecan-9-yl 8-((2-hydroxyethyl)(tetradecyl)amino)octanoate


Representative Procedure 1:




embedded image


Heptadecan-9-yl 8-bromooctanoate (Method A)



embedded image


To a solution of 8-bromooctanoic acid (1.04 g, 4.6 mmol) and heptadecan-9-ol (1.5 g, 5.8 mmol) in dichloromethane (20 mL) was added N-(3-dimethylaminopropyl)-N-ethylcarbodiimide hydrochloride (1.1 g, 5.8 mmol), N,N-diisopropylethylamine (3.3 mL, 18.7 mmol) and DMAP (114 mg, 0.9 mmol). The reaction was allowed to stir at rt for 18 h. The reaction was diluted with dichloromethane and washed with saturated sodium bicarbonate. The organic layer was separated and washed with brine, and dried over MgSO4. The organic layer was filtered and evaporated in vacuo. The residue was purified by silica gel chromatography (0-10% ethyl acetate in hexanes) to obtain heptadecan-9-yl 8-bromooctanoate (875 mg, 1.9 mmol, 41%).



1H NMR (300 MHz, CDCl3) δ: ppm 4.89 (m, 1H); 3.42 (m, 2H); 2.31 (m, 2H); 1.89 (m, 2H); 1.73-1.18 (br. m, 36H); 0.88 (m, 6H).


Heptadecan-9-yl 8-((2-hydroxyethyl)amino)octanoate (Method B)



embedded image


A solution of heptadecan-9-yl 8-bromooctanoate (3.8 g, 8.2 mmol) and 2-aminoethan-1-ol (15 mL, 248 mmol) in ethanol (3 mL) was allowed to stir at 62° C. for 18 h. The reaction mixture was concentrated in vacuo and the residue was taken-up in ethyl acetate and water. The organic layer was separated and washed with water, brine and dried over Na2SO4. The mixture was filtered and evaporated in vacuo. The residue was purified by silica gel chromatography (0-100% (mixture of 1% NH4OH, 20% MeOH in dichloromethane) in dichloromethane) to obtain heptadecan-9-yl 8-((2-hydroxyethyl)amino)octanoate (3.1 g, 7 mmol, 85%). UPLC/ELSD: RT=2.67 min. MS (ES): m/z (MH+) 442.68 for C27H55NO3



1H NMR (300 MHz, CDCl3) δ: ppm 4.89 (p, 1H); 3.67 (t, 2H); 2.81 (t, 2H); 2.65 (t, 2H); 2.30 (t, 2H); 2.05 (br. m, 2H); 1.72-1.41 (br. m, 8H); 1.40-1.20 (br. m, 30H); 0.88 (m, 6H).


Heptadecan-9-yl 8-yl 8-((2-hydroxyethyl)(tetradecyl)amino)octanoate (Method C)



embedded image


Chemical Formula: C41H83NO3


Molecular Weight: 638.12


A solution of heptadecan-9-yl 8-((2-hydroxyethyl)amino)octanoate (125 mg, 0.28 mmol), 1-bromotetradecane (94 mg, 0.34 mmol) and N,N-diisopropylethylamine (44 mg, 0.34 mmol) in ethanol was allowed to stir at 65° C. for 18 h. The reaction was cooled to rt and solvents were evaporated in vacuo. The residue was taken-up in ethyl acetate and saturated sodium bicarbonate. The organic layer was separated, dried over Na2SO4 and evaporated in vacuo. The residue was purified by silica gel chromatography (0-100% (mixture of 1% NH4OH, 20% MeOH in dichloromethane) in dichloromethane) to obtain heptadecan-9-yl 8-((2-hydroxyethyl)(tetradecyl)amino)octanoate (89 mg, 0.14 mmol, 50%). UPLC/ELSD: RT=3.61 min. MS (ES): m/z (MH+) 638.91 for C41H83NO3. 1H NMR (300 MHz, CDCl3) δ: ppm 4.86 (p, 1H); 3.72-3.47 (br. m, 2H); 2.78-2.40 (br. m, 5H); 2.28 (t, 2H); 1.70-1.40 (m, 10H); 1.38-1.17 (br. m, 54H); 0.88 (m, 9H).


Synthesis of Intermediates:

Intermediate A: 2-Octyldecanoic acid




embedded image


A solution of diisopropylamine (2.92 mL, 20.8 mmol) in THF (10 mL) was cooled to −78° C. and a solution of n-BuLi (7.5 mL, 18.9 mmol, 2.5 M in hexanes) was added. The reaction was allowed to warm to 0° C. To a solution of decanoic acid (2.96 g, 17.2 mmol) and NaH (754 mg, 18.9 mmol, 60% w/w) in THF (20 mL) at 0° C. was added the solution of LDA and the mixture was allowed to stir at rt for 30 min. After this time 1-iodooctane (5 g, 20.8 mmol) was added and the reaction mixture was heated at 45° C. for 6 h. The reaction was quenched with 1N HCl (10 mL). The organic layer was dried over MgSO4, filtered and evaporated in vacuo. The residue was purified by silica gel chromatography (0-20% ethyl acetate in hexanes) to yield 2-octyldecanoic acid (1.9 g, 6.6 mmol, 38%). 1H NMR (300 MHz, CDCl3) δ: ppm 2.38 (br. m, 1H); 1.74-1.03 (br. m, 28H); 0.91 (m, 6H).


Intermediate B: 7-Bromoheptyl 2-octyldecanoate



embedded image


7-bromoheptyl 2-octyldecanoate was synthesized using Method A from 2-octyldecanoic acid and 7-bromoheptan-1-ol. 1H NMR (300 MHz, CDCl3) δ: ppm 4.09 (br. m, 2H); 3.43 (br. m, 2H); 2.48-2.25 (br. m, 1H); 1.89 (br. m, 2H); 1.74-1.16 (br. m, 36H); 0.90 (m, 6H).


Intermediate C: (2-Hexylcyclopropyl)methanol



embedded image


A solution of diethyl zinc (20 mL, 20 mmol, 1 M in hexanes), in dichloromethane (20 mL) was allowed to cool to −40° C. for 5 min. Then a solution of diiodomethane (3.22 mL, 40 mmol) in dichloromethane (10 mL) was added dropwise. After the reaction was allowed to stir for 1 h at −40° C., a solution of trichloro-acetic acid (327 mg, 2 mmol) and DME (1 mL, 9.6 mmol) in dichloromethane (10 mL) was added. The reaction was allowed to warm to −15° C. and stir at this temperature for 1 h. A solution of (Z)-non-2-en-1-ol (1.42 g, 10 mmol) in dichloromethane (10 mL) was then added to the −15° C. solution. The reaction was then slowly allowed to warm to rt and stir for 18 h. After this time saturated NH4Cl (200 mL) was added and the reaction was extracted with dichloromethane (3×), washed with brine, and dried over Na2SO4. The organic layer was filtered, evaporated in vacuo and the residue was purified by silica gel chromatography (0-50% ethyl acetate in hexanes) to yield (2-hexylcyclopropyl)methanol (1.43 g, 9.2 mmol, 92%). 1H NMR (300 MHz, CDCl3) δ: ppm 3.64 (m, 2H); 1.57-1.02 (m, 12H); 0.99-0.80 (m, 4H); 0.72 (m, 1H), 0.00 (m, 1H).


C. Compound 18: Heptadecan-9-yl8-((2-hydroxyethyl)(8-(nonyloxy)-8-oxooctyl)amino)octanoate



embedded image


Chemical Formula: C44H87NO5


Molecular Weight: 710.18


Compound 18 was synthesized according to the general procedure and Representative Procedure 1 described above.


UPLC/ELSD: RT=3.59 min. MS (ES): m/z (MH+) 710.89 for C44H87NO5. 1H NMR (300 MHz, CDCl3) δ: ppm 4.86 (m, 1H); 4.05 (t, 2H); 3.53 (br. m, 2H); 2.83-2.36 (br. m, 5H); 2.29 (m, 4H); 0.96-1.71 (m, 64H); 0.88 (m, 9H).


D. Compound 136: Nonyl 8-((2-hydroxyethyl)((9Z,12Z)-octadeca-9,12-dien-1-yl)amino)octanoate

Representative Procedure 2:


Nonyl 8-bromooctanoate (Method A)



embedded image


To a solution of 8-bromooctanoic acid (5 g, 22 mmol) and nonan-l-ol (6.46 g, 45 mmol) in dichloromethane (100 mL) were added N-(3-Dimethylaminopropyl)-N′-ethylcarbodiimide hydrochloride (4.3 g, 22 mmol) and DMAP (547 mg, 4.5 mmol). The reaction was allowed to stir at rt for 18 h. The reaction was diluted with dichloromethane and washed with saturated sodium bicarbonate. The organic layer was separated and washed with brine, dried over MgSO4. The organic layer was filtered and evaporated under vacuum. The residue was purified by silica gel chromatography (0-10% ethyl acetate in hexanes) to obtain nonyl 8-bromooctanoate (6.1 g, 17 mmol, 77%).



1H NMR (300 MHz, CDCl3) δ: ppm 4.06 (t, 2H); 3.40 (t, 2H); 2.29 (t, 2H); 1.85 (m, 2H); 1.72-0.97 (m, 22H); 0.88 (m, 3H).


Nonyl 8-((2-hydroxyethyl)amino)octanoate



embedded image


A solution of nonyl 8-bromooctanoate (1.2 g, 3.4 mmol) and 2-aminoethan-1-ol (5 mL, 83 mmol) in ethanol (2 mL) was allowed to stir at 62° C. for 18 h. The reaction mixture was concentrated in vacuum and the residue was extracted with ethyl acetate and water. The organic layer was separated and washed with water, brine and dried over Na2SO4. The organic layer was filtered and evaporated in vacuo. The residue was purified by silica gel chromatography (0-100% (mixture of 1% NH4OH, 20% MeOH in dichloromethane) in dichloromethane) to obtain nonyl 8-((2-hydroxyethyl)amino)octanoate (295 mg, 0.9 mmol, 26%).


UPLC/ELSD: RT=1.29 min. MS (ES): m/z (MH+) 330.42 for C19H39NO3



1H NMR (300 MHz, CDCl3) δ: ppm 4.07 (t, 2H); 3.65 (t, 2H); 2.78 (t, 2H); 2.63 (t, 2H); 2.32-2.19 (m, 4H); 1.73-1.20 (m, 24H); 0.89 (m, 3H)


Nonyl 8-((2-hydroxyethyl)((9Z,12Z)-octadeca-9,12-dien-1-yl)amino)octanoate



embedded image


Chemical Formula: C37H71NO3


Molecular Weight: 577.98


A solution of nonyl 8-((2-hydroxyethyl)amino)octanoate (150 mg, 0.46 mmol), (6Z,9Z)-18-bromooctadeca-6,9-diene (165 mg, 0.5 mmol) and N,N-diisopropylethylamine (65 mg, 0.5 mmol) in ethanol (2 mL) was allowed to stir at reflux for 48 h. The reaction was allowed to cool to rt and solvents were evaporated under vacuum. The residue was purified by silica gel chromatography (0-10% MeOH in dichloromethane) to obtain nonyl 8-((2-hydroxyethyl)((9Z,12Z)-octadeca-9,12-dien-1-yl)amino)octanoate (81 mg, 0.14 mmol, 30%) as a HBr salt.


UPLC/ELSD: RT=3.24 min. MS (ES): m/z (MH+) 578.64 for C37H71NO3



1H NMR (300 MHz, CDCl3) δ: ppm 10.71 (br., 1H); 5.36 (br. m, 4H); 4.04 (m, 4H); 3.22-2.96 (br. m, 5H); 2.77 (m, 2H); 2.29 (m, 2H); 2.04 (br. m, 4H); 1.86 (br. m, 4H); 1.66-1.17 (br. m, 40H); 0.89 (m, 6H)


E. Compound 138: Dinonyl 8,8′-((2-hydroxyethyl)azanediyl)dioctanoate

Representative Procedure 3:


Dinonyl 8,8′-((2-hydroxyethyl)azanediyl)dioctanoate



embedded image


Chemical Formula: C36H71NO5


Molecular Weight: 597.97


A solution of nonyl 8-bromooctanoate (200 mg, 0.6 mmol) and 2-aminoethan-1-ol (16 mg, 0.3 mmol) and N,N-diisopropylethylamine (74 mg, 0.6 mmol) in THF/CH3CN (1:1) (3 mL) was allowed to stir at 63° C. for 72 h. The reaction was cooled to rt and solvents were evaporated under vacuum. The residue was extracted with ethyl acetate and saturated sodium bicarbonate. The organic layer was separated, dried over Na2SO4 and evaporated under vacuum. The residue was purified by silica gel chromatography (0-10% MeOH in dichloromethane) to obtain dinonyl 8,8′-((2-hydroxyethyl)azanediyl)dioctanoate (80 mg, 0.13 mmol, 43%).


UPLC/ELSD: RT=3.09 min. MS (ES): m/z (MH+) 598.85 for C36H71NO5



1H NMR (300 MHz, CDCl3) δ: ppm 4.05 (m, 4H); 3.57 (br. m, 2H); 2.71-2.38 (br. m, 6H); 2.29 (m, 4H), 1.71-1.01 (br. m, 49H), 0.88 (m, 6H).


All other compounds of Formula (X) of this disclosure can be obtained by a method analogous to Representative Procedures 1-3 as described above.


Example 12: Production of Nanoparticle Compositions

A. Production of Nanoparticle Compositions


Nanoparticles can be made with mixing processes such as microfluidics and T-junction mixing of two fluid streams, one of which contains the polynucleotide and the other has the lipid components.


Lipid compositions are prepared by combining a lipid according to Formula (X), a phospholipid (such as DOPE or DSPC, obtainable from Avanti Polar Lipids, Alabaster, Ala.), a PEG lipid (such as 1,2-dimyristoyl-sn-glycerol methoxypolyethylene glycol, also known as PEG-DMG, obtainable from Avanti Polar Lipids, Alabaster, Ala.), and a structural lipid (such as cholesterol, obtainable from Sigma-Aldrich, Taufkirchen, Germany, or a corticosteroid (such as prednisolone, dexamethasone, prednisone, and hydrocortisone), or a combination thereof) at concentrations of about 50 mM in ethanol. Solutions should be refrigerated for storage at, for example, −20° C. Lipids are combined to yield desired molar ratios and diluted with water and ethanol to a final lipid concentration of between about 5.5 mM and about 25 mM.


Nanoparticle compositions including a polynucleotide and a lipid composition are prepared by combining the lipid solution with a solution including the a polynucleotide at lipid composition to polynucleotide wt:wt ratios between about 5:1 and about 50:1. The lipid solution is rapidly injected using a NanoAssemblr microfluidic based system at flow rates between about 10 ml/min and about 18 ml/min into the polynucleotide solution to produce a suspension with a water to ethanol ratio between about 1:1 and about 4:1.


For nanoparticle compositions including an RNA, solutions of the RNA at concentrations of 0.1 mg/ml in deionized water are diluted in 50 mM sodium citrate buffer at a pH between 3 and 4 to form a stock solution.


Nanoparticle compositions can be processed by dialysis to remove ethanol and achieve buffer exchange. Formulations are dialyzed twice against phosphate buffered saline (PBS), pH 7.4, at volumes 200 times that of the primary product using Slide-A-Lyzer cassettes (Thermo Fisher Scientific Inc., Rockford, Ill.) with a molecular weight cutoff of 10 kD. The first dialysis is carried out at room temperature for 3 hours. The formulations are then dialyzed overnight at 4° C. The resulting nanoparticle suspension is filtered through 0.2 μm sterile filters (Sarstedt, Nümbrecht, Germany) into glass vials and sealed with crimp closures. Nanoparticle composition solutions of 0.01 mg/ml to 0.10 mg/ml are generally obtained.


The method described above induces nano-precipitation and particle formation. Alternative processes including, but not limited to, T-junction and direct injection, can be used to achieve the same nano-precipitation.


B. Characterization of Nanoparticle Compositions


A Zetasizer Nano ZS (Malvern Instruments Ltd, Malvern, Worcestershire, UK) can be used to determine the particle size, the polydispersity index (PDI) and the zeta potential of the nanoparticle compositions in 1×PBS in determining particle size and 15 mM PBS in determining zeta potential.


Ultraviolet-visible spectroscopy can be used to determine the concentration of a polynucleotide (e.g., RNA) in nanoparticle compositions. 100 μL of the diluted formulation in 1×PBS is added to 900 μL of a 4:1 (v/v) mixture of methanol and chloroform. After mixing, the absorbance spectrum of the solution is recorded, for example, between 230 nm and 330 nm on a DU 800 spectrophotometer (Beckman Coulter, Beckman Coulter, Inc., Brea, Calif.). The concentration of polynucleotide in the nanoparticle composition can be calculated based on the extinction coefficient of the polynucleotideused in the composition and on the difference between the absorbance at a wavelength of, for example, 260 nm and the baseline value at a wavelength of, for example, 330 nm.


For nanoparticle compositions including an RNA, a QUANT-IT™ RIBOGREEN® RNA assay (Invitrogen Corporation Carlsbad, Calif.) can be used to evaluate the encapsulation of an RNA by the nanoparticle composition. The samples are diluted to a concentration of approximately 5 μg/mL in a TE buffer solution (10 mM Tris-HCl, 1 mM EDTA, pH 7.5). 50 μL of the diluted samples are transferred to a polystyrene 96 well plate and either 50 μL of TE buffer or 50 μL of a 2% Triton X-100 solution is added to the wells. The plate is incubated at a temperature of 37° C. for 15 minutes. The RIBOGREEN® reagent is diluted 1:100 in TE buffer, and 100 μL of this solution is added to each well. The fluorescence intensity can be measured using a fluorescence plate reader (Wallac Victor 1420 Multilablel Counter; Perkin Elmer, Waltham, Mass.) at an excitation wavelength of, for example, about 480 nm and an emission wavelength of, for example, about 520 nm. The fluorescence values of the reagent blank are subtracted from that of each of the samples and the percentage of free RNA is determined by dividing the fluorescence intensity of the intact sample (without addition of Triton X-100) by the fluorescence value of the disrupted sample (caused by the addition of Triton X-100).


Exemplary formulations of the nanoparticle compositions are presented in the Table 5 below.









TABLE 5







Exemplary Formulations of Nanoparticles










Composition




(mol %)
Components







40:20:38.5:1.5
Compound:Phospholipid:Chol*:PEG-lipid



45:15:38.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



50:10:38.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



55:5:38.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



60:5:33.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



45:20:33.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



50:20:28.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



55:20:23.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



60:20:18.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



40:15:43.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



50:15:33.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



55:15:28.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



60:15:23.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



40:10:48.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



45:10:43.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



55:10:33.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



60:10:28.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



40:5:53.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



45:5:48.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



50:5:43.5:1.5
Compound:Phospholipid:Chol:PEG-lipid



40:20:40:0
Compound:Phospholipid:Chol:PEG-lipid



45:20:35:0
Compound:Phospholipid:Chol:PEG-lipid



50:20:30:0
Compound:Phospholipid:Chol:PEG-lipid



55:20:25:0
Compound:Phospholipid:Chol:PEG-lipid



60:20:20:0
Compound:Phospholipid:Chol:PEG-lipid



40:15:45:0
Compound:Phospholipid:Chol:PEG-lipid



45:15:40:0
Compound:Phospholipid:Chol:PEG-lipid



50:15:35:0
Compound:Phospholipid:Chol:PEG-lipid



55:15:30:0
Compound:Phospholipid:Chol:PEG-lipid



60:15:25:0
Compound:Phospholipid:Chol:PEG-lipid



40:10:50:0
Compound:Phospholipid:Chol:PEG-lipid



45:10:45:0
Compound:Phospholipid:Chol:PEG-lipid



50:10:40:0
Compound:Phospholipid:Chol:PEG-lipid



55:10:35:0
Compound:Phospholipid:Chol:PEG-lipid



60:10:30:0
Compound:Phospholipid:Chol:PEG-lipid







*reference to Chol in the table may be any type of structural lipid






Example 13: Expression and Activity of Factor VIII (F8) mRNA Constructs

Expression and activity of F8 mRNA constructs was observed in vitro in CHO-K1 cells (FIGS. 1A-1B). 2 ug mRNA was transfected into CHO-Kl cells in 6-well plates. 48 h post transfection, F8 expression and activity in cell culture media was measured using F8 ELISA kit (Affinity Biologicals) and 2-stage Chomogenix assay (DiaPharma), respectively. Normal human calibrator plasma was used as standard in both assays.


The data in FIG. 1 demonstrate that Factor VIII proteins can be expressed both in vitro and in vivo and that variants (i.e., the truncated versions) are even more active and stable than the full length constructs. The full length wild type Factor VIII is very large and challenging to make recombinantly. It is too large to be delivered in vivo as DNA for gene therapy. However, the full length protein can be produced and delivered in vivo using the mRNA of the invention. The mRNA constructs are also particularly useful for producing therapeutically enhanced modified and truncated versions of the F8, as shown in the data.


A dose-dependent increase in expression and activity was observed for F8 mRNA constructs in WT CD1 mice (FIG. 2). F8 mRNAs formulated in LNPs were intravenously injected into wild type CD1 mice via tail vein at varying concentrations (see Table 6). 24h post injection, blood was collected, plasma was prepared and F8 concentration and activity were measured using ELISA kit (Affinity Biologicals) and 2-stage Chomogenix assay (DiaPharma), respectively. Normal human calibrator plasma was used as standard in both assays. Activity data: wild type mouse F8 interferes with modRNA expressed huF8 activity assay.













TABLE 6








Dose




mRNA
[mg/kg]
# animals









F8FL.F309S
1.0
4




0.5
4




0.1
4



F8N6.F309S_SE
1.0
4




0.5
4




0.1
4



eGFP
0.5
3










To test short-term expression of human FVIII by delivering FVIII mRNA LNP in Hemophilia A mice, different forms of FVIII mRNA LNPs (F8-FL, F8-FL-F309S, and F8-N6-F309S) were retro-orbitally injected at 2 mg/kg into hemophilia A (HemA) mice (FIGS. 3A-3B and 4A-4C). 0 hr, 6 hr, 12 hr, 24 hr, 48 hr, and 72 hr post-injected blood were collected and FVIII antigen level and activity were determined using ELISA and aPTT. Human normal pooled plasma was used as 100% antigen and activity standard in both assays. 4 mice per FVIII form were administered in LNP at 50 μg/25 g body weight. FIG. 4B shows that HemA mice injected with each of the different FVIII mRNA LNP variants displayed high FVIII activity at 12 hours post-injection and FVIII activity was maintained at least 72 hours after single administration (lines from top to bottom in FIG. 4B: F8-N6-F309S, F8-FL-F309S, F8-FL, Luciferase). FIG. 4C shows that each variant FVIII mRNA LNP displayed highest FVIII expression levels at 1 day following injection, with the F8-N6 LNPs with a mutated furin cleavage site displaying the highest FVIII expression levels through 5 days post-injection (lines from top to bottom in FIG. 4C: F8-N6-SQR-F309S, F8-N6-TR-F309S, F8-N6C-TR-F309S, F8-FL-F309S, Luciferase).


To assess the development of F8 inhibitor, 1, 2, 3 and 4 weeks post-injected blood were collected and FVIII inhibitor level was determined using Bethesda assay (FIG. 5). Raw data of Bethesda assay and aPTT week 1 to week 4 is shown in Tables 7-11.


Tables 12-16 show mRNA and amino acid construct sequences. Sequence alignments are shown in FIG. 6.













TABLE 7









Bethda



LNP
ID
unit









Luciferase
787-1W
0.1




787-2W
0.3




787-3W
0.2




787-4W
0.3





















TABLE 8









Bethda



LNP
ID
unit




















F8-FL
789-1W
0




789-2W
0




789-3W
0.3




789-4W
1




791-1W
0




791-2W
0.2




791-3W
0.2




791-4W
0.3





















TABLE 9









Bethda



LNP
ID
unit




















F8-FL-F309S
792-1W
0.1




792-2W
0




792-3W
0.5




792-4W
0.3




793-1W
0




793-2W
16




793-3W
64




793-4W
25




794-1W
0.1




794-2W
0.2




794-3W
2




794-4W
2





















TABLE 10









Bethda



LNP
ID
unit




















F8-N6-F309S
795-1W
0.2




795-2W
16




795-3W
32




795-4W
130




796-1W
12




796-2W
34




796-3W
130




796-4W
281.82




797-1W
6




797-2W
32




797-3W
64




797-4W
281.82

















TABLE 11







aPTT-Percentage of normal plasma (%)












LNP
aPTT
Week 1
Week 2
Week 3
Week 4















Luciferase
K 787
6
3.9
2
2.9


F8-FL
K 789
6.3
5.7
4.2
4.3



K 791
3.5
4.2
4.8
2.1


F8-FL-F309S
K 792
4.2
2.4
1.8
1.2



K 793
3.1
2.9
2.7
1.4



K 794
5.7
4.1
3.8
5.2


F8-N6-F309S
K 795
10.5
3.4
1.8
1



K 796
6.6
2.6
3.1
0.9



K 797
7.8
3.3
7.2
2.1









A single-dose pK study in non-human primates may be performed. Two mRNA constructs (wild type and an N6 mutation) formulated in preferred ionizable lipid and PEG lipid LNPs is used. Levels of protein expression and clotting activity are assessed. At a dose of 0.1 mg/kg of N6 it is expected that about 20% activity will be observed as compared to a reference value for the N6 construct.


FVIII mRNA LNPs (F8-N6-SQR-F309S) were repeatedly injected into HemA mice at 0.5 mg/kg per injection. HemA mice received two injections (at days 1 and 8), three injections (at days 1, 6, and 11), or four injections (at days 1, 4, 8, and 12) over the course of about two weeks. Blood was collected at several time points following injection, and FVIII antigen levels and activity were determined using ELISA and aPTT. FVIII inhibitor level was also determined using Bethesda assay. As shown in FIGS. 7A-C, FVIII expression levels following two, three, or four injections maintained for at least 10-12 days following two, three, or four injections of the FVIII mRNA LNPs. FIG. 7D shows that HemA mice that received repeated injections (two, three, or four injections) of FVIII mRNA LNPs began to produce FVIII inhibitory antibodies within 2 weeks, and the titer of FVIII inhibitors increases over time (lines from top to bottom in FIG. 7D at 4 weeks: four injections, three injections, two injections). Generally, increasing the number of injections increases the titer of FVIII inhibitors.


Example 14: Tissue-Specific Expression and Biocompatibility of LNPs

To test the tissue specificity of LNP-delivered mRNA, luciferase mRNAwas encapsulated in LNPs and intravenously injected into wild-type C57BL/6 mice. In vivo imaging was used to detect luciferase signal at 4 hours, 24 hours, and 48 hours following injection (FIGS. 8A-B). FIG. 8A shows that luciferase was expressed mainly in the liver of mice at 4 hours after injection. Luciferase expression was detectable through 24 hours after injection.


The stability of mRNA LNPs was also tested by injecting luciferase mRNA LNPs into C57BL/6 mice after the luciferase mRNA LNPs were stored at 4° C. for 1 month, 3 months, or 6 months. FIG. 8B shows that mRNA LNPs that have been stored for 6 months or less retained their activity, as luciferase was detected at 4 hours after post-injection. Luciferase activity was detectable through 24 hours after injection.


The biocompatibility of mRNA encapsulated in LNPs was also tested. Mice were injected with luciferase mRNA LNPs daily for five consecutive days. FIG. 9A shows that luciferase was detectable through the course of injections. Livers were harvested 7 and 15 days following 5 daily mRNA LNP injections, fixed, and stained for haemotoxylin and eosin (H&E) or CD4 and CD8 markers. Livers harvested from naive, uninjected wild-type mice were used as a control. There was a low-level prevalence of lymphocyte infiltrates in the livers of mice injected with mRNA LNPs (data not shown). To test liver function, mice were injected with LNPs encapsulating luciferase mRNA or an mRNA encoding nonfunctional factor IX (FIX) (daily for five consecutive days). ALT and AST levels were then measured and compared to control mice that were not administered LNPs. FIG. 9B shows that ALT and AST levels in mice injected with luciferase mRNA LNPs and mice injected with FIX mRNA LNPs were comparable to the ALT and AST levels in controls.


Additional Embodiments

The present disclosure encompasses the following embodiments, respresented by numbered paragraphs.


A polynucleotide comprising an open reading frame (ORF) encoding a Factor VIII polypeptide, wherein the uracil or thymine content of the ORF relative to the theoretical minimum uracil or thymine content of a nucleotide sequence encoding the Factor VIII polypeptide (% UTM or % TTM) is between about 175% and about 225%.


The polynucleotide of paragraph 1, wherein the % UTM or % TTM is between about 180% and about 220%, about 184% and about 220%, about 184% and about 215%, about 180% and about 215%, about 180% and about 210%, about 184% and about 210%, about 180% and about 200%, about 184% and about 200%, or about 184% and about 198%.


The polynucleotide of paragraph 2, wherein the % UTM or % TTM is between (i) 174%, 175%, 176%, 177%, 178%, 179%, 180%, 181%, 182%, 183%, or 184%, and (ii) 198%, 199%, 200%, 201%, 202%, 203%, 204%, 205%, 206%, 207%, or 208%.


The polynucleotide of any one of paragraphs 1 to 3, wherein the uracil or thymine content of the ORF relative to the uracil or thymine content of the corresponding wild-type ORF (% UWT or % TWT) is less than 100%.


The polynucleotide of paragraph 4, wherein the %UwT or %TWT is less than about 95%, less than about 90%, less than about 85%, less than about 80%, less than about 75%, or less than 74%.


The polynucleotide of paragraph 4, wherein the % UWT or % TWT is between 68% and 74%.


The polynucleotide of any one of paragraphs 1 to 6, wherein the uracil or thymine content in the ORF relative to the total nucleotide content in the ORF (% UTL or % TTL) is less than about 50%, less than about 40%, less than about 30%, or less than about 21%.


The polynucleotide of paragraph 7, wherein the % UTL or % TTL is less than about 21%.


The polynucleotide of any one of paragraphs 1 to 8, wherein the % UTL or % TTL is between about 14% and about 16%.


The polynucleotide of any one of paragraphs 1 to 9, wherein the guanine content of the ORF with respect to the theoretical maximum guanine content of a nucleotide sequence encoding the Factor VIII polypeptide (% GTMX) is at least 71%, at least 72%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, or about 100%.


The polynucleotide of paragraph 10, wherein the % GTMX is between about 72% and about 80%, between about 72% and about 79%, between about 73% and about 78%, or between about 74% and about 77%.


The polynucleotide of any one of paragraphs 1 to 11, wherein the cytosine content of the ORF relative to the theoretical maximum cytosine content of a nucleotide sequence encoding the Factor VIII polypeptide (% CTMX) is at least 63%, at least 64%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or about 100%.


The polynucleotide of paragraph 12, wherein the % CTMX is between about 65% and about 80%, between about 65% and about 79%, between about 65% and about 78%, or between about 72% and about 77%.


The polynucleotide of any one of paragraphs 1 to 13, wherein the guanine and cytosine content (G/C) of the ORF relative to the theoretical maximum G/C content in a nucleotide sequence encoding the Factor VIII polypeptide (% G/CTMX) is at least about 81%, at least about 82%, at least about 85%, at least about 90%, at least about 95%, or about 100%.


The polynucleotide of any one of paragraphs 1 to 13, wherein the % G/CTMX is between about 80% and about 100%, between about 85% and about 99%, between about 90% and about 97%, or between about 90% and about 93%.


The polynucleotide of any one of paragraphs 1 to 15, wherein the G/C content in the ORF relative to the G/C content in the corresponding wild-type ORF (% G/CWT) is at least 102%, at least 103%, at least 104%, at least 105%, at least 106%, at least 107%, or at least about 110%.


The polynucleotide of any one of paragraphs 1 to 15, wherein the average G/C content in the 3rd codon position in the ORF is at least 20%, at least 21%, at least 22%, at least 23%, or at least 24% higher than the average G/C content in the 3rd codon position in the corresponding wild-type ORF.


The polynucleotide of any one of paragraphs 1 to 17, wherein the ORF further comprises at least one low-frequency codon.


The polynucleotide of any one of paragraphs 1 to 18,


(i) wherein the ORF is at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Factor VIII-CO21, Factor VIII-CO17, Factor VIII-CO7, Factor VIII-CO2, Factor VIII-CO18, Factor VIII-CO1, Factor VIII-CO16, Factor VIII-CO12, Factor VIII-CO4, Factor VIII-CO24, Factor VIII-CO15, Factor VIII-CO5, Factor VIII-CO25, or Factor VIII-CO23;


(ii) wherein the ORF is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Factor VIII-CO14, Factor VIII-CO11, Factor VIII-CO13, Factor VIII-CO10, Factor VIII-CO22, Factor VIII-CO8, Factor VIII-CO9, Factor VIII-CO19, Factor VIII-CO3, or Factor VIII-CO20; or


(iii) wherein the ORF is at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Factor VIII-CO6.


A polynucleotide comprising an ORF,


(i) wherein the ORF is at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to JAG CO21, Factor VIII-CO17, Factor VIII-CO7, Factor VIII-CO2, Factor VIII-CO18, Factor VIII-CO1, Factor VIII-CO16, Factor VIII-CO12, Factor VIII-CO4, Factor VIII-CO24, Factor VIII-CO15, Factor VIII-CO5, Factor VIII-CO25, or Factor VIII-CO23;


(ii) wherein the ORF is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Factor VIII-CO14, Factor VIII-CO11, Factor VIII-CO13, Factor VIII-CO10, Factor VIII-CO22, Factor VIII-CO8, Factor VIII-CO9, Factor VIII-CO19, Factor VIII-CO3, or Factor VIII-CO20; or


(iii) wherein the ORF is at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to Factor VIII-CO6.


The polynucleotide of any one of paragraphs 1 to 20, wherein the ORF has at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% sequence identity to an ORF sequence within the sequence of SEQ ID NO: 3, 127-135, or 166-169.


The polynucleotide of any one of paragraphs 1 to 21, wherein the Factor VIII polypeptide comprises an amino acid sequence at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to the polypeptide sequence of wild type Factor VIII (SEQ ID NO: 1 or 2).


The polynucleotide of paragraph 22, wherein the Factor VIII polypeptide is a variant, derivative, or mutant having bleeding prevention activity.


The polynucleotide of any one of paragraphs 1 to 23, wherein the polynucleotide sequence further comprises a nucleotide sequence encoding a transit peptide.


The polynucleotide of any one of paragraphs 1 to 24, wherein the polynucleotide is single stranded.


The polynucleotide of any one of paragraphs 1 to 24, wherein the polynucleotide is double stranded.


The polynucleotide of any one of paragraphs 1 to 26, wherein the polynucleotide is DNA.


The polynucleotide of any one of paragraphs 1 to 26, wherein the polynucleotide is RNA.


The polynucleotide of paragraph 28, wherein the polynucleotide is mRNA.


The polynucleotide of any one of paragraphs 1 to 29, wherein the polynucleotide comprises at least one chemically modified nucleobase, sugar, backbone, or any combination thereof.


The polynucleotide of paragraph 30, wherein the at least one chemically modified nucleobase is selected from the group consisting of pseudouracil (ψ), N1-methylpseudouracil (m1ψ), 2-thiouracil (s2U), 4′-thiouracil, 5-methylcytosine, 5-methyluracil, and any combination thereof.


The polynucleotide of paragraph 30, wherein the at least one chemically modified nucleobase is 5-methoxyuracil.


The polynucleotide of paragraph 32, wherein at least about 25%, at least about 30%, at least about 40%, at least about 50%, at least about 60%, at least about 70%, at least about 80%, at least about 90%, at least about 95%, at least about 99%, or 100% of the uracils are 5-methoxyuracils.


The polynucleotide of any one of paragraphs 1 to 33, wherein the polynucleotide further comprises a miRNA binding site.


The polynucleotide of paragraph 34, wherein the miRNA binding site comprises one or more nucleotide sequences selected from Table 4.


The polynucleotide of paragraph 34, wherein the miRNA binding site binds to miR-142.


The polynucleotide of paragraph 35 or 36, wherein the miRNA binding site binds to miR-142-3p or miR-142-5p.


The polynucleotide of paragraph 36 or 37, wherein the miR-142 comprises SEQ ID NO: 79.


The polynucleotide of any one of paragraphs 1 to 38, wherein the polynucleotide further comprises a 5′ UTR.


The polynucleotide of paragraph 39, wherein the 5′ UTR comprises a nucleic acid sequence at least 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to a sequence selected from the group consisting of SEQ ID NOs:36-78 and 125-126.


The polynucleotide of any one of paragraphs 1 to 40, wherein the polynucleotide further comprises a 3′ UTR.


The polynucleotide of paragraph 41, wherein the 3′ UTR comprises a nucleic acid sequence at least about 90%, at least about 95%, at least about 96%, at least about 97%, at least about 98%, at least about 99%, or about 100% identical to a sequence selected from the group consisting of SEQ ID NOs:112-122 and 146.


The polynucleotide of paragraph 41 or 42, wherein the miRNA binding site is located within the 3′ UTR.


The polynucleotide of any one of paragraphs 1 to 43, wherein the polynucleotide further comprises a 5′ terminal cap.


The polynucleotide of paragraph 44, wherein the 5′ terminal cap comprises a Cap0, Cap1, ARCA, inosine, N1-methyl-guanosine, 2′-fluoro-guanosine, 7-deaza-guanosine, 8-oxo-guanosine, 2-amino-guanosine, LNA-guanosine, 2-azidoguanosine, Cap2, Cap4, 5′ methylG cap, or an analog thereof.


The polynucleotide of any one of paragraphs 1 to 45, wherein the polynucleotide further comprises a poly-A region.


The polynucleotide of paragraph 46, wherein the poly-A region is at least about 10, at least about 20, at least about 30, at least about 40, at least about 50, at least about 60, at least about 70, at least about 80, or at least about 90 nucleotides in length.


The polynucleotide of paragraph 47, wherein the poly-A region has about 10 to about 200, about 20 to about 180, about 50 to about 160, about 70 to about 140, or about 80 to about 120 nucleotides in length.


The polynucleotide of any one of paragraphs 1 to 46, wherein the polynucleotide encodes a Factor VIII polypeptide that is fused to one or more heterologous polypeptides.


The polynucleotide of paragraph 49, wherein the one or more heterologous polypeptides increase a pharmacokinetic property of the Factor VIII polypeptide.


The polynucleotide of any one of paragraphs 1 to 50, wherein upon administration to a subject, the polynucleotide has:


(i) a longer plasma half-life;


(ii) increased expression of a Factor VIIIpolypeptide encoded by the ORF;


(iii) a lower frequency of arrested translation resulting in an expression fragment;


(iv) greater structural stability; or


(v) any combination thereof,


relative to a corresponding polynucleotide comprising SEQ ID NO: 3, 127-135, or 166-169.


The polynucleotide of any one of paragraphs 1 to 51, wherein the polynucleotide comprises:


(i) a 5′-terminal cap;


(ii) a 5′-UTR;


(iii) an ORF encoding a Factor VIII polypeptide;


(iv) a 3′-UTR; and


(v) a poly-A region.


The polynucleotide of paragraph 52, wherein the 3′-UTR comprises a miRNA binding site.


A method of producing the polynucleotide of any one of paragraphs 1 to 52, the method comprising modifying an ORF encoding a Factor VIII polypeptide by substituting at least one uracil nucleobase with an adenine, guanine, or cytosine nucleobase, or by substituting at least one adenine, guanine, or cytosine nucleobase with a uracil nucleobase, wherein all the substitutions are synonymous substitutions.


The method of paragraph 54, wherein the method further comprises replacing at least about 90%, at least about 95%, at least about 99%, or about 100% of uracils with 5-methoxyuracils.


A composition comprising


the polynucleotide of any one of paragraphs 1 to 53; and


a delivery agent.


The composition of paragraph 56, wherein the delivery agent comprises a lipidoid, a liposome, a lipoplex, a lipid nanoparticle, a polymeric compound, a peptide, a protein, a cell, a nanoparticle mimic, a nanotube, or a conjugate.


The composition of paragraph 56, wherein the delivery agent comprises a lipid nanoparticle.


The composition of paragraph 58, wherein the lipid nanoparticle comprises a lipid selected from the group consisting of


3-(didodecylamino)-N1,N1,4-tridodecyl-1-piperazineethanamine (KL10),


N1-[2-(didodecylamino)ethyl]-N1,N4,N4-tridodecyl-1,4-piperazinediethanamine (KL22),


14,25-ditridecyl-15,18,21,24-tetraaza-octatriacontane (KL25),


1,2-dilinoleyloxy-N,N-dimethylaminopropane (DLin-DMA),


2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA),


heptatriaconta-6,9,28,31-tetraen-19-yl 4-(dimethylamino)butanoate (DLin-MC3-DMA),


2,2-dilinoleyl-4-(2-dimethylaminoethyl)[1,3]-dioxolane (DLin-KC2-DMA),


1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA), (13Z,165Z)-N,N-dimethyl-3-nonydocosa-13-16-dien-l-amine (L608),


2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yl oxy]propan-1-amine (Octyl-CLinDMA),


(2R)-2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA (2R)),


(2S)-2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA (2S)), and any combination thereof.


The composition of any one of paragraphs 56 to 59, wherein the delivery agent comprises a compound having the Formula (I)




embedded image


or a salt or stereoisomer thereof, wherein


R1 is selected from the group consisting of C5-20 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;


R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;


R4 is selected from the group consisting of a C3-6 carbocycle, —(CH2)nQ, —(CH2)nCHQR, —CHQR, —CQ(R)2, and unsubstituted C1-6 alkyl, where Q is selected from a carbocycle, heterocycle, —OR, —O(CH2)nN(R)2, —C(O)OR, —OC(O)R, —CX3, —CX2H, —CXH2, —CN, —N(R)2, —C(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)C(O)N(R)2, —N(R)C(S)N(R)2, and —C(R)N(R)2C(O)OR, and each n is independently selected from 1, 2, 3, 4, and 5;


each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, an aryl group, and a heteroaryl group;


R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;


each R″ is independently selected from the group consisting of C3-14 alkyl and C3-14 alkenyl;


each R* is independently selected from the group consisting of C1-12 alkyl and C2-12 alkenyl;


each Y is independently a C3-6 carbocycle;


each X is independently selected from the group consisting of F, Cl, Br, and I; and


m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13; and


provided when R4 is —(CH2)nQ, —(CH2)nCHQR, —CHQR, or —CQ(R)2, then (i) Q is not —N(R)2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2.


A composition comprising a nucleotide sequence encoding a Factor VIII polypeptide and a delivery agent, wherein the delivery agent comprises a compound having the Formula (I)




embedded image


or a salt or stereoisomer thereof, wherein


R1 is selected from the group consisting of C5-20 alkyl, C5-20 alkenyl, —R*YR″, —YR″, and —R″M′R′;


R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, C2-14 alkenyl, —R*YR″, —YR″, and —R*OR″, or R2 and R3, together with the atom to which they are attached, form a heterocycle or carbocycle;


R4 is selected from the group consisting of a C3-6 carbocycle, —(CH2)nQ, —(CH2)nCHQR,


—CHQR, —CQ(R)2, and unsubstituted C1-6 alkyl, where Q is selected from a carbocycle, heterocycle, —OR, —O(CH2)nN(R)2, —C(O)OR, —OC(O)R, —CX3, —CX2H, —CXH2, —CN, —N(R)2, —C(O)N(R)2, —N(R)C(O)R, —N(R)S(O)2R, —N(R)C(O)N(R)2, —N(R)C(S)N(R)2, and —C(R)N(R)2C(O)OR, and each n is independently selected from 1, 2, 3, 4, and 5;


each R5 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R6 is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —N(R′)C(O)—, —C(O)—, —C(S)—, —C(S)S—, —SC(S)—, —CH(OH)—, —P(O)(OR′)O—, —S(O)2—, an aryl group, and a heteroaryl group;


R7 is selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R is independently selected from the group consisting of C1-3 alkyl, C2-3 alkenyl, and H;


each R′ is independently selected from the group consisting of C1-18 alkyl, C2-18 alkenyl, —R*YR″, —YR″, and H;


each R″ is independently selected from the group consisting of C3-14 alkyl and


C3-14 alkenyl;


each R* is independently selected from the group consisting of C1-12 alkyl and


C2-12 alkenyl;


each Y is independently a C3-6 carbocycle;


each X is independently selected from the group consisting of F, Cl, Br, and I; and


m is selected from 5, 6, 7, 8, 9, 10, 11, 12, and 13; and


provided when R4 is —(CH2)nQ, —(CH2)nCHQR, —CHQR, or —CQ(R)2, then (i) Q is not —N(R)2 when n is 1, 2, 3, 4 or 5, or (ii) Q is not 5, 6, or 7-membered heterocycloalkyl when n is 1 or 2.


The composition of paragraph 60 or 61, wherein the compound is of Formula (IA):




embedded image


or a salt or stereoisomer thereof, wherein


l is selected from 1, 2, 3, 4, and 5;


m is selected from 5, 6, 7, 8, and 9;


M1 is a bond or M′;


R4 is unsubstituted C1-3 alkyl, or —(CH2)nQ, in which n is 1, 2, 3, 4, or 5 and Q is OH, —NHC(S)N(R)2, or —NHC(O)N(R)2;


M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —P(O)(OR′)O—, an aryl group, and a heteroaryl group; and

    • R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl.


The composition of any one of paragraphs 60 to 62, wherein m is 5, 7, or 9.


The composition of any one of paragraphs 60 to 63, wherein the compound is of Formula (II):




embedded image


or a salt or stereoisomer thereof, wherein


l is selected from 1, 2, 3, 4, and 5;


M1 is a bond or M′;


R4 is unsubstituted C1-3 alkyl, or —(CH2)nQ, in which n is 2, 3, or 4 and Q is OH, —NHC(S)N(R)2, or —NHC(O)N(R)2;


M and M′ are independently selected from —C(O)O—, —OC(O)—, —C(O)N(R′)—, —P(O)(OR′)O—, an aryl group, and a heteroaryl group; and

    • R2 and R3 are independently selected from the group consisting of H, C1-14 alkyl, and C2-14 alkenyl.


The composition of any one of paragraphs 62 to 64, wherein M1 is M′.


The composition of paragraph 65, wherein M and M′ are independently —C(O)O— or —OC(O)—.


The composition of any one of paragraphs 62 to 66, wherein 1 is 1, 3, or 5.


The composition of paragraph 60 or 61, wherein the compound is of the Formula (IIa),




embedded image


or a salt or stereoisomer thereof.


The composition of paragraph 60 or 61, wherein the compound is of the Formula (IIb),




embedded image


or a salt or stereoisomer thereof.


The composition of paragraph 60 or 61, wherein the compound is of the Formula (IIc) or (IIe),




embedded image


or a salt or stereoisomer thereof.


The composition of any one of paragraphs 69 to 71, wherein R4 is selected from —(CH2)nQ and —(CH2)nCHQR.


The composition of paragraph 60 or 61, wherein the compound is of the Formula (IId),




embedded image


or a salt or stereoisomer thereof,


wherein R2 and R3 are independently selected from the group consisting of C5-14 alkyl and C5-14 alkenyl, n is selected from 2, 3, and 4, and R′, R″, R5, R6 and m are as defined in paragraph 61 or 62.


The composition of paragraph 73, wherein R2 is C8 alkyl.


The composition of paragraph 74, wherein R3 is C5 alkyl, C6 alkyl, C7 alkyl, C8 alkyl, or C9 alkyl.


The composition of any one of paragraphs 73 to 75, wherein m is 5, 7, or 9.


The composition of any one of paragraphs 73 to 76, wherein each R5 is H.


The composition of paragraph 77, wherein each R6 is H.


The composition of any one of paragraphs 60 to 78, which is a nanoparticle composition.


The composition of paragraph 79, wherein the delivery agent further comprises a phospholipid.


The composition of paragraph 80, wherein the phospholipid is selected from the group consisting of 1,2-dilinoleoyl-sn-glycero-3-phosphocholine (DLPC),


1,2-dimyristoyl-sn-glycero-phosphocholine (DMPC),


1,2-dioleoyl-sn-glycero-3-phosphocholine (DOPC),


1,2-dipalmitoyl-sn-glycero-3-phosphocholine (DPPC),


1,2-distearoyl-sn-glycero-3-phosphocholine (DSPC),


1,2-diundecanoyl-sn-glycero-phosphocholine (DUPC),


1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine (POPC),


1,2-di-O-octadecenyl-sn-glycero-3-phosphocholine (18:0 Diether PC),


1-oleoyl-2-cholesterylhemisuccinoyl-sn-glycero-3-phosphocholine (OChemsPC),


1-hexadecyl-sn-glycero-3-phosphocholine (C16 Lyso PC),


1,2-dilinolenoyl-sn-glycero-3-phosphocholine, 1,2-diarachidonoyl-sn-glycero-3-phosphocholine,


1,2-didocosahexaenoyl-sn-glycero-3-phosphocholine,


1,2-dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE),


1,2-diphytanoyl-sn-glycero-3-phosphoethanolamine (ME 16:0 PE),


1,2-distearoyl-sn-glycero-3-phosphoethanolamine,


1,2-dilinoleoyl-sn-glycero-3-phosphoethanolamine,


1,2-dilinolenoyl-sn-glycero-3-phosphoethanolamine,


1,2-diarachidonoyl-sn-glycero-3-phosphoethanolamine,


1,2-didocosahexaenoyl-sn-glycero-3-phosphoethanolamine,


1,2-dioleoyl-sn-glycero-3-phospho-rac-(1-glycerol) sodium salt (DOPG), sphingomyelin, and any mixtures thereof.


The composition of any one of paragraphs 60 to 81, wherein the delivery agent further comprises a structural lipid.


The composition of paragraph 82, wherein the structural lipid is selected from the group consisting of cholesterol, fecosterol, sitosterol, ergosterol, campesterol, stigmasterol, brassicasterol, tomatidine, ursolic acid, alpha-tocopherol, and any mixtures thereof.


The composition of any one of paragraphs 60 to 83, wherein the delivery agent further comprises a PEG lipid.


The composition of paragraph 84, wherein the PEG lipid is selected from the group consisting of a PEG-modified phosphatidylethanolamine, a PEG-modified phosphatidic acid, a PEG-modified ceramide, a PEG-modified dialkylamine, a PEG-modified diacylglycerol, a PEG-modified dialkylglycerol, and any mixtures thereof.


The composition of any one of paragraphs 60 to 85, wherein the delivery agent further comprises an ionizable lipid selected from the group consisting of 3-(didodecylamino)-N1,N1,4-tridodecyl-1-piperazineethanamine (KL10),


N1-[2-(didodecylamino)ethyl]-N1,N4,N4-tridodecyl-1,4-piperazinediethanamine (KL22),


14,25-ditridecyl-15,18,21,24-tetraaza-octatriacontane (KL25),


1,2-dilinoleyloxy-N,N-dimethylaminopropane (DLin-DMA),


2,2-dilinoleyl-4-dimethylaminomethyl-[1,3]-dioxolane (DLin-K-DMA),


heptatriaconta-6,9,28,31-tetraen-19-yl 4-(dimethylamino)butanoate (DLin-MC3-DMA),


2,2-dilinoleyl-4-(2-dimethylaminoethyl)[1,3]-dioxolane (DLin-KC2-DMA),


1,2-dioleyloxy-N,N-dimethylaminopropane (DODMA),


2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yl oxy]propan-1-amine (Octyl-CLinDMA),


(2R)-2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA (2R)), and


(2S)-2-({8-[(3β)-cholest-5-en-3-yloxy]octyl}oxy)-N,N-dimethyl-3-[(9Z,12Z)-octadeca-9,12-dien-1-yloxy]propan-1-amine (Octyl-CLinDMA (2S)).


The composition of any one of paragraphs 60 to 86, wherein the delivery agent further comprises a phospholipid, a structural lipid, a PEG lipid, or any combination thereof.


The composition of any one of paragraphs 60 to 87, wherein the composition is formulated for in vivo delivery.


The composition according any one of paragraphs 60 to 88, which is formulated for intramuscular, subcutaneous, or intradermal delivery.


A host cell comprising the polynucleotide of any one of paragraphs 1 to 53.


The host cell of paragraph 90, wherein the host cell is a eukaryotic cell.


A vector comprising the polynucleotide of any one of paragraphs 1 to 53.


A method of making a polynucleotide comprising enzymatically or chemically synthesizing the polynucleotide of any one of paragraphs 1 to 53.


A polypeptide encoded by the polynucleotide of any one of paragraphs 1 to 53, the composition of any one of paragraphs 56 to 89, the host cell of paragraph 90 or 91, or the vector of paragraph 92 or produced by the method of paragraph 93.


A method of expressing in vivo an active Factor VIII polypeptide in a subject in need thereof comprising administering to the subject an effective amount of the polynucleotide of any one of paragraphs 1 to 53, the composition of any one of paragraphs 56 to 89, the host cell of paragraph 90 or 91, or the vector of paragraph 92.


A method of treating Hemophilia A in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the polynucleotide of any one of paragraphs 1 to 53, the composition of any one of paragraphs 56 to 89, the host cell of paragraph 90 or 91, or the vector of paragraph 92, wherein the administration alleviates the signs or symptoms of Hemophilia A in the subject.


A method to prevent or delay the onset of Hemophilia A signs or symptoms in a subject in need thereof comprising administering to the subject a prophylactically effective amount of the polynucleotide of any one of paragraphs 1 to 53, the composition of any one of paragraphs 56 to 89, the host cell of paragraph 90 or 91, or the vector of paragraph 92 before Hemophilia A signs or symptoms manifest, wherein the administration prevents or delays the onset of Hemophilia A signs or symptoms in the subject.


A method to ameliorate the signs or symptoms of Hemophilia A in a subject in need thereof comprising administering to the subject a therapeutically effective amount of the polynucleotide of any one of paragraphs 1 to 53, the composition of any one of paragraphs 56 to 89, the host cell of paragraph 90 or 91, or the vector of paragraph 92 before Hemophilia A or symptoms manifest, wherein the administration ameliorates Hemophilia A signs or symptoms in the subject.


It is to be appreciated that the Detailed Description section, and not the Summary and Abstract sections, is intended to be used to interpret the claims. The Summary and Abstract sections can set forth one or more but not all exemplary embodiments of the present disclosure as contemplated by the inventor(s), and thus, are not intended to limit the present disclosure and the appended claims in any way.


The present disclosure has been described above with the aid of functional building blocks illustrating the implementation of specified functions and relationships thereof The boundaries of these functional building blocks have been arbitrarily defined herein for the convenience of the description. Alternate boundaries can be defined so long as the specified functions and relationships thereof are appropriately performed.


The foregoing description of the specific embodiments will so fully reveal the general nature of the present disclosure that others can, by applying knowledge within the skill of the art, readily modify and/or adapt for various applications such specific embodiments, without undue experimentation, without departing from the general concept of the present disclosure. Therefore, such adaptations and modifications are intended to be within the meaning and range of equivalents of the disclosed embodiments, based on the teaching and guidance presented herein. It is to be understood that the phraseology or terminology herein is for the purpose of description and not of limitation, such that the terminology or phraseology of the present specification is to be interpreted by the skilled artisan in light of the teachings and guidance.


The breadth and scope of the present disclosure should not be limited by any of the above-described exemplary embodiments, but should be defined only in accordance with the following claims and their equivalents.


All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification, including definitions, will control.

Claims
  • 1.-133. (canceled)
  • 134. A pharmaceutical composition comprising a lipid nanoparticle, wherein the lipid nanoparticle comprises a compound having the formula (I)
  • 135. The pharmaceutical composition of claim 134, wherein the lipid nanoparticle comprises the compound is of Formula (IA):
  • 136. The pharmaceutical composition of claim 134, wherein m is 5, 7, or 9.
  • 137. The pharmaceutical composition of claim 134, wherein the compound is of Formula (II)
  • 138. The pharmaceutical composition of claim 135, wherein M1 is M′.
  • 139. The pharmaceutical composition of claim 138, wherein M and M′ are independently —C(O)O— or —OC(O)—.
  • 140. The pharmaceutical composition of claim 135, wherein l is 1, 3, or 5.
  • 141. The pharmaceutical composition of claim 134, wherein the compound is selected from the group consisting of Compound 1 to Compound 232, salts and stereoisomers thereof, and any combination thereof.
  • 142. The pharmaceutical composition of claim 141, wherein the compound is Compound 18, a salt or a stereoisomer thereof, or any combination thereof.
  • 143. A method of expressing a human Factor VIII polypeptide in a human subject in need thereof comprising administering to the subject an effective amount of the pharmaceutical composition of claim 134, wherein the pharmaceutical composition is suitable for administrating as a single dose or as a plurality of single unit doses to the subject.
  • 144. A method of treating, preventing or delaying the onset and/or progression of Hemophilia A signs or symptoms in a human subject in need thereof comprising administering to the subject an effective amount of the pharmaceutical composition of claim 134, wherein the administration treats, prevents or delays the onset and/or progression of one or more of the signs or symptoms of Hemophilia A in the subject.
  • 145. A method for the treatment of Hemophilia A, comprising administering to a human subject suffering from Hemophilia A a single intravenous dose of the pharmaceutical composition of claim 134.
  • 146. A method of improving the clotting rate in a human subject comprising administering to the subject an effective amount of the pharmaceutical composition of claim 134, wherein the administration improves the clotting rate in the subject.
  • 147. The method of claim 146, wherein the clotting rate is improved by at least 10%, at least 20%, at least 30%, at least 40%, or at least 50%, as compared to the clotting rate in a human subject untreated for Hemophilia A, for at least 24 hours, at least 48 hours, at least 72 hours, at least 96 hours, or at least 120 hours post-administration.
  • 148. A method of increasing the level of Factor VIII activity in a human subject comprising administering to the subject an effective amount of the pharmaceutical composition of claim 134, wherein the administration increases the level of Factor VIII activity in the subject.
CROSS-REFERENCE TO RELATED APPLICATIONS

This application claims priority to U.S. Provisional Appl. No. 62/519,827, filed Jun. 14, 2017, U.S. Provisional Appl. No. 62/589,914, filed Nov. 22, 2017, and U.S. Provisional Appl. No. 62/663,839, filed Apr. 27, 2018. The content of both applications are incorporated by reference herein in their entirety.

PCT Information
Filing Document Filing Date Country Kind
PCT/US2018/037361 6/13/2018 WO 00
Provisional Applications (3)
Number Date Country
62663839 Apr 2018 US
62589914 Nov 2017 US
62519827 Jun 2017 US