Polynucleotides encoding novel human mitochondrial and microsomal glycerol-3-phosphate acyl-transferases and variants thereof

Abstract

The present invention provides novel polynucleotides encoding Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides, fragments and homologues thereof. Also provided are vectors, host cells, antibodies, and recombinant and synthetic methods for producing said polypeptides. The invention further relates to diagnostic and therapeutic methods for applying these novel Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides to the diagnosis, treatment, and/or prevention of various diseases and/or disorders related to these polypeptides. The invention further relates to screening methods for identifying agonists and antagonists of the polynucleotides and polypeptides of the present invention.

Description

FIELD OF THE INVENTION

[0002] The present invention provides novel polynucleotides encoding Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides, fragments and homologues thereof. Also provided are vectors, host cells, antibodies, and recombinant and synthetic methods for producing said polypeptides. The invention further relates to diagnostic and therapeutic methods for applying these novel Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides to the diagnosis, treatment, and/or prevention of various diseases and/or disorders related to these polypeptides. The invention further relates to screening methods for identifying agonists and antagonists of the polynucleotides and polypeptides of the present invention.

BACKGROUND OF THE INVENTION

[0003] Obesity and its related increased risk for other disorders, such as type 2 diabetes, hypercholesterolemia, hypertension, cardiovascular disease and some cancers, are becoming epidemic in the Western and the developed world (Friedman, J. M., Nature 404, pp. 632-634 (2000), (World Health Organization, Obesity: W.H.O., Geneva, (1998). Obesity is, ultimately, caused by a positive energy balance, calories consumed exceed calories expended, with the accumulation of excess triglyceride (TG), the body's long term energy storage molecule, in adipose tissue. The underlying etiology of this surge in obesity is, most likely, multifactorial. Although environmental factors, such as the availability of relatively inexpensive, high calorie, high fat foods and the lack of physical exercise are undoubtedly the primary causes of the emerging obesity epidemic (Hill, J. O., et al. Science 280, pp.1371-1374 (1998), behavioral remedies, such as dieting and increasing physical activity, fail in the vast majority of cases to provide long term weight reduction (Friedman, J. M., Nature 404, pp. 632-634 (2000).

[0004] Genetic factors which can lead to early onset obesity have been identified in animal models, such as deficiencies in the fat cell derived secreted hormone, leptin, ob/ob mouse (Zhang, Y., et al. Nature 372, pp. 425-432 (1994), or its receptor, db/db mouse (Tartaglia, L. A., et al. Cell 83, pp.1263-1271 (1995), fa/fa rat (Chua Jr., S. et al. Diabetes 45, pp. 1141-1143 (1996) and carboxypeptidase mutations, fat/fat mice (Naggert, J. K., et al. Nature Genetics 10, pp. 135-141 (1995).(Yeo, G. S. H., et al. Nature Genetics 20, pp. 111-112 (1998), and mutations in the melanocortin-4 receptor. Similarly, leptin deficiencies (Montague, C. T., et al. Nature 387, pp. 903-908 (1997), have been found in rare human cases, which can lead to obesity. However, the human genome can not have changed substantially in the last few decades, therefore, monogenic disorders are likely to play only a small contributing role in the overall human obesity epidemic.

[0005] On the other hand, genetic manipulations such as targeted disruption of specific mouse genes can give rise to very lean phenotypes. Reduced fat pad mass and resistance to diet induced weight gain is seen in mice lacking the adipocyte lipid droplet coating protein, perilipin (Martinez-Botas, J., et al. Nature Genetics 26, pp. 474-479 (2000) and (Tansey, J. T., et al. Natl. Acad. Sci. USA 98, pp6494-6499 (2001). Continuous lipolysis of TG by hormone sensitive lipase in the absence of perilipin does not result in increased plasma levels of TG or non-esterified free fatty acids (NEFA), nor does it result in fat accumulation in the liver (Martinez-Botas, J., et al. Nature Genetics 26, pp. 474-479 (2000) and (Tansey, J. T., et al. Proc. Natl. Acad. Sci. USA 98, pp 6494-6499 (2001). Ablation of metabolic enzymes such as acetyl-CoA carboxylase 2 (Abu-Elheiga, L., et al. Science 291, pp. 2613-2616 (2001) or diacyl glycerol acyltransferase (DGAT) (Smith, S. et al. Nature Genetics 25, pp.87-90 (2000) in mice leads to reduced fat pad mass and TG content.

[0006] Pharmacological interventions have been used to reduce obesity in humans including inhibition of dietary fat absorption with Orlistat, a gastrointestinal lipase inhibitor (Davidson, M. H., et al. Am. Med. Assoc. 281, pp.235-242 (1999) the serotonin, noradreniline reuptake inhibitor, Sibutrimine which reduces food intake (Smith, S. J., et al. Nature Genetics 25, pp.87-90 (2000), and phase II clinical trials are under way with the neurocytokine, Cillary Neurotrophic Factor (CNTF, Axokine) (Yancopoulos, G. D., unpublished data presented at the Endocrine Society meeting, Denver, Colorado (2001) and (Lambert, P. D., et al. Proc. Natl. Acad. Sci., USA, 98, pp. 4652-4657 (2001), which acts on leptin like pathways. In rodents, inhibitors of fatty acid synthase (FAS) lead to reduced food intake and body weight (Loftus, T., et al. Science 288, pp. 2379-2381 (2000). FAS catalyzes the synthesis of long chain fatty acids from acetyl-CoA and malonyl-CoA . Blocking FAS activity leads to an increase in malonyl-CoA, mimicking the fed state, and either directly or indirectly influencing feeding behavior (Loftus, T., et al., Science 288, pp. 2379-2381 (2000).

[0007] Taken together, the data indicate that by modulating the activity or expression of specific metabolic targets, TG accumulation and obesity can be altered therapeutically. An attractive target pathway is glycerolipid synthesis. All tissues and most cells synthesize glycerolipids including phospholipids for cell membranes, and TG for energy storage. In most tissues the de novo biosynthesis starts with the esterification of glycerol-3-phosphate in the sn-1 position with a fatty acyl-CoA forming 1-acylglycerol-3-phosphate (lysophosphatidic acid, LPA). This is then further esterified with a second fatty acyl-CoA in the sn-2 position to form 1,2-diacylglycerol-3-phosphate (phosphatidic acid, PA). Phosphatidic acid is the branch point between phospholipid and TG synthesis. It can be converted to CDP-diacylglycerol and ultimately to phosphatidylglycerol, phosphatidylinositol and cardiolipin. Or, phosphatidic acid can be dephosphorylated to form diacylglycerol (DAG) which can be esterified in the sn-3 position with a fatty acyl-CoA to make TG. DAG is also an intermediate in the synthesis of phosphatidylethanolamine, phosphatidylserine and phosphatidylcholine (Lehner, R., et al. Prog. Lipid Res., 35, pp. 169-201 (1996). and (Dircks, L., et al., Lipid Res. 38, pp. 461-479 (1999).

[0008] Intermediates in the glycerophospholipid synthesis pathway, LPA, PA, and DAG, can play important cellular signaling roles (Athenstaedt, K., et al. Eur. J. Biochem 266, pp.1-16 (1999) and (Wakelam, M. J. O, Biochim. Biophys. Acta 1436, pp. 117-126 (1998) thus, a therapeutic intervention early in this pathway may be advantageous to prevent the buildup of these signaling molecules.

[0009] This invention presents the concept of modulating an enzymatic step early in the glycerolipid synthesis pathway for the treatment of obesity and other related disorders.

Glycerol-3-phoshate Acyltransferase

[0010] Glycerol-3-Phosphate Acyltransferase (GPAT, E.C.2.3.1.15), is the enzyme which catalyzes the esterification of glycerol-3-phospate (G-3-P) in the sn-1 position with a fatty acyl-Coenzyme A (acyl-CoA) forming 1-acylglycerol-3-phosphate (lysophosphatidic acid, LPA), the first committed, and presumed rate limiting, step in glycerophospholipid synthesis. LPA is then further esterified by the enzyme 1-acyl-glycerol-3-phosphate acyltransferase (AGPAT) at the sn-2 position to form phosphatidic acid (PA) which is a substrate for either triglyceride (TG) or phospholipid (PL) biosynthesis (Lehner, R., et al., Prog. Lipid Res., 35, pp. 169-201 (1996), (Dircks, L., et al., Prog. In Lipid Res. 38, pp. 461-479 (1999), and (Bell, R. M., et al., Enzymes, vol.16. New York Academic Press (1983). Thus, GPAT is an important and controlling enzyme early in the pathway of de novo synthesis of the energy storage molecules, triglycerides and of phospholipids for membrane biogenesis.

[0011] GPAT activity is found in virtually all species including bacteria, fungi, plants and animals. In mammals, it is found to varying degrees in most all tissues including liver, adipose, heart, lung, kidney, adrenal, muscle, lactating mammary, intestinal mucosa, brain, and in many mammalian cultured cell lines (Bell, R. M., et al., In: The Enzymes, vol.16. New York Academic Press (1983).

[0012] There are two known isoforms of GPAT activity in mammals, one which isolates with the mitochondria, and one with the microsomal, endoplasmic reticulum fraction (Hill, J. O.,et al. Science 280, pp.1371-1374 (1998). These two isoforms can be distinguished by a number of criteria. The mitochondrial GPAT is resistant to inhibition by sulfhydral group modifying reagents such as N-ethylmaleimide (NEM), shows a preference for saturated fatty acyl-CoA, and has a lower Km for fatty acyl-CoA and G-3-P than the microsomal isoform. Additionally, the mitochondrial isoform comprises only about 10% of the overall GPAT activity in most tissues, except in liver where it contributes about 50% of the activity (Haldar, D., et al., J. Biol. Chem. 254, pp.4502-4509 (1979). The mitochondrial GPAT gene transcription and GPAT activity is negatively regulated by starvation, glucagon and strptozotocin induced diabetes, and positively regulated by refeeding fasted animals a high carbohydrate, fat-free diet, and by the administration of insulin to diabetic animals (Dircks, L., et al., Prog. In Lipid Res. 38, pp. 461-479 (1999). Conversely, the microsomal isoform is NEM sensitive and, except as noted below, is largely unaffected by hormonal and nutritional status Dircks, L., et al., Prog. In Lipid Res. 38, pp. 461-479 (1999).

[0013] The major acylation end product from mitochondria is primarily LPA, whereas PA is the major end product in microsomes Dircks, L., Sul, H. S., Lipid Res. 38, pp. 461-479 (1999). The next enzyme in the glycerophospholipid pathway, AGPAT, is present at only small levels in the mitochondria. Presumably, the LPA formed in the mitochondria must be transported to the ER where most of the glycerophospholipid synthesis occurs.

[0014] GPAT activity is increased upon preadipocyte to adipocyte differentiation, and while most of the increase can be attributed to the NEM sensitive microsomal isoform, the mitochondrial isoform mRNA increased 8 fold over the course of differentiation Ericsson, J., et al. J. Biol. Chem. 272, pp. 7298-7305 (1997).

[0015] Mitochondrial GPAT mRNA expression has been shown to increase with ectopic expression of rat adipocyte determination and differentiation factor-1 (ADD1), and that the increase of mitochondrial GPAT mRNA seen during during differentiation can be blocked by ectopic expression of a dominant-negative form of ADD 1 (Ericsson, J., et al. J. Biol. Chem. 272, pp. 7298-7305 (1997). Additionally, the proximal promoter of the murine mitochondrial GPAT was shown to contain consensus binding sites for sterol regulatory element-binding protein-1a (SREBP-1a) and nuclear factor-Y (NF-Y), and that ectopic expression of SREBP-1a stimulated GPAT promoter driven luciferase reporter activity (Ericsson, J., et al., J. Biol. Chem. 272, pp. 7298-7305 (1997).

[0016] Both isoforms of GPAT are membrane associated, which hampers the ability to purify and crystallize them for detailed structural analysis(20). The active site for the microsomal isoform has been determined by proteolysis of intact microsomes, to face the cytosol. It has likewise been concluded that the mitochondrial isoform spans the outer mitochondrial membrane Dircks, L., et al., Prog. In Lipid Res. 38, pp. 461-479 (1999).

[0017] The E. coli. GPAT gene (Larson, T. J., et al., J. Biol. Chem. 255, pp 9421-9426 (1980), and the mouse (Shin, D. H., et al., J. Biol. Chem. 266, pp.23834-23839 (1991), and rat (Bhat, B. G., et al., Biochem. Biophys. Acta. 1439, pp. 415-423 (1999). cDNA for the mitochondrial GPAT have been cloned. Neither the cloning of the microsomal isoform nor the cloning of the human genes has been reported. Recently, a 45 kDa protein with thiol-reagent sensitivite GPAT activity was purified to homogeneity from an oleaginous fungus microsomes (Mishra, S., Biochem. J. 355, pp. 315-322 (2001). This 45 kDa protein is the presumed microsomal GPAT. The rat mitochondrial GPAT cDNA contains an open reading frame of 828 amino acids (aa) encoding a 90 kDa protein that has an 89% homology and a predicted 96% aa identity with the mouse (Bhat, B. G.,et al., Biochem. Biophys. Acta. 1439, pp. 415-423 (1999). There are two membrane spanning domains identified in rat mitochondrial GPAT (Balija, V. S., et al., J. Biol. Chem. 275, pp.31668-31673 (2000), and a conserved stretch of seven amino acids spanning Arg-318 has been shown to be important for acyltransferase activity in the mouse mitochondrial GPAT (Dircks, L. K., et al., J. Biol. Chem. 274, pp.34728-34734 (1999). Based on homology to and site directed mutagenesis of, the E. coli. sequence, and similarities to other acyltransferases, a number of serine, histidine and arginine residues are predicted to be critical for activity Lewin, T. M., et al., Biochemistry 38, pp.5764-5771 (1999).

[0018] Using the above examples, it is clear the availability of a novel cloned glycerol-3-phosphate acyltransferase (GPAT) provides an opportunity for adjunct or replacement therapy, and are useful for the identification of glycerol-3-phosphate acyltransferase agonists, or stimulators (which might stimulate and/or bias glycerol-3-phosphate acyltransferase function), as well as, in the identification of glycerol-3-phosphate acyltransferase inhibitors. All of which might be therapeutically useful under different circumstances.

[0019] The present invention also relates to recombinant vectors, which include the isolated nucleic acid molecules of the present invention, and to host cells containing the recombinant vectors, as well as to methods of making such vectors and host cells, in addition to their use in the production of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1. polypeptides using recombinant techniques. Synthetic methods for producing the polypeptides and polynucleotides of the present invention are provided. Also provided are diagnostic methods for detecting diseases, disorders, and/or conditions related to the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides and polynucleotides, and therapeutic methods for treating such diseases, disorders, and/or conditions. The invention further relates to screening methods for identifying binding partners of the polypeptides.

BRIEF SUMMARY OF THE INVENTION

[0020] The present invention provides isolated nucleic acid molecules, that comprise, or alternatively consist of, a polynucleotide encoding the Mitochondrial GPAT protein having the amino acid sequence shown in FIGS. 1A-C (SEQ ID NO: 2).

[0021] The present invention provides isolated nucleic acid molecules, that comprise, or alternatively consist of, a polynucleotide encoding the Microsomal GPAT_hlog1 protein having the amino acid sequence shown in FIGS. 2A-B (SEQ ID NO: 4).

[0022] The present invention provides isolated nucleic acid molecules, that comprise, or alternatively consist of, a polynucleotide encoding the Microsomal GPAT_hlog2 protein having the amino acid sequence shown in FIGS. 3A-B (SEQ ID NO: 6).

[0023] The present invention provides isolated nucleic acid molecules, that comprise, or alternatively consist of, a polynucleotide encoding the Microsomal GPAT_hlog3 protein having the amino acid sequence shown in FIGS. 4A-B (SEQ ID NO: 8).

[0024] The present invention provides isolated nucleic acid molecules, that comprise, or alternatively consist of, a polynucleotide encoding the Microsomal GPAT_hlog3_v1 protein having the amino acid sequence shown in FIGS. 16A-B (SEQ ID NO: 203) or the amino acid sequence encoded by the cDNA clone, Microsomal GPAT_hlog3_v1 deposited as ATCC Deposit Number PTA-4803 on Nov. 14th, 2002.

[0025] The present invention also relates to recombinant vectors, which include the isolated nucleic acid molecules of the present invention, and to host cells containing the recombinant vectors, as well as to methods of making such vectors and host cells, in addition to their use in the production of Mitochondrial GPAT polynucleotides or polypeptides using recombinant techniques. Synthetic methods for producing the polypeptides and polynucleotides of the present invention are provided. Also provided are diagnostic methods for detecting diseases, disorders, and/or conditions related to the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides and polynucleotides, and therapeutic methods for treating such diseases, disorders, and/or conditions. The invention further relates to screening methods for identifying binding partners of the polypeptides.

[0026] The invention further provides an isolated Mitochondrial GPAT polypeptide having an amino acid sequence encoded by a polynucleotide described herein.

[0027] The invention further provides an isolated Microsomal GPAT_hlog1 polypeptide having an amino acid sequence encoded by a polynucleotide described herein.

[0028] The invention further provides an isolated Microsomal GPAT_hlog2 polypeptide having an amino acid sequence encoded by a polynucleotide described herein.

[0029] The invention further provides an isolated Microsomal GPAT_hlog3 polypeptide having an amino acid sequence encoded by a polynucleotide described herein.

[0030] The invention further relates to a polynucleotide encoding a polypeptide fragment of SEQ ID NO: 2, 4, or 6, or a polypeptide fragment encoded by the cDNA sequence included in the deposited clone, which is hybridizable to SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0031] The invention further relates to a polynucleotide encoding a polypeptide domain of SEQ ID NO: 2, 4, 6, 8, and/or 203 or a polypeptide domain encoded by the cDNA sequence included in the deposited clone, which is hybridizable to SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0032] The invention further relates to a polynucleotide encoding a polypeptide epitope of SEQ ID NO: 2, 4, 6, 8, and/or 203 or a polypeptide epitope encoded by the cDNA sequence included in the deposited clone, which is hybridizable to SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0033] The invention further relates to a polynucleotide encoding a polypeptide of SEQ ID NO: 2, 4, 6, 8, and/or 203 or the cDNA sequence included in the deposited clone, which is hybridizable to SEQ ID NO: 1, 3, 5, 7, and/or 202, having biological activity.

[0034] The invention further relates to a polynucleotide which is a variant of SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0035] The invention further relates to a polynucleotide which is an allelic variant of SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0036] The invention further relates to a polynucleotide which encodes a species homologue of the SEQ ID NO: SEQ ID NO: 2, 4, 6, 8, and/or 203.

[0037] The invention further relates to a polynucleotide which represents the complimentary sequence (antisense) of SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0038] The invention further relates to a polynucleotide capable of hybridizing under stringent conditions to any one of the polynucleotides specified herein, wherein said polynucleotide does not hybridize under stringent conditions to a nucleic acid molecule having a nucleotide sequence of only A residues or of only T residues.

[0039] The invention further relates to an isolated nucleic acid molecule of SEQ ID NO: 2, 4, 6, 8, and/or 203, wherein the polynucleotide fragment comprises a nucleotide sequence encoding an immunoglobulin protein.

[0040] The invention further relates to an isolated nucleic acid molecule of SEQ ID NO: 1, 3, 5, 7, and/or 202 wherein the polynucleotide fragment comprises a nucleotide sequence encoding the sequence identified as SEQ ID NO: 2, 4, 6, 8, and/or 203 or the polypeptide encoded by the cDNA sequence included in the deposited clone, which is hybridizable to SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0041] The invention further relates to an isolated nucleic acid molecule of SEQ ID NO: 1, 3, 5, 7, and/or 202, wherein the polynucleotide fragment comprises the entire nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA sequence included in the deposited clone, which is hybridizable to SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0042] The invention farther relates to an isolated nucleic acid molecule of SEQ ID NO: 1, 3, 5, 7, and/or 202, wherein the nucleotide sequence comprises sequential nucleotide deletions from either the C-terminus or the N-terminus.

[0043] The invention further relates to an isolated polypeptide comprising an amino acid sequence that comprises a polypeptide fragment of SEQ ID NO: 2, 4, 6, 8, and/or 203 or the encoded sequence included in the deposited clone.

[0044] The invention further relates to a polypeptide fragment of SEQ ID NO: 2, 4, 6, 8, and/or 203 or the encoded sequence included in the deposited clone, having biological activity.

[0045] The invention further relates to a polypeptide domain of SEQ ID NO: 2, 4, 6, 8, and/or 203 or the encoded sequence included in the deposited clone.

[0046] The invention further relates to a polypeptide epitope of SEQ ID NO: 2, 4, 6, 8, and/or 203 or the encoded sequence included in the deposited clone.

[0047] The invention further relates to a full length protein of SEQ ID NO: 2, 4, 6, 8, and/or 203 or the encoded sequence included in the deposited clone.

[0048] The invention further relates to a variant of SEQ ID NO: 2, 4, 6, 8, and/or 203.

[0049] The invention further relates to an allelic variant of SEQ ID NO: 2, 4, 6, 8, and/or 203.

[0050] The invention further relates to a species homologue of SEQ ID NO: 2, 4, 6, 8, and/or 203.

[0051] The invention further relates to the isolated polypeptide of of SEQ ID NO: 2, 4, 6, 8, and/or 203, wherein the full length protein comprises sequential amino acid deletions from either the C-terminus or the N-terminus.

[0052] The invention further relates to an isolated antibody that binds specifically to the isolated polypeptide of SEQ ID NO: 2, 4, 6, 8, and/or 203.

[0053] The invention further relates to a method for preventing, treating, or ameliorating a medical condition, comprising administering to a mammalian subject a therapeutically effective amount of the polypeptide of SEQ ID NO: 2, 4, 6, 8, and/or 203 or the polynucleotide of SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0054] The invention further relates to a method of diagnosing a pathological condition or a susceptibility to a pathological condition in a subject comprising the steps of (a) determining the presence or absence of a mutation in the polynucleotide of SEQ ID NO: 1, 3, 5, 7, and/or 202; and (b) diagnosing a pathological condition or a susceptibility to a pathological condition based on the presence or absence of said mutation.

[0055] The invention further relates to a method of diagnosing a pathological condition or a susceptibility to a pathological condition in a subject comprising the steps of (a) determining the presence or amount of expression of the polypeptide of of SEQ ID NO: 2, 4, 6, 8, and/or 203 in a biological sample; and diagnosing a pathological condition or a susceptibility to a pathological condition based on the presence or amount of expression of the polypeptide.

[0056] The invention further relates to a method for identifying a binding partner to the polypeptide of SEQ ID NO: 2, 4, 6, 8, and/or 203 comprising the steps of (a) contacting the polypeptide of SEQ ID NO: 2, 4, 6, 8, and/or 203 with a binding partner; and (b) determining whether the binding partner effects an activity of the polypeptide.

[0057] The invention further relates to a gene corresponding to the cDNA sequence of SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0058] The invention further relates to a method of identifying an activity in a biological assay, wherein the method comprises the steps of expressing SEQ ID NO: 1, 3, 5, 7, and/or 202 in a cell, (b) isolating the supernatant; (c) detecting an activity in a biological assay; and (d) identifying the protein in the supernatant having the activity.

[0059] The invention further relates to a process for making polynucleotide sequences encoding gene products having altered activity selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, and/or 203 activity comprising the steps of (a) shuffling a nucleotide sequence of SEQ ID NO: 1, 3, 5, 7, and/or 202, (b) expressing the resulting shuffled nucleotide sequences and, (c) selecting for altered activity selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, and/or 203 activity as compared to the activity selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, and/or 203 activity of the gene product of said unmodified nucleotide sequence.

[0060] The invention further relates to a shuffled polynucleotide sequence produced by a shuffling process, wherein said shuffled DNA molecule encodes a gene product having enhanced tolerance to an inhibitor of any one of the activities selected from the group consisting of SEQ ID NO: 2, 4, 6, 8, and/or 203 activity.

[0061] The invention further relates to methods of using modulators of the present invention in the treatment of diseases including, but not limited to, obesity, type 2 diabetes, dyslipidermia, cardivascular disease, hypertension, hypercholesterolemia, and some forms of cancer.

[0062] The invention relates to the use of the purified and isolated human mitochondrial GPAT and the human microsomal GPAT_hlog1, GPAT_hlog2 and GPAT_hlog3 DNA sequences in the production of reagents that might be used in assays for the identification of modulators of GPAT function including antibodies for detection, naturally-occuring modulators and small molecule modulators.

[0063] The invention further relates to the use of the protein product isolated from the expression of the human mitochondrial GPAT and the human microsomal GPAT_hlog1, GPAT_hlog2 and GPAT_hlog3 gene products, as well as any homologous product resulting from the genetic manipulation of the structure, for purposes of NMR-based design of modulators of the biological activities of GPAT or other acyltransferases.

[0064] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is an immune disorder

[0065] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is a hematopoietic disorder.

[0066] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is a an inflammatory disorder.

[0067] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is a pulmonary disorder.

[0068] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is a neural disorder.

[0069] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is a metabolic disorder.

[0070] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is a disorder related to abnormal levels of triglyceride.

[0071] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is a disorder related to abnormal levels of LPA.

[0072] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is a disorder related to abnormal levels of PA.

[0073] The invention further relates to a method for preventing, treating, or ameliorating a medical condition with the polypeptide provided as SEQ ID NO: 2, 4, 6, 8, and/or 203, in addition to, its encoding nucleic acid, wherein the medical condition is a disorder related to abnormal levels of DAG.

[0074] The invention further relates to a method of identifying a compound that modulates the biological activity of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1, comprising the steps of, (a) combining a candidate modulator compound with Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 having the sequence set forth in one or more of SEQ ID NO: 2; and measuring an effect of the candidate modulator compound on the activity of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1.

[0075] The invention further relates to a method of identifying a compound that modulates the biological activity of a acyltransferases, comprising the steps of, (a) combining a candidate modulator compound with a host cell expressing Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 having the sequence as set forth in SEQ ID NO: 2; and, (b) measuring an effect of the candidate modulator compound on the activity of the expressed Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1.

[0076] The invention further relates to a method of identifying a compound that modulates the biological activity of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1, comprising the steps of, (a) combining a candidate modulator compound with a host cell containing a vector described herein, wherein Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 is expressed by the cell; and, (b) measuring an effect of the candidate modulator compound on the activity of the expressed Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1.

[0077] The invention further relates to a method of screening for a compound that is capable of modulating the biological activity of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1, comprising the steps of: (a) providing a host cell described herein; (b) determining the biological activity of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 in the absence of a modulator compound; (c) contacting the cell with the modulator compound; and (d) determining the biological activity of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 in the presence of the modulator compound; wherein a difference between the activity of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 in the presence of the modulator compound and in the absence of the modulator compound indicates a modulating effect of the compound.

[0078] The invention further relates to a compound that modulates the biological activity of human Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 as identified by the methods described herein.

[0079] The present invention also provides structure coordinates of the three dimensional homology models of GPAT_hlog1, GPAT_hlog3 and mitochondrial GPAT. The complete coordinates are listed in Table IV, Table V and Table VI. The model present in this invention further provides a basis for designing stimulators and inhibitors or antagonists of one or more of the biological functions of GPAT_log1 GPAT_hlog3 and mitochondrial GPAT, or of mutants with altered specificity.

BRIEF DESCRIPTION OF THE FIGURES/DRAWINGS

[0080] FIGS. 1A-C show the polynucleotide sequence (SEQ ID NO: 1) and deduced amino acid sequence (SEQ ID NO: 2) of the novel human glycerol-3-phosphate acyltransferase, Mitochondrial GPAT, of the present invention. The standard one-letter abbreviation for amino acids is used to illustrate the deduced amino acid sequence. The polynucleotide sequence contains a sequence of 2478 nucleotides (SEQ ID NO: 1), encoding a polypeptide of 826 amino acids (SEQ ID NO: 2). An analysis of the Mitochondrial GPAT polypeptide determined that it comprised the following features: two transmembrane domains (TM1-TM2) located from about amino acid 471 to about amino acid 491 (TM1), and/or from about amino acid 572 to about amino acid 592 (TM2) of SEQ ID NO: 2 represented by double underlining; a conserved cAMP-dependent protein kinase phosphorylation site from amino acid 796 to amino acid 799 of SEQ ID NO: 2 represented by dark shading; four conserved catalytic/functional domain Blocks (Blocks I, II, III, and IV) located from about amino acid 225 to about amino acid 237 (Block I), from about amino acid 270 to about amino acid 276 (Block II), from about amino acid 310 to about amino acid 321 (Block III), and/or from about amino acid 345 to about amino acid 352 (Block IV) of SEQ ID NO: 2 represented by light shading; conserved residues that are essential for catalytic activity located at amino acid 228, 233, 314, and 349 of SEQ ID NO: 2 represented by arrows below each amino acid (“↑”); and conserved residures that are essential for ligand binding located at amino acid 275, 313, and 317 SEQ ID NO: 2 represented by an asterisk below each amino acid (“*”),

[0081] FIGS. 2A-B show the polynucleotide sequence (SEQ ID NO: 3) and deduced amino acid sequence (SEQ ID NO: 4) of the novel human glycerol-3-phosphate acyltransferase, Microsomal GPAT_hlog1, of the present invention. The standard one-letter abbreviation for amino acids is used to illustrate the deduced amino acid sequence. The polynucleotide sequence contains a sequence of 1632 nucleotides (SEQ ID NO: 3), encoding a polypeptide of 542 amino acids (SEQ ID NO: 4). An analysis of the Microsomal GPAT_hlog1 polypeptide determined that it comprised the following features: two transmembrane domains (TM1-TM2) located from about amino acid 100 to about amino acid 116 (TM1), and/or from about amino acid 140 to about amino acid 156 (TM2) of SEQ ID NO: 4 represented by double underlining; conserved residues that are essential for catalytic activity located at amino acid 178, 183, 253, and 277 of SEQ ID NO: 4 represented by arrows below each amino acid (“↑”); and conserved residures that are essential for ligand binding located at amino acid 198, 252, and 256 SEQ ID NO: 4 represented by an asterisk below each amino acid (“*”).

[0082] FIGS. 3A-B show the polynucleotide sequence (SEQ ID NO: 5) and deduced amino acid sequence (SEQ ID NO: 6) of the partial novel human glycerol-3-phosphate acyltransferase, Microsomal GPAT_hlog2, of the present invention. The standard one-letter abbreviation for amino acids is used to illustrate the deduced amino acid sequence. The polynucleotide sequence contains a sequence of 1612 nucleotides (SEQ ID NO: 5), encoding a polypeptide of 502 amino acids (SEQ ID NO: 6). An analysis of the Microsomal GPAT_hlog2 polypeptide determined that it comprised the following features: one transmembrane domain (TM1) located from about amino acid 26 to about amino acid 46 (TM1) of SEQ ID NO: 6 represented by double underlining; conserved residues that are essential for catalytic activity located at amino acid 103, 108, 177, and 201 of SEQ ID NO: 6 represented by arrows below each amino acid (“|”); and conserved residures that are essential for ligand binding located at amino acid 145, 176, and 180 SEQ ID NO: 6 represented by an asterisk below each amino acid (“*”).

[0083] FIGS. 4A-B show the polynucleotide sequence (SEQ ID NO: 7) and deduced amino acid sequence (SEQ ID NO: 8) of the novel human glycerol-3-phosphate acyltransferase, Microsomal GPAT_hlog3, of the present invention. The standard one-letter abbreviation for amino acids is used to illustrate the deduced amino acid sequence. The polynucleotide sequence contains a sequence of 1912 nucleotides (SEQ ID NO: 8), encoding a polypeptide of 544 amino acids (SEQ ID NO: 8). An analysis of the Microsomal GPAT_hlog3 polypeptide determined that it comprised the following features: four transmembrane domains (TM1-TM4) located from about amino acid 70 to about amino acid 86 (TM1), from about amino acid 113 to about amino acid 133 (TM2), from about amino acid 143 to about amino acid 164 (TM3), and/or from about amino acid 261 to about amino acid 278 (TM4) of SEQ ID NO: 8 represented by double underlining; conserved residues that are essential for catalytic activity located at amino acid 146, 151, 221, and 245 of SEQ ID NO: 8 represented by arrows below each amino acid (“↑”); and conserved residures that are essential for ligand binding located at amino acid 189, 220, and 224 SEQ ID NO: 8 represented by an asterisk below each amino acid (“*”).

[0084] FIGS. 5A-B show the regions of identity and similarity between the Mitochondrial GPAT (SEQ ID NO: 2) to other glycerol-3-phosphate acyltransferases, specifically, the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and the rat mitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 10)). The alignment was created using the CLUSTALW algorithm as provided in the Vector NTI AlignX program (Vector NTI Version 5.5) as described elsewhere herein using default parameters (CLUSTALW parameters: gap opening penalty: 10; gap extension penalty: 0.5; gap separation penalty range: 8; percent identity for alignment delay: 40%; and transition weighting: 0). The darkly shaded amino acids represent regions of matching identity. The lightly shaded amino acids represent regions of matching similarity. Dots between residues indicate gapped regions for the aligned polypeptides.

[0085] FIGS. 6A-C show the regions of identity and similarity between the Microsomal GPAT_hlog1 (SEQ ID NO: 4), Microsomal GPAT_hlog2 (SEQ ID NO: 6), and Microsomal GPAT_hlog3 (SEQ ID NO: 8) of the present invention to the human the Mitochondrial GPAT (SEQ ID NO: 2) of the present invention and the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9). The alignment was created using the CLUSTALW algorithm as provided in the Vector NTI AlignX program (Vector NTI Version 5.5) as described elsewhere herein using default parameters (CLUSTALW parameters: gap opening penalty: 10; gap extension penalty: 0.5; gap separation penalty range: 8; percent identity for alignment delay: 40%; and transition weighting: 0). The darkly shaded amino acids represent regions of matching identity. The lightly shaded amino acids represent regions of matching similarity. Dots between residues indicate gapped regions for the aligned polypeptides.

[0086] FIG. 7 shows an expression profile of the novel human mitochondrial glycerol-3-phosphate acyltransferase, Mitochondrial GPAT. The figure illustrates the relative expression level of Mitochondrial GPAT amongst various mRNA tissue, cells, and cell line sources. As shown, transcripts corresponding to Mitochondrial GPAT expressed predominately in liver tissue. The Mitochondrial GPAT polypeptide was also expressed to a lesser extent in the small intestine, kidney, and other tissues as shown. Expression data was obtained by measuring the steady state Mitochondrial GPAT mRNA levels by RT-PCR using the PCR primer pair provided as SEQ ID NO: 18 and 19 as described herein.

[0087] FIG. 8 shows an expression profile of the novel human microsomal glycerol-3-phosphate acyltransferase, Microsomal GPAT_hlog1. The figure illustrates the relative expression level of Microsomal GPAT_hlog1 amongst various mRNA tissue, cells, and cell line sources. As shown, transcripts corresponding to Microsomal GPAT_hlog1 expressed predominately in small intestine tissue. The Microsomal GPAT_hlog1 polypeptide was also expressed signficantly in the lung, spleen, and to a lesser extent in other tissues as shown. Expression data was obtained by measuring the steady state Microsomal GPAT_hlog1 mRNA levels by RT-PCR using the PCR primer pair provided as SEQ ID NO: 20 and 21 as described herein.

[0088] FIG. 9 shows an expression profile of the novel human microsomal glycerol-3-phosphate acyltransferase, Microsomal GPAT_hlog2. The figure illustrates the relative expression level of Microsomal GPAT_hlog2 amongst various mRNA tissue, cells, and cell line sources. As shown, transcripts corresponding to Microsomal GPAT_hlog2 expressed predominately in lung tissue. The Microsomal GPAT_hlog2 polypeptide was also expressed signficantly in the spleen, and to a lesser extent in other tissues as shown. Expression data was obtained by measuring the steady state Microsomal GPAT_hlog2 mRNA levels by RT-PCR using the PCR primer pair provided as SEQ ID NO: 22 and 23 as described herein.

[0089] FIG. 10 shows an expression profile of the novel human microsomal glycerol-3-phosphate acyltransferase, Microsomal GPAT_hlog3. The figure illustrates the relative expression level of Microsomal GPAT_hlog3 amongst various mRNA tissue, cells, and cell line sources. As shown, transcripts corresponding to Microsomal GPAT_hlog3 expressed predominately in bone marrow tissue. The Microsomal GPAT_hlog3 polypeptide was also expressed signficantly in the spinal cord, and to a lesser extent in other tissues as shown. Expression data was obtained by measuring the steady state Microsomal GPAT_hlog3 mRNA levels by RT-PCR using the PCR primer pair provided as SEQ ID NO: 24 and 25 as described herein.

[0090] FIG. 11 shows a table illustrating the percent identity and percent similarity between the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, and Microsomal GPAT_hlog3 polypeptides of the present invention with the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and the rat mitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 10)). The percent identity and percent similarity values were determined based upon the GAP algorithm (GCG suite of programs; and Henikoff, S. and Henikoff, J. G., Proc. Natl. Acad. Sci. USA 89: 10915-10919(1992)).

[0091] FIG. 12 shows an expanded expression profile of the novel human glycerol-3-phosphate acyltransferase, Mitochondrial GPAT. The figure illustrates the relative expression level of Mitochondrial GPAT amongst various mRNA tissue sources. As shown, the Mitochondrial GPAT polypeptide was expressed predominately in the liver, and breast. Expression of Mitochondrial GPAT was also significantly expressed in the adipose, adrenal gland, and to a lesser extent in other tissues as shown. Expression data was obtained by measuring the steady state Mitochondrial GPAT mRNA levels by quantitative PCR using the PCR primer pair provided as SEQ ID NO: 190 and 191, and Taqman probe (SEQ ID NO: 192) as described in Example 6 herein.

[0092] FIG. 13 shows an expanded expression profile of the novel human glycerol-3-phosphate acyltransferase, Microsomal GPAT_hlog1. The figure illustrates the relative expression level of Microsomal GPAT_hlog1 amongst various mRNA tissue sources. As shown, the Microsomal GPAT_hlog1 polypeptide was expressed predominately in the brain, and a number of brain sub-regions including nucleus accubens, cerebellum, frontal cortex, occipital lobe, parietal lobe, caudate, and substantia nigia, among others. Expression of Microsomal GPAT_hlog1 was also significantly expressed in gastrointestinal tissues, including the colon, caecum, ileum, jejunam, and to a lesser extent in other tissues as shown. Expression data was obtained by measuring the steady state Microsomal GPAT_hlog1 mRNA levels by quantitative PCR using the PCR primer pair provided as SEQ ID NO: 193 and 194, and Taqman probe (SEQ ID NO: 195) as described in Example 6 herein.

[0093] FIG. 14 shows an expanded expression profile of the novel human glycerol-3-phosphate acyltransferase, Microsomal GPAT_hlog2. The figure illustrates the relative expression level of Microsomal GPAT_hlog2 amongst various mRNA tissue sources. As shown, the Microsomal GPAT_hlog2 polypeptide was expressed predominately in the parenchyma of the lung. Expression of Microsomal GPAT_hlog2 was also significantly expressed in the tertiary bronchus of the lung, spleen, and to a lesser extent in other tissues as shown. Expression data was obtained by measuring the steady state Microsomal GPAT_hlog2 mRNA levels by quantitative PCR using the PCR primer pair provided as SEQ ID NO: 196 and 197, and Taqman probe (SEQ ID NO: 198) as described in Example 6 herein.

[0094] FIG. 15 shows an expanded expression profile of the novel human glycerol-3-phosphate acyltransferase, Microsomal GPAT_hlog3. The figure illustrates the relative expression level of Microsomal GPAT_hlog3 amongst various mRNA tissue sources. As shown, the Microsomal GPAT_hlog3 polypeptide was expressed predominately in the thyroid gland. Expression of Microsomal GPAT_hlog3 was also significantly expressed in the uterus, vas deferens, and to a lesser extent in other tissues as shown. Expression data was obtained by measuring the steady state Microsomal GPAT_hlog3 mRNA levels by quantitative PCR using the PCR primer pair provided as SEQ ID NO: 199 and 200, and Taqman probe (SEQ ID NO: 201) as described in Example 6 herein.

[0095] FIGS. 16A-B show the polynucleotide sequence (SEQ ID NO: 202) and deduced amino acid sequence (SEQ ID NO: 203) of the novel human glycerol-3-phosphate acyltransferase variant, Microsomal GPAT_hlog3_v1, of the present invention. The standard one-letter abbreviation for amino acids is used to illustrate the deduced amino acid sequence. The polynucleotide sequence contains a sequence of 1875 nucleotides (SEQ ID NO: 202), encoding a polypeptide of 517 amino acids (SEQ ID NO: 203). An analysis of the Microsomal GPAT_hlog3 polypeptide determined that it comprised the following features: four transmembrane domains (TM1-TM4) located from about amino acid 43 to about amino acid 59 (TMI), from about amino acid 86 to about amino acid 106 (TM2), from about amino acid 116 to about amino acid 137 (TM3), and/or from about amino acid 234 to about amino acid 251 (TM4) of SEQ ID NO: 203 represented by double underlining; conserved residues that are essential for catalytic activity located at amino acid 119, 124, 194, and 218 of SEQ ID NO: 203 represented by arrows below each amino acid (“↑”); and conserved residures that are essential for ligand binding located at amino acid 162, 193, and 197 SEQ ID NO: 203 represented by an asterisk below each amino acid (“*”).

[0096] FIG. 17 shows a sequence alignment of the conceptual translated sequence of the microsomal GPAT_hlog1 polypeptide (SEQ ID NO: 4) of the present invention with the glycerol-3-phosphate acyltransferase (Protein Data Bank entry 1K30 chain A; SEQ ID NO: 204). These data were used as the basis for building the homology model as represented in Table IV. Amino acids defining the catalytic and active site regions are highlighted with either an asterisk (“*”) or a plus sign (“+”), respectively.

[0097] FIG. 18 shows the three-dimensional homology model of the GPAT_hlog1 polypeptide (residues L43 to R422 of SEQ ID NO: 4). The model is based upon an alignment to a structural homologue squash chloroplast glycerol-3-phosphate acyltransferase, PDB code 1K30 (chain A) (SEQ ID NO: 204) that was used as the basis for building the homology model as represented in Table IV.

[0098] FIG. 19 shows the three-dimensional homology model of the GPAT_hlog1 polypeptide active site of SEQ ID NO: 4. The putative catalytic residues are shown H178 and D183 as well as substrate binding site residues.

[0099] FIG. 20 shows a comparison of the energy of the GPAT_hlog1 model to that of the squash glycerol-3-phosphate acyltransferase structural template (Protein Data Bank code, 1K30). The GPAT_hlog1 model is represented by the dotted (dashed) line and the squash protein is represented in the solid line. As shown, the 3D homology model of the GPAT_hlog1 polypeptide represents an accurate representation of the native three dimensional structure of the GPAT_hlog1 polypeptide.

[0100] FIG. 21 shows a sequence alignment of the conceptual translated sequence of the microsomal GPAT_hlog3 polypeptide (SEQ ID NO: 8) of the present invention with the glycerol-3-phosphate acyltransferase (Protein Data Bank entry 1K30 chain A; SEQ ID NO: 204). These data were used as the basis for building the homology model as represented in Table V. Amino acids defining the catalytic and active site regions are highlighted with either an asterisk (“*”) or a plus sign (“+”), respectively.

[0101] FIG. 22 shows the three-dimensional homology model of the GPAT_hlog3 polypeptide (residues P27 to S427 of SEQ ID NO: 8). The model is based upon an alignment to a structural homologue squash chloroplast glycerol-3-phosphate acyltransferase, PDB code 1K30 (chain A) (SEQ ID NO: 204) that was used as the basis for building the homology model as represented in Table V.

[0102] FIG. 23 shows the three-dimensional homology model of the GPAT_hlog3 polypeptide active site of SEQ ID NO: 8. The putative catalytic residues are shown H146 and D151 as well as substrate binding site residues.

[0103] FIG. 24 shows a comparison of the energy of the GPAT_hlog3 model to that of the squash glycerol-3-phosphate acyltransferase structural template (Protein Data Bank code, 1K30). The GPAT_hlog3 model is represented by the dotted (dashed) line and the squash protein is represented in the solid line. As shown, the 3D homology model of the GPAT_hlog3 polypeptide represents an accurate representation of the native three dimensional structure of the GPAT_hlog3 polypeptide.

[0104] FIG. 25 shows a sequence alignment of the conceptual translated sequence of the mitochondrial GPAT polypeptide (SEQ ID NO: 2) of the present invention with the glycerol-3-phosphate acyltransferase (Protein Data Bank entry 1K30 chain A; SEQ ID NO: 204). These data were used as the basis for building the homology model as represented in Table VI. Amino acids defining the catalytic and active site regions are highlighted with either an asterisk (“*”) or a plus sign (“+”), respectively.

[0105] FIG. 26 shows the three-dimensional homology model of the mitochondrial GPAT polypeptide (residues R57 to I493 of SEQ ID NO: 2). The model is based upon an alignment to a structural homologue squash chloroplast glycerol-3-phosphate acyltransferase, PDB code 1K30 (chain A) (SEQ ID NO: 204) that was used as the basis for building the homology model as represented in Table VI.

[0106] FIG. 27 shows the three-dimensional homology model of the mitochondrial GPAT polypeptide active site of SEQ ID NO: 2. The putative catalytic residues are shown H227 and D232 as well as substrate binding site residues.

[0107] FIG. 28 shows a comparison of the energy of the mitochondrial GPAT model to that of the squash glycerol-3-phosphate acyltransferase structural template (Protein Data Bank code, 1K30). The mitochondrial GPAT model is represented by the dotted (dashed) line and the squash protein is represented in the solid line. As shown, the 3D homology model of the mitochondrial GPAT polypeptide represents an accurate representation of the native three dimensional structure of the mitochondrial GPAT polypeptide.

[0108] Table I provides a summary of the novel polypeptides and their encoding polynucleotides of the present invention.

[0109] Table II illustrates the preferred hybridization conditions for the polynucleotides of the present invention. Other hybridization conditions may be known in the art or are described elsewhere herein.

[0110] Table III provides a summary of various conservative substitutions encompassed by the present invention.

[0111] Table IV provides the structural coordinates of the three dimensional structure of the microsomal GPAT_hlog1 polypeptide (SEQ ID NO: 4) of the present invention.

[0112] Table V provides the structural coordinates of the three dimensional structure of the microsomal GPAT_hlog3 polypeptide (SEQ ID NO: 8) of the present invention.

[0113] Table VI provides the structural coordinates of the three dimensional structure of the mitochondrial GPAT polypeptide (SEQ ID NO: 2) of the present invention.

DETAILED DESCRIPTION OF THE INVENTION

[0114] The present invention may be understood more readily by reference to the following detailed description of the preferred embodiments of the invention and the Examples included herein.

[0115] The invention provides a novel human sequence that potentially encodes a glycerol-3-phosphate acyltransferase called Mitochondrial GPAT. Mitochondrial GPAT shares significant homologue with other glycerol-3-phosphate acyltransferases, such as the mouse and rat mitochondrial glycerol-3-phosphate acyltransferase. Transcripts for Mitochondrial GPAT are found primarily in the liver suggesting that the invention potentially modulates metabolic processes, triglyceride levels, fatty acyl-CoA flux into either glycerophospholipid synthesis or into, β-oxidation in the liver.

[0116] The invention provides a novel human sequence that potentially encodes a glycerol-3-phosphate acyltransferase called Microsomal GPAT_hlog1. Microsomal GPAT_hlog1 shares significant homologue with the Mitochondrial GPAT of the present invention, and the mouse GPAT. Transcripts for Microsomal GPAT_hlog1 are found in uterus and testis tissue suggesting that the invention potentially modulates reproductive processes. The Microsomal GPAT_hlog1 polypeptide may potentially modulate metabolic processes, triglyceride levels, fatty acyl-CoA flux into either glycerophospholipid synthesis or into β-oxidation in these tissues.

[0117] The invention provides a novel human sequence that potentially encodes a glycerol-3-phosphate acyltransferase called Microsomal GPAT_hlog2. Microsomal GPAT_hlog2 shares significant homologue with the Mitochondrial GPAT of the present invention, and the mouse GPAT. Transcripts for Microsomal GPAT hlog2 are found in heart, brain, stomach, kidney suggesting that the invention potentially modulates metabolic processes, triglyceride levels, fatty acyl-CoA flux into either glycerophospholipid synthesis or into β-oxidation in these tissues.

[0118] The invention provides a novel human sequence that potentially encodes a glycerol-3-phosphate acyltransferase called Microsomal GPAT_hlog3. Microsomal GPAT_hlog3 shares significant homologue with the Mitochondrial GPAT of the present invention, and the mouse GPAT. Transcripts for Microsomal GPAT_hlog2 are found in heart, brain, stomach, kidney suggesting that the invention potentially modulates metabolic processes, triglyceride levels, fatty acyl-CoA flux into either glycerophospholipid synthesis or into β-oxidation in these tissues.

[0119] In the present invention, “isolated” refers to material removed from its original environment (e.g., the natural environment if it is naturally occurring), and thus is altered “by the hand of man” from its natural state. For example, an isolated polynucleotide could be part of a vector or a composition of matter, or could be contained within a cell, and still be “isolated” because that vector, composition of matter, or particular cell is not the original environment of the polynucleotide. The term “isolated” does not refer to genomic or cDNA libraries, whole cell total or mRNA preparations, genormic DNA preparations (including those separated by electrophoresis and transferred onto blots), sheared whole cell genomic DNA preparations or other compositions where the art demonstrates no distinguishing features of the polynucleotide/sequences of the present invention.

[0120] In specific embodiments, the polynucleotides of the invention are at least 15, at least 30, at least 50, at least 100, at least 125, at least 500, or at least 1000 continuous nucleotides but are less than or equal to 300 kb, 200 kb, 100 kb, 50 kb, 15 kb, 10 kb, 7.5 kb, 5 kb, 2.5 kb, 2.0 kb, or 1 kb, in length. In a further embodiment, polynucleotides of the invention comprise a portion of the coding sequences, as disclosed herein, but do not comprise all or a portion of any intron. In another embodiment, the polynucleotides comprising coding sequences do not contain coding sequences of a genomic flanking gene (i.e., 5′ or 3′ to the gene of interest in the genome). In other embodiments, the polynucleotides of the invention do not contain the coding sequence of more than 1000, 500, 250, 100, 50, 25, 20, 15, 10, 5, 4, 3, 2, or 1 genomic flanking gene(s).

[0121] As used herein, a “polynucleotide” refers to a molecule having a nucleic acid sequence contained in SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, or the cDNA contained within the clone deposited with the ATCC. For example, the polynucleotide can contain the nucleotide sequence of the full length cDNA sequence, including the 5′ and 3′ untranslated sequences, the coding region, with or without a signal sequence, the secreted protein coding region, as well as fragments, epitopes, domains, and variants of the nucleic acid sequence. Moreover, as used herein, a “polypeptide” refers to a molecule having the translated amino acid sequence generated from the polynucleotide as broadly defined.

[0122] In the present invention, the full length sequence identified as SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, and SEQ ID NO: 7, was often generated by overlapping sequences contained in multiple clones (contig analysis). A representative clone containing all or most of the sequence for SEQ ID NO: 7 and SEQ ID NO: 202, was deposited with the American Type Culture Collection (“ATCC”). As shown in Table 1, each clone is identified by a cDNA Clone ID (Identifier) and the ATCC Deposit Number. The ATCC is located at 10801 University Boulevard, Manassas, Virginia 20110-2209, USA. The ATCC deposit was made pursuant to the terms of the Budapest Treaty on the international recognition of the deposit of microorganisms for purposes of patent procedure. The deposited clone is inserted in the pTOPO plasmid accordinging to the methodology provided by the manufacturer.

[0123] Unless otherwise indicated, all nucleotide sequences determined by sequencing a DNA molecule herein were determined using an automated DNA sequnencer (such as the Model 373, preferably a Model 3700, from Applied Biosystems, Inc.), and all amino acid sequences of polypeptides encoded by DNA molecules determined herein were pridcted by translation of a DNA sequence determined above. Therefore, as is known in the art for any DNA seuqnece determined by this automated approach, any nucleotide seqence determined herein may contain some errors. Nucleotide sequences determined by automation are typically at least about 90% identical, more typically at least about 95% to at least about 99.9% identical to the actual nucleotide seqnece of the sequenced DNA molecule. The actual sequence can be more precisely determined by other approaches including manual DNA sequencing methods well known in the art. As is also known in the art, a single insertion or deletion in a determined nucleotide sequence compared to the actual sequence will cause a frame shift in translation of the nucleotide sequence such that the predicted amino acid sequence encoded by a determined nucleotide sequence will be completely different from the amino acid sequence actually encoded bt the sequenced DNA molecule, beginning at the point of such an insertion or deletion.

[0124] Using the information provided herein, such as the nucleotide sequence in FIGS. 1A-C (SEQ ID NO: 1), a nucleic acid molecule of the present invention encoding the Mitochondrial GPAT polypeptide may be obtained using standard cloning and screening procedures, such as those for cloning cDNAs using mRNA as starting material.

[0125] The determined nucleotide sequence of the Mitochondrial GPAT cDNA in FIGS. 1A-C (SEQ ID NO: 1) contains an open reading frame encoding a protein of about 826 amino acid residues, with a deduced molecular weight of about 93.6 kDa. The amino acid sequence of the predicted Mitochondrial GPAT polypeptide is shown in FIGS. 1A-C (SEQ ID NO: 2).

[0126] Using the information provided herein, such as the nucleotide sequence in FIGS. 2A-B (SEQ ID NO: 3), a nucleic acid molecule of the present invention encoding the Microsomal GPAT_hlog1 polypeptide may be obtained using standard cloning and screening procedures, such as those for cloning cDNAs using mRNA as starting material.

[0127] The determined nucleotide sequence of the Microsomal GPAT_hlog1 cDNA in FIGS. 2A-B (SEQ ID NO: 3) contains an open reading frame encoding a protein of about 542 amino acid residues, with a deduced molecular weight of about 59.2 kDa. The amino acid sequence of the predicted Microsomal GPAT_hlog1 polypeptide is shown in FIGS. 2A-B (SEQ ID NO: 4).

[0128] Using the information provided herein, such as the nucleotide sequence in FIGS. 3A-B (SEQ ID NO: 5), a nucleic acid molecule of the present invention encoding the Microsomal GPAT_hlog2 polypeptide may be obtained using standard cloning and screening procedures, such as those for cloning cDNAs using mRNA as starting material.

[0129] The determined nucleotide sequence of the Microsomal GPAT_hlog2 cDNA in FIGS. 3A-B (SEQ ID NO: 5) contains an open reading frame encoding a protein of about 502 amino acid residues, with a deduced molecular weight of about 56.0 kDa. The amino acid sequence of the predicted Microsomal GPAT_hlog2 polypeptide is shown in FIGS. 3A-B (SEQ ID NO: 6).

[0130] Using the information provided herein, such as the nucleotide sequence in FIGS. 4A-B (SEQ ID NO: 7), a nucleic acid molecule of the present invention encoding the Microsomal GPAT_hlog3 polypeptide may be obtained using standard cloning and screening procedures, such as those for cloning cDNAs using mRNA as starting material.

[0131] The determined nucleotide sequence of the Microsomal GPAT_hlog3 cDNA in FIGS. 4A-B (SEQ ID NO: 7) contains an open reading frame encoding a protein of about 544 amino acid residues, with a deduced molecular weight of about 60.1 kDa. The amino acid sequence of the predicted Microsomal GPAT_hlog3 polypeptide is shown in FIGS. 4A-B (SEQ ID NO: 8).

[0132] A “polynucleotide” of the present invention also includes those polynucleotides capable of hybridizing, under stringent hybridization conditions, to sequences contained in SEQ ID NO: 1, SEQ ID NO: 3, SEQ ID NO: 5, SEQ ID NO: 7, SEQ ID NO: 202, the complements thereof, the sequences encoding the polypeptide sequences contained in SEQ ID NO: 2, SEQ ID NO: 4, SEQ ID NO: 6, SEQ ID NO: 8, SEQ ID NO: 203, the complements thereof, or the cDNA(s) within the clone(s) deposited with the ATCC. “Stringent hybridization conditions” refers to an overnight incubation at 42 degree C. in a solution comprising 50% formamide, 5×SSC (750 mM NaCl, 75 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5×Denhardt's solution, 10% dextran sulfate, and 20 μg/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 0.1×SSC at about 65 degree C.

[0133] Also contemplated are nucleic acid molecules that hybridize to the polynucleotides of the present invention at lower stringency hybridization conditions. Changes in the stringency of hybridization and signal detection are primarily accomplished through the manipulation of formamide concentration (lower percentages of formamide result in lowered stringency); salt conditions, or temperature. For example, lower stringency conditions include an overnight incubation at 37 degree C. in a solution comprising 6×SSPE (20×SSPE=3M NaCl; 0.2M NaH2PO4; 0.02M EDTA, pH 7.4), 0.5% SDS, 30% formamide, 100 ug/ml salmon sperm blocking DNA; followed by washes at 50 degree C. with 1×SSPE, 0.1% SDS. In addition, to achieve even lower stringency, washes performed following stringent hybridization can be done at higher salt concentrations (e.g. 5×SSC).

[0134] Note that variations in the above conditions may be accomplished through the inclusion and/or substitution of alternate blocking reagents used to suppress background in hybridization experiments. Typical blocking reagents include Denhardt's reagent, BLOTTO, heparin, denatured salmon sperm DNA, and commercially available proprietary formulations. The inclusion of specific blocking reagents may require modification of the hybridization conditions described above, due to problems with compatibility.

[0135] Of course, a polynucleotide which hybridizes only to polyA+ sequences (such as any 3′ terminal polyA+ tract of a cDNA shown in the sequence listing), or to a omplementary stretch of T (or U) residues, would not be included in the definition of “polynucleotide,” since such a polynucleotide would hybridize to any nucleic acid molecule containing a poly (A) stretch or the complement thereof (e.g., practically any double-stranded cDNA clone generated using oligo dT as a primer).

[0136] The polynucleotide of the present invention can be composed of any polyribonucleotide or polydeoxribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. For example, polynucleotides can be composed of single- and double-stranded DNA, DNA that is a mixture of single- and double-stranded regions, single- and double-stranded RNA, and RNA that is mixture of single- and double-stranded regions, hybrid molecules comprising DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single- and double-stranded regions. In addition, the polynucleotide can be composed of triple-stranded regions comprising RNA or DNA or both RNA and DNA. A polynucleotide may also contain one or more modified bases or DNA or RNA backbones modified for stability or for other reasons. “Modified” bases include, for example, tritylated bases and unusual bases such as inosine. A variety of modifications can be made to DNA and RNA; thus, “polynucleotide” embraces chemically, enzymatically, or metabolically modified forms.

[0137] The polypeptide of the present invention can be composed of amino acids joined to each other by peptide bonds or modified peptide bonds, i.e., peptide isosteres, and may contain amino acids other than the 20 gene-encoded amino acids. The polypeptides may be modified by either natural processes, such as posttranslational processing, or by chemical modification techniques which are well known in the art. Such modifications are well described in basic texts and in more detailed monographs, as well as in a voluminous research literature. Modifications can occur anywhere in a polypeptide, including the peptide backbone, the amino acid side-chains and the amino or carboxyl termini. It will be appreciated that the same type of modification may be present in the same or varying degrees at several sites in a given polypeptide. Also, a given polypeptide may contain many types of modifications. Polypeptides may be branched, for example, as a result of ubiquitination, and they may be cyclic, with or without branching. Cyclic, branched, and branched cyclic polypeptides may result from posttranslation natural processes or may be made by synthetic methods. Modifications include acetylation, acylation, ADP-ribosylation, amidation, covalent attachment of flavin, covalent attachment of a heme moiety, covalent attachment of a nucleotide or nucleotide derivative, covalent attachment of a lipid or lipid derivative, covalent attachment of phosphotidylinositol, cross-linking, cyclization, disulfide bond formation, demethylation, formation of covalent cross-links, formation of cysteine, formation of pyroglutamate, formylation, gamma-carboxylation, glycosylation, GPI anchor formation, hydroxylation, iodination, methylation, myristoylation, oxidation, pegylation, proteolytic processing, phosphorylation, prenylation, racemization, selenoylation, sulfation, transfer-RNA mediated addition of amino acids to proteins such as arginylation, and ubiquitination. (See, for instance, Proteins—Structure and Molecular Properties, 2nd Ed., T. E. Creighton, W.H. Freeman and Company, New York (1993); Posttranslational Covalent Modification of Proteins, B. C. Johnson, Ed., Academic Press, N.Y., pgs. 1-12 (1983); Seifter et al., Meth Enzymol 182:626-646 (1990); Rattan et al., Ann N.Y. Acad Sci 663:48-62 (1992).)

[0138] “SEQ ID NO: 1”, “SEQ ID NO: 3”, “SEQ ID NO: 5”, “SEQ ID NO: 7”, and “SEQ ID NO: 202” refer to polynucleotide sequences, while “SEQ ID NO: 2”, “SEQ ID NO: 4”, “SEQ ID NO: 6”, “SEQ ID NO: 8”, and “SEQ ID NO: 203” refer to polypeptide sequences, all sequences are identified by an integer in Table 1 herein.

[0139] “A polypeptide having biological activity” refers to polypeptides exhibiting activity similar, but not necessarily identical to, an activity of a polypeptide of the present invention, including mature forms, as measured in a particular biological assay, with or without dose dependency. In the case where dose dependency does exist, it need not be identical to that of the polypeptide, but rather substantially similar to the dose-dependence in a given activity as compared to the polypeptide of the present invention (i.e., the candidate polypeptide will exhibit greater activity or not more than about 25-fold less and, preferably, not more than about tenfold less activity, and most preferably, not more than about three-fold less activity relative to the polypeptide of the present invention).

[0140] As will be appreciated by the skilled practitioner, should the amino acid fragment comprise an antigenic epitope, for example, biological function per se need not be maintained. The terms Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide and Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 protein are used interchangeably herein to refer to the encoded product of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 nucleic acid sequence according to the present invention.

[0141] It is another aspect of the present invention to provide modulators of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 protein and Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 peptide targets which can affect the function or activity of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 in a cell in which Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 function or activity is to be modulated or affected. In addition, modulators of, Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 can affect downstream systems and molecules that are regulated by, or which interact with, Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 in the cell. Modulators of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 include compoutals, materials, agents, drugs, and the like, that antagonize, inhibit, reduce, block, suppress, diminish, decrease, or eliminate Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or MicrosorPal GPAT_hlog3_v1 function and/or activity. Such compounds, materials, agents drugs and the like can be collectively termed “antagonists”. Alternatively, modulators of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 include compounds, materials, agents, drugs, and the like, that agonize, enhance, increase, augment, or amplify Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3 v1 function in a cell. Such compounds, materials, agents, drugs and the like can be collectively termed “agonists”.

[0142] As used herein the terms “modulate” or “modulates” refer to an increase or decrease in the amount, quality or effect of a particular activity, DNA, RNA, or protein. The definition of “modulate” or “modulates” as used herein is meant to encompass agonil/ts and/or antagonists of a particular activity, DNA, RNA, or protein.

[0143] The term “organism” as referred to herein is meant to encompass any organism referehced herein, though preferably to eukaryotic organisms, more preferably to mammals, and most preferably to humans.

[0144] The presvnt invention encompasses the identification of proteins, nucleic acids, or other molecules, that bind to polypeptides and polynucleotides of the present invention (for example, in a receptor-ligand interaction). The polynucleotides of the present invention can also be used in interaction trap assays (such as, for example, that discribed by zenberger and Young (Mol Endocrinol., 9(10):1321-9, (1995); and Ann. N. Y. Acad7Sci., 7;766:279-81, (1995)).

[0145] The polylnucleotide and polypeptides of the present invention are useful as probes for the identification and isolation of full-length cDNAs and/or genomic DNA which correspond to the polynucleotides of the present invention, as probes to hybridize and discover novel, related DNA sequences, as probes for positional cloning of this or a related sequence, as probe to “subtract-out” known sequences in the process of discovering other novel polynucleotides, as probes to quantify gene expression, and as probes for microarays.

[0146] In addition, polynucleotides and polypeptides of the present invention may comprise one, two, three, four, five, six, seven, eight, or more membrane domains.

[0147] Also, in preferred embodiments the present invention provides methods for further refining the biological fuction of the polynucleotides and/or polypeptides of the present invention.

[0148] Specifically, the invention provides methods for using the polynucleotides and polypeptides of the invention to identify orthologs, homologs, paralogs, variants, and/or allelic variants of the invention. Also provided are methods of using the polynucleotides and polypeptides of the invention to identify the entire coding region of the invention, non-coding regions of the invention, regulatory sequences of the invention, and secreted, mature, pro-, prepro-, forms of the invention (as applicable).

[0149] In preferred embodiments, the invention provides methods for identifying the glycosylation sites inherent in the polynucleotides and polypeptides of the invention, and the subsequent alteration, deletion, and/or addition of said sites for a number of desirable characteristics which include, but are not limited to, augmentation of protein folding, inhibition of protein aggregation, regulation of intracellular trafficking to organelles, increasing resistance to proteolysis, modulation of protein antigenicity, and mediation of intercellular adhesion.

[0150] In further preferred embodiments, methods are provided for evolving the polynucleotides and polypeptides of the present invention using molecular evolution techniques in an effort to create and identify novel variants with desired structural, functional, and/or physical characteristics.

[0151] The present invention further provides for other experimental methods and procedures currently available to derive functional assignments. These procedures include but are not limited to spotting of clones on arrays, micro-array technology, PCR based methods (e.g., quantitative PCR), anti-sense methodology, gene knockout experiments, and other procedures that could use sequence information from clones to build a primer or a hybrid partner.

Polynucleotides and Polypeptides of the Invention

Features of the Polypeptide Encoded by Gene No: 1

[0152] The polypeptide of this gene provided as SEQ ID NO: 2 (FIGS. 1A-C), encoded by the polynucleotide sequence according to SEQ ID NO: 1 (FIGS. 1A-C), and/or encoded by the polynucleotide contained within the deposited clone, Mitochondrial GPAT, has significant homology at the nucleotide and amino acid level to other glycerol-3-phosphate acyltransferases, specifically, the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and the rat mitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 10)). An alignment of the Mitochondrial GPAT polypeptide with these proteins is provided in FIGS. 5A-B.

[0153] The Mitochondrial GPAT polypeptide was determined to share 92.7% identity and 95% similarity with the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and to share 91.8% identity and 94.3% similarity with the rat mitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 10)) as shown in FIG. 14.

[0154] Based upon the strong identity between the mouse and rat GPAT proteins, the human Mitochondrial GPAT of the present invention is believed to represent the human ortholog of the mouse and rat GPAT proteins.

[0155] Based upon the observed homology, the polypeptide of the present invention is expected to share at least some biological activity with other glycerol-3-phosphate acyltransferases, specifically with the mouse and rat GPAT proteins, particularly with GPATs found in the liver, in addition to, other glycerol-3-phosphate acyltransferases referenced elsewhere herein.

[0156] The Mitochondrial GPAT homologue was determined to comprise two putative transmembrane domains located from about amino acid residue 471 to about amino acid residue 491 (TM1), and/or from about amino acid residue 572 to about amino acid residue 592 of SEQ ID NO: 2 as predicted by aligning the rat mitochondrial GPAT polypeptide sequence to SEQ ID NO: 2. Both transmembrane domains are believed to affect the orientation of the human mitochondrial GPAT orientation in the same way as the rat mitochondrial GPAT such that in the region between the two transmembrane domains, human amino acid 492 to about amino acid 571 of SEQ ID NO: 2, is cytosolic and that the N and C terminal domains are sequesterd on the inner side of the mitochondrial outer membrane.

[0157] In preferred embodiments, the following transmembrane domain polypeptides are encompassed by the present invention: LFTASKSCAIMSTHIVACLLL (SEQ ID NO: 26), and/or NGVLHVFIMEAIIACSLYAVL (SEQ ID NO: 27). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Mitochondrial GPAT transmembrane polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0158] The present invention also encompasses the polypeptide sequences that intervene between each of the predicted Mitochondrial GPAT transmembrane domains. Since these regions are solvent accessible in the cytosol, they are particularly useful for designing antibodies specific to this region. Such antibodies may be useful as antagonists or agonists of the Mitochondrial GPAT full-length polypeptide and may modulate its activity.

[0159] In preferred embodiments, the following intertransmembrane domain polypeptide is encompassed by the present invention: YRHRQGIDLSTLVEDFFVMKEEVLARDFDLGFSGNSEDVVMHAIQLLGNCVT ITHTSRNDEFFITPSTTVPSVFELNFYS (SEQ ID NO: 28). Polynucleotides encoding this polypeptide are also provided. The present invention also encompasses the use of this Mitochondrial GPAT transmembrane polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0160] In preferred embodiments, the following N-terminal Mitochondrial GPAT TM1-2 intertransmembrane domain deletion polypeptides are encompassed by the present invention: Y1-S80, R2-S80, H3-S80, R4-S80, Q5-S80, G6-S80, I7-S80, D8-S80, L9-S80, S10-S80, T11-S80, L12-S80, V13-S80, E14-S80, D15-S80, F16-S80, F17-S80, V18-S80, M19-S80, K20-S80, E21-S80, E22-S80, V23-S80, L24-S80, A25-S80, R26-S80, D27-S80, F28-S80, D29-S80, L30-S80, G31-S80, F32-S80, S33-S80, G34-S80, N35-S80, S36-S80, E37-S80, D38-S80, V39-S80, V40-S80, M41-S80, H42-S80, A43-S80, I44-S80, Q45-S80, L46-S80, L47-S80, G48-S80, N49-S80, C50-S80, V51-S80, T52-S80, I53-S80, T54-S80, H55-S80, T56-S80, S57-S80, R58-S80, N59-S80, D60-S80, E61-S80, F62-S80, F63-S80, I64-S80, T65-S80, P66-S80, S67-S80, T68-S80, T69-S80, V70-S80, P71-S80, S72-S80, V73-S80, and/or F74-S80 of SEQ ID NO: 28. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these N-terminal Mitochondrial GPAT TM1-2 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0161] In preferred embodiments, the following C-terminal Mitochondrial GPAT TM1-2 intertransmembrane domain deletion polypeptides are encompassed by the present invention: Y1-S80, Y1-Y79, Y1-F78, Y1-N77, Y1-L76, Y1-E75, Y1-F74, Y1-V73, Y1-S72, Y1-P71, Y1-V70, Y1-T69, Y1-T68, Y1-S67, Y1-P66, Y1-T65, Y1-I64, Y1-F63, Y1-F62, Y1-E61, Y1-D60, Y1-N59, Y1-R58, Y1-S57, Y1-T56, Y1-H55, Y1-T54, Y1-I53, Y1-T52, Y1-V51, Y1-C50, Y1-N49, Y1-G48, Y1-L47, Y1-L46, Y1-Q45, Y1-I44, Y1-A43, Y1-H42, Y1-M41, Y1-V40, Y1-V39, Y1-D38, Y1-E37, Y1-S36; Y1-N35, Y1-G34, Y1-S33, Y1-F32, Y1-G31, Y1-L30, Y1-D29, Y1-F28, Y1-D27, Y1-R26, Y1-A25, Y1-L24, Y1-V23, Y1-E22, Y1-E21, Y1-K20, Y1-M19, Y1-V18, Y1-F17, Y1-F16, Y1-D15, Y1-E14, Y1-V13, Y1-L12, Y1-T11, Y1-S10, Y1-L9, Y1-D8, and/or Y1-17 of SEQ ID NO: 28. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these C-terminal Mitochondrial GPAT TM1-2 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0162] Alternatively, the Mitochondrial GPAT homologue was determined to comprise six putative transmembrane domains located from about amino acid residue 175 to about amino acid residue 200 (TM1), from about amino acid residue 231 to about amino acid residue 252 (TM2), from about amino acid residue 327 to about amino acid residue 352 (TM3), from about amino acid residue 462 to about amino acid residue 492 (TM4), from about amino acid residue 573 to about amino acid residue 592 (TM5), and/or from about amino acid residue 722 to about amino acid residue 744 of SEQ ID NO: 2 as predicted by the TmPhred algorithm (K Hofmann, W Stoffel., Biol. Chem. Hoppe-Seyler 347:166, 1993).

[0163] In addition, the Mitochondrial GPAT polypeptide was also determined to comprise several conserved cysteines, at amino acid 27, 36, 65, 66, 69, 243, 478, 488, 541, 586, 621, 634, 642, 702, 775, and 812 of SEQ ID No: 2 (FIGS. 1A-C). Conservation of cysteines at key amino acid residues is indicative of conserved structural features, which may correlate with conservation of protein function and/or activity, particularly with other glycerol-3-phosphate acyltransferase proteins.

[0164] Mitochondrial GPAT polypeptides and polynucleotides are useful for diagnosing diseases related to the over and/or under expression of Mitochondrial GPAT by identifying mutations in the Mitochondrial GPAT gene using Mitochondrial GPAT sequences as probes or by determining Mitochondrial GPAT protein or mRNA expression levels. Mitochondrial GPAT polypeptides will be useful in screens for compounds that affect the activity of the protein. Mitochondrial GPAT peptides can also be used for the generation of specific antibodies and as bait in yeast two hybrid screens to find proteins the specifically interact with Mitochondrial GPAT.

[0165] Expression profiling designed to measure the steady state mRNA levels encoding the Mitochondrial GPAT polypeptide showed predominately high expression levels in liver (as shown in FIG. 7).

[0166] Expanded analysis of Mitochondrial GPAT expression levels by TaqMan™ quantitative PCR (see FIG. 12) confirmed that the Mitochondrial GPAT polypeptide is expressed in liver. Mitochondrial GPAT mRNA was also expressed predominately in the breast. Significant expression was observed in adipose, adrenal gland, and to a lesser extent in other tissues as shown.

[0167] The Mitochondrial GPAT polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, have uses that include modulating metabolism, energy utilization, and triglyceride levels, among others, in various cells, tissues, and organisms, and particularly in mammalian liver and adipose tissue, preferably human. Mitochondrial GPAT polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, may be useful in diagnosing, treating, prognosing, and/or preventing hepatic, metabolic, gastrointestinal, and/or proliferative diseases or disorders.

[0168] The strong homology to the mouse and rat mitochondrial glycerol-3-phosphate acyltransferase proteins, combined with the predominate localized expression in liver, suggests the potential utility for the human Mitochondrial GPAT polynucleotides and polypeptides in treating, diagnosing, prognosing, and/or preventing hepatic disorders. Representative uses are described in the “Hyperproliferative Disorders”, “Infectious Disease”, and “Binding Activity” sections below, and elsewhere herein. Briefly, the protein can be used for the detection, treatment, amelioration, and/or prevention of hepatoblastoma, jaundice, hepatitis, liver metabolic diseases and conditions that are attributable to the differentiation of hepatocyte progenitor cells, cirrhosis, hepatic cysts, pyrogenic abscess, amebic abcess, hydatid cyst, cystadenocarcinoma, adenoma, focal nodular hyperplasia, hemangioma, hepatocellulae carcinoma, cholangiocarcinoma, and angiosarcoma, granulomatous liver disease, liver transplantation, hyperbilirubinemia, jaundice, parenchymal liver disease, portal hypertension, hepatobiliary disease, hepatic parenchyma, hepatic fibrosis, anemia, gallstones, cholestasis, carbon tetrachloride toxicity, beryllium toxicity, vinyl chloride toxicity, choledocholithiasis, hepatocellular necrosis, aberrant metabolism of amino acids, aberrant metabolism of carbohydrates, aberrant synthesis proteins, aberrant synthesis of glycoproteins, aberrant degradation of proteins, aberrant degradation of glycoproteins, aberrant metabolism of drugs, aberrant metabolism of hormones, aberrant degradation of drugs, aberrant degradation of drugs, aberrant regulation of lipid metabolism, aberrant regulation of cholesterol metabolism, aberrant glycogenesis, aberrant glycogenolysis, aberrant glycolysis, aberrant gluconeogenesis, hyperglycemia, glucose intolerance, hyperglycemia, decreased hepatic glucose uptake, decreased hepatic glycogen synthesis, hepatic resistance to insulin, portal-systemic glucose shunting, peripheral insulin resistance, hormonal abnormalities, increased levels of systemic glucagon, decreased levels of systemic cortisol, increased levels of systemic insulin, hypoglycemia, decreased gluconeogenesis, decreased hepatic glycogen content, hepatic resistance to glucagon, elevated levels of systemic aromatic amino acids, decreased levels of systemic branched-chain amino acids, hepatic encephalopathy, aberrant hepatic amino acid transamination, aberrant hepatic amino acid oxidative deamination, aberrant ammonia synthesis, aberant albumin secretion, hypoalbuminemia, aberrant cytochromes b5 function, aberrant P450 function, aberrant glutathione S-acyltransferase function, aberrant cholesterol synthesis, and aberrant bile acid synthesis.

[0169] Moreover, polynucleotides and polypeptides, including fragments and/or antagonists thereof, have uses which include, directly or indirectly, treating, preventing, diagnosing, and/or prognosing the following, non-limiting, hepatic infections: liver disease caused by sepsis infection, liver disease caused by bacteremia, liver disease caused by Pneomococcal pneumonia infection, liver disease caused by Toxic shock syndrome, liver disease caused by Listeriosis, liver disease caused by Legionnaries' disease, liver disease caused by Brucellosis infection, liver disease caused by Neisseria gonorrhoeae infection, liver disease caused by Yersinia infection, liver disease caused by Salmonellosis, liver disease caused by Nocardiosis, liver disease caused by Spirochete infection, liver disease caused by Treponema pallidum infection, liver disease caused by Brrelia burgdorferi infection, liver disease caused by Leptospirosis, liver disease caused by Coxiella burnetii infection, liver disease caused by Rickettsia richettsii infection, liver disease caused by Chlamydia trachomatis infection, liver disease caused by Chlamydia psittaci infection, liver disease caused by hepatitis virus infection, liver disease caused by Epstein-Barr virus infection in addition to any other hepatic disease and/or disorder implicated by the causative agents listed above or elsewhere herein.

[0170] The Mitochondrial GPAT polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, have uses that include the treatment, diagnosis, prognosis and/or prevention of a variety of other disorders, which include, but are not limited to, malnutrition, starvation, disorders related to low triglyceride production, disorders related to low triglyceride accumulation, disorders related to low phosphatidic acid production, disorders related to low phospholipid production, disorders related to low VLDL levels, disorders related to low LDL levels, disorders related to low cholesterol levels, diabetes, tissue wasting disorders, bolemia, viral infections, bacterial infections, recovery from major surgery, disoders related to low levels of stored fat researves, infertility related to abnormally low levels of fat reserves, DNA repair disorders, disorders that increase an individuals suspectibility to mutagens, particularly from by-products of fatty acid oxidation and/or degradation, etc.

[0171] The antagonists of the Mitochondrial GPAT polynucleotides and polypeptides of the present invention have uses that include the treatment, diagnosis, prognosis and/or prevention of a variety of other disorders, which include, but are not limited to, obesity, disorders related to excess triglyceride production, disorders related to excess triglyceride accumulation, disorders related to elevated phosphatidic acid production, disorders related to elevated phospholipid production, disorders related to elevated VLDL plasma levels, disorders related to elevated LDL plasma levels, disorders related to elevated cholesterol plasma levels, etc.

[0172] Moreover, antagonists of Mitochondrial GPAT polynucleotides and polypeptides of the present invention have uses that include increasing the cellular level of oxidized fatty acycl-CoA, decreasing the cellular level of non-oxidized fatty acycl-CoA, and/or effectively decreasing the level of triglyceride stored in fat reserves.

[0173] Although it is believed the encoded polypeptide may share at least some biological activities with glycerol-3-phosphate acyltransferase proteins, a number of methods of determining the exact biological function of this clone are either known in the art or are described elsewhere herein. Briefly, the function of this clone may be determined by applying microarray methodology. Nucleic acids corresponding to the Mitochondrial GPAT polynucleotides, in addition to, other clones of the present invention, may be arrayed on microchips for expression profiling. Depending on which polynucleotide probe is used to hybridize to the slides, a change in expression of a specific gene may provide additional insight into the function of this gene based upon the conditions being studied. For example, an observed increase or decrease in expression levels when the polynucleotide probe used comes from tissue that has been treated with known glycerol-3-phosphate acyltransferase inhibitors, which include, but are not limited to the drugs listed herein or otherwise known in the art, might indicate a function in modulating glycerol-3-phosphate acyltransferase function, for example. In the case of Mitochondrial GPAT, liver tissue should be used to extract RNA to prepare the probe.

[0174] In addition, the function of the protein may be assessed by applying quantitative PCR methodology, for example. Real time quantitative PCR would provide the capability of following the expression of the Mitochondrial GPAT gene throughout development, for example. Quantitative PCR methodology requires only a nominal amount of tissue from each developmentally important step is needed to perform such experiements. Therefore, the application of quantitative PCR methodology to refining the biological function of this polypeptide is encompassed by the present invention. Also encompassed by the present invention are quantitative PCR probes corresponding to the polynucleotide sequence provided as SEQ ID NO: 1 (FIGS. 1A-C).

[0175] The function of the protein may also be assessed through complementation assays in yeast. For example, in the case of the Mitochondrial GPAT, transforming yeast deficient in glycerol-3-phosphate acyltransferase activity with Mitochondrial GPAT and assessing their ability to grow would provide convincing evidence the Mitochondrial GPAT polypeptide has glycerol-3-phosphate acyltransferase activity. Additional assay conditions and methods that may be used in assessing the function of the polynucletides and polypeptides of the present invention are known in the art, some of which are disclosed elsewhere herein.

[0176] Alternatively, the biological function of the encoded polypeptide may be determined by disrupting a homologue of this polypeptide in Mice and/or rats and observing the resulting phenotype.

[0177] Moreover, the biological function of this polypeptide may be determined by the application of antisense and/or sense methodology and the resulting generation of transgenic mice and/or rats. Expressing a particular gene in either sense or antisense orientation in a transgenic mouse or rat could lead to respectively higher or lower expression levels of that particular gene. Altering the endogenous expression levels of a gene can lead to the obervation of a particular phenotype that can then be used to derive indications on the function of the gene. The gene can be either over-expressed or under expressed in every cell of the organism at all times using a strong ubiquitous promoter, or it could be expressed in one or more discrete parts of the organism using a well characterized tissue-specific promoter (e.g., a liver, or adipose-specific promoter), or it can be expressed at a specified time of development using an inducible and/or a developmentally regulated promoter.

[0178] In the case of Mitochondrial GPAT transgenic mice or rats, if no phenotype is apparent in normal growth conditions, observing the organism under diseased conditions (hepatic, gastrointestinal, or proliferative disorders, etc.) may lead to understanding the function of the gene. Therefore, the application of antisense and/or sense methodology to the creation of transgenic mice or rats to refine the biological function of the polypeptide is encompassed by the present invention.

[0179] In preferred embodiments, the following N-terminal Mitochondrial GPAT deletion polypeptides are encompassed by the present invention: M1-L826, D2-L826, E3-L826, S4-L826, A5-L826, L6-L826, T7-L826, L8-L826, G9-L826, T10-L826, I11-L826, D12-L826, V13-L826, S14-L826, Y15-L826, L16-L826, P17-L826, H18-L826, S19-L826, S20-L826, E21-L826, Y22-L826, S23-L826, V24-L826, G25-L826, R26-L826, C27-L826, K28-L826, H29-L826, T30-L826, S31-L826, E32-L826, E33-L826, W34-L826, E35-L826, C36-L826, G37-L826, F38-L826, R39-L826, P40-L826, T41-L826, I42-L826, F43-L826, R44-L826, S45-L826, A46-L826, T47-L826, L48-L826, K49-L826, W50-L826, K51-L826, E52-L826, S53-L826, L54-L826, M55-L826, S56-L826, R57-L826, K58-L826, R59-L826, P60-L826, F61-L826, V62-L826, G63-L826, R64-L826, C65-L826, C66-L826, Y67-L826, S68-L826, C69-L826, T70-L826, P71-L826, Q72-L826, S73-L826, W74-L826, D75-L826, K76-L826, F77-L826, F78-L826, N79-L826, P80-L826, S81-L826, I82-L826, P83-L826, S84-L826, L85-L826, G86-L826, L87-L826, R88-L826, N89-L826, V90-L826, I91-L826, Y92-L826, L826, I93-L826, N94-L826, E95-L826, T96-L826, H97-L826, T98-L826, R99-L826, H100-L826, R10-L826, G102-L826, W103-L826, L104-L826, A105-L826, R106-L826, R107-L826, L108-L826, S109-L826, Y110-L826, V111-L826, L112-L826, F113-L826, I114-L826, Q115-L826, E116-L826, R117-L826, D118-L826, V119-L826, H120-L826, K121-L826, G122-L826, M123-L826, F124-L826, A125-L826, T126-L826, N127-L826, V128-L826, T129-L826, E130-L826, N131-L826, V132-L826, L133-L826, N134-L826, S135-L826, S136-L826, R137-L826, V138-L826, Q139-L826, E140-L826, A141-L826, 1142-L826, A143-L826, E144-L826, V145-L826, A146-L826, A147-L826, E148-L826, L149-L826, N150-L826, P151-L826, D152-L826, G153-L826, S154-L826, A155-L826, Q156-L826, Q157-L826, Q158-L826, S159-L826, K160-L826, A161-L826, V162-L826, N163-L826, K164-L826, K165-L826, K166-L826, K167-L826, A168-L826, K169-L826, R170-L826, I171-L826, L172-L826, Q173-L826, E174-L826, M175-L826, V176-L826, A177-L826, T178-L826, V179-L826, S180-L826, P181-L826, A182-L826, M183-L826, I184-L826, R185-L826, L186-L826, T187-L826, G188-L826, W189-L826, V190-L826, L191-L826, L192-L826, K193-L826, L194-L826, F195-L826, N196-L826, S197-L826, F198-L826, F199-L826, W200-L826, N201-L826, 1202-L826, Q203-L826, I204-L826, H205-L826, K206-L826, G207-L826, Q208-L826, L209-L826, E210-L826, M211-L826, V212-L826, K213-L826, A214-L826, A215-L826, T216-L826, E217-L826, T218-L826, N219-L826, L220-L826, P221-L826, L222-L826, L223-L826, L826, F224-L826, L225-L826, P226-L826, V227-L826, H228-L826, R229-L826, S230-L826, H231-L826, 1232-L826, D233-L826, Y234-L826, L235-L826, L236-L826, L237-L826, T238-L826, F239-L826, 1240-L826, L241-L826, F242-L826, C243-L826, H244-L826, N245-L826, 1246-L826, K247-L826, A248-L826, P249-L826, L826, Y250-L826, 1251-L826, A252-L826, S253-L826, G254-L826, N255-L826, N256-L826, L257-L826, N258-L826, 1259-L826, P260-L826, I261-L826, F262-L826, L826, S263-L826, T264-L826, L265-L826, 1266-L826, H267-L826, K268-L826, L269-L826, G270-L826, G271-L826, F272-L826, F273-L826, 1274-L826, R275-L826, R276-L826, R277-L826, L278-L826, D279-L826, E280-L826, T281-L826, P282-L826, D283-L826, G284-L826, R285-L826, K286-L826, D287-L826, V288-L826, L289-L826, Y290-L826, R291-L826, A292-L826, L293-L826, L294-L826, H295-L826, G296-L826, H297-L826, 1298-L826, V299-L826, E300-L826, L301 -L826, L302-L826, R303-L826, Q304-L826, Q305-L826, Q306-L826, F307-L826, L308-L826, E309-L826, 1310-L826, F311-L826, L312-L826, E313-L826, G314-L826, T315-L826, R316-L826, S317-L826, R318-L826, S319-L826, G320-L826, K321-L826, T322-L826, S323-L826, C324-L826, A325-L826, R326-L826, A327-L826, G328-L826, L329-L826, L330-L826, S331-L826, V332-L826, V333-L826, V334-L826, D335-L826, T336-L826, L337-L826, S338-L826, T339-L826, N340-L826, V341-L826, I342-L826, P343-L826, D344-L826, I345-L826, L346-L826, I347-L826, I348-L826, P349-L826, V350-L826, G351-L826, I352-L826, S353-L826, Y354-L826, D355-L826, R356-L826, 1357-L826, 1358-L826, E359-L826, G360-L826, H361-L826, Y362-L826, N363-L826, G364-L826, E365-L826, Q366-L826, L367-L826, G368-L826, K369-L826, P370-L826, K371-L826, K372-L826, N373-L826, E374-L826, S375-L826, L376-L826, W377-L826, S378-L826, V379-L826, A380-L826, R381-L826, G382-L826, V383-L826, I384-L826, R385-L826, M386-L826, L387-L826, R388-L826, K389-L826, N390-L826, Y391-L826, G392-L826, C393-L826, V394-L826, R395-L826, V396-L826, D397-L826, F398-L826, A399-L826, L826, Q400-L826, P401-L826, F402-L826, S403-L826, L404-L826, K405-L826, E406-L826, Y407-L826, L408-L826, E409-L826, S410-L826, Q411-L826, S412-L826, L826, Q413-L826, K414-L826, P415-L826, V416-L826, S417-L826, A418-L826, L419-L826, L420-L826, S421-L826, L422-L826, E423-L826, Q424-L826, A425-L826, L426-L826, L427-L826, P428-L826, A429-L826, 1430-L826, L431-L826, P432-L826, S433-L826, R434-L826, P435-L826, S436-L826, D437-L826, A438-L826, A439-L826, D440-L826, E441-L826, G442-L826, R443-L826, D444-L826, T445-L826, S446-L826, I447-L826, N448-L826, E449-L826, S450-L826, R451-L826, N452-L826, A453-L826, T454-L826, D455-L826, E456-L826, S457-L826, L458-L826, R459-L826, R460-L826, R461-L826, L462-L826, 1463-L826, A464-L826, N465-L826, L466-L826, A467-L826, E468-L826, H469-L826, 1470-L826, L471-L826, F472-L826, T473-L826, A474-L826, S475-L826, K476-L826, S477-L826, C478-L826, A479-L826, 1480-L826, M481-L826, S482-L826, T483-L826, H484-L826, I485-L826, V486-L826, A487-L826, C488-L826, L489-L826, L490-L826, L491-L826, Y492-L826, R493-L826, H494-L826, R495-L826, Q496-L826, G497-L826, I498-L826, D499-L826, L500-L826, S501-L826, T502-L826, L503-L826, V504-L826, E505-L826, D506-L826, F507-L826, F508-L826, V509-L826, M510-L826, K511-L826, E512-L826, E513-L826, V514-L826, L515-L826, A516-L826, R517-L826, D518-L826, F519-L826, D520-L826, L521-L826, G522-L826, F523-L826, S524-L826, G525-L826, N526-L826, S527-L826, E528-L826, D529-L826, V530-L826, V531-L826, M532-L826, H533-L826, A534-L826, I535-L826, Q536-L826, L537-L826, L538-L826, G539-L826, N540-L826, C541-L826, V542-L826, T543-L826, I544-L826, T545-L826, H546-L826, T547-L826, S548-L826, R549-L826, N550-L826, D551-L826, E552-L826, F553-L826, F554-L826, I555-L826, T556-L826, P557-L826, S558-L826, T559-L826, T560-L826, V561-L826, P562-L826, S563-L826, V564-L826, F565-L826, E566-L826, L567-L826, N568-L826, F569-L826, Y570-L826, S571-L826, N572-L826, G573-L826, V574-L826, L575-L826, H576-L826, V577-L826, F578-L826, 1579-L826, M580-L826, E581-L826, A582-L826, I583-L826, I584-L826, A585-L826, C586-L826, S587-L826, L588-L826, Y589-L826, A590-L826, V591-L826, L592-L826, N593-L826, K594-L826, R595-L826, G596-L826, L597-L826, G598-L826, G599-L826, P600-L826, T601-L826, S602-L826, T603-L826, P604-L826, P605-L826, N606-L826, L607-L826, I608-L826, S609-L826, Q610-L826, E611-L826, Q612-L826, L613-L826, V614-L826, R615-L826, K616-L826, A617-L826, A618-L826, S619-L826, L620-L826, C621-L826, Y622-L826, L623-L826, L624-L826, S625-L826, N626-L826, E627-L826, G628-L826, T629-L826, 1630-L826, S631-L826, L632-L826, P633-L826, C634-L826, Q635-L826, T636-L826, F637-L826, Y638-L826, Q639-L826, V640-L826, C641-L826, H642-L826, E643-L826, T644-L826, V645-L826, G646-L826, K647-L826, F648-L826, I649-L826, Q650-L826, Y651-L826, G652-L826, I653-L826, L654-L826, T655-L826, V656-L826, A657-L826, E658-L826, H659-L826, D660-L826, D661-L826, Q662-L826, E663-L826, D664-L826, I665-L826, S666-L826, P667-L826, S668-L826, L669-L826, A670-L826, E671-L826, Q672-L826, Q673-L826, W674-L826, D675-L826, K676-L826, K677-L826, L678-L826, P679-L826, E680-L826, P681-L826, L682-L826, S683-L826, W684-L826, R685-L826, S686-L826, D687-L826, E688-L826, E689-L826, D690-L826, E691-L826, D692-L826, S693-L826, D694-L826, F695-L826, G696-L826, E697-L826, E698-L826, Q699-L826, R700-L826, D701-L826, C702-L826, Y703-L826, L704-L826, K705-L826, V706-L826, S707-L826, Q708-L826, S709-L826, K710-L826, E711-L826, H712-L826, Q713-L826, Q714-L826, F715-L826, I716-L826, T717-L826, F718-L826, L719-L826, Q720-L826, R721-L826, L722-L826, L723-L826, G724-L826, P725-L826, L726-L826, L727-L826, E728-L826, A729-L826, Y730-L826, S731-L826, S732-L826, A733-L826, A734-L826, I735-L826, F736-L826, V737-L826, H738-L826, N739-L826, F740-L826, S741-L826, G742-L826, P743-L826, V744-L826, P745-L826, E746-L826, P747-L826, E748-L826, Y749-L826, L750-L826, Q751-L826, K752-L826, L753-L826, H754-L826, K755-L826, Y756-L826, L757-L826, I758-L826, T759-L826, R760-L826, T761-L826, E762-L826, R763-L826, N764-L826, V765-L826, A766-L826, V767-L826, Y768-L826, A769-L826, E770-L826, S771-L826, A772-L826, T773-L826, Y774-L826, C775-L826, L776-L826, V777-L826, K778-L826, N779-L826, A780-L826, V781-L826, K782-L826, M783-L826, F784-L826, K785-L826, D786-L826, I787-L826, G788-L826, V789-L826, F790-L826, K791-L826, E792-L826, T793-L826, K794-L826, Q795-L826, K796-L826, R797-L826, V798-L826, S799-L826, V800-L826, L801-L826, E802-L826, L803-L826, S804-L826, S805-L826, T806-L826, F807-L826, L808-L826, P809-L826, Q810-L826, C811-L826, N812-L826, R813-L826, Q814-L826, K815-L826, L816-L826, L817-L826, E818-L826, Y819-L826, and/or 1820-L826 of SEQ ID NO: 2. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these N-terminal Mitochondrial GPAT deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0180] In preferred embodiments, the following C-terminal Mitochondrial GPAT deletion polypeptides are encompassed by the present invention: M1-L826, M1-V825, M1-V824, M1-F823, M1-S822, M1-L821, M1-1820, M1-Y819, M1-E818, M1-L817, M1-L816, M1-K815, M1-Q814, M1-R813, M1-N812, M1-C811, M1-Q810, M1-P809, M1-L808, M1-F807, M1-T806, M1-S805, M1-S804, M1-L803, M1-E802, M1-L801, M1-V800, M1-S799, M1-V798, M1-R797, M1-K796, M1-Q795, M1-L801, M1-T793, M1-E792, M1-K791, M1-F790, M1-V789, M1-G788, M1-I787, M1-D786, M1-K785, M1-F784, M1-M783, M1-K782, M1-V781, M1-A780, M1-N779, M1-K778, M1-V777, M1-L776, M1-C775, M1-Y774, M1-T773, M1-A772, M1-S771, M1-E770, M1-A769, M1-Y768, M1-V767, M1-A766, M1-V765, M1-N764, M1-R763, M1-E762, M1-T761, M1-R760, M1-T759, M1-I758, M1-L757, M1-Y756, M1-K755, M1-H754, M1-L753, M1-K752, M1-Q751, M1-L750, M1-Y749, M1-E748, M1-P747, M1-E746, M1-P745, M1-V744, M1-P743, M1-G742, M1-S741, M1-F740, M1-N739, M1-H738, M1-V737, M1-F736, M1-I735, M1-A734, M1-A733, M1-S732, M1-S731, M1-Y730, M1-A729, M1-E728, M1-L727, M1-L726, M1-P725, M1-G724, M1-L723, M1-L722, M1-R721, M1-Q720, M1-L719, M1-F718, M1-T717, M1-I716, M1-F715, M1-Q714, M1-Q713, M1-H712, M1-E711, M1-K710, M1-S709, M1-Q708, M1-S707, M1-V706, M1-K705, M1-L704, M1-Y703, M1-C702, M1-D701, M1-R700, M1-Q699, M1-E698, M1-E697, M1-G696, M1-F695, M1-D694, M1-S693, M1-D692, M1-E691, M1-D690, M1-E689, M1-E688, M1-D687, M1-S686, M1-R685, M1-W684, M1-S683, M1-L682, M1-P681, M1-E680, M1-P679, M1-L678, M1-K677, M1-K676, M1-D675, M1-W674, M1-Q673, M1-Q672, M1-E671, M1-A670, M1-L669, M1-S668, M1-P667, M1-S666, M1-I665, M1-D664, M1-E663, M1-Q662, M1-D661, M1-D660, M1-H659, M1-E658, M1-A657, M1-V656, M1-T655, M1-L654, M1-I653, M1-G652, M1-Y651, M1-Q650, M1-F649, M1-F648, M1-K647, M1-G646, M1-V645, M1-T644, M1-E643, M1-H642, M1-C641, M1-V640, M1-Q639, M1-Y638, M1-F637, M1-T636, M1-Q635, M1-C634, M1-P633, M1-L632, M1-S631, M1-I630, M1-T629, M1-G628, M1-E627, M1-N626, M1-S625, M1-L624, M1-L623, M1-Y622, M1-C621, M1-L620, M1-S619, M1-A618, M1-A617, M1-K616, M1-R615, M1-V614, M1-L613, M1-Q612, M1-E611, M1-Q610, M1-S609, M1-I608, M1-L607, M1-N606, M1-P605, M1-P604, M1-T603, M1-S602, M1-T601, M1-P600, M1-G599, M1-G598, M1-L597, M1-G596, M1-R595, M1-K594, M1-N593, M1-L592, M1-V591, M1-A590, M1-Y589, M1-L588, M1-S587, M1-C586, M1-A585, M1-I584, M1-I583, M1-A582, M1-E581, M1-M580, M1-I579, M1-F578, M1-V577, M1-H576, M1-L575, M1-V574, M1-G573, M1-N572, M1-S571, M1-Y570, M1-F569, M1-N568, M1-L567, M1-E566, M1-F565, M1-V644, M1-S563, M1-P562, M1-V561, M1-T560, M1-T559, M1-S558, M1-P557, M1-T556, M1-I555, M1-F554, M1-F553, M1-E552, M1-D551, M1-N550, M1-R549, M1-S548, M1-T547, M1-H546, M1-T545, M1-I544, M1-T543, M1-V542, M1-C541, M1-N540, M1-G539, M1-L538, M1-L537, M1-Q536, M1-I535, M1-A534, M1-H533, M1-M532, M1-V531, M1-V530, M1-D529, M1-E528, M1-S527, M1-N526, M1-G525, M1-S524, M1-F523, M1-G522, M1-L521, M1-D520, M1-F519, M1-D518, M1-R517, M1-A516, M1-L515, M1-V514, M1-E513, M1-E512, M1-K511, M1-M510, M1-V509, M1-F508, M1-F507, M1-D506, M1-E505, M1-V504, M1-L503, M1-T502, M1-S501, M1-L500, M1-D499, M1-I498, M1-G497, M1-Q496, M1-R495, M1-H494, M1-R493, M1-Y492, M1-L491, M1-L490, M1-L489, M1-C488, M1-A487, M1-V486, M1-I485, M1-H484, M1-T483, M1-S482, M1-M481, M1-I480, M1-A479, M1-C478, M1-S477, M1-K476, M1-S475, M1-A474, M1-T473, M1-F472, M1-L471, M1-I470, M1-H469, M1-E468, M1-A467, M1-L466, M1-N466, M1-N465, M1-A464, M1-I463, M1-L462, M1-R461, M1-R460, M1-R459, M1-L458, M1-S457, M1-E456, M1-D455, M1-T454, M1-A453, M1-N452, M1-R451, M1-S450, M1-E449, M1-N448, M1-I447, M1-S446, M1-T445, M1-D444, M1-R443, M1-G442, M1-E441, M1-D440, M1-A439, M1-A438, M1-D437, M1-S436, M1-P435, M1-R434, M1-S433, M1-P432, M1-L431, M1-I430, M1-A429, M1-P428, M1-L426, M1-A425, M1-Q424, M1-E423, M1-L422, M1-S421, M1-L420, M1-L419, M1-A418, M1-S417, M1-V416, M1-P415, M1-K414, M1-Q413, M1-S412, M1-Q411, M1-S410, M1-E409, M1-L408, M1-Y407, M1-E406, M1-K405, M1-L404, M1-S403, M1-F402, M1-P401, M1-Q400, M1-A399, M1-F398, M1-D397, M1-V396, M1-R395, M1-V394, M1-C393, M1-G392, M1-Y391, M1-N390, M1-K389, M1-R388, M1-L387, M1-M386, M1-R385, M1-I384, M1-V383, M1-G382, M1-R381, M1-A380, M1-V379, M1-S378, M1-W377, M1-L376, M1-S375, M1-E374, M1-N373, M1-K372, M1-K371, M1-P370, M1-K369, M1-G368, M1-L367, M1-Q366, M1-E365, M1-G364, M1-N363, M1-Y362, M1-H361, M1-G360, M1-E359, M1-I358, M1-I357, M1-R356, M1-D355, M1-Y354, M1-S353, M1-I352, M1-G351, M1-V350, M1-P349, M1-I348, M1-I347, M1-L346, M1-I345, M1-D344, M1-P343, M1-I342, M1-V341, M1-N340, M1-T339, M1-S338, M1-L337, M1-T336, M1-D335, M1-V334, M1-V333, M1-V332, M1-S331, M1-L330, M1-L329, M1-G328, M1-A327, M1-R326, M1-A325, M1-C324, M1-S323, M1-T322, M1-K321, M1-G320, M1-S319, M1-R318, M1-S317, M1-R316, M1-T315, M1-G314, M1-E313, M1-L312, M1-F311, M1-I310, M1-E309, M1-L308, M1-F307, M1-Q306, M1-Q305, M1-Q403, M1-R303, M1-L302, M1-L301, M1-E300, M1-V299, M1-I298, M1-H297, M1-G296, M1-H295, M1-L294, M1-L293, M1-A292, M1-R291, M1-Y290, M1-L289, M1-V288, M1-D287, M1-K286, M1-R285, M1-G284, M1-D283, M1-P282, M1-T281, M1-E280, M1-D279, M1-L278, M1-R277, M1-R276, M1-R275, M1-I274, M1-F273, M1-F272, M1-G271, M1-G270, M1-L269, M1-K268, M1-H267, M1-I266, M1-L265, M1-T264, M1-S263, M1-F262, M1-I261, M1-P260, M1-I259, M1-N258, M1-L257, M1-N256, M1-N255, M1-G254, M1-S253, M1-A252, M1-I251, M1-Y250, M1-P249, M1-A248, M1-K247, M1-I246, M1-N245, M1-H244, M1-C243, M1-F242, M1-L241, M1-I240, M1-F239, M1-T238, M1-L237, M1-L236, M1-L235, M1-Y234, M1-D233, M1-I232, M1-H231, M1-S230, M1-R229, M1-H228, M1-V227, M1-P226, M1-L225, M1-F224, M1-L223, M1-L222, M1-P221, M1-L220, M1-N219, M1-T218, M1-E217, M1-T216, M1-A215, M1-A214, M1-K213, M1-V212, M1-M211, M1-E210, M1-L209, M1-Q208, M1-G207, M1-K206, M1-H205, M1-I204, M1-Q203, M1-I202, M1-N201, M1-W200, M1-F199, M1-F198, M1-S197, M1-N196, M1-F195, M1-L194, M1-K193, M1-L192, M1-L191, M1-V190, M1-W189, M1-G188, M1-T187, M1-L186, M1-R185, M1-I184, M1-M183, M1-A182, M1-P181, M1-S180, M1-V179, M1-T178, M1-A177, M1-V176, M1-M175, M1-E174, M1-Q173, M1-L172, M1-I171, M1-R170, M1-K169, M1-A168, M1-K167, M1-K166, M1-K165, M1-K164, M1-N163, M1-V162, M1-A161, M1-K160, M1-S159, M1-Q158, M1-Q157, M1-Q156, M1-A155, M1-S154, M1-G153, M1-D152, M1-P151, M1-N150, M1-L149, M1-E148, M1-A147, M1-A146, M1-V145, M1-E144, M1-A143, M1-I142, M1-A141, M1-E140, M1-Q139, M1-V138, M1-R137, M1-S136, M1-S135, M1-N134, M1-L133, M1-V132, M1-N131, M1-E130, M1-T129, M1-V128, M1-N127, M1-T126, M1-A125, M1-F124, M1-M123, M1-G122, M1-K121, M1-H120, M1-V119, M1-D118, M1-R117, M1-E116, M1-Q115, M1-I114, M1-F113, M1-L112, M1-V111, M1-Y110, M1-S109, M1-L108, M1-R107, M1-R106, M1-A105, M1-L104, M1-W103, M1-G102, M1-R101, M1-H100, M1-R99, M1-T98, M1-H97, M1-T96, M1-E95, M1-N94, M1-I93, M1-Y92, M1-I91, M1-V90, M1-N89, M1-R88, M1-L87, M1-G86, M1-L85, M1-S84, M1-P83, M1-I82, M1-S81, M1-P80, M1-N79, M1-F78, M1-F77, M1-K76, M1-D75, M1-W74, M1-S73, M1-Q72, M1-P71, M1-T70, M1-C69, M1-S68, M1-Y67, M1-C66, M1-C65, M1-R64, M1-G63, M1-V62, M1-F61, M1-P60, M1-R59, M1-K58, M1-R57, M1-S56, M1-M55, M1-L54, M1-S53, M1-E52, M1-K51, M1-W50, M1-K49, M1-L48, M1-T47, M1-A46, M1-S45, M1-R44, M1-F43, M1-I42, M1-T41, M1-P40, M1-R39, M1-F38, M1-G37, M1-C36, M1-E35, M1-W34, M1-E33, M1-E32, M1-S31, M1-T30, M1-H29, M1-K28, M1-C27, M1-R26, M1-G25, M1-V24, M1-S23, M1-Y22, M1-E21, M1-S20, M1-S19, M1-H18, M1-P17, M1-L16, M1-Y15, M1-SI4, M1-V13, M1-D12, M1-I11, M1-T10, M1-G9, M1-L8, and/or M1-T7 of SEQ ID NO: 2. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these C-terminal Mitochondrial GPAT deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0181] Alternatively, preferred polypeptides of the present invention may comprise polypeptide sequences corresponding to, for example, internal regions of the Mitochondrial GPAT polypeptide (e.g., any combination of both N-and C- terminal Mitochondrial GPAT polypeptide deletions) of SEQ ID NO: 2. For example, internal regions could be defined by the equation: amino acid NX to amino acid CX, wherein NX refers to any N-terminal deletion polypeptide amino acid of Mitochondrial GPAT (SEQ ID NO: 2), and where CX refers to any C-terminal deletion polypeptide amino acid of Mitochondrial GPAT (SEQ ID NO: 2). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these polypeptides as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0182] The present invention also encompasses immunogenic and/or antigenic epitopes of the Mitochondrial GPAT polypeptide.

[0183] The Mitochondrial GPAT polypeptides of the present invention were determined to comprise several phosphorylation sites based upon the Motif algorithm (Genetics Computer Group, Inc.). The phosphorylation of such sites may regulate some biological activity of the Mitochondrial GPAT polypeptide. For example, phosphorylation at specific sites may be involved in regulating the proteins ability to associate or bind to other molecules (e.g., proteins, ligands, substrates, DNA, etc.). In the present case, phosphorylation may modulate the ability of the Mitochondrial GPAT polypeptide to associate with other potassium channel alpha subunits, beta subunits, or its ability to modulate potassium channel function.

[0184] Specifically, the Mitochondrial GPAT polypeptide was predicted to comprise one tyrosine phosphorylation site using the Motif algorithm (Genetics Computer Group, Inc.). Such sites are phosphorylated at the tyrosine amino acid residue. The consensus pattern for tyrosine phosphorylation sites are as follows: [RK]-x(2)-[DE]-x(3)-Y, or [RK]-x(3)-[DE]-x(2)-Y, where Y represents the phosphorylation site and ‘x’ represents an intervening amino acid residue. Additional information specific to tyrosine phosphorylation sites can be found in Patschinsky T., Hunter T., Esch F. S., Cooper J. A., Sefton B. M., Proc. Natl. Acad. Sci. U.S.A. 79:973-977(1982); Hunter T., J. Biol. Chem. 257:4843-4848(1982), and Cooper J. A., Esch F. S., Taylor S. S., Hunter T., J. Biol. Chem. 259:7835-7841(1984), which are hereby incorporated herein by reference.

[0185] In preferred embodiments, the following Mitochondrial GPAT tyrosine phosphorylation site polypeptide is encompassed by the present invention: GISYDRIIEGHYNGEQL (SEQ ID NO: 39). Polynucleotides encoding this polypeptide are also provided. The present invention also encompasses the use of this Mitochondrial GPAT tyrosine phosphorylation site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0186] The Mitochondrial GPAT polypeptide was predicted to comprise ten PKC phosphorylation sites using the Motif algorithm (Genetics Computer Group, Inc.). In vivo, protein kinase C exhibits a preference for the phosphorylation of serine or threonine residues. The PKC phosphorylation sites have the following consensus pattern: [ST]-x-[RK], where S or T represents the site of phosphorylation and ‘x’ an intervening amino acid residue. Additional information regarding PKC phosphorylation sites can be found in Woodget J. R., Gould K. L., Hunter T., Eur. J. Biochem. 161:177-184(1986), and Kishimoto A., Nishiyama K., Nakanishi H., Uratsuji Y., Nomura H., Takeyama Y., Nishizuka Y., J. Biol. Chem. 260:12492-12499(1985); which are hereby incorporated by reference herein.

[0187] In preferred embodiments, the following PKC phosphorylation site polypeptides are encompassed by the present invention: IFRSATLKWKESL (SEQ ID NO: 29), KESLMSRKRPFVG (SEQ ID NO: 30), ENVLNSSRVQEAI (SEQ ID NO: 31), GTRSRSGKTSCAR (SEQ ID NO: 32), FAQPFSLKEYLES (SEQ ID NO: 33), YLESQSQKPVSAL (SEQ ID NO: 34), NATDESLRRRLIA (SEQ ID NO: 35), VTITHTSRNDEFF (SEQ ID NO: 36), LPEPLSWRSDEED (SEQ ID NO: 37), and/or YLITRTERNVAVY (SEQ ID NO: 38). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Mitochondrial GPAT PKC phosphorylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0188] The Mitochondrial GPAT polypeptide was predicted to comprise twelve casein kinase II phosphorylation sites using the Motif algorithm (Genetics Computer Group, Inc.). Casein kinase II (CK-2) is a protein serine/threonine kinase whose activity is independent of cyclic nucleotides and calcium. CK-2 phosphorylates many different proteins. The substrate specificity [1] of this enzyme can be summarized as follows: (1) Under comparable conditions Ser is favored over Thr.; (2) An acidic residue (either Asp or Glu) must be present three residues from the C-terminal of the phosphate acceptor site; (3) Additional acidic residues in positions +1, +2, +4, and +5 increase the phosphorylation rate. Most physiological substrates have at least one acidic residue in these positions; (4) Asp is preferred to Glu as the provider of acidic determinants; and (5) A basic residue at the N-terminal of the acceptor site decreases the phosphorylation rate, while an acidic one will increase it.

[0189] A consensus pattern for casein kinase II phosphorylations site is as follows: [ST]-x(2)-[DE], wherein ‘x’ represents any amino acid, and S or T is the phosphorylation site.

[0190] Additional information specific to casein kinase II phosphorylation sites may be found in reference to the following publication: Pinna L. A., Biochim. Biophys. Acta 1054:267-284(1990); which is hereby incorporated herein in its entirety.

[0191] In preferred embodiments, the following casein kinase II phosphorylation site polypeptides are encompassed by the present invention: GRCKHTSEEWECGF (SEQ ID NO: 40), LPVHRSHIDYLLLT (SEQ ID NO: 41), FAQPFSLKEYLESQ (SEQ ID NO: 42), EGRDTSINESRNAT (SEQ ID NO: 43), GIDLSTLVEDFFVM (SEQ ID NO: 44), TITHTSRNDEFFIT (SEQ ID NO: 45), STTVPSVFELNFYS (SEQ ID NO: 46), QYGILTVAEHDDQE (SEQ ID NO: 47), EDISPSLAEQQWDK (SEQ ID NO: 48), PLSWRSDEEDEDSD (SEQ ID NO: 49), HKYLITRTERNVAV (SEQ ID NO: 50), and/or KQKRVSVLELSSTF (SEQ ID NO: 51). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of this casein kinase II phosphorylation site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0192] The Mitochondrial GPAT polypeptide was predicted to comprise two cAMP-and cGMP-dependent protein kinase phosphorylation site using the Motif algorithm (Genetics Computer Group, Inc.). There has been a number of studies relative to the specificity of cAMP-and cGMP-dependent protein kinases. Both types of kinases appear to share a preference for the phosphorylation of serine or threonine residues found close to at least two consecutive N-terminal basic residues.

[0193] A consensus pattern for cAMP-and cGMP-dependent protein kinase phosphorylation sites is as follows: [RK](2)-x-[ST], wherein “x” represents any amino acid, and S or T is the phosphorylation site.

[0194] Additional information specific to cAMP-and cGMP-dependent protein kinase phosphorylation sites may be found in reference to the following publication: Fremisco J. R., Glass D. B., Krebs E. G, J. Biol. Chem. 255:4240-4245(1980); Glass D. B., Smith S. B., J. Biol. Chem. 258:14797-14803(1983); and Glass D. B., E1-Maghrabi M. R., Pilkis S. J., J. Biol. Chem. 261:2987-2993(1986); which is hereby incorporated herein in its entirety.

[0195] In preferred embodiments, the following cAMP-and cGMP-dependent protein kinase phosphorylation site polypeptides are encompassed by the present invention: RGWLARRLSYVLFI (SEQ ID NO: 52), and/or KETKQKRVSVLELS (SEQ ID NO: 53). Polynucleotides encoding this polypeptide are also provided. The present invention also encompasses the use of these cAMP-and cGMP-dependent protein kinase phosphorylation site polypeptides as immunogenic and/or antigenic epitope as described elsewhere herein.

[0196] The Mitochondrial GPAT polypeptide has been shown to comprise seven glycosylation sites according to the Motif algorithm (Genetics Computer Group, Inc.). As discussed more specifically herein, protein glycosylation is thought to serve a variety of functions including: augmentation of protein folding, inhibition of protein aggregation, regulation of intracellular trafficking to organelles, increasing resistance to proteolysis, modulation of protein antigenicity, and mediation of intercellular adhesion.

[0197] Asparagine phosphorylation sites have the following consensus pattern, N-{P}-[ST]-{P}, wherein N represents the glycosylation site. However, it is well known that that potential N-glycosylation sites are specific to the consensus sequence Asn-Xaa-Ser/Thr. However, the presence of the consensus tripeptide is not sufficient to conclude that an asparagine residue is glycosylated, due to the fact that the folding of the protein plays an important role in the regulation of N-glycosylation. It has been shown that the presence of proline between Asn and Ser/Thr will inhibit N-glycosylation; this has been confirmed by a recent statistical analysis of glycosylation sites, which also shows that about 50% of the sites that have a proline C-terminal to Ser/Thr are not glycosylated. Additional information relating to asparagine glycosylation may be found in reference to the following publications, which are hereby incorporated by reference herein: Marshall R. D., Annu. Rev. Biochem. 41:673-702(1972); Pless D. D., Lennarz W. J., Proc. Natl. Acad. Sci. U.S.A. 74:134-138(1977); Bause E., Biochem. J. 209:331-336(1983); Gavel Y., von Heijne G., Protein Eng. 3:433-442(1990); and Miletich J. P., Broze G. J. Jr., J. Biol. Chem. 265:11397-11404(1990).

[0198] In preferred embodiments, the following asparagine glycosylation site polypeptides are encompassed by the present invention: NVIYINETHTRHRG (SEQ ID NO: 54), GMFATNVTENVLNS (SEQ ID NO: 55), TENVLNSSRVQEAI (SEQ ID NO: 56), GKPKKNESLWSVAR (SEQ ID NO: 57), RDTSINESRNATDE (SEQ ID NO: 58), INESRNATDESLRR (SEQ ID NO: 59), and/or AIFVHNFSGPVPEP (SEQ ID NO: 60). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Mitochondrial GPAT asparagine glycosylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0199] The Mitochondrial GPAT polypeptide was predicted to comprise five N-myristoylation sites using the Motif algorithm (Genetics Computer Group, Inc.). An appreciable number of eukaryotic proteins are acylated by the covalent addition of myristate (a C14-saturated fatty acid) to their N-terminal residue via an amide linkage. The sequence specificity of the enzyme responsible for this modification, myristoyl CoA:protein N-myristoyl transferase (NMT), has been derived from the sequence of known N-myristoylated proteins and from studies using synthetic peptides. The specificity seems to be the following: i.) The N-terminal residue must be glycine; ii.) In position 2, uncharged residues are allowed; iii.) Charged residues, proline and large hydrophobic residues are not allowed; iv.) In positions 3 and 4, most, if not all, residues are allowed; v.) In position 5, small uncharged residues are allowed (Ala, Ser, Thr, Cys, Asn and Gly). Serine is favored; and vi.) In position 6, proline is not allowed.

[0200] A consensus pattern for N-myristoylation is as follows: G-{EDRKHPFYW}-x(2)-[STAGCN]-{P}, wherein ‘x’ represents any amino acid, and G is the N-myristoylation site.

[0201] Additional information specific to N-myristoylation sites may be found in reference to the following publication: Towler D. A., Gordon J. I., Adams S. P., Glaser L., Annu. Rev. Biochem. 57:69-99(1988); and Grand R. J. A., Biochem. J. 258:625-638(1989); which is hereby incorporated herein in its entirety.

[0202] In preferred embodiments, the following N-myristoylation site polypeptides are encompassed by the present invention: RDVHKGMFATNVTENV (SEQ ID NO: 61), PYIASGNNLNIPIFST (SEQ ID NO: 62), YRHRQGIDLSTLVEDF (SEQ ID NO: 63), AIQLLGNCVTITHTSR (SEQ ID NO: 64), and/or NKRGLGGPTSTPPNLI (SEQ ID NO: 65). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these N-myristoylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0203] The Mitochondrial GPAT polypeptide has been shown to comprise one amidation site according to the Motif algorithm (Genetics Computer Group, Inc.). The precursor of hormones and other active peptides which are C-terminally amidated is always directly followed by a glycine residue which provides the amide group, and most often by at least two consecutive basic residues (Arg or Lys) which generally function as an active peptide precursor cleavage site. Although all amino acids can be amidated, neutral hydrophobic residues such as Val or Phe are good substrates, while charged residues such as Asp or Arg are much less reactive. A consensus pattern for amidation sites is the following: x-G-[RK]-[RK], wherein “X” represents the armdation site. Additional information relating to asparagine glycosylation may be found in reference to the following publications, which are hereby incorporated by reference herein: Kreil G., Meth. Enzymol. 106:218-223(1984); and Bradbury A. F., Smyth D. G., Biosci. Rep. 7:907-916(1987).

[0204] In preferred embodiments, the following amidation site polypeptide is encompassed by the present invention: LDETPDGRKDVLYR (SEQ ID NO: 66). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of this Mitochondrial GPAT amidation site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0205] Many polynucleotide sequences, such as EST sequences, are publicly available and accessible through sequence databases. Some of these sequences are related to SEQ ID NO: 1 and may have been publicly available prior to conception of the present invention. Preferably, such related polynucleotides are specifically excluded from the scope of the present invention. To list every related sequence would be cumbersome. Accordingly, preferably excluded from the present invention are one or more polynucleotides consisting of a nucleotide sequence described by the general formula of a-b, where a is any integer between 1 to 2464 of SEQ ID NO: 1, b is an integer between 15 to 2478, where both a and b correspond to the positions of nucleotide residues shown in SEQ ID NO: 1, and where b is greater than or equal to a+14.

Features of the Polypeptide Encoded by Gene No:2

[0206] The polypeptide of this gene provided as SEQ ID NO: 4 (FIGS. 2A-B), encoded by the polynucleotide sequence according to SEQ ID NO: 3 (FIGS. 2A-B), and/or encoded by the polynucleotide contained within the deposited clone, Microsomal GPAT_hlog1, has significant homology at the nucleotide and amino acid level to other glycerol-3-phosphate acyltransferases, specifically, the human Mitochondrial GPAT of the present invention (H_GPAT; SEQ ID NO: 2); the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and the rat mitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 30)). An alignment of the Microsomal GPAT_hlog1 polypeptide with these proteins is provided in FIGS. 6A-C.

[0207] The Microsomal GPAT_hlog1 polypeptide was determined to share 22.2% identity and 27.8% similarity with the human Mitochondrial GPAT of the present invention (H_GPAT; SEQ ID NO: 2); to share 11.1% identity and 16.7% similarity with the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and to share 11.1% identity and 16.7% similarity with the rat nitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 30)) as shown in FIG. 14.

[0208] Based upon the strong identity between the human, mouse, and rat GPAT proteins, the human Microsomal GPAT_hlog1 of the present invention is believed to represent the a novel human microsomal glycerol-3-phosphate acyltransferase.

[0209] Based upon the observed homology, the polypeptide of the present invention is expected to share at least some biological activity with other glycerol-3-phosphate acyltransferases, specifically with the human, mouse, and rat GPAT proteins, particularly with GPATs found in the liver and/or microsomes, in addition to, other glycerol-3-phosphate acyltransferases referenced elsewhere herein.

[0210] The Microsomal GPAT_hlog1 homologue was determined to comprise two putative transmembrane domains located from about amino acid residue 100 to about amino acid residue 116 (TM1), and/or from about amino acid residue 140 to about amino acid residue 156 of SEQ ID NO: 4 as predicted by the TMPRED program (Biol. Chem. Hoppe-Seyler 347:166, 1993).

[0211] In preferred embodiments, the following transmembrane domain polypeptides are encompassed by the present invention: VLLAFIVLFLLWPFAWL (SEQ ID NO: 67), and/or NGVLGLSRLLFFLLGFL (SEQ ID NO: 68). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog1 transmembrane polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0212] The present invention also encompasses the polypeptide sequences that intervene between each of the predicted Microsomal GPAT_hlog1 transmembrane domains. Since these regions are solvent accessible in the cytosol, they are particularly useful for designing antibodies specific to this region. Such antibodies may be useful as antagonists or agonists of the Microsomal GPAT_hlog1 full-length polypeptide and may modulate its activity.

[0213] In preferred embodiments, the following intertransmembrane domain polypeptide is encompassed by the present invention: QVAGLSEEQLQEPITGWRKTVCH (SEQ ID NO: 69). Polynucleotides encoding this polypeptide are also provided. The present invention also encompasses the use of this Microsomal GPAT_hlog1 transmembrane polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0214] In preferred embodiments, the following N-terminal Microsomal GPAT.hlog1 TM1-2 intertransmembrane domain deletion polypeptides are encompassed by the present invention: Q1-H23, V2-H23, A3-H23, G4-H23, L5-H23, S6-H23, E7-H23 E8-H23, Q9-H23, L10-H23, Q11-H23, E12-H23, P13-H23, I14-H23, T15-H23, G16-H23, and/or W17-H23 of SEQ ID NO: 69. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these N-terminal Microsomal GPAT.hlog1 TM1-2 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0215] In preferred embodiments, the following C-terminal Microsomal GPAT.hlog1 TM1-2 intertransmembrane domain deletion polypeptides are encompassed by the present invention: Q1-H23, Q1-C22, Q1-V21, Q1-T20, Q1-K19, Q1-R18, Q1-W17, Q1-G16, Q1-TI5, Q1-114, Q1-P13, Q1-E12, Q1-Q11, Q1-L10, Q1-Q9, Q1-E8, and/or Q1-E7 of SEQ ID NO: 69. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these C-terminal Microsomal GPAT.hlog1 TM1-2 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0216] In addition, the Microsomal GPAT_hlog1 polypeptide was also determined to comprise several conserved cysteines, at amino acid 255 of SEQ ID NO: 4 (FIGS. 2A-B). Conservation of cysteines at key amino acid residues is indicative of conserved structural features, which may correlate with conservation of protein function and/or activity, particularly with other glycerol-3-phosphate acyltransferase proteins.

[0217] Microsomal GPAT_hlog1 polypeptides and polynucleotides are useful for diagnosing diseases related to the over and/or under expression of Microsomal GPAT_hlog1 by identifying mutations in the Microsomal GPAT_hlog1 gene using Microsomal GPAT_hlog1 sequences as probes or by determining Microsomal GPAT_hlog1 protein or mRNA expression levels. Microsomal GPAT_hlog1 polypeptides will be useful in screens for compounds that affect the activity of the protein. Microsomal GPAT_hlog1 peptides can also be used for the generation of specific antibodies and as bait in yeast two hybrid screens to find proteins the specifically interact with Microsomal GPAT_hlog1.

[0218] Expression profiling designed to measure the steady state mRNA levels encoding the Microsomal GPAT_hlog1 polypeptide showed predominately high expression levels in small intestine, and significant expression levels in the lung and spleen (as shown in FIG. 8).

[0219] Expanded analysis of Microsomal GPAT_hlog1 expression levels by TaqMan™ quantitative PCR (see FIG. 13) determined that the Microsomal GPAT_hlog1 was expressed predominately in the brain, and a number of brain sub-regions including nucleus accubens, cerebellum, frontal cortex, occipital lobe, parietal lobe, caudate, and substantia nigia, among others. Significant expression was observed in gastrointestinal tissues, including the colon, caecum, ileum, jejunam, and to a lesser extent in other tissues as shown.

[0220] The Microsomal GPAT_hlog1 polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, have uses that include modulating metabolism, energy utilization, and triglyceride levels, among others, in various cells, tissues, and organisms, and particularly in mammalian small intestine, lung, spleen, and adipose tissue, preferably human. Microsomal GPAT_hlog1 polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, may be useful in diagnosing, treating, prognosing, and/or preventing gastrointestinal, metabolic, immune, pulmonary, and/or proliferative diseases or disorders.

[0221] The strong homology to the human, mouse, and rat mitochondrial glycerol-3-phosphate acyltransferase proteins, combined with the predominate localized expression in small intestine, suggests the Microsomal GPAT_hlog1 polynucleotides and polypeptides may be useful in treating, diagnosing, prognosing, and/or preventing gastrointesinal diseases and/or disorders, which include, but are not limited to, ulcers, irritable bowel syndrome, inflammatory bowel disease, diarrhea, traveler's diarrhea, drug-related diarrhea polyps, absorption disorders, constipation, diverticulitis, vascular disease of the intestines, intestinal obstruction, intestinal infections, ulcerative colitis, Shigellosis, cholera, Crohn's Disease, amebiasis, enteric fever, Whipple's Disease, peritonitis, intrabdominal abcesses, hereditary hemochromatosis, gastroenteritis, viral gastroenteritis, food poisoning, mesenteric ischemia, mesenteric infarction, in addition to, metabolic diseases and/or disorders.

[0222] Moreover, polynucleotides and polypeptides, including fragments and/or antagonists thereof, have uses which include, directly or indirectly, treating, preventing, diagnosing, and/or prognosing susceptibility to the following, non-limiting, gastrointestinal infections: Salmonella infection, E.coli infection, E.coli O157:H7 infection, Shiga Toxin-producing E.coli infection, Campylobacter infection (e.g., Campylobacter fetus, Campylobacter upsaliensis, Campylobacter hyointestinalis, Campylobacter lari, Campylobacter jejuni, Campylobacter concisus, Campylobacter mucosalis, Campylobacter sputorum, Campylobacter rectus, Campylobacter curvus, Campylobacter sputorum, etc.), Heliobacter infection (e.g., Heliobacter cinaedi, Heliobacter fennelliae, etc.) Yersinia enterocolitica infection, Vibrio sp. Infection (e.g., Vibrio mimicus, Vibrio parahaemolyticus, Vibrio fluvialis, Vibrio furnissii, Vibrio hollisae, Vibrio vulnificus, Vibrio alginolyticus, Vibrio metschnikovii, Vibrio damsela, Vibrio cincinnatiensis, etc.) Aeromonas infection (e.g., Aeromonas hydrophila, Aeromonas sobira, Aeromonas caviae, etc.), Plesiomonas shigelliodes infection, Giardia infection (e.g., Giardia lamblia, etc.), Cryptosporidium infection, Listeria infection, Entamoeba histolytica infection, Rotavirus infection, Norwalk virus infection, Clostridium difficile infection, Clostriudium perfringens infection, Staphylococcus infection, Bacillus infection, in addition to any other gastrointestinal disease and/or disorder implicated by the causative agents listed above or elsewhere herein.

[0223] The strong homology to the human, mouse, and rat mitochondrial glycerol-3-phosphate acyltransferase proteins, combined with the localized expression in lung, suggests the human Microsomal GPAT_hlog1 polynucleotides and polypeptides are useful for treating, diagnosing, prognosing, and/or preventing pulmonary diseases and disorders which include the following, not limiting examples: ARDS, emphysema, cystic fibrosis, interstitial lung disease, chronic obstructive pulmonary disease, bronchitis, lymphangioleiomyomatosis, pneumonitis, eosinophilic pneumonias, granulomatosis, pulmonary infarction, pulmonary fibrosis, pneumoconiosis, alveolar hemorrhage, neoplasms, lung abscesses, empyema, and increased susceptibility to lung infections (e.g., immumocompromised, HIV, etc.), for example.

[0224] Moreover, polynucleotides and polypeptides, including fragments and/or antagonists thereof, have uses which include, directly or indirectly, treating, preventing, diagnosing, and/or prognosing the following, non-limiting, pulmonary infections: pnemonia, bacterial pnemonia, viral pnemonia (for example, as caused by Influenza virus, Respiratory syncytial virus, Parainfluenza virus, Adenovirus, Coxsackievirus, Cytomegalovirus, Herpes simplex virus, Hantavirus, etc.), mycobacteria pnemonia (for example, as caused by Mycobacterium tuberculosis, etc.) mycoplasma pnemonia, fungal pnemonia (for example, as caused by Pneumocystis carinii, Histoplasma capsulatum, Coccidioides immitis, Blastomyces dermatitidis, Candida sp., Cryptococcus neoformans, Aspergillus sp., Zygomycetes, etc.), Legionnaires' Disease, Chlamydia pnemonia, aspiration pnemonia, Nocordia sp. Infections, parasitic pnemonia (for example, as caused by Strongyloides, Toxoplasma gondii, etc.) necrotizing pnemonia, in addition to any other pulmonary disease and/or disorder (e.g., non-pneumonia) implicated by the causative agents listed above or elsewhere herein.

[0225] The strong homology to the human, mouse, and rat mitochondrial glycerol-3-phosphate acyltransferase proteins, combined with the localized expression in spleen, suggests the human Microsomal GPAT_hlog1 polynucleotides and polypeptides may be useful in treating, diagnosing, prognosing, and/or preventing immune diseases and/or disorders. Representative uses are described in the “Immune Activity”, “Chemotaxis”, and “Infectious Disease” sections below, and elsewhere herein. Briefly, the strong expression in immune tissue indicates a role in regulating the proliferation; survival; differentiation; and/or activation of hematopoietic cell lineages, including blood stem cells.

[0226] The Microsomal GPAT_hlog1 polypeptide may also be useful as a preventative agent for immunological disorders including arthritis, asthma, immunodeficiency diseases such as AIDS, leukemia, rheumatoid arthritis, granulomatous disease, inflammatory bowel disease, sepsis, acne, neutropenia, neutrophilia, psoriasis, hypersensitivities, such as T-cell mediated cytotoxicity; immune reactions to transplanted organs and tissues, such as host-versus-graft and graft-versus-host diseases, or autoimmunity disorders, such as autoimmune infertility, lense tissue injury, demyelination, systemic lupus erythematosis, drug induced hemolytic anemia, rheumatoid arthritis, Sjogren's disease, and scleroderma. The Microsomal GPAT_hlog1 polypeptide may be useful for modulating cytokine production, antigen presentation, or other processes, such as for boosting immune responses, etc.

[0227] Moreover, the protein may represent a secreted factor that influences the differentiation or behavior of other blood cells, or that recruits hematopoietic cells to sites of injury. Thus, this gene product is thought to be useful in the expansion of stem cells and committed progenitors of various blood lineages, and in the differentiation and/or proliferation of various cell types. Furthermore, the protein may also be used to determine biological activity, raise antibodies, as tissuemarkers, to isolate cognate ligands or receptors, to identify agents that modulate their interactions, in addition to its use as a nutritional supplement. Protein, as well as, antibodies directed against the protein may show utility as a tumor marker and/or immunotherapy targets for the above listed tissues.

[0228] The Microsomal GPAT_hlog1 polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, have uses that include the treatment, diagnosis, prognosis and/or prevention of a variety of other disorders, which include, but are not limited to, malnutrition, starvation, disorders related to low triglyceride production, disorders related to low triglyceride accumulation, disorders related to low phosphatidic acid production, disorders related to low phospholipid production, disorders related to low VLDL levels, disorders related to low LDL levels, disorders related to low cholesterol levels, diabetes, tissue wasting disorders, bolemia, viral infections, bacterial infections, recovery from major surgery, disoders related to low levels of stored fat researves, infertility related to abnormally low levels of fat reserves, DNA repair disorders, disorders that increase an individuals suspectibility to mutagens, particularly from by-products of fatty acid oxidation and/or degradation, etc.

[0229] The antagonists of the Microsomal GPAT_hlog1 polynucleotides and polypeptides of the present invention have uses that include the treatment, diagnosis, prognosis and/or prevention of a variety of other disorders, which include, but are not limited to, obesity, disorders related to excess triglyceride production, disorders related to excess triglyceride accumulation, disorders related to elevated phosphatidic acid production, disorders related to elevated phospholipid production, disorders related to elevated VLDL plasma levels, disorders related to elevated LDL plasma levels, disorders related to elevated cholesterol plasma levels, etc.

[0230] Moreover, antagonists of Microsomal GPAT_hlog1 polynucleotides and polypeptides of the present invention have uses that include increasing the cellular level of oxidized fatty acycl-CoA, decreasing the cellular level of non-oxidized fatty acycl-CoA, and/or effectively decreasing the level of triglyceride stored in fat reserves.

[0231] Although it is believed the encoded polypeptide may share at least some biological activities with glycerol-3-phosphate acyltransferase proteins, a number of methods of determining the exact biological function of this clone are either known in the art or are described elsewhere herein. Briefly, the function of this clone may be determined by applying microarray methodology. Nucleic acids corresponding to the Microsomal GPAT_hlog1 polynucleotides, in addition to, other clones of the present invention, may be arrayed on microchips for expression profiling. Depending on which polynucleotide probe is used to hybridize to the slides, a change in expression of a specific gene may provide additional insight into the function of this gene based upon the conditions being studied. For example, an observed increase or decrease in expression levels when the polynucleotide probe used comes from tissue that has been treated with known glycerol-3-phosphate acyltransferase inhibitors, which include, but are not limited to the drugs listed herein or otherwise known in the art, might indicate a function in modulating glycerol-3-phosphate acyltransferase function, for example. In the case of Microsomal GPAT_hlog1, small intestine, lung, and/or spleen tissue should be used to extract RNA to prepare the probe.

[0232] In addition, the function of the protein may be assessed by applying quantitative PCR methodology, for example. Real time quantitative PCR would provide the capability of following the expression of the Microsomal GPAT_hlog1 gene throughout development, for example. Quantitative PCR methodology requires only a nominal amount of tissue from each developmentally important step is needed to perform such experiements. Therefore, the application of quantitative PCR methodology to refining the biological function of this polypeptide is encompassed by the present invention. Also encompassed by the present invention are quantitative PCR probes corresponding to the polynucleotide sequence provided as SEQ ID NO: 3 (FIGS. 2A-B).

[0233] The function of the protein may also be assessed through complementation sashays in yeast. For example, in the case of the Microsomal GPAT_hlog1, transforming yeast deficient in glycerol-3-phosphate acyltransferase activity with Microsomal GPAT_hlog1 and assessing their ability to grow would provide convincing evidence the Microsomal GPAT hlog1 polypeptide has glycerol-3-phosphate acyltransferase activity. Additional assay conditions and methods that may be used in assessing the function of the polynucletides and polypeptides of the present invention are known in the art, some of which are disclosed elsewhere herein.

[0234] Alternatively, the biological function of the encoded polypeptide may be determined by disrupting a homologue of this polypeptide in Mice and/or rats and observing the resulting phenotype.

[0235] Moreover, the biological function of this polypeptide may be determined by the application of antisense and/or sense methodology and the resulting generation of transgenic rice and/or rats. Expressing a particular gene in either sense or antisense orientation in a transgenic mouse or rat could lead to respectively higher or lower expression levels of that particular gene. Altering the endogenous expression levels of a gene can lead to the obervation of a particular phenotype that can then be used to derive indications on the function of the gene. The gene can be either over-expressed or under expressed in every cell of the organism at all times using a strong ubiquitous promoter, or it could be expressed in one or more discrete parts of the organism using a well characterized tissue-specific promoter (e.g., a small intestine, lung, spleen, or adipose-specific promoter), or it can be expressed at a specified time of development using an inducible and/or a developmentally regulated promoter.

[0236] In the case of Microsomal GPAT_hlog1 transgenic mice or rats, if no phenotype is apparent in normal growth conditions, observing the organism under diseased conditions (gastrointestinal, pulmonary, spleen, metabolic, or proliferative disorders, etc.) may lead to understanding the function of the gene. Therefore, the application of antisense and/or sense methodology to the creation of transgenic mice or rats to refine the biological function of the polypeptide is encompassed by the present invention.

[0237] In preferred embodiments, the following N-terminal Microsomal GPAT_hlog1 deletion polypeptides are encompassed by the present invention: M1-G542, A2-G542, E3-G542, R4-G542, L5-G542, A6-G542, E7-G542, R8-G542, E9-G542, S10-G542, G11-G542, G12-G542, A13-G542, H14-G542, V15-G542, G16-G542, A17-G542, A18-G542, A19-G542, V20-G542, G21-G542, Q22-G542, G23-G542, V24-G542, L25-G542, E26-G542, R27-G542, T28-G542, L29-G542, R30-G542, A31-G542, W32-G542, A33-G542, I34-G542, D35-G542, K36-G542, L37-G542, E38-G542, D39-G542, V40-G542, E41-G542, K42-G542, L43-G542, K44-G542, W45-G542, G46-G542, R47-G542, A48-G542, L49-G542, V50-G542, S51-G542, H52-G542, I53-G542, P54-G542, R55-G542, Y56-G542, S57-G542, K58-G542, I59-G542, A60-G542, V61-G542, E62-G542, Q63-G542, C64-G542, Q65-G542, K66-G542, M67-G542, T68-G542, S69-G542, G70-G542, L71-G542, K72-G542, T73-G542, G74-G542, P75-G542, L76-G542, A77-G542, V78-G542, Y79-G542, S80-G542, P81-G542, L82-G542, P83-G542, P84-G542, R85-G542, P86-G542, K87-G542, F88-G542, C89-G542, L90-G542, L91-G542, G92-G542, A93-G542, L94-G542, L95-G542, A96-G542, P97-G542, I98-G542, R99-G542, V100-G542, L101-G542, L102-G542, A103-G542, F104-G542, I105-G542, V106-G542, L107-G542, F108-G542, L109-G542, L110-G542, W111-G542, P112-G542, F113-G542, A114-G542, W115-G542, L116-G542, Q117-G542, V118-G542, A119-G542, G120-G542, L121-G542, S122-G542, E123-G542, E124-G542, Q125-G542, L126-G542, Q127-G542, E128-G542, P129-G542, I130-G542, T131-G542, G132-G542, W133-G542, R134-G542, K135-G542, T136-G542, V137-G542, C138-G542, H139-G542, N140-G542, G141-G542, V142-G542, L143-G542, G144-G542, L145-G542, S146-G542, R147-G542, L148-G542, L149-G542, F150-G542, F151-G542, L152-G542, L153-G542, G154-G542, F155-G542, L156-G542, R157-G542, I158-G542, R159-G542, V160-G542, R161-G542, G162-G542, Q163-G542, R164-G542, A165-G542, S166-G542, R167-G542, L168-G542, Q169-G542, A170-G542, P171-G542, V172-G542, L173-G542, V174-G542, A175-G542, A176-G542, P177-G542, H178-G542, S179-G542, T180-G542, F181-G542, F182-G542, D183-G542, P184-G542, I185-G542, V186-G542, L187-G542, L188-G542, P189-G542, C190-G542, D191-G542, L192-G542, P193-G542, K194-G542, V195-G542, V196-G542, S197-G542, R198-G542, A199-G542, E200-G542, N201-G542, L202-G542, S203-G542, V204-G542, P205-G542, V206-G542, I207-G542, G208-G542, A209-G542, L210-G542, L211-G542, R212-G542, F213-G542, N214-G542, Q215-G542, A216-G542, I217-G542, L218-G542, V219-G542, S220-G542, R221-G542, H222-G542, D223-G542, P224-G542, A225-G542, S226-G542, R227-G542, R228-G542, R229-G542, V230-G542, V231-G542, E232-G542, E233-G542, V234-G542, R235-G542, R236-G542, R237-G542, A238-G542, T239-G542, S240-G542, G241-G542, G242-G542, K243-G542, W244-G542, P245-G542, Q246-G542, V247-G542, L248-G542, F249-G542, F250-G542, P251-G542, E252-G542, G253-G542, T254-G542, C255-G542, S256-G542, N257-G542, K258-G542, K259-G542, A260-G542, L261-G542, L262-G542, K263-G542, F264-G542, K265-G542, P266-G542, G267-G542, A268-G542, F269-G542, I270-G542, A271-G542, G272-G542, V273-G542, P274-G542, V275-G542, Q276-G542, P277-G542, V278-G542, L279-G542, I280-G542, R281-G542, Y282-G542, P283-G542, N284-G542, S285-G542, L286-G542, F287-G542, L288-G542, P289-G542, V290-G542, Y291-G542, H292-G542, P293-G542, S294-G542, P295-G542, E296-G542, E297-G542, S298-G542, R299-G542, D300-G542, P301-G542, T302-G542, L303-G542, Y304-G542, A305-G542, N306-G542, N307-G542, V308-G542, Q309-G542, R310-G542, V311-G542, M312-G542, A313-G542, Q314-G542, A315-G542, L316-G542, G317-G542, I318-G542, P319-G542, A320-G542, T321-G542, E322-G542, C323-G542, E324-G542, F325-G542, V326-G542, G327-G542, S328-G542, L329-G542, P330-G542, V331-G542, I332-G542, V333-G542, V334-G542, G335-G542, R336-G542, L337-G542, K338-G542, V339-G542, A340-G542, L341-G542, E342-G542, P343-G542, Q344-G542, L345-G542, W346-G542, E347-G542, L348-G542, G349-G542, K350-G542, V351-G542, L352-G542, R353-G542, K354-G542, A355-G542, G356-G542, L357-G542, S358-G542, A359-G542, G360-G542, Y361-G542, V362-G542, D363-G542, A364-G542, G365-G542, A366-G542, E367-G542, P368-G542, G369-G542, R370-G542, S371-G542, R372-G542, M373-G542, I374-G542, S375-G542, Q376-G542, E377-G542, E378-G542, F379-G542, A380-G542, R381-G542, Q382-G542, L383-G542, Q384-G542, L385-G542, S386-G542, D387-G542, P388-G542, Q389-G542, T390-G542, V391-G542, A392-G542, G393-G542, A394-G542, F395-G542, G396-G542, Y397-G542, F398-G542, Q399-G542, Q400-G542, D401-G542, T402-G542, K403-G542, G404-G542, L405-G542, V406-G542, D407-G542, F408-G542, R409-G542, D410-G542, V411-G542, A412-G542, L413-G542, A414-G542, L415-G542, A416-G542, A417-G542, L418-G542, D419-G542, G420-G542, G421-G542, R422-G542, S423-G542, L424-G542, E425-G542, E426-G542, L427-G542, T428-G542, R429-G542, L430-G542, A431-G542, F432-G542, E433-G542, L434-G542, F435-G542, A436-G542, E437-G542, E438-G542, Q439-G542, A440-G542, E441-G542, G442-G542, P443-G542, N444-G542, R445-G542, L446-G542, L447-G542, Y448-G542, K449-G542, D450-G542, G451-G542, F452-G542, S453-G542, T454-G542, I455-G542, L456-G542, H457-G542, L458-G542, L459-G542, L460-G542, G461-G542, S462-G542, P463-G542, H464-G542, P465-G542, A466-G542, A467-G542, T468-G542, A469-G542, L470-G542, H471-G542, A472-G542, E473-G542, L474-G542, C475-G542, Q476-G542, A477-G542, G478-G542, S479-G542, S480-G542, Q481-G542, G482-G542, L483-G542, S484-G542, L485-G542, C486-G542, Q487-G542, F488-G542, Q489-G542, N490-G542, F491-G542, S492-G542, I493-G542, H494-G542, D495-G542, P496-G542, L497-G542, Y498-G542, G499-G542, K500-G542, L501-G542, F502-G542, S503-G542, T504-G542, Y505-G542, L506-G542, R507-G542, P508-G542, P509-G542, H510-G542, T511-G542, S512-G542, R513-G542, G514-G542, T515-G542, S516-G542, Q517-G542, T518-G542, P519-G542, N520-G542, A521-G542, S522-G542, S523-G542, P524-G542, G525-G542, N526-G542, P527-G542, T528-G542, A529-G542, L530-G542, A531-G542, N532-G542, G533-G542, T534-G542, V535-G542, and/or Q536-G542 of SEQ ID NO: 4. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these N-terminal Microsomal GPAT_hlog1 deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0238] In preferred embodiments, the following C-terminal Microsomal GPAT_hlog1 deletion polypeptides are encompassed by the present invention: M1-G542, M1-K541, M1-Q540, M1-K539, M1-P538, M1-A537, M1-Q536, M1-V535, M1-T534, M1-G533, M1-N532, M1-A531, M1-L530, M1-A529, M1-T528, M1-P527, M1-N526, M1-G525, M1-P524, M1-S523, M1-S522, M1-A521, M1-N520, M1-P519, M1-T518, M1-Q517, M1-S516, M1-T515, M1-G514, M1-R513, M1-S512, M1-T511, M1-H510, M1-P509, M1-P508, M1-R507, M1-L506, M1-Y505, M1-T504, M1-S503, M1-F502, M1-L501, M1-K500, M1-G499, M1-Y498, M1-L497, M1-P496, M1-D495, M1-H494, M1-L493, M1-S492, M1-F491, M1-N490, M1-Q489, M1-F488, M1-Q487, M1-C486, M1-L485, M1-S484, M1-L483, M1-G482, M1-Q481, M1-S480, M1-S479, M1-G478, M1-A477, M1-Q476, M1-C475, M1-L474, M1-E473, M1-A472, M1-H471, M1-L470, M1-A469, M1-T468, M1-A467, M1-A466, M1-P465, M1-H464, M1-P463, M1-S462, M1-G461, M1-L460, M1-L459, M1-L458, M1-H457, M1-L456, M1-I455, M1-T454, M1-S453, M1-F452, M1-G450, M1-K449, M1-Y448, M1-L447, M1-L446, M1-R445, M1-N444, M1-P443, M1-G442, M1-E441, M1-A440, M1-Q439, M1-E438, M1-E437, M1-A436, M1-F435, M1-L434, M1-E433, M1-F432, M1-A431, M1-L430, M1-R429, M1-T428, M1-L427, M1-E426, M1-E425, M1-L424, M1-S423, M1-R422, M1-G421, M1-G420, M1-D419, M1-L418, M1-A417, M1-A416, M1-L415, M1-A414, M1-L413, M1-A412, M1-V411, M1-D410, M1-R409, M1-F408, M1-D407, M1-V406, M1-L405, M1-G404, M1-K403, M1-T402, M1-D401, M1-Q400, M1-Q399, M1-F398, M1-Y397, M1-G396, M1-F395, M1-A394, M1-G393, M1-A392, M1-V391, M1-T390, M1-Q389, M1-P388, M1-D387, M1-S386, M1-L385, M1-Q384, M1-L383, M1-Q382, M1-R381, M1-A380, M1-F379, M1-E378, M1-E377, M1-Q376, M1-S375, M1-I374, M1-M373, M1-R372, M1-S371, M1-R370, M1-G369, M1-P368, M1-E367, M1-A366, M1-G365, M1-A364, M1-D363, M1-V362, M1-Y361, M1-G360, M1-A359, M1-S358, M1-L357, M1-G356, M1-A355, M1-K354, M1-R353, M1-L352, M1-V351, M1-K350, M1-G349, M1-L348, M1-E347, M1-W346, M1-L345, M1-Q344, M1-P343, M1-E342, M1-L341, M1-A340, M1-V339, M1-K338, M1-L337, M1-R336, M1-G335, M1-V334, M1-V333, M1-I332, M1-V331, M1-P330, M1-L329, M1-S328, M1-G327, M1-V326, M1-F325, M1-E324, M1-C323, M1-E322, M1-T321, M1-A320, M1-P319, M1-I318, M1-G317, M1-L316, M1-A315, M1-Q314, M1-A313, M1-M312, M1-V311, M1-R310, M1-Q309, M1-V308, M1-N307, M1-N306, M1-A305, M1-Y304, M1-L303, M1-T302, M1-P301, M1-D300, M1-R299, M1-S298, M1-E297, M1-E296, M1-P295, M1-S294, M1-P293, M1-H292, M1-Y291, M1-V290, M1-P289, M1-L288, M1-F287, M1-L286, M1-S285, M1-N284, M1-P283, M1-Y282, M1-R281, M1-I280, M1-L279, M1-V278, M1-P277, M1-Q276, M1-V275, M1-P274, M1-V273, M1-G272, M1-A271, M1-I270, M1-F269, M1-A268, M1-G267, M1-P266, M1-K265, M1-F264, M1-K263, M1-L262, M1-L261, M1-A260, M1-K259, M1-K258, M1-N257, M1-S256, M1-C255, M1-T254, M1-G253, M1-E252, M1-P251, M1-F250, M1-F249, M1-L248, M1-V247, M1-Q246, M1-P245, M1-W244, M1-K243, M1-G242, M1-G241, M1-S240, M1-T239, M1-A238, M1-R237, M1-R236, M1-R235, M1-V234, M1-E233, M1-E232, M1-V231, M1-V230, M1-R229, M1-R228, M1-R227, M1-S226, M1-A225, M1-P224, M1-D223, M1-H222, M1-R221, M1-S220, M1-V219, M1-L218, M1-I217, M1-A216, M1-Q215, M1-N214, M1-F213, M1-R212, M1-L211, M1-L210, M1-A209, M1-G208, M1-I207, M1-V206, M1-P205, M1-V204, M1-S203, M1-L202, M1-N201, M1-E200, M1-A199, M1-R198, M1-S197, M1-V196, M1-V195, M1-K194, M1-P193, M1-L192, M1-D191, M1-C190, M1-P189, M1-L188, M1-L187, M1-V186, M1-I185, M1-P184, M1-D183, M1-F182, M1-F181, M1-T180, M1-S179, M1-H178, M1-P177, M1-A176, M1-A175, M1-V174, M1-L173, M1-V172, M1-P171, M1-A170, M1-Q169, M1-L168, M1-R167, M1-S166, M1-A165, M1-R164, M1-Q163, M1-G162, M1-R161, M1-V160, M1-R159, M1-I158, M1-R157, M1-L156, M1-FI55, M1-G154, M1-L153, M1-L152, M1-F151, M1-F150, M1-L149, M1-L148, M1-R147, M1-S146, M1-L145, M1-G144, M1-L143, M1-V142, M1-G141, M1-N140, M1-H139, M1-C138, M1-V137, M1-T136, M1-K135, M1-R134, M1-WI33, M1-G132, M1-T131, M1-I130, M1-P129, M1-E128, M1-Q127, M1-L126, M1-Q125, M1-E124, M1-E123, M1-S122, M1-L121, M1-G120, M1-A119, M1-V118, M1-Q117, M1-L116, M1-W115, M1-A114, M1-F113, M1-P112, M1-W111, M1-L110, M1-L109, M1-F108, M1-L107, M1-V106, M1-I105, M1-F104, M1-A103, M1-L102, M1-L101, M1-V100, M1-R99, M1-I98, M1-P97, M1-A96, M1-L95, M1-L94, M1-A93, M1-G92, M1-L91, M1-L90, M1-C89, M1-F88, M1-K87, M1-P86, M1-R85, M1-P84, M1-P83, M1-L82, M1-P81, M1-S80, M1-Y79, M1-V78, M1-A77, M1-L76, M1-P75, M1-G74, M1-T73, M1-K72, M1-L71, M1-G70, M1-S69, M1-T68, M1-M67, M1-K66, M1-Q65, M1-C64, M1-Q63, M1-E62, M1-V61, M1-A60, M1-I59, M1-K58, M1-S57, M1-Y56, M1-R55, M1-P54, M1-I53, M1-H52, M1-S51, M1-V50, M1-L49, M1-A48, M1-R47, M1-G46, M1-W45, M1-K44, M1-L43, M1-K42, M1-E41, M1-V40, M1-D39, M1-E38, M1-L37, M1-K36, M1-D35, M1-I34, M1-A33, M1-W32, M1-A31, M1-R30, M1-L29, M1-T28, M1-R27, M1-E26, M1-L25, M1-V24, M1-G23, M1-Q22, M1-G21, M1-V20, M1-A19, M1-A18, M1-A17, M1-G16, M1-V15, M1-H14, M1-A13, M1-G12, M1-G11, M1-S10, M1-E9, M1-R8, and/or M1-E7 of SEQ ID NO: 4. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these C-terminal Microsomal GPAT_hlog1 deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0239] Alternatively, preferred polypeptides of the present invention may comprise polypeptide sequences corresponding to, for example, internal regions of the Microsomal GPAT_hlog1 polypeptide (e.g., any combination of both N-and C-terminal Microsomal GPAT_hlog1 polypeptide deletions) of SEQ ID NO: 4. For example, internal regions could be defined by the equation: amino acid NX to amino acid CX, wherein NX refers to any N-terminal deletion polypeptide amino acid of Microsomal GPAT_hlog1 (SEQ ID NO: 4), and where CX refers to any C-terminal deletion polypeptide amino acid of Microsomal GPAT_hlog1 (SEQ ID NO: 4). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these polypeptides as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0240] The present invention also encompasses immunogenic and/or antigenic epitopes of the Microsomal GPAT_hlog1 polypeptide.

[0241] The Microsomal GPAT_hlog1 polypeptides of the present invention were determined to comprise several phosphorylation sites based upon the Motif algorithm (Genetics Computer Group, Inc.). The phosphorylation of such sites may regulate some biological activity of the Microsomal GPAT_hlog1 polypeptide. For example, phosphorylation at specific sites may be involved in regulating the proteins ability to associate or bind to other molecules (e.g., proteins, ligands, substrates, DNA, etc.). In the present case, phosphorylation may modulate the ability of the Microsomal GPAT_hlog1 polypeptide to associate with other potassium channel alpha subunits, beta subunits, or its ability to modulate potassium channel function.

[0242] The Microsomal GPAT_hlog1 polypeptide was predicted to comprise four PKC phosphorylation sites using the Motif algorithm (Genetics Computer Group, Inc.). In vivo, protein kinase C exhibits a preference for the phosphorylation of serine or threonine residues. The PKC phosphorylation sites have the following consensus pattern: [ST]-x-[RK], where S or T represents the site of phosphorylation and ‘x’ an intervening amino acid residue. Additional information regarding PKC phosphorylation sites can be found in Woodget J. R., Gould K. L., Hunter T., Eur. J. Biochem. 161:177-184(1986), and Kishimoto A., Nishiyama K., Nakanishi H., Uratsuji Y., Nomura H., Takeyama Y., Nishizuka Y., J. Biol. Chem. 260:12492-12499(1985); which are hereby incorporated by reference herein.

[0243] In preferred embodiments, the following PKC phosphorylation isite polypeptides are encompassed by the present invention: GVLERTLRAWAID (SEQ ID NO: 70), RHDPASRRRVVEE (SEQ ID NO: 71), PEGTCSNKKALLK (SEQ ID NO: 72), and/or LRPPHTSRGTSQT (SEQ ID NO: 73). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog1 PKC phosphorylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0244] The Microsomal GPAT_hlog1 polypeptide was predicted to comprise eight casein kinase II phosphorylation sites using the Motif algorithm (Genetics Computer Group, Inc.). Casein kinase II (CK-2) is a protein serine/threonine kinase whose activity is independent of cyclic nucleotides and calcium. CK-2 phosphorylates many different proteins. The substrate specificity [1] of this enzyme can be summarized as follows: (1) Under comparable conditions Ser is favored over Thr.; (2) An acidic residue (either Asp or Glu) must be present three residues from the C-terminal of the phosphate acceptor site; (3) Additional acidic residues in positions +1, +2, +4, and +5 increase the phosphorylation rate. Most physiological substrates have at least one acidic residue in these positions; (4) Asp is preferred to Glu as the provider of acidic determinants; and (5) A basic residue at the N-terminal of the acceptor site decreases the phosphorylation rate, while an acidic one will increase it.

[0245] A consensus pattern for casein kinase II phosphorylations site is as follows: [ST]-x(2)-[DE], wherein ‘x’ represents any amino acid, and S or T is the phosphorylation site.

[0246] Additional information specific to casein kinase II phosphorylation sites may be found in reference to the following publication: Pinna L. A., Biochim. Biophys. Acta 1054:267-284(1990); which is hereby incorporated herein in its entirety.

[0247] In preferred embodiments, the following casein kinase II phosphorylation site polypeptides are encompassed by the present invention: AAPHSTFFDPIVLL (SEQ ID NO: 74), LPKVVSRAENLSVP (SEQ ID NO: 75), QAILVSRHDPASRR (SEQ ID NO: 76), PVYHPSPEESRDPT (SEQ ID NO: 77), LGIPATECEFVGSL (SEQ ID NO: 78), RSRMISQEEFARQL (SEQ ID NO: 79), LDGGRSLEELTRLA (SEQ ID NO: 80), and/or QFQNFSLHDPLYGK (SEQ ID NO: 81). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of this casein kinase II phosphorylation site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0248] The Microsomal GPAT_hlog1 polypeptide was predicted to comprise one cAMP-and cGMP-dependent protein kinase phosphorylation site using the Motif algorithm (Genetics Computer Group, Inc.). There has been a number of studies relative to the specificity of cAMP-and cGMP-dependent protein kinases. Both types of kinases appear to share a preference for the phosphorylation of serine or threonine residues found close to at least two consecutive N-terminal basic residues.

[0249] A consensus pattern for cAMP-and cGMP-dependent protein kinase phosphorylation sites is as follows: [RK](2)-x-[ST], wherein “x” represents any amino acid, and S or T is the phosphorylation site.

[0250] Additional information specific to cAMP-and cGMP-dependent protein kinase phosphorylation sites may be found in reference to the following publication: Fremisco J. R., Glass D. B., Krebs E. G, J. Biol. Chem. 255:4240-4245(1980); Glass D. B., Smith S. B., J. Biol. Chem. 258:14797-14803(1983); and Glass D. B., E1-Maghrabi M. R., Pilkis S. J., J. Biol. Chem. 261:2987-2993(1986); which is hereby incorporated herein in its entirety.

[0251] In preferred embodiments, the following cAMP-and cGMP-dependent protein kinase phosphorylation site polypeptides are encompassed by the present invention: VEEVRRRATSGGKW (SEQ ID NO: 82). Polynucleotides encoding this polypeptide are also provided. The present invention also encompasses the use of these cAMP-and cGMP-dependent protein kinase phosphorylation site polypeptides as immunogenic and/or antigenic epitope as described elsewhere herein.

[0252] The Microsomal GPAT_hlog1 polypeptide has been shown to comprise four glycosylation sites according to the Motif algorithm (Genetics Computer Group, Inc.). As discussed more specifically herein, protein glycosylation is thought to serve a variety of functions including: augmentation of protein folding, inhibition of protein aggregation, regulation of intracellular trafficking to organelles, increasing resistance to proteolysis, modulation of protein antigenicity, and mediation of intercellular adhesion.

[0253] Asparagine phosphorylation sites have the following consensus pattern, N-{P}-[ST]-{P}, wherein N represents the glycosylation site. However, it is well known that that potential N-glycosylation sites are specific to the consensus sequence Asn-Xaa-Ser/Thr. However, the presence of the consensus tripeptide is not sufficient to conclude that an asparagine residue is glycosylated, due to the fact that the folding of the protein plays an important role in the regulation of N-glycosylation. It has been shown that the presence of proline between Asn and Ser/Thr will inhibit N-glycosylation; this has been confirmed by a recent statistical analysis of glycosylation sites, which also shows that about 50% of the sites that have a proline C-terminal to Ser/Thr are not glycosylated. Additional information relating to asparagine glycosylation may be found in reference to the following publications, which are hereby incorporated by reference herein: Marshall R. D., Annu. Rev. Biochem. 41:673-702(1972); Pless D. D., Lennarz W. J., Proc. Natl. Acad. Sci. U.S.A. 74:134-138(1977); Bause E., Biochem. J. 209:331-336(1983); Gavel Y., von Heijne G., Protein Eng. 3:433-442(1990); and Miletich J. P., Broze G. J. Jr., J. Biol. Chem. 265:11397-11404(1990).

[0254] In preferred embodiments, the following asparagine glycosylation site polypeptides are encompassed by the present invention: VSRAENLSVPVIGA (SEQ ID NO: 83), LCQFQNFSLHDPLY (SEQ ID NO: 84), TSQTPNASSPGNPT (SEQ ID NO: 85), and/or PTALANGTVQAPKQ (SEQ ID NO: 86). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog1 asparagine glycosylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0255] The Microsomal GPAT_hlog1 polypeptide was predicted to comprise five N-myristoylation sites using the Motif algorithm (Genetics Computer Group, Inc.). An appreciable number of eukaryotic proteins are acylated by the covalent addition of myristate (a C14-saturated fatty acid) to their N-terminal residue via an amide linkage. The sequence specificity of the enzyme responsible for this modification, myristoyl CoA:protein N-myristoyl transferase (NMT), has been derived from the sequence of known N-myristoylated proteins and from studies using synthetic peptides. The specificity seems to be the following: i.) The N-terminal residue must be glycine; ii.) In position 2, uncharged residues are allowed; iii.) Charged residues, proline and large hydrophobic residues are not allowed; iv.) In positions 3 and 4, most, if not all, residues are allowed; v.) In position 5, small uncharged residues are allowed (Ala, Ser, Thr, Cys, Asn and Gly). Serine is favored; and vi.) In position 6, proline is not allowed.

[0256] A consensus pattern for N-myristoylation is as follows: G-{EDRKHPFYW}-x(2)-[STAGCN]-{P}, wherein ‘x’ represents any amino acid, and G is the N-myristoylation site.

[0257] Additional information specific to N-myristoylation sites may be found in reference to the following publication: Towler D. A., Gordon J. I., Adams S. P., Glaser L., Annu. Rev. Biochem. 57:69-99(1988); and Grand R. J. A., Biochem. J. 258:625-638(1989); which is hereby incorporated herein in its entirety.

[0258] In preferred embodiments, the following N-myristoylation site polypeptides are encompassed by the present invention: ERESGGAHVGAAAVGQ (SEQ ID NO: 87), RIRVRGQRASRLQAPV (SEQ ID NO: 88), LFFPEGTCSNKKALLK (SEQ ID NO: 89), LKFKPGAFIAGVPVQP (SEQ ID NO: 90), MAQALGIPATECEFVG (SEQ ID NO: 91), VLRKAGLSAGYVDAGA (SEQ ID NO: 92), GYVDAGAEPGRSRMIS (SEQ ID NO: 93), ELCQAGSSQGLSLCQF (SEQ ID NO: 94), AGSSQGLSLCQFQNFS (SEQ ID NO: 95), and/or NASSPGNPTALANGTV (SEQ ID NO: 96). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these N-myristoylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0259] Many polynucleotide sequences, such as EST sequences, are publicly available and accessible through sequence databases. Some of these sequences are related to SEQ ID NO: 3 and may have been publicly available prior to conception of the present invention. Preferably, such related polynucleotides are specifically excluded from the scope of the present invention. To list every related sequence would be cumbersome. Accordingly, preferably excluded from the present invention are one or more polynucleotides consisting of a nucleotide sequence described by the general formula of a-b, where a is any integer between 1 to 1618 of SEQ ID NO: 3, b is an integer between 15 to 1632, where both a and b correspond to the positions of nucleotide residues shown in SEQ ID NO: 3, and where b is greater than or equal to a+14.

Features of the Polypeptide Encoded by Gene No:3

[0260] The polypeptide of this gene provided as SEQ ID NO: 6 (FIGS. 3A-B), encoded by the polynucleotide sequence according to SEQ ID NO: 5 (FIGS. 3A-B), and/or encoded by the polynucleotide contained within the deposited clone, Microsomal GPAT_hlog2, has significant homology at the nucleotide and amino acid level to other glycerol-3-phosphate acyltransferases, specifically, the human Mitochondrial GPAT of the present invention (H-GPAT; SEQ ID NO: 2); the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and the rat mitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 50)). An alignment of the Microsomal GPAT_hlog2 polypeptide with these proteins is provided in FIGS. 6A-C.

[0261] The Microsomal GPAT_hlog2 polypeptide was determined to share 24.1% identity and 27.6% similarity with the human Mitochondrial GPAT of the present invention (H_GPAT; SEQ ID NO: 2); to share 24.1% identity and 27.6% similarity with the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and to share 34.6% identity and 38.5% similarity with the rat mitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 50)) as shown in FIG. 14.

[0262] Based upon the strong identity between the human, mouse, and rat GPAT proteins, the human Microsomal GPAT_hlog2 of the present invention is believed to represent the a novel human microsomal glycerol-3-phosphate acyltransferase.

[0263] Based upon the observed homology, the polypeptide of the present invention is expected to share at least some biological activity with other glycerol-3-phosphate acyltransferases, specifically with the human, mouse, and rat GPAT proteins, particularly with GPATs found in the liver and/or microsomes, in addition to, other glycerol-3-phosphate acyltransferases referenced elsewhere herein.

[0264] The Microsomal GPAT_hlog2 homologue was determined to comprise one putative transmembrane domain located from about amino acid residue 26 to about amino acid residue 46 (TM1) of SEQ ID NO: 6 as predicted by the TMPRED program (Biol. Chem. Hoppe-Seyler 347:166, 1993).

[0265] In preferred embodiments, the following transmembrane domain polypeptides are encompassed by the present invention: LLVAAAMMLLAWPLALVASLG (SEQ ID NO: 92). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog2 transmembrane polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0266] In addition, the Microsomal GPAT_hlog2 polypeptide was also determined to comprise several conserved cysteines, at amino acid 179, 184, 231, 282, and/or 380 of SEQ ID NO: 6 (FIGS. 3A-B). Conservation of cysteines at key amino acid residues is indicative of conserved structural features, which may correlate with conservation of protein function and/or activity, particularly with other glycerol-3-phosphate acyltransferase proteins.

[0267] Microsomal GPAT_hlog2 polypeptides and polynucleotides are useful for diagnosing diseases related to the over and/or under expression of Microsomal GPAT_hlog2 by identifying mutations in the Microsomal GPAT_hlog2 gene using Microsomal GPAT_hlog2 sequences as probes or by determining Microsomal GPAT_hlog2 protein or mRNA expression levels. Microsomal GPAT_hlog2 polypeptides will be useful in screens for compounds that affect the activity of the protein. Microsomal GPAT_hlog2 peptides can also be used for the generation of specific antibodies and as bait in yeast two hybrid screens to find proteins the specifically interact with Microsomal GPAT_hlog2.

[0268] Expression profiling designed to measure the steady state mRNA levels encoding the Microsomal GPAT_hlog2 polypeptide showed predominately high expression levels in lung (as shown in FIG. 9).

[0269] Expanded analysis of Microsomal GPAT_hlog2 expression levels by TaqMan™ quantitative PCR (see FIG. 14) confirmed that the Microsomal GPAT_hlog2 polypeptide is expressed in lung. Microsomal GPAT_hlog2 mRNA was expressed predominately in the parenchyma of the lung. Significant expression was observed in the tertiary bronchus of the lung, spleen, and to a lesser extent in other tissues as shown.

[0270] The Microsomal GPAT_hlog2 polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, have uses that include modulating metabolism, energy utilization, and triglyceride levels, among others, in various cells, tissues, and organisms, and particularly in mammalian small intestine, lung, spleen, and adipose tissue, preferably human. Microsomal GPAT_hlog2 polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, may be useful in diagnosing, treating, prognosing, and/or preventing gastrointestinal, metabolic, immune, pulmonary, and/or proliferative diseases or disorders.

[0271] The strong homology to the human, mouse, and rat mitochondrial glycerol-3-phosphate acyltransferase proteins, combined with the predominate localized expression in lung, suggests the Microsomal GPAT_hlog2 polynucleotides and polypeptides are useful for treating, diagnosing, prognosing, and/or preventing pulmonary diseases and disorders which include the following, not limiting examples: ARDS, emphysema, cystic fibrosis, interstitial lung disease, chronic obstructive pulmonary disease, bronchitis, lymphangioleiomyomatosis, pneumonitis, eosinophilic pneumonias, granulomatosis, pulmonary infarction, pulmonary fibrosis, pneumoconiosis, alveolar hemorrhage, neoplasms, lung abscesses, empyema, and increased susceptibility to lung infections (e.g., immumocompromised, HIV, etc.), for example.

[0272] Moreover, polynucleotides and polypeptides, including fragments and/or antagonists thereof, have uses which include, directly or indirectly, treating, preventing, diagnosing, and/or prognosing the following, non-limiting, pulmonary infections: pnemonia, bacterial pnemonia, viral pnemonia (for example, as caused by Influenza virus, Respiratory syncytial virus, Parainfluenza virus, Adenovirus, Coxsackievirus, Cytomegalovirus, Herpes simplex virus, Hantavirus, etc.), mycobacteria pnemonia (for example, as caused by Mycobacterium tuberculosis, etc.) mycoplasma pnemonia, fungal pnemonia (for example, as caused by Pneumocystis carinii, Histoplasma capsulatum, Coccidioides immitis, Blastomyces dermatitidis, Candida sp., Cryptococcus neoformans, Aspergillus sp., Zygomycetes, etc.), Legionnaires' Disease, Chlamydia pnemonia, aspiration pnemonia, Nocordia sp. Infections, parasitic pnemonia (for example, as caused by Strongyloides, Toxoplasma gondii, etc.) necrotizing pnemonia, in addition to any other pulmonary disease and/or disorder (e.g., non-pneumonia) implicated by the causative agents listed above or elsewhere herein.

[0273] The Microsomal GPAT_hlog2 polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, have uses that include the treatment, diagnosis, prognosis and/or prevention of a variety of other disorders, which include, but are not limited to, malnutrition, starvation, disorders related to low triglyceride production, disorders related to low triglyceride accumulation, disorders related to low phosphatidic acid production, disorders related to low phospholipid production, disorders related to low VLDL levels, disorders related to low LDL levels, disorders related to low cholesterol levels, diabetes, tissue wasting disorders, bolemia, viral infections, bacterial infections, recovery from major surgery, disoders related to low levels of stored fat researves, infertility related to abnormally low levels of fat reserves, DNA repair disorders, disorders that increase an individuals suspectibility to mutagens, particularly from by-products of fatty acid oxidation and/or degradation, etc.

[0274] The antagonists of the Microsomal GPAT_hlog2 polynucleotides and polypeptides of the present invention have uses that include the treatment, diagnosis, prognosis and/or prevention of a variety of other disorders, which include, but are not limited to, obesity, disorders related to excess triglyceride production, disorders related to excess triglyceride accumulation, disorders related to elevated phosphatidic acid production, disorders related to elevated phospholipid production, disorders related to elevated VLDL plasma levels, disorders related to elevated LDL plasma levels, disorders related to elevated cholesterol plasma levels, etc.

[0275] Moreover, antagonists of Microsomal GPAT_hlog2 polynucleotides and polypeptides of the present invention have uses that include increasing the cellular level of oxidized fatty acycl-CoA, decreasing the cellular level of non-oxidized fatty acycl-CoA, and/or effectively decreasing the level of triglyceride stored in fat reserves.

[0276] Although it is believed the encoded polypeptide may share at least some biological activities with glycerol-3-phosphate acyltransferase proteins, a number of methods of determining the exact biological function of this clone are either known in the art or are described elsewhere herein. Briefly, the function of this clone may be determined by applying microarray methodology. Nucleic acids corresponding to the Microsomal GPAT_hlog2 polynucleotides, in addition to, other clones of the present invention, may be arrayed on microchips for expression profiling. Depending on which polynucleotide probe is used to hybridize to the slides, a change in expression of a specific gene may provide additional insight into the function of this gene based upon the conditions being studied. For example, an observed increase or decrease in expression levels when the polynucleotide probe used comes from tissue that has been treated with known glycerol-3-phosphate acyltransferase inhibitors, which include, but are not limited to the drugs listed herein or otherwise known in the art, might indicate a function in modulating glycerol-3-phosphate acyltransferase function, for example. In the case of Microsomal GPAT_hlog2, lung tissue should be used to extract RNA to prepare the probe.

[0277] In addition, the function of the protein may be assessed by applying quantitative PCR methodology, for example. Real time quantitative PCR would provide the capability of following the expression of the Microsomal GPAT_hlog2 gene throughout development, for example. Quantitative PCR methodology requires only a nominal amount of tissue from each developmentally important step is needed to perform such experiements. Therefore, the application of quantitative PCR methodology to refining the biological function of this polypeptide is encompassed by the present invention. Also encompassed by the present invention are quantitative PCR probes corresponding to the polynucleotide sequence provided as SEQ ID NO: 5 (FIGS. 3A-B).

[0278] The function of the protein may also be assessed through complementation assays in yeast. For example, in the case of the Microsomal GPAT_hlog2, transforming yeast deficient in glycerol-3-phosphate acyltransferase activity with Microsomal GPAT_hlog2 and assessing their ability to grow would provide convincing evidence the Microsomal GPAT_hlog2 polypeptide has glycerol-3-phosphate acyltransferase activity. Additional assay conditions and methods that may be used in assessing the function of the polynucletides and polypeptides of the present invention are known in the art, some of which are disclosed elsewhere herein.

[0279] Alternatively, the biological function of the encoded polypeptide may be determined by disrupting a homologue of this polypeptide in Mice and/or rats and observing the resulting phenotype.

[0280] Moreover, the biological function of this polypeptide may be determined by the application of antisense and/or sense methodology and the resulting generation of transgenic mice and/or rats. Expressing a particular gene in either sense or antisense orientation in a transgenic mouse or rat could lead to respectively higher or lower expression levels of that particular gene. Altering the endogenous expression levels of a gene can lead to the obervation of a particular phenotype that can then be used to derive indications on the function of the gene. The gene can be either over-expressed or under expressed in every cell of the organism at all times using a strong ubiquitous promoter, or it could be expressed in one or more discrete parts of the organism using a well characterized tissue-specific promoter (e.g., a lung-specific promoter), or it can be expressed at a specified time of development using an inducible and/or a developmentally regulated promoter.

[0281] In the case of Microsomal GPAT_hlog2 transgenic mice or rats, if no phenotype is apparent in normal growth conditions, observing the organism under diseased conditions (pulmonary, metabolic, or proliferative disorders, etc.) may lead to understanding the function of the gene. Therefore, the application of antisense and/or sense methodology to the creation of transgenic mice or rats to refine the biological function of the polypeptide is encompassed by the present invention.

[0282] In preferred embodiments, the following N-terminal Microsomal GPAT_hlog2 deletion polypeptides are encompassed by the present invention: V1-D502, H2-D502, E3-D502, L4-D502, H5-D502, L6-D502, S7-D502, A8-D502, L9-D502, Q10-D502, K11-D502, A12-D502, Q13-D502, V14-D502, A15-D502, L16-D502, M17-D502, T18-D502, L19-D502, T20-D502, L21-D502, F22-D502, P23-D502, V24-D502, R25-D502, L26-D502, L27-D502, V28-D502, A29-D502, A30-D502, A31-D502, M32-D502, M33-D502, L34-D502, L35-D502, A36-D502, W37-D502, P38-D502, L39-D502, A40-D502, L41-D502, V42-D502, A43-D502, S44-D502, L45-D502, G46-D502, S47-D502, A48-D502, E49-D502, K50-D502, E51-D502, P52-D502, E53-D502, Q54-D502, P55-D502, P56-D502, A57-D502, L58-D502, W59-D502, R60-D502, K61-D502, V62-D502, V63-D502, D64-D502, F65-D502, L66-D502, L67-D502, K68-D502, A69-D502, I70-D502, M71-D502, R72-D502, T73-D502, M74-D502, W75-D502, F76-D502, A77-D502, G78-D502, G79-D502, F80-D502, H81-D502, R82-D502, V83-D502, A84-D502, V85-D502, K86-D502, G87-D502, R88-D502, Q89-D502, A90-D502, L91-D502, P92-D502, T93-D502, E94-D502, A95-D502, A96-D502, I97-D502, L98-D502, T99-D502, L100-D502, A101-D502, P102-D502, H103-D502, S104-D502, S105-D502, Y106-D502, F107-D502, D108-D502, A109-D502, I110-D502, P111-D502, V112-D502, T113-D502, M114-D502, T115-D502, M116-D502, S117-D502, S118-D502, I119-D502, V120-D502, M121-D502, K122-D502, T123-D502, E124-D502, S125-D502, R126-D502, D127-D502, I128-D502, P129-D502, I130-D502, W131-D502, G132-D502, T133-D502, L134-D502, I135-D502, Q136-D502, Y137-D502, I138-D502, R139-D502, P140-D502, V141-D502, F142-D502, V143-D502, S144-D502, R145-D502, S146-D502, D147-D502, Q148-D502, D149-D502, S150-D502, R151-D502, R152-D502, K153-D502, T154-D502, V155-D502, E156-D502, E157-D502, I158-D502, K159-D502, R160-D502, R161-D502, A162-D502, Q163-D502, S164-D502, N165-D502, G166-D502, K167-D502, W168-D502, P169-D502, Q170-D502, I171-D502, M172-D502, I173-D502, F174-D502, P175-D502, E176-D502, G177-D502, T178-D502, C179-D502, T180-D502, N181-D502, R182-D502, T183-D502, C184-D502, L185-D502, I186-D502, T187-D502, F188-D502, K189-D502, P190-D502, G191-D502, A192-D502, F193-D502, I194-D502, P195-D502, G196-D502, A197-D502, P198-D502, V199-D502, H200-D502, P201-D502, G202-D502, V203-D502, L204-D502, R205-D502, Y206-D502, P207-D502, N208-D502, K209-D502, L210-D502, D211-D502, T212-D502, I213-D502, T214-D502, W215-D502, T216-D502, W217-D502, Q218-D502, G219-D502, P220-D502, G221-D502, A222-D502, L223-D502, E224-D502, I225-D502, L226-D502, W227-D502, L228-D502, T229-D502, L230-D502, C231-D502, Q232-D502, F233-D502, H234-D502, N235-D502, Q236-D502, V237-D502, E238-D502, I239-D502, E240-D502, F241-D502, L242-D502, P243-D502, V244-D502, Y245-D502, S246-D502, P247-D502, S248-D502, E249-D502, E250-D502, E251-D502, K252-D502, R253-D502, N254-D502, P255-D502, A256-D502, L257-D502, Y258-D502, A259-D502, S260-D502, N261-D502, V262-D502, R263-D502, R264-D502, V265-D502, M266-D502, A267-D502, E268-D502, A269-D502, L270-D502, G271-D502, V272-D502, S273-D502, V274-D502, T275-D502, D276-D502, Y277-D502, T278-D502, F279-D502, E280-D502, D281-D502, C282-D502, Q283-D502, L284-D502, A285-D502, L286-D502, A287-D502, E288-D502, G289-D502, Q290-D502, L291-D502, R292-D502, L293-D502, P294-D502, A295-D502, D296-D502, T297-D502, C298-D502, L299-D502, L300-D502, E301-D502, F302-D502, A303-D502, R304-D502, L305-D502, V306-D502, R307-D502, G308-D502, L309-D502, G310-D502, L311-D502, K312-D502, P313-D502, E314-D502, K315-D502, L316-D502, E317-D502, K318-D502, D319-D502, L320-D502, D321-D502, R322-D502, Y323-D502, S324-D502, E325-D502, R326-D502, A327-D502, R328-D502, M329-D502, K330-D502, G331-D502, G332-D502, E333-D502, K334-D502, I335-D502, G336-D502, I337-D502, A338-D502, E339-D502, F340-D502, A341-D502, A342-D502, S343-D502, L344-D502, E345-D502, V346-D502, P347-D502, V348-D502, S349-D502, D350-D502, L351-D502, L352-D502, E353-D502, D354-D502, M355-D502, F356-D502, S357-D502, L358-D502, F359-D502, D360-D502, E361-D502, S362-D502, G363-D502, S364-D502, G365-D502, E366-D502, V367-D502, D368-D502, L369-D502, R370-D502, E371-D502, C372-D502, V373-D502, V374-D502, A375-D502, L376-D502, S377-D502, V378-D502, V379-D502, C380-D502, W381-D502, P382-D502, A383-D502, R384-D502, T385-D502, L386-D502, D387-D502, T388-D502, I389-D502, Q390-D502, L391-D502, A392-D502, F393-D502, K394-D502, M395-D502, Y396-D502, G397-D502, A398-D502, Q399-D502, E400-D502, D401-D502, G402-D502, S403-D502, V404-D502, G405-D502, E406-D502, G407-D502, D408-D502, L409-D502, S410-D502, C411-D502, I412-D502, L413-D502, K414-D502, T415-D502, A416-D502, L417-D502, G418-D502, V419-D502, A420-D502, E421-D502, L422-D502, T423-D502, V424-D502, T425-D502, D426-D502, L427-D502, F428-D502, R429-D502, A430-D502, I431-D502, D432-D502, Q433-D502, E434-D502, E435-D502, K436-D502, G437-D502, K438-D502, I439-D502, T440-D502, F441-D502, A442-D502, D443-D502, F444-D502, H445-D502, R446-D502, F447-D502, A448-D502, E449-D502, M450-D502, Y451-D502, P452-D502, A453-D502, F454-D502, A455-D502, E456-D502, E457-D502, Y458-D502, L459-D502, Y460-D502, P461-D502, D462-D502, Q463-D502, T464-D502, H465-D502, F466-D502, E467-D502, S468-D502, C469-D502, A470-D502, E471-D502, T472-D502, S473-D502, P474-D502, A475-D502, P476-D502, I477-D502, P478-D502, N479-D502, G480-D502, F481-D502, C482-D502, A483-D502, D484-D502, F485-D502, S486-D502, P487-D502, E488-D502, N489-D502, S490-D502, D491-D502, A492-D502, G493-D502, R494-D502, K495-D502, and/or P496-D502 of SEQ ID NO: 6. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these N-terminal Microsomal GPAT_hlog2 deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0283] In preferred embodiments, the following C-terminal Microsomal GPAT_hlog2 deletion polypeptides are encompassed by the present invention: V1-D502, V1-L501, V1-K500, V1-K499, V1-R498, V1-V497, V1-P496, V1-K495, V1-R494, V1-G493, V1-A492, V1-D491, V1-S490, V1-N489, V1-E488, V1-P487, V1-S486, V1-F485, V1-D484, V1-A483, V1-C482, V1-F481, V1-G480, V1-N479, V1-P478, V1-I477, V1-P476, V1-A475, V1-P474, V1-S473, V1-T472, V1-E471, V1-A470, V1-C469, V1-S468, V1-E467, V1-F466, V1-H465, V1-T464, V1-Q463, V1-D462, V1-P461, V1-Y460, V1-L459, V1-Y458, V1-E457, V1-E456, V1-A455, V1-F454, V1-A453, V1-P452, V1-Y451, V1-M450, V1-E449, V1-A448, V1-F447, V1-R446, V1-H445, V1-F444, V1-D443, V1-A442, V1-F441, V1-T440, V1-I439, V1-K438, V1-G438, V1-K436, V1-E435, V1-E434, V1-Q433, V1-D432, V1-I431, V1-A430, V1-R429, V1-F428, V1-L427, V1-D426, V1-T425, V1-V424, V1-T423, V1-L422, V1-E421, V1-A420, V1-V419, V1-G418, V1-L417, V1-A416, V1-T415, V1-K414, V1-L413, V1-I412, V1-C411, V1-S410, V1-L409, V1-D408, V1-G407, V1-E406, V1-G405, V1-V404, V1-S403, V1-G402, V1-D401, V1-E400, V1-Q399, V1-A398, V1-G397, V1-Y396, V1-M395, V1-K394, V1-F393, V1-A392, V1-L391, V1-Q390, V1-I389, V1-T388, V1-D387, V1-L386, V1-T385, V1-R384, V1-A383, V1-P382, V1-W381, V1-C380, V1-V379, V1-V378, V1-S377, V1-L376, V1-A375, V1-V374, V1-V373, V1-C372, V1-E371, V1-R370, V1-L369, V1-D368, V1-V367, V1-E366, V1-G365, V1-S364, V1-G363, V1-S362, V1-E361, V1-D360, V1-F359, V1-L358, V1-S357, V1-F356, V1-M355, V1-D354, V1-E353, V1-L352, V1-L351, V1-D350, V1-S349, V1-V348, V1-P347, V1-V346, V1-E345, V1-L344, V1-S343, V1-A342, V1-A341, V1-F340, V1-E339, V1-A338, V1-I337, V1-G336, V1-I335, V1-K334, V1-E333, V1-G332, V1-G331, V1-K330, V1-M329, V1-R328, V1-A327, V1-R326, V1-E325, V1-S324, V1-Y323, V1-R322, V1-D321, V1-L320, V1-D319, V1-K318, V1-E317, V1-L316, V1-K315, V1-E314, V1-P313, V1-K312, V1-L311, V1-G310, V1-L309, V1-G308, V1-R307, V1-V306, V1-L305, V1-R304, V1-A303, V1-F302, V1-E301, V1-L300, V1-L299, V1-C298, V1-T297, V1-D296, V1-A295, V1-P294, V1-L293, V1-R292, V1-L291, V1-Q290, V1-G289, V1-E288, V1-A287, V1-L286, V1-A285, V1-L284, V1-Q283, V1-C282, V1-D281, V1-E280, V1-F279, V1-T278, V1-Y277, V1-D276, V1-T275, V1-V274, V1-S273, V1-V272, V1-G271, V1-L270, V1-A269, V1-E268, V1-A267, V1-M266, V1-V265, V1-R264, V1-R263, V1-V262, V1-N261, V1-S260, V1-A259, V1-Y258, V1-L257, V1-A256, V1-P255, V1-N254, V1-R253, V1-K252, V1-E251, V1-E250, V1-E249, V1-S248, V1-P247, V1-S246, V1-Y245, V1-V244, V1-P243, V1-L242, V1-F241, V1-E240, V1-I239, V1-E238, V1-V237, V1-Q236, V1-N235, V1-H234, V1-F233, V1-Q232, V1-C231, V1-L230, V1-T229, V1-L228, V1-W227, V1-L226, V1-I225, V1-E224, V1-L223, V1-A222, V1-G221, V1-P220, V1-G219, V1-Q218, V1-W217, V1-T216, V1-W215, V1-T214, V1-I213, V1-T212, V1-D211, V1-L210, V1-K209, V1-N208, V1-P207, V1-Y206, V1-R205, V1-L204, V1-V203, V1-G202, V1-P201, V1-H200, V1-VI99, V1-P198, V1-A197, V1-G196, V1-P195, V1-I194, V1-F193, V1-A192, V1-G191, V1-P190, V1-K189, V1-F188, V1-T187, V1-I186, V1-L185, V1-C184, V1-T183, V1-R182, V1-N181, V1-T180, V1-C179, V1-TI78, V1-G177, V1-E176, V1-P175, V1-F174, V1-I173, V1-M172, V1-I171, V1-Q170, V1-P169, V1-W168, V1-K167, V1-GI66, V1-N165, V1-S164, V1-Q163, V1-A162, V1-R161, V1-R160, V1-K159, V1-I158, V1-E157, V1-E156, V1-V155, V1-T154, V1-K153, V1-R152, V1-R151, V1-S150, V1-D149, V1-Q148, V1-D147, V1-SI46, V1-R145, V1-S144, V1-V143, V1-F142, V1-V141, V1-P140, V1-R139, V1-I138, V1-Y137, V1-Q136, V1-I135, V1-L134, V1-T133, V1-G132, V1-W131, V1-I130, V1-P129, V1-I128, V1-D127, V1-R126, V1-S125, V1-E124, V1-T123, V1-K122, V1-M121, V1-V120, V1-I119, V1-S118, V1-S117, V1-M116, V1-T115, V1-M114, V1-T113, V1-V112, V1-P111, V1-I110, V1-A109, V1-D108, V1-F107, V1-Y106, V1-S105, V1-S104, V1-H103, V1-P102, V1-A101, V1-L100, V1-T99, V1-L98, V1-I97, V1-A96, V1-A95, V1-E94, V1-T93, V1-P92, V1-L91, V1-A90, V1-Q89, V1-R88, V1-G87, V1-K86, V1-V85, V1-A84, V1-V83, V1-R82, V1-H81, V1-F80, V1-G79, V1-G78, V1-A77, V1-F76, V1-W75, V1-M74, V1-T73, V1-R72, V1-M71, V1-I70, V1-A69, V1-K68, V1-L67, V1-L66, V1-F65, V1-D64, V1-V63, V1-V62, V1-K61, V1-R60, V1-W59, V1-L58, V1-A57, V1-P56, V1-P55, V1-Q54, V1-E53, V1-P52, V1-E51, V1-K50, V1-E49, V1-A48, V1-S47, V1-G46, V1-L45, V1-S44, V1-A43, V1-V42, V1-L41, V1-A40, V1-L39, V1-P38, V1-W37, V1-A36, V1-L35, V1-L34, V1-M33, V1-M32, V1-A31, V1-A30, V1-A29, V1-V28, V1-L27, V1-L26, V1-R25, V1-V24, V1-P23, V1-F22, V1-L21, V1-T20, V1-L19, V1-T18, V1-M17, V1-L16, V1-A15, V1-VI4, V1-Q13, V1-A12, V1-K11, V1-Q10, V1-L9, V1-A8, and/or V1-S7 of SEQ ID NO: 6. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these C-terminal Microsomal GPAT_hlog2 deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0284] Alternatively, preferred polypeptides of the present invention may comprise polypeptide sequences corresponding to, for example, internal regions of the Microsomal GPAT_hlog2 polypeptide (e.g., any combination of both N-and C-terminal Microsomal GPAT_hlog2 polypeptide deletions) of SEQ ID NO: 6. For example, internal regions could be defined by the equation: amino acid NX to amino acid CX, wherein NX refers to any N-terminal deletion polypeptide amino acid of Microsomal GPAT_hlog2 (SEQ ID NO: 6), and where CX refers to any C-terminal deletion polypeptide amino acid of Microsomal GPAT_hlog2 (SEQ ID NO: 6). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these polypeptides as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0285] The present invention also encompasses immunogenic and/or antigenic epitopes of the Microsomal GPAT_hlog2 polypeptide.

[0286] The Microsomal GPAT_hlog2 polypeptides of the present invention were determined to comprise several phosphorylation sites based upon the Motif algorithm (Genetics Computer Group, Inc.). The phosphorylation of such sites may regulate some biological activity of the Microsomal GPAT_hlog2 polypeptide. For example, phosphorylation at specific sites may be involved in regulating the proteins ability to associate or bind to other molecules (e.g., proteins, ligands, substrates, DNA, etc.). In the present case, phosphorylation may modulate the ability of the Microsomal GPAT_hlog2 polypeptide to associate with other potassium channel alpha subunits, beta subunits, or its ability to modulate potassium channel function.

[0287] Specifically, the Microsomal GPAT_hlog2 polypeptide was predicted to comprise one tyrosine phosphorylation site using the Motif algorithm (Genetics Computer Group, Inc.). Such sites are phosphorylated at the tyrosine amino acid residue. The consensus pattern for tyrosine phosphorylation sites are as follows: [RK]-x(2)-[DE]-x(3)-Y, or [RK]-x(3)-[DE]-x(2)-Y, where Y represents the phosphorylation site and ‘x’ represents an intervening amino acid residue. Additional information specific to tyrosine phosphorylation sites can be found in Patschinsky T., Hunter T., Esch F. S., Cooper J. A., Sefton B. M., Proc. Natl. Acad. Sci. U.S.A. 79:973-977(1982); Hunter T., J. Biol. Chem. 257:4843-4848(1982), and Cooper J. A., Esch F. S., Taylor S. S., Hunter T., J. Biol. Chem. 259:7835-7841(1984), which are hereby incorporated herein by reference.

[0288] In preferred embodiments, the following Microsomal GPAT_hlog2 tyrosine phosphorylation site polypeptides are encompassed by the present invention: TKFIVRSKDGPSYFTVSF (SEQ ID NO: 17). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog2 tyrosine phosphorylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0289] The Microsomal GPAT_hlog2 polypeptide was predicted to comprise four PKC phosphorylation sites using the Motif algorithm (Genetics Computer Group, Inc.). In vivo, protein kinase C exhibits a preference for the phosphorylation of serine or threonine residues. The PKC phosphorylation sites have the following consensus pattern: [ST]-x-[RK], where S or T represents the site of phosphorylation and ‘x’ an intervening amino acid residue. Additional information regarding PKC phosphorylation sites can be found in Woodget J. R., Gould K. L., Hunter T., Eur. J. Biochem. 161:177-184(1986), and Kishimoto A., Nishiyama K., Nakanishi H., Uratsuji Y., Nomura H., Takeyama Y., Nishizuka Y., J. Biol. Chem. 260:12492-12499(1985); which are hereby incorporated by reference herein.

[0290] In preferred embodiments, the following PKC phosphorylation site polypeptides are encompassed by the present invention: RSDQDSRRKTVEE (SEQ ID NO: 94), PEGTCTNRTCLIT (SEQ ID NO: 95), RTCLITFKPGAFI (SEQ ID NO: 96), and/or DLDRYSERARMKG (SEQ ID NO: 97). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog2 PKC phosphorylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0291] The Microsomal GPAT_hlog2 polypeptide was predicted to :comprise forteen casein kinase II phosphorylation sites using the Motif algorithm (Genetics Computer Group, Inc.). Casein kinase II (CK-2) is a protein serine/threonine kinase whose activity is independent of cyclic nucleotides and calcium. CK-2 phosphorylates many different proteins. The substrate specificity [1] of this enzyme can be summarized as follows: (1) Under comparable conditions Ser is favored over Thr.; (2) An acidic residue (either Asp or Glu) must be present three residues from the C-terminal of the phosphate acceptor site; (3) Additional acidic residues in positions +1, +2, +4, and +5 increase the phosphorylation rate. Most physiological substrates have at least one acidic residue in these positions; (4) Asp is preferred to Glu as the provider of acidic determinants; and (5) A basic residue at the N-terminal of the acceptor site decreases the phosphorylation rate, while an acidic one will increase it.

[0292] A consensus pattern for casein kinase II phosphorylations site is as follows: [ST]-x(2)-[DE], wherein ‘x’ represents any amino acid, and S or T is the phosphorylation site.

[0293] Additional information specific to casein kinase II phosphorylation sites may be found in reference to the following publication: Pinna L. A., Biochim. Biophys. Acta 1054:267-284(1990); which is hereby incorporated herein in its entirety.

[0294] In preferred embodiments, the following casein kinase II phosphorylation site polypeptides are encompassed by the present invention: LAPHSSYFDAIPVT (SEQ ID NO: 98), RPVFVSRSDQDSRR (SEQ ID NO: 99), VFVSRSDQDSRRKT (SEQ ID NO: 100), DSRRKTVEEIKRRA (SEQ ID NO: 101), FLPVYSPSEEEKRN (SEQ ID 5 NO: 102), PVYSPSEEEKRNPA (SEQ ID NO: 103), EALGVSVTDYTFED (SEQ ID NO: 104), SVTDYTFEDCQLAL (SEQ ID NO: 105), LEDMFSLFDESGSG (SEQ ID NO: 106), AQEDGSVGEGDLSC (SEQ ID NO: 107), GVAELTVTDLFRAI (SEQ ID NO: 108), EKGKITFADFHRFA (SEQ ID NO: 109), LYPDQTHFESCAET (SEQ ID NO: 110), and/or QTHFESCAETSPAP (SEQ ID NO: 111). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of this casein kinase II phosphorylation site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0295] The Microsomal GPAT_hlog2 polypeptide was predicted to comprise one cAMP-and cGMP-dependent protein kinase phosphorylation site using the Motif algorithm (Genetics Computer Group, Inc.). There has been a number of studies relative to the specificity of cAMP-and cGMP-dependent protein kinases. Both types of kinases appear to share a preference for the phosphorylation of serine or threonine residues found close to at least two consecutive N-terminal- basic residues.

[0296] A consensus pattern for cAMP-and cGMP-dependent protein kinase phosphorylation sites is as follows: [RK](2)-x-[ST], wherein “x” represents any amino acid, and S or T is the phosphorylation site.

[0297] Additional information specific to cAMP-and cGMP-dependent protein kinase phosphorylation sites may be found in reference to the following publication: Fremisco J. R., Glass D. B., Krebs E. G, J. Biol. Chem. 255:4240-4245(1980); Glass D. B., Smith S. B., J. Biol. Chem. 258:14797-14803(1983); and Glass D. B., El-Maghrabi M. R., Pilkis S. J., J. Biol. Chem. 261:2987-2993(1986); which is hereby incorporated herein in its entirety.

[0298] In preferred embodiments, the following cAMP-and cGMP-dependent protein kinase phosphorylation site polypeptides are encompassed by the present invention: SDQDSRRKTVEEIK (SEQ ID NO: 112). Polynucleotides encoding this polypeptide are also provided. The present invention also encompasses the use of these cAMP-and cGMP-dependent protein kinase phosphorylation site polypeptides as immunogenic and/or antigenic epitope as described elsewhere herein.

[0299] The Microsomal GPAT_hlog2 polypeptide has been shown to comprise one glycosylation sites according to the Motif algorithm (Genetics Computer Group, Inc.). As discussed more specifically herein, protein glycosylation is thought to serve a variety of functions including: augmentation of protein folding, inhibition of protein aggregation, regulation of intracellular trafficking to organelles, increasing resistance to proteolysis, modulation of protein antigenicity, and mediation of intercellular adhesion.

[0300] Asparagine phosphorylation sites have the following consensus pattern, N-{P}-[ST]-{P}, wherein N represents the glycosylation site. However, it is well known that that potential N-glycosylation sites are specific to the consensus sequence Asn-Xaa-Ser/Thr. However, the presence of the consensus tripeptide is not sufficient to conclude that an asparagine residue is glycosylated, due to the fact that the folding of the protein plays an important role in the regulation of N-glycosylation. It has been shown that the presence of proline between Asn and Ser/Thr will inhibit N-glycosylation; this has been confirmed by a recent statistical analysis of glycosylation sites, which also shows that about 50% of the sites that have a proline C-terminal to Ser/Thr are not glycosylated. Additional information relating to asparagine glycosylation may be found in reference to the following publications, which are hereby incorporated by reference herein: Marshall R. D., Annu. Rev. Biochem. 41:673-702(1972); Pless D. D., Lennarz W. J., Proc. Natl. Acad. Sci. U.S.A. 74:134-138(1977); Bause E., Biochem. J. 209:331-336(1983); Gavel Y., von Heijne G., Protein Eng. 3:433-442(1990); and Miletich J. P., Broze G. J. Jr., J. Biol. Chem. 265:11397-11404(1990).

[0301] In preferred embodiments, the following asparagine glycosylation site polypeptides are encompassed by the present invention: EGTCTNRTCLITFK (SEQ ID NO: 86). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog2 asparagine glycosylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0302] The Microsomal GPAT_hlog2 polypeptide was predicted to comprise two N-myristoylation sites using the Motif algorithm (Genetics Computer Group, Inc.). An appreciable number of eukaryotic proteins are acylated by the covalent addition of myristate (a C14-saturated fatty acid) to their N-terminal residue via an amide linkage. The sequence specificity of the enzyme responsible for this modification, myristoyl CoA:protein N-myristoyl transferase (NMT), has been derived from the sequence of known N-myristoylated proteins and from studies using synthetic peptides. The specificity seems to be the following: i.) The N-terminal residue must be glycine; ii.) In position 2, uncharged residues are allowed; iii.) Charged residues, proline and large hydrophobic residues are not allowed; iv.) In positions 3 and 4, most, if not all, residues are allowed; v.) In position 5, small uncharged residues are allowed (Ala, Ser, Thr, Cys, Asn and Gly). Serine is favored; and vi.) In position 6, proline is not allowed.

[0303] A consensus pattern for N-myristoylation is as follows: G-{EDRKHPFYW}-x(2)-[STAGCN]-{P}, wherein ‘x’ represents any amino acid, and G is the N-myristoylation site.

[0304] Additional information specific to N-myristoylation sites may be found in reference to the following publication: Towler D. A., Gordon J. I., Adams S. P., Glaser L., Annu. Rev. Biochem. 57:69-99(1988); and Grand R. J. A., Biochem. J. 258:625-638(1989); which is hereby incorporated herein in its entirety.

[0305] In preferred embodiments, the following N-myristoylation site polypeptides are encompassed by the present invention: MIFPEGTCTNRTCLIT (SEQ ID NO: 114), and/or MAEALGVSVTDYTFED (SEQ ID NO: 115). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these N-myristoylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0306] The Microsomal GPAT_hlog2 polypeptide has been shown to comprise one glycosaminoglycan attachment site according to the Motif algorithm (Genetics Computer Group, Inc.). Proteoglycans are complex glycoconjugates containing a core protein to which a variable number of glycosaminoglycan chains (such as heparin sulfate, chondroitin sulfate, etc.) are covalently attached. The glycosaminoglycans are attached to the core proteins through a xyloside residue which is in turn linked to a serine residue of the protein. A consensus sequence for the attachment site seems to exist and follows the following pattern: S-G-x-G, wherein ‘S’ represents the attachment site, and ‘x’ represents any amino acid. Additional information relating to leucine zipper motifs may be found in reference to the following publications, which are hereby incorporated by reference herein: Hassel J. R., Kimura J. H., Hascall V. C., Annu. Rev. Biochem. 55:539-567(1986); and/or Bourdon M. A., Krusius T., Campbell S., Schwarz N. B., Proc. Natl. Acad. Sci. U.S.A. 84:3194-3198(1987).

[0307] In preferred embodiments, the following glycosaminoglycan attachment site polypeptide is encompassed by the present invention: SLFDESGSGEVDLR (SEQ ID NO: 116). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of this Microsomal GPAT hlog2 glycosaminoglycan attachment site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0308] The Microsomal GPAT hlog2 polypeptide has been shown to comprise one amidation site according to the Motif algorithm (Genetics Computer Group, Inc.). The precursor of hormones and other active peptides which are C-terminally amidated is always directly followed by a glycine residue which provides the amide group, and most often by at least two consecutive basic residues (Arg or Lys) which generally function as an active peptide precursor cleavage site. Although all amino acids can be amidated, neutral hydrophobic residues such as Val or Phe are good substrates, while charged residues such as Asp or Arg are much less reactive. A consensus pattern for amidation sites is the following: x-G-[RK]-[RK], wherein “X” represents the amidation site. Additional information relating to asparagine glycosylation may be found in reference to the following publications, which are hereby incorporated by reference herein: Kreil G., Meth. Enzymol. 106:218-223(1984); and Bradbury A. F., Smyth D. G., Biosci. Rep. 7:907-916(1987).

[0309] In preferred embodiments, the following amidation site polypeptide is encompassed by the present invention: PENSDAGRKPVRKK (SEQ ID NO: 117). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of this Microsomal GPAT_hlog2 amidation site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0310] Many polynucleotide sequences, such as EST sequences, are publicly available and accessible through sequence databases. Some of these sequences are related to SEQ ID NO: 5 and may have been publicly available prior to conception of the present invention. Preferably, such related polynucleotides are specifically excluded from the scope of the present invention. To list every related sequence would be cumbersome. Accordingly, preferably excluded from the present invention are one or more polynucleotides consisting of a nucleotide sequence described by the general formula of a-b, where a is any integer between 1 to 1598 of SEQ ID NO: 5, b is an integer between 15 to 1612, where both a and b correspond to the positions of nucleotide residues shown in SEQ ID NO: 5, and where b is greater than or equal to a+14.

Features of the Polypeptide Encoded by Gene No:4

[0311] The polypeptide of this gene provided as SEQ ID NO: 8 (FIGS. 4A-B), encoded by the polynucleotide sequence according to SEQ ID NO: 7 (FIGS. 4A-B), and/or encoded by the polynucleotide contained within the deposited clone, Microsomal GPAT_hlog3, has significant homology at the nucleotide and amino acid level to other glycerol-3-phosphate acyltransferases, specifically, the human Mitochondrial GPAT of the present invention (H_GPAT; SEQ ID NO: 2); the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and the rat mitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 70)). An alignment of the Microsomal GPAT_hlog3 polypeptide with these proteins is provided in FIGS. 6A-C.

[0312] The Microsomal GPAT_hlog3 polypeptide was determined to share 23.3% identity and 23.3% similarity with the human Mitochondrial GPAT of the present invention (H_GPAT; SEQ ID NO: 2); to share 23.3% identity and 23.3% similarity with the mouse mitochondrial glycerol-3-phosphate acyltransferase protein (M_GPAT; Genbank Accession No. gi| 6680057; SEQ ID NO: 9); and to share 23.3% identity and 23.3% similarity with the rat nitochondrial glycerol-3-phosphate acyltransferase protein (R_GPAT; Genbank Accession No. gi| 8393466; SEQ ID NO: 70)) as shown in FIG. 14.

[0313] Based upon the strong identity between the human, mouse, and rat GPAT proteins, the human Microsomal GPAT_hlog3 of the present invention is believed to represent the a novel human microsomal glycerol-3-phosphate acyltransferase.

[0314] Based upon the observed homology, the polypeptide of the present invention is expected to share at least some biological activity with other glycerol-3-phosphate acyltransferases, specifically with the human, mouse, and rat GPAT proteins, particularly with GPATs found in the liver and/or microsomes, in addition to, other glycerol-3-phosphate acyltransferases referenced elsewhere herein.

[0315] The Microsomal GPAT_hlog3 homologue was determined to comprise four putative transmembrane domains located from about amino acid residue 70 to about amino acid residue 86 (TM1), from about amino acid residue 113 to about amino acid residue 133 (TM2), from about amino acid residue 143 to about amino acid residue 164 (TM3), and/or from about amino acid residue 261 to about amino acid residue 278 (TM4) of SEQ ID NO: 8 as predicted by the TMPRED program (Biol. Chem. Hoppe-Seyler 347:166, 1993).

[0316] In preferred embodiments, the following transmembrane domain polypeptides are encompassed by the present invention: LLVALILLLAWPFAAI (SEQ ID NO: 118), FLGRAMFFSMGFIVAVKGKIA (SEQ ID NO: 119), AAPHSTFFDGIACVVAGLPSMV (SEQ ID NO: 120), and/or WQGYTFIQLCMLTFCQLF (SEQ ID NO: 121). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog3 transmembrane polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0317] The present invention also encompasses the polypeptide sequences that intervene between each of the predicted Microsomal GPAT_hlog4 transmembrane domains. Since these regions are solvent accessible in the cytosol, they are particularly useful for designing antibodies specific to this region. Such antibodies may be useful as antagonists or agonists of the Microsomal GPAT_hlog4 full-length polypeptide and may modulate its activity.

[0318] In preferred embodiments, the following intertransmembrane domain polypeptide is encompassed by the present invention: STVCCPEKLTHPITGWRRKITQTALK (SEQ ID NO: 69), SPLEAPVFV (SEQ ID NO: 69), and/or SRNENAQVPLIGRLLRAVQPVLVSRVDPDSRKNTINEIIKRTTSGGEWPQILVF PEGTCTNRSCLITFKPGAFIPGVPVQP-VLLRYPNKLDTVTWT (SEQ ID NO: 69). Polynucleotides encoding this polypeptide are also provided. The present invention also encompasses the use of this Microsomal GPAT_hlog4 transmembrane polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0319] In preferred embodiments, the following N-terminal Microsomal GPAT_hlog3 TM1-2 intertransmembrane domain deletion polypeptides are encompassed by the present invention: S1-K26, T2-K26, V3-K26, C4-K26, C5-K26, P6-K26, E7-K26, K8-K26, L9-K26, T10-K26, H11-K26, P12-K26, I13-K26, T14-K26, G15-K26, W16-K26, R17-K26, R18-K26, K19-K26, and/or I20-K26 of SEQ ID NO: 122. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these N-terminal Microsomal GPAT_hlog3 TM1-2 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0320] In preferred embodiments, the following C-terminal Microsomal GPAT_hlog3 TM1-2 intertransmembrane domain deletion polypeptides are encompassed by the present invention: S1-K26, S1-L25, S1-A24, S1-T23, S1-Q22, S1-T21, S1-I20, S1-K19, S1-R18, S1-R17, S1-W16, S1-GI5, S1-T14, S1-I13, S1-P12, S1-H11, S1-T10, S1-L9, S1-K8, and/or S1-E7 of SEQ ID NO: 122. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these C-terminal Microsomal GPAT_hlog3 TM1-2 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0321] In preferred embodiments, the following N-terminal Microsomal GPAT_hlog3 TM2-3 intertransmembrane domain deletion polypeptides are encompassed by the present invention: S1-V9, P2-V9, and/or L3-V9 of SEQ ID NO: 123. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these N-terminal Microsomal GPAT_hlog3 TM2-3 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0322] In preferred embodiments, the following C-terminal Microsomal GPAT_hlog3 TM2-3 intertransmembrane domain deletion polypeptides are encompassed by the present invention: S1-V9, S1-F8, and/or S1-V7 of SEQ ID NO: 123. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these C-terminal Microsomal GPAT_hlog3 TM2-3 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0323] In preferred embodiments, the following N-terminal Microsomal GPAT_hlog3 TM3-4 intertransmembrane domain deletion polypeptides are encompassed by the present invention: S1-P81, R2-P81, N3-P81, E4-P81, N5-P81, A6-P81, Q7-P81, V8-P81, P9-P81, L10-P81, I11-P81, G12-P81, R13-P81, L14-P81, L15-P81, R16-P81, A17-P81, V18-P81, Q19-P81, P20-P81, V21-P81, L22-P81, V23-P81, S24-P81, R25-P81, V26-P81, D27-P81, P28-P81, D29-P81, S30-P81, R31-P81, K32-P81, N33-P81, T34-P81, I35-P81, N36-P81, E37-P81, I38-P81, I39-P81, K40-P81, R41-P81, T42-P81, T43-P81, S44-P81, G45-P81, G46-P81, E47-P81, W48-P81, P49-P81, Q50-P81, I51-P81, L52-P81, V53-P81, F54-P81, P55-P81, E56-P81, G57-P81, T58-P81, C59-P81, T60-P81, N61-P81, R62-P81, S63-P81, C64-P81, L65-P81, I66-P81, T67-P81, F68-P81, K69-P81, P70-P81, G71-P81, A72-P81, F73-P81, I74-P81, and/or P75-P81, of SEQ ID NO: 124. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these N-terminal Microsomal GPAT_hlog3 TM3-4 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0324] In preferred embodiments, the following C-terminal Microsomal GPAT_hlog3 TM3-4 intertransmembrane domain deletion polypeptides are encompassed by the present invention: S1-P81, S1-Q80, S1-V79, S1-P78, S1-V77, S1-G76, S1-P75, S1-I74, S1-F73, S1-A72, S1-G71, S1-P70, S1-K69, S1-F68, S1-T67, S1-I66, S1-L65, S1-C64, S1-S63, S1-R62, S1-N61, S1-T60, S1-C59, S1-T58, S1-G57, S1-E56, S1-P55, S1-F54, S1-V53, S1-L52, S1-I51, S1-Q50, S1-P49, S1-W48, S1-E47, S1-G46, S1-G45, S1-S44, S1-T43, S1-T42, S1-R41, S1-K40, S1-I39, S1-I38, S1-E37, S1-N36, S1-I35, S1-T34, S1-N33, S1-K32, S1-R31, S1-S30, S1-D29, S1-P28, S1-D27, S1-V26, S1-R25, S1-S24, S1-V23, S1-L22, S1-V21, S1-P20, S1-Q19, S1-V18, S1-A17, S1-R16, S1-L15, S1-L14, S1-R13, S1-G12, S1-I11, S1-L10, S1-P9, S1-V8, and/or S1-Q7 of SEQ ID NO: 124. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these C-terminal Microsomal GPAT_hlog3 TM3-4 intertransmembrane domain deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0325] In addition, the Microsomal GPAT_hlog3 polypeptide was also determined to comprise several conserved cysteines, at amino acid 223, 228, 275, 326, and/or 424 of SEQ ID NO: 8 (FIGS. 4A-B). Conservation of cysteines at key amino acid residues is indicative of conserved structural features, which may correlate with conservation of protein function and/or activity, particularly with other glycerol-3-phosphate acyltransferase proteins.

[0326] The present invention is also directed to polynucleotides encoding a variant of the Microsomal GPAT_hlog3 polypeptide, referred to as Microsomal GPAT_hlog3_v1. The polynucleotide (SEQ ID NO: 202) and polypeptide (SEQ ID NO: 203) sequence of the Microsomal GPAT_hlog3_v1 is provided in FIGS. 16A-B. All references to Microsomal GPAT_hlog3 should also be construed to apply to the Microsomal GPAT_hlog3_v1 polynucleotides and polypeptides as well. Descriptions of the Microsomal GPAT_hlog3_v1 transmembrane domains, catalytic residues, ligand binding residues, including their respective amino acid locations are provided in FIGS. 16A-B.

[0327] Microsomal GPAT_hlog3 polypeptides and polynucleotides are useful for diagnosing diseases related to the over and/or under expression of Microsomal GPAT_hlog3 by identifying mutations in the Microsomal GPAT_hlog3 gene using Microsomal GPAT_hlog3 sequences as probes or by determining Microsomal GPAT_hlog3 protein or mRNA expression levels. Microsomal GPAT_hlog3 polypeptides will be useful in screens for compounds that affect the activity of the protein. Microsomal GPAT.hlog3 peptides can also be used for the generation of specific antibodies and as bait in yeast two hybrid screens to find proteins the specifically interact with Microsomal GPAT_hlog3.

[0328] Expression profiling designed to measure the steady state mRNA levels encoding the Microsomal GPAT_hlog3 polypeptide showed predominately high expression levels in bone marrow; and significant expression in spinal cord tissue (as shown in FIG. 10).

[0329] Expanded analysis of Microsomal GPAT_hlog3 expression levels by TaqMan™ quantitative PCR (see FIG. 15) determined that Microsomal GPAT_hlog3 was expressed predominately in the thyroid gland. Significant expression was observed in the uterus, vas deferens, and to a lesser extent in other tissues as shown.

[0330] The Microsomal GPAT_hlog3 polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, have uses that include modulating metabolism, energy utilization, and triglyceride levels, among others, in various cells, tissues, and organisms, and particularly in mammalian small intestine, lung, spleen, and adipose tissue, preferably human. Microsomal GPAT_hlog3 polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, may be useful in diagnosing, treating, prognosing, and/or preventing gastrointestinal, metabolic, immune, pulmonary, and/or proliferative diseases or disorders.

[0331] The strong homology to the human, mouse, and rat mitochondrial glycerol-3-phosphate acyltransferase proteins, combined with the predominate localized expression in bone marrow, suggests the Microsomal GPAT_hlog3 polynucleotides and polypeptides may be useful in treating, diagnosing, prognosing, and/or preventing immune diseases and/or disorders. Representative uses are described in the “Immune Activity”, “Chemotaxis”, and “Infectious Disease” sections below, and elsewhere herein. Briefly, the strong expression in immune tissue indicates a role in regulating the proliferation; survival; differentiation; and/or activation of hematopoietic cell lineages, including blood stem cells.

[0332] The Microsomal GPAT_hlog3 polypeptide may also be useful as a preventative agent for immunological disorders including arthritis, asthma, immunodeficiency diseases such as AIDS, leukemia, rheumatoid arthritis, granulomatous disease, inflammatory bowel disease, sepsis, acne, neutropenia, neutrophilia, psoriasis, hypersensitivities, such as T-cell mediated cytotoxicity; immune reactions to transplanted organs and tissues, such as host-versus-graft and graft-versus-host diseases, or autoimmunity disorders, such as autoimmune infertility, lense tissue injury, demyelination, systemic lupus erythematosis, drug induced hemolytic anemia, rheumatoid arthritis, Sjogren's disease, and scleroderma. The Microsomal GPAT_hlog3 polypeptide may be useful for modulating cytokine production, antigen presentation, or other processes, such as for boosting immune responses, etc.

[0333] Moreover, the protein may represent a secreted factor that influences the differentiation or behavior of other blood cells, or that recruits hematopoietic cells to sites of injury. Thus, this gene product is thought to be useful in the expansion of stem cells and committed progenitors of various blood lineages, and in the differentiation and/or proliferation of various cell types. Furthermore, the protein may also be used to determine biological activity, raise antibodies, as tissuemarkers, to isolate cognate ligands or receptors, to identify agents that modulate their interactions, in addition to its use as a nutritional supplement. Protein, as well as, antibodies directed against the protein may show utility as a tumor marker and/or immunotherapy targets for the above listed tissues.

[0334] The strong homology to the human, mouse, and rat mitochondrial glycerol-3-phosphate acyltransferase proteins, combined with the predominate localized expression in spinal cord, suggests the Microsomal GPAT_hlog3 polynucleotides and polypeptides may be useful in treating, diagnosing, prognosing, and/or preventing neurodegenerative disease states, behavioral disorders, or inflammatory conditions. Representative uses are described in the “Regeneration” and “Hyperproliferative Disorders” sections below, in the Examples, and elsewhere herein. Briefly, the uses include, but are not limited to the detection, treatment, and/or prevention of Alzheimer's Disease, Parkinson's Disease, Huntington's Disease, Tourette Syndrome, meningitis, encephalitis, demyelinating diseases, peripheral neuropathies, neoplasia, trauma, congenital malformations, spinal cord injuries, ischemia and infarction, aneurysms, hemorrhages, schizophrenia, mania, dementia, paranoia, obsessive compulsive disorder, depression, panic disorder, learning disabilities, ALS, psychoses, autism, and altered behaviors, including disorders in feeding, sleep patterns, balance, and perception. In addition, elevated expression of this gene product in regions of the brain indicates it plays a role in normal neural function. Potentially, this gene product is involved in synapse formation, neurotransmission, learning, cognition, homeostasis, or neuronal differentiation or survival. Furthermore, the protein may also be used to determine biological activity, to raise antibodies, as tissue markers, to isolate cognate ligands or receptors, to identify agents that modulate their interactions, in addition to its use as a nutritional supplement. Protein, as well as, antibodies directed against the protein may show utility as a tumor marker and/or immunotherapy targets for the above listed tissues.

[0335] The Microsomal GPAT_hlog3 polynucleotides and polypeptides of the present invention, including agonists and/or fragments thereof, have uses that include the treatment, diagnosis, prognosis and/or prevention of a variety of other disorders, which include, but are not limited to, malnutrition, starvation, disorders related to low triglyceride production, disorders related to low triglyceride accumulation, disorders related to low phosphatidic acid production, disorders related to low phospholipid production, disorders related to low VLDL levels, disorders related to low LDL levels, disorders related to low cholesterol levels, diabetes, tissue wasting disorders, bolemia, viral infections, bacterial infections, recovery from major surgery, disoders related to low levels of stored fat researves, infertility related to abnormally low levels of fat reserves, DNA repair disorders, disorders that increase an individuals suspectibility to mutagens, particularly from by-products of fatty acid oxidation and/or degradation, etc.

[0336] The antagonists of the Microsomal GPAT_hlog3 polynucleotides and polypeptides of the present invention have uses that include the treatment, diagnosis, prognosis and/or prevention of a variety of other disorders, which include, but are not limited to, obesity, disorders related to excess triglyceride production, disorders related to excess triglyceride accumulation, disorders related to elevated phosphatidic acid production, disorders related to elevated phospholipid production, disorders related to elevated VLDL plasma levels, disorders related to elevated LDL plasma levels, disorders related to elevated cholesterol plasma levels, etc.

[0337] Moreover, antagonists of Microsomal GPAT_hlog3 polynucleotides and polypeptides of the present invention have uses that include increasing the cellular level of oxidized fatty acycl-CoA, decreasing the cellular level of non-oxidized fatty acycl-CoA, and/or effectively decreasing the level of triglyceride stored in fat reserves.

[0338] Although it is believed the encoded polypeptide may share at least some biological activities with glycerol-3-phosphate acyltransferase proteins, a number of methods of determining the exact biological function of this clone are either known in the art or are described elsewhere herein. Briefly, the function of this clone may be determined by applying microarray methodology. Nucleic acids corresponding to the Microsomal GPAT_hlog3 polynucleotides, in addition to, other clones of the present invention, may be arrayed on microchips for expression profiling. Depending on which polynucleotide probe is used to hybridize to the slides, a change in expression of a specific gene may provide additional insight into the function of this gene based upon the conditions being studied. For example, an observed increase or decrease in expression levels when the polynucleotide probe used comes from tissue that has been treated with known glycerol-3-phosphate acyltransferase inhibitors, which include, but are not limited to the drugs listed herein or otherwise known in the art, might indicate a function in modulating glycerol-3-phosphate acyltransferase function, for example. In the case of Microsomal GPAT_hlog3, bone marrow, and/or spinal cord tissue should be used to extract RNA to prepare the probe.

[0339] In addition, the function of the protein may be assessed by applying quantitative PCR methodology, for example. Real time quantitative PCR would provide the capability of following the expression of the Microsomal GPAT_hlog3 gene throughout development, for example. Quantitative PCR methodology requires only a nominal amount of tissue from each developmentally important step is needed to perform such experiements. Therefore, the application of quantitative PCR methodology to refining the biological function of this polypeptide is encompassed by the present invention. Also encompassed by the present invention are quantitative PCR probes corresponding to the polynucleotide sequence provided as SEQ ID NO: 7 (FIGS. 4A-B).

[0340] The function of the protein may also be assessed through complementation assays in yeast. For example, in the case of the Microsomal GPAT_hlog3, transforming yeast deficient in glycerol-3-phosphate acyltransferase activity with Microsomal GPAT_hlog3 and assessing their ability to grow would provide convincing evidence the Microsomal GPAT_hlog3 polypeptide has glycerol-3-phosphate acyltransferase activity. Additional assay conditions and methods that may be used in assessing the function of the polynucletides and polypeptides of the present invention are known in the art, some of which are disclosed elsewhere herein.

[0341] Alternatively, the biological function of the encoded polypeptide may be determined by disrupting a homologue of this polypeptide in Mice and/or rats and observing the resulting phenotype.

[0342] Moreover, the biological function of this polypeptide may be determined by the application of antisense and/or sense methodology and the resulting generation of transgenic mice and/or rats. Expressing a particular gene in either sense or antisense orientation in a transgenic mouse or rat could lead to respectively higher or lower expression levels of that particular gene. Altering the endogenous expression levels of a gene can lead to the obervation of a particular phenotype that can then be used to derive indications on the function of the gene. The gene can be either over-expressed or under expressed in every cell of the organism at all times using a strong ubiquitous promoter, or it could be expressed in one or more discrete parts of the organism using a well characterized tissue-specific promoter (e.g., a bone marrow, or spinal cord-specific promoter), or it can be expressed at a specified time of development using an inducible and/or a developmentally regulated promoter.

[0343] In the case of Microsomal GPAT_hlog3 transgenic mice or rats, if no phenotype is apparent in normal growth conditions, observing the organism under diseased conditions (immune, hematopoietic, neural, metabolic, or proliferative disorders, etc.) may lead to understanding the function of the gene. Therefore, the application of antisense and/or sense methodology to the creation of transgenic mice or rats to refine the biological function of the polypeptide is encompassed by the present invention.

[0344] In preferred embodiments, the following N-terminal Microsomal GPAT_hlog3 deletion polypeptides are encompassed by the present invention: M1-D544, S2-D544, R3-D544, C4-D544, A5-D544, Q6-D544, A7-D544, A8-D544, E9-D544, V10-D544, A11-D544, A12-D544, T13-D544, V14-D544, P15-D544, G16-D544, A17-D544, G18-D544, V19-D544, G20-D544, N21-D544, V22-D544, G23-D544, L24-D544, R25-D544, P26-D544, P27-D544, M28-D544, V29-D544, P30-D544, R31-D544, Q32-D544, A33-D544, S34-D544, F35-D544, F36-D544, P37-D544, P38-D544, D544, V40-D544, P41-D544, N42-D544, P43-D544, F44-D544, V45-D544, Q46-D544, Q47-D544, T48-D544, Q49-D544, I50-D544, G51-D544, S52-D544, A53-D544, R54-D544, R55-D544, V56-D544, Q57-D544, I58-D544, V59-D544, L60-D544, L61-D544, G62-D544, I63-D544, I64-D544, L65-D544, L66-D544, P67-D544, I68-D544, R69-D544, V70-D544, L71-D544, L72-D544, V73-D544, A74-D544, L75-D544, I76-D544, L77-D544, L78-D544, L79-D544, A80-D544, W81-D544, P82-D544, F83-D544, A84-D544, A85-D544, I86-D544, S87-D544, T88-D544, V89-D544, C90-D544, C91-D544, P92-D544, E93-D544, K94-D544, L95-D544, T96-D544, H97-D544, P98-D544, I99-D544, T100-D544, G101-D544, W102-D544, R103-D544, R104-D544, K105-D544, I106-D544, T107-D544, Q108-D544, T109-D544, A110-D544, L111-D544, K112-D544, F113-D544, L114-D544, G115-D544, R116-D544, A117-D544, M118-D544, F119-D544, F120-D544, S121-D544, M122-D544, G123-D544, F124-D544, I125-D544, V126-D544, A127-D544, V128-D544, K129-D544, G130-D544, K131-D544, I132-D544, A133-D544, S134-D544, P135-D544, L136-D544, E137-D544, A138-D544, P139-D544, V140-D544, F141-D544, V142-D544, A143-D544, A144-D544, P145-D544, H146-D544, S147-D544, T148-D544, F149-D544, F150-D544, D151-D544, G152-D544, I153-D544, A154-D544, C155-D544, V156-D544, V157-D544, A158-D544, G159-D544, L160-D544, P161-D544, S162-D544, M163-D544, V164-D544, S165-D544, R166-D544, N167-D544, E168-D544, N169-D544, A170-D544, Q171-D544, V172-D544, P173-D544, L174-D544, I175-D544, G176-D544, R177-D544, L178-D544, L179-D544, R180-D544, A181-D544, V182-D544, Q183-D544, P184-D544, V185-D544, L186-D544, V187-D544, S188-D544, R189-D544, V190-D544, D191-D544, P192-D544, D193-D544, S194-D544, R195-D544, K196-D544, N197-D544, T198-D544, I199-D544, N200-D544, E201-D544, I202-D544, I203-D544, K204-D544, P205-D544, T206-D544, T207-D544, S208-D544, G209-D544, G210-D544, E211-D544, W212-D544, P213-D544, Q214-D544, I215-D544, L216-D544, V217-D544, F218-D544, P219-D544, E220-D544, G221-D544, T222-D544, C223-D544, T224-D544, N225-D544, R226-D544, S227-D544, C228-D544, L229-D544, I230-D544, T231-D544, F232-D544, K233-D544, P234-D544, G235-D544, A236-D544, F237-D544, I238-D544, P239-D544, G240-D544, V241-D544, P242-D544, V243-D544, Q244-D544, P245-D544, V246-D544, L247-D544, L248-D544, R249-D544, Y250-D544, P251-D544, N252-D544, K253-D544, L254-D544, D255-D544, T256-D544, V257-D544, T258-D544, W259-D544, T260-D544, W261-D544, Q262-D544, G263-D544, Y264-D544, T265-D544, F266-D544, I267-D544, Q268-D544, L269-D544, C270-D544, M271-D544, L272-D544, T273-D544, F274-D544, C275-D544, Q276-D544, L277-D544, F278-D544, T279-D544, K280-D544, V281-D544, E282-D544, V283-D544, E284-D544, F285-D544, M286-D544, P287-D544, V288-D544, Q289-D544, V290-D544, P291-D544, N292-D544, D293-D544, E294-D544, E295-D544, K296-D544, N297-D544, D298-D544, P299-D544, V300-D544, L301-D544, F302-D544, A303-D544, N304-D544, K305-D544, V306-D544, R307-D544, N308-D544, L309-D544, M310-D544, A311-D544, E312-D544, A313-D544, L314-D544, G315-D544, I316-D544, P317-D544, V318-D544, T319-D544, D320-D544, H321-D544, T322-D544, Y323-D544, E324-D544, D325-D544, C326-D544, R327-D544, L328-D544, M329-D544, I330-D544, S331-D544, A332-D544, G333-D544, Q334-D544, L335-D544, T336-D544, L337-D544, P338-D544, M339-D544, E340-D544, A341-D544, G342-D544, L343-D544, V344-D544, E345-D544, F346-D544, T347-D544, K348-D544, I349-D544, S350-D544, R351-D544, K352-D544, L353-D544, K354-D544, L355-D544, D356-D544, W357-D544, D358-D544, G359-D544, V360-D544, R361-D544, K362-D544, H363-D544, L364-D544, D365-D544, E366-D544, Y367-D544, A368-D544, S369-D544, I370-D544, A371-D544, S372-D544, S373-D544, S374-D544, K375-D544, G376-D544, G377-D544, R378-D544, I379-D544, G380-D544, I381-D544, E382-D544, E383-D544, F384-D544, A385-D544, K386-D544, Y387-D544, L388-D544, K389-D544, L390-D544, P391-D544, V392-D544, S393-D544, D394-D544, V395-D544, L396-D544, R397-D544, Q398-D544, L399-D544, F400-D544, A401-D544, L402-D544, F403-D544, D404-D544, R405-D544, N406-D544, H407-D544, D408-D544, G409-D544, S410-D544, I411-D544, D412-D544, F413-D544, R414-D544, E415-D544, Y416-D544, V417-D544, I418-D544, G419-D544, L420-D544, A421-D544, V422-D544, L423-D544, C424-D544, N425-D544, P426-D544, S427-D544, N428-D544, T429-D544, E430-D544, E431-D544, I432-D544, I433-D544, Q434-D544, V435-D544, A436-D544, F437-D544, K438-D544, L439-D544, F440-D544, D441-D544, V442-D544, D443-D544, E444-D544, D445-D544, G446-D544, Y447-D544, I448-D544, T449-D544, E450-D544, E451-D544, E452-D544, F453-D544, S454-D544, T455-D544, I456-D544, L457-D544, Q458-D544, A459-D544, S460-D544, L61-D544, G462-D544, V463-D544, P464-D544, D465-D544, L466-D544, D467-D544, V468-D544, S469-D544, G470-D544, L471-D544, F472-D544, K473-D544, E474-D544, I475-D544, A476-D544, Q477-D544, G478-D544, D479-D544, S480-D544, I481-D544, S482-D544, Y483-D544, E484-D544, E485-D544, F486-D544, K487-D544, S488-D544, F489-D544, A490-D544, L491-D544, K492-D544, H493-D544, P494-D544, E495-D544, Y496-D544, A497-D544, K498-D544, I499-D544, F500-D544, T501-D544, T502-D544, Y503-D544, L504-D544, D505-D544, L506-D544, Q507-D544, T508-D544, C509-D544, H510-D544, V511-D544, F512-D544, S513-D544, L514-D544, P515-D544, K516-D544, E517-D544, V518-D544, Q519-D544, T520-D544, T521-D544, P522-D544, S523-D544, T524-D544, A525-D544, S526-D544, N527-D544, K528-D544, V529-D544, S530-D544, P531-D544, E532-D544, K533-D544, H534-D544, E535-D544, E536-D544, S537-D544, and/or T538-D544 of SEQ ID NO: 8. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these N-terminal Microsomal GPAT_hlog3 deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0345] In preferred embodiments, the following C-terminal Microsomal GPAT_hlog3 deletion polypeptides are encompassed by the present invention: M1-D544, M1-D543, M1-K542, M1-K541, M1-D540, M1-S539, M1-T538, M1-S537, M1-E536, M1-E535, M1-H534, M1-K533, M1-E532, M1-P531, M1-S530, M1-V529, M1-K528, M1-N527, M1-S526, M1-A525, M1-T524, M1-S523, M1-P522, M1-T521, M1-T520, M1-Q519, M1-V518, M1-E517, M1-K516, M1-P515, M1-L514, M1-S513, M1-F512, M1-V511, M1-H510, M1-C509, M1-T508, M1-Q507, M1-L506, M1-D505, M1-L504, M1-Y503, M1-T502, M1-T501, M1-F500, M1-I499-M1-K498, M1-A497, M1-Y496, M1-E495, M1-P494, M1-H493, M1-K492, M1-L491, M1-A490, M1-F489, M1-S488, M1-K487, M1-F486, M1-E485, M1-E484, M1-Y483, M1-S482, M1-I481, M1-S480, M1-D479, M1-G478, M1-Q477, M1-A476, M1-I475, M1-E474, M1-K473, M1-F472, M1-L471, M1-G470, M1-S469, M1-V468, M1-D467, M1-L466, M1-D465, M1-P464, M1-V463, M1-G462, M1-L461, M1-S460, M1-A459, M1-Q458, M1-L457, M1-I456, M1-T455, M1-S454, M1-F453, M1-E452, M1-E451, M1-E450, M1-T449, M1-I448, M1-Y447, M1-G446, M1-D445, M1-E444, M1-D443, M1-V442, M1-D441, M1-F440, M1-L439, M1-K438, M1-F437, M1-A436, M1-V435, M1-Q434, M1-I433, M1-I432, M1-E431, M1-E430, M1-T429, M1-N428, M1-S427, M1-P426, M1-N425, M1-C424, M1-L423, M1-V422, M1-A421, M1-L420, M1-G419, M1-I418, M1-V417, M1-Y416, M1-E415, M1-R414, M1-F413, M1-D412, M1-I411, M1-S410, M1-G409, M1-D408, M1-H407, M1-N406, M1-R405, M1-D404, M1-F403, M1-L402, M1-A401, M1-F400, M1-L399, M1-Q398, M1-R397, M1-L396, M1-V395, M1-D394, M1-S393, M1-V392, M1-P391, M1-L390, M1-K389, M1-L388, M1-Y387, M1-K386, M1-A385, M1-F384, M1-E383, M1-E382, M1-I381, M1-G380, M1-I379, M1-R378, M1-G377, M1-G376, M1-K375, M1-S374, M1-S373, M1-S372, M1-A371, M1-I370, M1-S369, M1-A368, M1-Y367, M1-E366, M1-D365, M1-L364, M1-H363, M1-K362, M1-R361, M1-V360, M1-G359, M1-D358, M1-W357, M1-D356, M1-L355, M1-K354, M1-L353, M1-K352, M1-R351, M1-S350, M1-I349, M1-K348, M1-T347, M1-F346, M1-E345, M1-V344, M1-L343, M1-G342, M1-A341, M1-E340, M1-M339, M1-P338, M1-L337, M1-T336, M1-L335, M1-Q334, M1-G333, M1-A332, M1-S331, M1-I330, M1-M329, M1-L328, M1-R327, M1-C326, M1-D325, M1-E324, M1-Y323, M1-T322, M1-H321, M1-D320, M1-T319, M1-V318, M1-P317, M1-I316, M1-G315, M1-L314, M1-A313, M1-E312, M1-A311, M1-M310, M1-L309, M1-N308, M1-R307, M1-V306, M1-K305, M1-N304, M1-A303, M1-F302, M1-L301, M1-V300, M1-P299, M1-D298, M1-N297, M1-K296, M1-E295, M1-E294, M1-D293, M1-N292, M1-P291, M1-V290, M1-Q289, M1-V288, M1-P287, M1-M286, M1-F285, M1-E284, M1-V283, M1-E282, M1-V281, M1-K280, M1-T279, M1-F278, M1-L277, M1-Q276, M1-C275, M1-F274, M1-T273, M1-L272, M1-M271, M1-C270, M1-L269, M1-Q268, M1-I267, M1-F266, M1-T265, M1-Y264, M1-G263, M1-Q262, M1-W261, M1-T260, M1-W259, M1-T258, M1-V257, M1-T256, M1-D255, M1-L254, M1-K253, M1-N252, M1-P251, M1-Y250, M1-R249, M1-L248, M1-L247, M1-V246, M1-P245, M1-Q244, M1-V243, M1-P242, M1-V241, M1-G240, M1-P239, M1-I238, M1-F237, M1-A236, M1-G235, M1-P234, M1-K233, M1-F232, M1-T231, M1-I230, M1-L229, M1-C228, M1-S227, M1-R226, M1-N225, M1-T224, M1-C223, M1-T222, M1-G221, M1-E220, M1-P219, M1-F218, M1-V217, M1-L216, M1-I215, M1-Q214, M1-P213, M1-W212, M1-E211, M1-G210, M1-G209, M1-S208, M1-T207, M1-T206, M1-P205, M1-K204, M1-I203, M1-I202, M1-E201, M1-N200, M1-I199, M1-T198, M1-N197, M1-K196, M1-R195, M1-S194, M1-D193, M1-P192, M1-D191, M1-V190, M1-R189, M1-S188, M1-V187, M1-L186, M1-V185, M1-P184, M1-Q183, M1-V182, M1-A181, M1-R180, M1-L179, M1-L178, M1-R177, M1-G176, M1-I175, M1-L174, M1-P173, M1-V172, M1-Q171, M1-A170, M1-N169, M1-E168, M1-N167, M1-R166, M1-S165, M1-V164, M1-M163, M1-S162, M1-P161, M1-L160, M1-G159, M1-A158, M1-V157, M1-V156, M1-C155, M1-A154, M1-I153, M1-G152, M1-D151, M1-F150, M1-F149, M1-T148, M1-S147, M1-H146, M1-P145, M1-A144, M1-A143, M1-V142, M1-F141, M1-V140, M1-P139, M1-A138, M1-E137, M1-L136, M1-P135, M1-S134, M1-A133, M1-I132, M1-K131, M1-G130, M1-K129, M1-V128, M1-A127, M1-V126, M1-I125, M1-F124, M1-G123, M1-M122, M1-S121, M1-F120, M1-F119, M1-M118, M1-A117, M1-R116, M1-G115, M1-L114, M1-F113, M1-K112, M1-L111, M1-A110, M1-T109, M1-Q108, M1-T107, M1-I106, M1-K105, M1-R104, M1-R103, M1-W102, M1-G101, M1-T100, M1-I99, M1-P98, M1-H97, M1-T96, M1-L95, M1-K94, M1-E93, M1-P92, M1-C91, M1-C90, M1-V89, M1-T88, M1-S87, M1-I86, M1-A85, M1-A84, M1-F83, M1-P82, M1-W81, M1-A80, M1-L79, M1-L78, M1-L77, M1-I76, M1-L75, M1-A74, M1-V73, M1-L72, M1-L71, M1-V70, M1-R69, M1-I68, M1-P67, M1-L66, M1-L65, M1-I64, M1-I63, M1-G62, M1-L61, M1-L60, M1-V59, M1-I58, M1-Q57, M1-V56, M1-R55, M1-R54, M1-A53, M1-S52, M1-G51, M1-I50, M1-Q49, M1-T48, M1-Q47, M1-Q46, M1-V45, M1-F44, M1-P43, M1-N42, M1-P41, M1-V40, M1-P39, M1-P38, M1-P37, M1-F36, M1-F35, M1-S34, M1-A33, M1-Q32, M1-R31, M1-P30, M1-V29, M1-M28, M1-P27, M1-P26, M1-R25, M1-L24, M1-G23, M1-V22, M1-N21, M1-G20, M1-V19, M1-G18, M1-A17, M1-G16, M1-P15, M1-V14, M1-T13, M1-A12, M1-A11, M1-V10, M1-E9, M1-A8, and/or M1-A7 of SEQ ID NO: 8. Polynucleotide sequences encoding these polypeptides are also provided. The present invention also encompasses the use of these C-terminal Microsomal GPAT_hlog3 deletion polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0346] Alternatively, preferred polypeptides of the present invention may comprise polypeptide sequences corresponding to, for example, internal regions of the Microsomal GPAT_hlog3 polypeptide (e.g., any combination of both N-and C-terminal Microsomal GPAT_hlog3 polypeptide deletions) of SEQ ID NO: 8. For example, internal regions could be defined by the equation: amino acid NX to amino acid CX, wherein NX refers to any N-terminal deletion polypeptide amino acid of Microsomal GPAT_hlog3 (SEQ ID NO: 8), and where CX refers to any C-terminal deletion polypeptide amino acid of Microsomal GPAT_hlog3 (SEQ ID NO: 8). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these polypeptides as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0347] The present invention also encompasses immunogenic and/or antigenic epitopes of the Microsomal GPAT_hlog3 polypeptide.

[0348] The Microsomal GPAT_hlog3 polypeptides of the present invention were determined to comprise several phosphorylation sites based upon the Motif algorithm (Genetics Computer Group, Inc.). The phosphorylation of such sites may regulate some biological activity of the Microsomal GPAT_hlog3 polypeptide. For example, phosphorylation at specific sites may be involved in regulating the proteins ability to associate or bind to other molecules (e.g., proteins, ligands, substrates, DNA, etc.). In the present case, phosphorylation may modulate the ability of the Microsomal GPAT_hlog3 polypeptide to associate with other potassium channel alpha subunits, beta subunits, or its ability to modulate potassium channel function.

[0349] The Microsomal GPAT_hlog3 polypeptide was predicted to comprise eight PKC phosphorylation sites using the Motif algorithm (Genetics Computer Group, Inc.). In vivo, protein kinase C exhibits a preference for the phosphorylation of serine or threonine residues. The PKC phosphorylation sites have the following consensus pattern: [ST]-x-[RK], where S or T represents the site of phosphorylation and ‘x’ an intervening amino acid residue. Additional information regarding PKC phosphorylation sites can be found in Woodget J. R., Gould K. L., Hunter T., Eur. J. Biochem. 161:177-184(1986), and Kishimoto A., Nishiyama K., Nakanishi H., Uratsuji Y., Nomura H., Takeyama Y., Nishizuka Y., J. Biol. Chem. 260:12492-12499(1985); which are hereby incorporated by reference herein.

[0350] In preferred embodiments, the following PKC phosphorylation site polypeptides are encompassed by the present invention: QTQIGSARRVQIV (SEQ ID NO: 125), RVDPDSRKNTINE (SEQ ID NO: 126), PEGTCTNRSCLIT (SEQ ID NO: 127), RSCLITFKPGAFI (SEQ ID NO: 128), EFTKISRKLKLDW (SEQ ID NO: 129), ASIASSSKGGRIG (SEQ ID NO: 130), TPSTASNKVSPEK (SEQ ID NO: 131), and/or HEESTSDKKDD (SEQ ID NO: 132). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog3 PKC phosphorylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0351] The Microsomal GPAT_hlog3 polypeptide was predicted to comprise thirteen casein kinase II phosphorylation sites using the Motif algorithm (Genetics Computer Group, Inc.). Casein kinase II (CK-2) is a protein serine/threonine kinase whose activity is independent of cyclic nucleotides and calcium. CK-2 phosphorylates many different proteins. The substrate specificity [1] of this enzyme can be summarized as follows: (1) Under comparable conditions Ser is favored over Thr.; (2) An acidic residue (either Asp or Glu) must be present three residues from the C-terminal of the phosphate acceptor site; (3) Additional acidic residues in positions +1, +2, +4, and +5 increase the phosphorylation rate. Most physiological substrates have at least one acidic residue in these positions; (4) Asp is preferred to Glu as the provider of acidic determinants; and (5) A basic residue at the N-terminal of the acceptor site decreases the phosphorylation rate, while an acidic one will increase it.

[0352] A consensus pattern for casein kinase II phosphorylations site is as follows: [ST]-x(2)-[DE], wherein ‘x’ represents any amino acid, and S or T is the phosphorylation site.

[0353] Additional information specific to casein kinase II phosphorylation sites may be found in reference to the following publication: Pinna L. A., Biochim. Biophys. Acta 1054:267-284(1990); which is hereby incorporated herein in its entirety.

[0354] In preferred embodiments, the following casein kinase II phosphorylation site polypeptides are encompassed by the present invention: KGKIASPLEAPVFV (SEQ ID NO: 133), AAPHSTFFDGIACV (SEQ ID NO: 134), LPSMVSRNENAQVP (SEQ ID NO: 135), QPVLVSRVDPDSRK (SEQ ID NO: 136), DSRKNTINEIIKPT (SEQ ID NO: 137), IKPTTSGGEWPQIL (SEQ ID NO: 138), FCQLFTKVEVEFMP (SEQ ID NO: 139), PVTDHTYEDCRLMI (SEQ ID NO: 140), VLCNPSNTEEIIQV (SEQ ID NO: 141), EDGYITEEEFSTIL (SEQ ID NO: 142), QGDSISYEEFKSFA (SEQ ID NO: 143), AKIFTTYLDLQTCH (SEQ ID NO: 144), and/or EKHEESTSDKKDD (SEQ ID NO: 145). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of this casein kinase II phosphorylation site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0355] The Microsomal GPAT_hlog3 polypeptide was predicted to comprise two cAMP-and cGMP-dependent protein kinase phosphorylation site using the Motif algorithm (Genetics Computer Group, Inc.). There has been a number of studies relative to the specificity of cAMP-and cGMP-dependent protein kinases. Both types of kinases appear to share a preference for the phosphorylation of serine or threonine residues found close to at least two consecutive N-terminal basic residues.

[0356] A consensus pattern for cAMP-and cGMP-dependent protein kinase phosphorylation sites is as follows: [RK](2)-x-[ST], wherein “x” represents any amino acid, and S or T is the phosphorylation site.

[0357] Additional information specific to cAMP-and cGMP-dependent protein kinase phosphorylation sites may be found in reference to the following publication: Fremisco J. R., Glass D. B., Krebs E. G, J. Biol. Chem. 255:4240-4245(1980); Glass D. B., Smith S. B., J. Biol. Chem. 258:14797-14803(1983); and Glass D. B., E1-Maghrabi M. R., Pilkis S. J., J. Biol. Chem. 261:2987-2993(1986); which is hereby incorporated herein in its entirety.

[0358] In preferred embodiments, the following cAMP-and cGMP-dependent protein kinase phosphorylation site polypeptides are encompassed by the present invention: ITGWRRKITQTALK (SEQ ID NO: 146), and/or VDPDSRKNTINEII (SEQ ID NO: 147). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these cAMP-and cGMP-dependent protein kinase phosphorylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0359] The Microsomal GPAT_hlog3 polypeptide has been shown to comprise one glycosylation sites according to the Motif algorithm (Genetics Computer Group, Inc.). As discussed more specifically herein, protein glycosylation is thought to serve a variety of functions including: augmentation of protein folding, inhibition of protein aggregation, regulation of intracellular trafficking to organelles, increasing resistance to proteolysis, modulation of protein antigenicity, and mediation of intercellular adhesion.

[0360] Asparagine phosphorylation sites have the following consensus pattern, N-{P}-[ST]-{P}, wherein N represents the glycosylation site. However, it is well known that that potential N-glycosylation sites are specific to the consensus sequence Asn-Xaa-Ser/Thr. However, the presence of the consensus tripeptide is not sufficient to conclude that an asparagine residue is glycosylated, due to the fact that the folding of the protein plays an important role in the regulation of N-glycosylation. It has been shown that the presence of proline between Asn and Ser/Thr will inhibit N-glycosylation; this has been confirmed by a recent statistical analysis of glycosylation sites, which also shows that about 50% of the sites that have a proline C-terminal to Ser/Thr are not glycosylated. Additional information relating to asparagine glycosylation may be found in reference to the following publications, which are hereby incorporated by reference herein: Marshall R. D., Annu. Rev. Biochem. 41:673-702(1972); Pless D. D., Lennarz W. J., Proc. Natl. Acad. Sci. U.S.A. 74:134-138(1977); Bause E., Biochem. J. 209:331-336(1983); Gavel Y., von Heijne G., Protein Eng. 3:433-442(1990); and Miletich J. P., Broze G. J. Jr., J. Biol. Chem. 265:11397-11404(1990).

[0361] In preferred embodiments, the following asparagine glycosylation site polypeptides are encompassed by the present invention: EGTCTNRSCLITFK (SEQ ID NO: 148). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these Microsomal GPAT_hlog3 asparagine glycosylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0362] The Microsomal GPAT_hlog3 polypeptide was predicted to comprise four N-myristoylation sites using the Motif algorithm (Genetics Computer Group, Inc.). An appreciable number of eukaryotic proteins are acylated by the covalent addition of myristate (a C14-saturated fatty acid) to their N-terminal residue via an amide linkage. The sequence specificity of the enzyme responsible for this modification, myristoyl CoA:protein N-myristoyl transferase (NMT), has been derived from the sequence of known N-myristoylated proteins and from studies using synthetic peptides. The specificity seems to be the following: i.) The N-terminal residue must be glycine; ii.) In position 2, uncharged residues are allowed; iii.) Charged residues, proline and large hydrophobic residues are not allowed; iv.) In positions 3 and 4, most, if not all, residues are allowed; v.) In position 5, small uncharged residues are allowed (Ala, Ser, Thr, Cys, Asn and Gly). Serine is favored; and vi.) In position 6, proline is not allowed.

[0363] A consensus pattern for N-myristoylation is as follows: G-{EDRKHPFYW}-x(2)-[STAGCN]-{P}, wherein ‘x’ represents any amino acid, and G is the N-myristoylation site.

[0364] Additional information specific to N-myristoylation sites may be found in reference to the following publication: Towler D. A., Gordon J. I., Adams S. P., Glaser L., Annu. Rev. Biochem. 57:69-99(1988); and Grand R. J. A., Biochem. J. 258:625-638(1989); which is hereby incorporated herein in its entirety.

[0365] In preferred embodiments, the following N-myristoylation site polypeptides are encompassed by the present invention: AATVPGAGVGNVGLRP (SEQ ID NO: 149), LVFPEGTCTNRSCLIT (SEQ ID NO: 150), MAEALGIPVTDHTYED (SEQ ID NO: 151), and/or ASSSKGGRIGIEEFAK (SEQ ID NO: 152). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these N-myristoylation site polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0366] The Microsomal GPAT_hlog3 polypeptide has been shown to comprise one glycosaminoglycan attachment site according to the Motif algorithm (Genetics Computer Group, Inc.). Proteoglycans are complex glycoconjugates containing a core protein to which a variable number of glycosaminoglycan chains (such as heparin sulfate, chondroitin sulfate, etc.) are covalently attached. The glycosaminoglycans are attached to the core proteins through a xyloside residue which is in turn linked to a serine residue of the protein. A consensus sequence for the attachment site seems to exist and follows the following pattern: S-G-x-G, wherein ‘S’ represents the attachment site, and ‘x’ represents any amino acid. Additional information relating to leucine zipper motifs may be found in reference to the following publications, which are hereby incorporated by reference herein: Hassel J. R., Kimura J. H., Hascall V. C., Annu. Rev. Biochem. 55:539-567(1986); and/or Bourdon M. A., Krusius T., Campbell S., Schwarz N. B., Proc. Natl. Acad. Sci. U.S.A. 84:3194-3198(1987).

[0367] In preferred embodiments, the following glycosaminoglycan attachment site polypeptide is encompassed by the present invention: SLFDESGSGEVDLR (SEQ ID NO: 116). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of this Microsomal GPAT_hlog3 glycosaminoglycan attachment site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0368] The Microsomal GPAT_hlog3 polypeptide has been shown to comprise one amidation site according to the Motif algorithm (Genetics Computer Group, Inc.). The precursor of hormones and other active peptides which are C-terminally amidated is always directly followed by a glycine residue which provides the amide group, and most often by at least two consecutive basic residues (Arg or Lys) which generally function as an active peptide precursor cleavage site. Although all amino acids can be amidated, neutral hydrophobic residues such as Val or Phe are good substrates, while charged residues such as Asp or Arg are much less reactive. A consensus pattern for amidation sites is the following: x-G-[RK]-[RK], wherein “X” represents the amidation site. Additional information relating to asparagine glycosylation may be found in reference to the following publications, which are hereby incorporated by reference herein: Kreil G., Meth. Enzymol. 106:218-223(1984); and Bradbury A. F., Smyth D. G., Biosci. Rep. 7:907-916(1987).

[0369] In preferred embodiments, the following amidation site polypeptide is encompassed by the present invention: PENSDAGRKPVRKK (SEQ ID NO: 117). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of this Microsomal GPAT_hlog3 amidation site polypeptide as an immunogenic and/or antigenic epitope as described elsewhere herein.

[0370] The Microsomal GPAT_hlog3 polypeptide has been shown to comprise two EF-hand calcium-binding domain according to the Motif algorithm (Genetics Computer Group, Inc.). Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand. This type of domain consists of a twelve residue loop flanked on both side by a twelve residue alpha-helical domain. In an EF-hand loop the calcium ion is coordinated in a pentagonal bipyramidal configuration. The six residues involved in the binding are in positions 1, 3, 5, 7, 9 and 12; these residues are denoted by X, Y, Z, -Y, -X and -Z. The invariant Glu or Asp at position 12 provides two oxygens for liganding Ca (bidentate ligand). Several representative proteins containing EF-hand regions are provided below: For each type of protein, the total number of EF-hand regions known or supposed to exist are provided in parenthesis: Aequorin and Renilla luciferin binding protein (LBP) (Ca=3); Alpha actinin (Ca=2); Calbindin (Ca=4); Calcineurin B subunit (protein phosphatase 2B regulatory subunit) (Ca=4); Calcium-binding protein from Streptomyces erythraeus (Ca=3?); Calcium-binding protein from Schistosoma mansoni (Ca=2?); Calcium-binding proteins TCBP-23 and TCBP-25 from Tetrahymena thermophila (Ca=4?); Calcium-dependent protein kinases (CDPK) from plants (Ca=4); Calcium vector protein from amphoxius (Ca=2); Calcyphosin (thyroid protein p24) (Ca=4?); Calmodulin (Ca=4, except in yeast where Ca=3); Calpain small and large chains (Ca=2); Calretinin (Ca=6); Calcyclin (prolactin receptor associated protein) (Ca=2); Caltractin (centrin) (Ca=2 or 4); Cell Division Control protein 31 (gene CDC31) from yeast (Ca=2?); Diacylglycerol kinase (EC 2.7.1.107) (DGK) (Ca=2); FAD-dependent glycerol-3-phosphate dehydrogenase (EC 1.1.99.5) from mammals (Ca=1); Fimbrin (plastin) (Ca=2); Flagellar calcium-binding protein (1f8) from Trypanosoma cruzi (Ca=1 or 2); Guanylate cyclase activating protein (GCAP) (Ca=3); Inositol phospholipid-specific phospholipase C isozymes gamma-1 and delta-1 (Ca=2) [10]; Intestinal calcium-binding protein (ICaBPs) (Ca=2); MIF related proteins 8 (MRP-8 or CFAG) and 14 (MRP-14) (Ca=2); Myosin regulatory light chains (Ca=1); Oncomodulin (Ca=2); Osteonectin (basement membrane protein BM-40) (SPARC) and proteins that contains an ‘osteonectin’ domain (QR1, matrix glycoprotein SC1) (Ca=1); Parvalbumins alpha and beta (Ca=2); Placental calcium-binding protein (18a2) (nerve growth factor induced protein 42a) (p9k) (Ca=2); Recoverins (visinin, hippocalcin, neurocalcin, S-modulin) (Ca=2 to 3); Reticulocalbin (Ca=4); S-100 protein, alpha and beta chains (Ca=2); Sarcoplasmic calcium-binding protein (SCPs) (Ca=2 to 3); Sea urchin proteins Spec 1 (Ca=4), Spec 2 (Ca=4?), Lps-1 (Ca=8); Serine/threonine protein phosphatase rdgc (EC 3.1.3.16) from Drosophila (Ca=2); Sorcin V19 from hamster (Ca=2); Spectrin alpha chain (Ca=2); Squidulin (optic lobe calcium-binding protein) from squid (Ca=4); and Troponins C; from skeletal muscle (Ca=4), from cardiac muscle (Ca=3), from arthropods and molluscs (Ca=2).

[0371] A consensus pattern for EF hand calcium binding domains is the following:

1 2 3     4         5        6         7    8       9          10    12    13
X   Y               Z                  −Y           −X               −Z
D-x-[DNS]-{ILVFYW}-{DENSTG}-[DNQGHRK]-(GP}-[LIVMC]-[DENQSTAGC]-x(2)-[DE]-[LIVMFYW],

[0372] wherein X, Y, Z, -Y, -X, and -Z are as defined above, and wherein “x” represents any amino acid. Amino acid residues within the consensus at positions 1 (X), 3 (Y) and 12 (-Z) are the most conserved. The 6th residue in an EF-hand loop is in most cases a Gly.

[0373] Additional information relating to EF-hand calcium binding domains may be found in reference to the following publications, which are hereby incorporated by reference herein: Kawasaki H., Kretsinger R. H., Protein Prof. 2:305-490(1995); Kretsinger R. H., Cold Spring Harbor Symp. Quant. Biol. 52:499-510(1987); Moncrief N. D., Kretsinger R. H., Goodman M., J. Mol. Evol. 30:522-562(1990); Nakayama S., Moncrief N. D., Kretsinger R. H., J. Mol. Evol. 34:416-448(1992); Heizmann C. W., Hunziker W., Trends Biochem. Sci. 16:98-103(1991); Kligman D., Hilt D. C., Trends Biochem. Sci. 13:437-443(1988); Strynadka N. C. J., James M. N. G., Annu. Rev. Biochem. 58:951-98(1989); Haiech J., Sallantin J., Biochimie 67:555-560(1985); Chauvaux S., Beguin P., Aubert J.-P., Bhat K. M., Gow L. A., Wood T. M., Bairoch A., Biochem. J. 265:261-265(1990); Bairoch A., Cox J. A., FEBS Lett. 269:454-456(1990).

[0374] In preferred embodiments, the following EF-hand calcium binding domain polypeptide are encompassed by the present invention: LFALFDRNHDGSIDFREYVIGLA (SEQ ID NO: 153), and/or AFKLFDVDEDGYITEEEFSTILQ (SEQ ID NO: 154). Polynucleotides encoding these polypeptides are also provided. The present invention also encompasses the use of these EF-hand calcium binding domain polypeptides as immunogenic and/or antigenic epitopes as described elsewhere herein.

[0375] Many polynucleotide sequences, such as EST sequences, are publicly available and accessible through sequence databases. Some of these sequences are related to SEQ ID NO: 7 and may have been publicly available prior to conception of the present invention. Preferably, such related polynucleotides are specifically excluded from the scope of the present invention. To list every related sequence would be cumbersome. Accordingly, preferably excluded from the present invention are one or more polynucleotides consisting of a nucleotide sequence described by the general formula of a-b, where a is any integer between 1 to 1898 of SEQ ID NO: 7, b is an integer between 15 to 1912, where both a and b correspond to the positions of nucleotide residues shown in SEQ ID NO: 7, and where b is greater than or equal to a+14.

Three Dimensional Homology Models

[0376] The present invention also provides three dimensional homology models that depict the structure of the Mitochondrial GPAT (SEQ ID NO: 2), Microsomal GPAT_hlog1 (SEQ ID NO: 4), and Microsomal GPAT_hlog3 (SEQ ID NO: 8) polypeptide sequences of the present invention.

[0377] The three dimensional crystallographic structure for glycerol-3-phosphate acyltransferase (G3PAT), EC number 2.3.1.5 from squash chloroplast was reported by Trunbull et al. (2001)(Protein Data Bank code 1K30, Bernstein et. al., 1977 & Berman et. al., 2000). The G3PAT structure is the first representative for an enzyme of this class. Structural searches against others proteins in the Protein Data Bank (Bernstein et. al., 1977 & Berman et. al., 2000) show that there are no other proteins with a similar fold to G3PAT. The structure consists of two domains. Domain I consists of the first 77 amino-terminal residues that form a 4-helix bundle. A loop region links this domain to the larger Domain II. Domain II consists of alternating α/β structural elements that give rise to a 9-stranded mixed parallel/antiparallel β sheet flanked by 11 α-helices. Based upon analysis of the three dimensional coordinates for G3PAT and patterns of sequence conservation across multiple species the putative active site residues have been described. They compose a cleft at the center of domain II that is lined with hydrophobic residues and contains at one end a cluster of positively charged residues flanked by histidine-139 (H139) and aspartate-144 (D144). The hydrophobic cleft makes up the binding site for the fatty acyl substrate while the positively charged residues represent the phosphate binding site. H139 and D144 correspond to a sequence motif, H(x)4D that has been proposed as the site of catalysis. This structure-based information and sequence information from novel genes can be used to identify other protein family members that share this same fold.

Structural Bioinformatics Analysis

[0378] Protein threading and molecular modeling of GPAT_hlog1, GPAT_hlog3 and mitochondrial GPAT suggest that a portion of these proteins has a three dimensional fold similar to that of 1K30, glycerol-3-phosphate acyltransferase (G3PAT), EC number 2.3.1.5 from squash chloroplast (Trunbull et al. (2001), Protein Data Bank code 1K30, Bernstein et. al., 1977 & Berman et. al., 2000). For GPAT_hlog1 (residues L43 to R342) has a three dimensional fold similar to that of 1K30, glycerol-3-phosphate acyltransferase (G3PAT), EC number 2.3.1.5 from squash chloroplast (Trunbull et al. (2001), Protein Data Bank code 1K30, Bernstein et. al., 1977 & Berman et. al., 2000). For GPAT_hlog3 (residues P27 to S427) has a three dimensional fold similar to that of 1K30, glycerol-3-phosphate acyltransferase (G3PAT), EC number 2.3.1.5 from squash chloroplast (Trunbull et al. (2001), Protein Data Bank code 1K30, Bernstein et. al., 1977 & Berman et. al., 2000). For the mitochondrial GPAT (residues R57 to 1493) has a three dimensional fold similar to that of 1K30, glycerol-3-phosphate acyltransferase (G3PAT), EC number 2.3.1.5 from squash chloroplast (Trunbull et al. (2001), Protein Data Bank code 1K30, Bernstein et. al., 1977 & Berman et. al., 2000).

[0379] Based on sequence, structure, motifs and known glycerol-3-phosphate acyltransferase signature sequences, GPAT_hlog1, GPAT_hlog3 and mitochondrial GPAT are novel glycerol-3-phosphate acyltransferase.

Sequence Alignment and Molecular Modeling

Homology Model for Catalytic Region of GPAT_hlog1, GPAT_hlog3, Mitochondrial GPAT and Structure-Based Drug Design

[0380] Homology models are useful when there is no experimental information available on the protein of interest. A three dimensional model can be constructed on the basis of the known structure of a homologous protein (Greer et. al., 1991, Lesk, et. al., 1992, Cardozo, et. al., 1995, Sali, et. al., 1995).

[0381] Those of skill in the art will understand that a homology model is constructed on the basis of first identifying a template, or, protein of known structure which is similar to the protein without known structure. This can be accomplished by through pairwise alignment of sequences using such programs as FASTA (Pearson, et. al. 1990) and BLAST (Altschul, et. al., 1990). In cases where sequence similarity is high (greater than 30%) these pairwise comparison methods may be adequate. Likewise, multiple sequence alignments or profile-based methods can be used to align a query sequence to an alignment of multiple (structurally and biochemically) related proteins. When the sequence similarity is low, more advanced techniques are used such as fold recognition (protein threading; Hendlich, et. al., 1990), where the compatibility of a particular sequence with the three dimensional fold of a potential template protein is gauged on the basis of a knowledge-based potential. Following the initial sequence alignment, the query template can be optimally aligned by manual manipulation or by incorporation of other features (motifs, secondary structure predictions, and allowed sequence conservation). Next, structurally conserved regions can be identified and are used to construct the core secondary structure (Sali, et. al., 1995) elements in the three dimensional model. Variable regions, called “unconserved regions” and loops can be added using knowledge-based techniques. The complete model with variable regions and loops can be refined performing forcefield calculations (Sali, et. al., 1995, Cardozo, et. al., 1995).

GPAT_hlog1

[0382] For GPAT_hlog1, a hand generated multiple sequence alignment, coupled with fold recognition methods (protein threading), were used to generate the sequence alignment for a portion (residues L43 to R422 of SEQ ID NO: 4) of the GPAT_hlog1 polypeptide aligned with the sequence of glycerol-3-phosphate acyltransferase from squash chloroplast (Protein Data Bank code 1K30) (SEQ ID NO: 204).

[0383] The alignment of GPAT_Hlog1 with PDB entry 1K30 is set forth in FIG. 17. In this invention, the homology model of GPA_hlog1 was derived from the sequence alignment set forth in FIG. 17. An overall atomic model including plausible sidechain orientations was generated using the program LOOK (Levitt, 1992). The three dimensional model for GPAT_hlog1 is defined by the set of structure coordinates as set forth in Table IV and is shown in FIGS. 18 and 19 rendered by backbone secondary structures.

[0384] In order to recognize errors in a three-dimensional structures knowledge based mean fields can be used to judge the quality of protein folds (Sippl 1993). The methods can be used to recognize misfolded structures as well as faulty parts of structural models. The technique generates an energy graph where the energy distribution for a given protein fold is displayed on the y-axis and residue position in the protein fold is displayed on the x-axis. The knowledge based mean fields compose a force field derived from a set of globular protein structures taken as a subset from the Protein Data Bank (Bernstein et. al. 1977). To analyze the quality of a model the energy distribution is plotted and compared to the energy distribution of the template from which the model was generated. FIG. 20 shows the energy graph for the GPAT_hlog1 model (dotted line) and the template (glycerol-3-phosphate acyltransferase from squash chloroplast) from which the model was generated. It is clear that the model has slightly higher energies but the model shows similar characteristics that suggest the overall three-dimensional fold is “native-like”. This graph supports the motif and sequence alignments in confirming that the three dimensional structure coordinates of GPAT_hlog1 are an accurate and useful representation for the polypeptide.

[0385] The term “structure coordinates” refers to Cartesian coordinates generated from the building of a homology model.

[0386] Those of skill in the art will understand that a set of structure coordinates for a protein is a relative set of points that define a shape in three dimensions. Thus, it is possible that an entirely different set of coordinates could define a similar or identical shape. Moreover, slight variations in the individual coordinates, as emanate from generation of similar homology models using different alignment templates (i.e., other than the structure coordinates of 1K30), and/or using different methods in generating the homology model, will have minor effects on the overall shape. Variations in coordinates may also be generated because of mathematical manipulations of the structure coordinates. For example, the structure coordinates set forth in Table IV could be manipulated by fractionalization of the structure coordinates; integer additions or subtractions to sets of the structure coordinates, inversion of the structure coordinates or any combination of the above.

[0387] Various computational analyses are therefore necessary to determine whether a molecule or a portion thereof is sufficiently similar to all or parts of GPAT_hlog1 described above as to be considered the same. Such analyses may be carried out in current software applications, such as INSIGHTII (Accelrys Inc., San Diego, Calif.) version 2000 as described in the User's Guide, online (www.acceirys.com) or software applications available in the SYBYL software suite (Tripos Inc., St. Louis, Mo.).

[0388] Using the superimposition tool in the program INSIGHTII comparisons can be made between different structures and different conformations of the same structure. The procedure used in INSIGHTII to compare structures is divided into four steps: 1) load the structures to be compared; 2) define the atom equivalencies in these structures; 3) perform a fitting operation; and 4) analyze the results. Each structure is identified by a name. One structure is identified as the target (i.e., the fixed structure); the second structure (i.e., moving structure) is identified as the source structure. Since atom equivalency within INSIGHTII is defined by user input, for the purpose of this invention we will define equivalent atoms as protein backbone atoms (N, Cα, C and O) for all conserved residues between the two structures being compared. We will also consider only rigid fitting operations. When a rigid fitting method is used, the working structure is translated and rotated to obtain an optimum fit with the target structure. The fitting operation uses an algorithm that computes the optimum translation and rotation to be applied to the moving structure, such that the root mean square difference of the fit over the specified pairs of equivalent atom is an absolute minimum. This number, given in angstroms, is reported by INSIGHTII. For the purpose of this invention, any homology model of a GPAT_hlog1 that has a root mean square deviation of conserved residue backbone atoms (N, Cα, C, O) of less than 3.0 A when superimposed on the relevant backbone atoms described by structure coordinates listed in Table IV are considered identical. More preferably, the root mean square deviation is less than 2.0, 1.5, 1.0, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, and/or 0.1 Å.

[0389] The term “root mean square deviation” means the square root of the arithmetic mean of the squares of the deviations from the mean. It is a way to express the deviation or variation from a trend or object. For purposes of this invention, the “root mean square deviation” defines the variation in the backbone of a protein from the relevant portion of the backbone of GPAT_hlog1 as defined by the structure coordinates described herein.

[0390] This invention as embodied by the three-dimensional model enables the structure-based design of modulators of the biological function of GPAT_hlog1, as well as mutants with altered biological function and/or specificity.

[0391] The manual sequence alignment used as a template for creating the three-dimensional model of GPAT_hlog1 has 12% sequence identity between catalytic domain of GPAT_hlog1 and the squash glycerol-3-phosphate acyltransferase, PDB code 1K30. For squash glycerol-3-phosphate acyltransferase, the functionally important residues are located in a cavity where several positively charged residues and the catalytic histidine, H139 and aspartate, D144 form a cluster at one end of the cleft. H139 and D144 correspond to the H(X)4D motif that has been identified as being important in the binding of glycerol-3-phosphate and catalysis of glycerolipid acyltransferases. These residues are highlighted in the sequence alignment in FIG. 17. The three-dimensional model of GPAT_hlog1 (FIGS. 17 and 19) shows that the catalytic histidine and aspartate are located in exactly the same position as the squash glycerol-3-phosphate acyltransferase. The conservation of the amino acids that are required for catalysis and substrate binding emphasize the significance of the active site three-dimensional model. The conserved residues are located in the active/functional site formed from the surface to a deep cleft which is at the core of domain II. These active site residues play critical roles in the mechanism of catalysis, substrate specificity and binding.

[0392] The structure coordinates of a GPAT_hlog1 homology model portion thereof are stored in a machine-readable storage medium. Such data may be used for a variety of purposes, such as drug discovery and target prioritization and validation.

[0393] Accordingly, in one embodiment of this invention is provided a machine-readable data storage medium comprising a data storage material encoded with the structure coordinates set forth in Table IV.

[0394] For the first time, the present invention permits the use, through homology modeling based upon the sequence of GPAT_hlog1 (FIGS. 17 and 18) of structure-based or rational drug design techniques to design, select, and synthesizes chemical entities that are capable of modulating the biological function of GPAT_hlog1. Comparison of the GPAT_hlog1 homology model with the structures of other glycerol-3-phosphate acyltransferases enable the use of rational or structure based drug design methods to design, select or synthesize specific chemical modulators of GPAT_hlog1.

[0395] Accordingly, the present invention is also directed to the entire sequence in FIG. 2A-B (SEQ ID NO: 4) or any portion thereof for the purpose of generating a homology model for the purpose of three dimensional structure-based drug designs.

[0396] The three-dimensional model structure of the GPAT_hlog1 will also provide methods for identifying modulators of biological function. Various methods or combination thereof can be used to identify these compounds.

[0397] Structure coordinates of the active site region defined above can also be used to identify structural and chemical features. Identified structural or chemical features can then be employed to design or select compounds as potential GPAT_hlog1 modulators. By structural and chemical features it is meant to include, but is not limited to, van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic interactions, and dipole interaction. Alternatively, or in conjunction, the three-dimensional structural model can be employed to design or select compounds as potential GPAT_hlog1 modulators. Compounds identified as potential GPAT_hlog1 modulators can then be synthesized and screened in an assay characterized by binding of a test compound to the GPAT_hlog1, or in characterizing GPAT_hlog1 deactivation in the presence of a small molecule. Examples of assays useful in screening of potential GPAT_hlog1 modulators include, but are not limited to, screening in silico, in vitro assays and high throughput assays. Finally, these methods may also involve modifying or replacing one or more amino acids from GPAT_hlog1 according to Table IV.

[0398] However, as will be understood by those of skill in the art upon this disclosure, other structure based design methods can be used. Various computational structure based design methods have been disclosed in the art.

[0399] For example, a number of computer modeling systems are available in which the sequence of the GPAT_hlog1 and the GPAT_hlog1 structure (i.e., atomic coordinates of GPAT_hlog1 and/or the atomic coordinates of the active site region as provided in Table IV) can be input. The computer system then generates the structural details of one or more these regions in which a potential GPAT_hlog1 modulator binds so that complementary structural details of the potential modulators can be determined. Design in these modeling systems is generally based upon the compound being capable of physically and structurally associating with GPAT_hlog1. In addition, the compound must be able to assume a conformation that allows it to associate with GPAT_hlog1. Some modeling systems estimate the potential inhibitory or binding effect of a potential GPAT_hlog1 modulator prior to actual synthesis and testing.

[0400] Methods for screening chemical entities or fragments for their ability to associate with a given protein target are well known. Often these methods begin by visual inspection of the binding site on the computer screen. Selected fragments or chemical entities are then positioned in one or more positions and orientations within the active site region in GPAT_hlog1. Molecular docking is accomplished using software such as INSIGHTII, ICM (Molsoft LLC, La Jolla, Calif.), and SYBYL, following by energy minimization and molecular dynamics with standard molecular mechanic forcefields such as: CHARMM and MMFF. Examples of computer programs which assist in the selection of chemical fragment or chemical entities useful in the present invention include, but are not limited to, GRID (Goodford, 1985), AUTODOCK (Goodsell, 1990), and DOCK (Kuntz et. al. 1982).

[0401] Alternatively, compounds may be designed de novo using either an empty active site or optionally including some portion of a known inhibitor. Methods of this type of design include, but are not limited to LUDI (Bohm 1992), LeapFrog (Tripos Associates, St. Louis Mo.) and DOCK (Kuntz et. al., 1982). Programs such as DOCK (Kuntz et. al. 1982) can be used with the atomic coordinates from the homology model to identify potential ligands from databases or virtual databases which potentially bind the in the active site region, and which may therefore be suitable candidates for synthesis and testing. The computer programs may utilize a combination of the following steps:

[0402] 1) Selection of fragments or chemical entities from a database and then positioning the chemical entity in one or more orientations within the GPAT_hlog1 active site defined by residues H178, F181, D183, Q215, K243, E297, R299 of SEQ ID NO: 4.

[0403] 2) Characterization of the structural and chemical features of the chemical entity and active site including van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic bonding interaction, and dipole interactions.

[0404] 3) Search databases for molecular fragments which can be joined to or replace the docked chemical entity and spatially fit into regions defined by the said GPAT_hlog1 active site

[0405] 4) Evaluate the docked chemical entity and fragments using a combination of scoring schemes which account for van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic interactions

[0406] Databases that may be used include ACD (Molecular Designs Limited), Aldrich (Aldrich Chemical Company), NCI (National Cancer Institute), Maybridge(Maybridge Chemical Company Ltd), CCDC (Cambridge Crystallographic Data Center), CAST (Chemical Abstract Service), Derwent (Derwent Information Limited).

[0407] Upon selection of preferred chemical entities or fragments, their relationship to each other and GPAT_hlog1 can be visualized and then assembled into a single potential modulator. Programs useful in assembling the individual chemical entities include, but are not limited to SYBYL and LeapFrog (Tripos Associates, St. Louis Mo.), LUDI (Bohm 1992) as well as 3D Database systems (Martin 1992).

[0408] Additionally, the three-dimensional homology model of GPAT_hlog1 will aid in the design of mutants with altered biological activity. Site directed mutagenesis can be used to generate proteins with similar or varying degrees of biological activity compared to native GPAT_hlog1. This invention also relates to the generation of mutants or homologues of GPAT_hlog1. It is clear that molecular modeling using the three dimensional structure coordinates set forth in Table IV and visualization of the GPAT_hlog1 model, FIGS. 18 and 19 can be utilized to design homologues or mutant polypeptides of GPAT_hlog1 that have similar or altered biological activities, function or reactivities.

GPAT_hlog3

[0409] For GPAT_hlog3 a hand generated multiple sequence alignment coupled with and fold recognition methods (protein threading) were used to generate the sequence alignment for a portion (P27 to S427 of SEQ ID NO: 8) of GPAT_hlog3 aligned with the sequence of glycerol-3-phosphate acyltransferase from squash chloroplast (Protein Data Bank code 1K30) (SEQ ID NO: 204). The three-dimensional structure of the GPAT_hlog3 polypeptide also represents an accurate representation of the three-dimensional structure of the GPAT_hlog3_v1 variant as the portion of the GPAT_hlog3 polypeptide represented in the model is also shared by the GPAT_hlog3_v1 variant. Aside from a few amino acid changes, only the amino acid positions are different.

[0410] The alignment of GPAT_Hlog3 with PDB entry 1K30 is set forth in FIG. 21. In this invention, the homology model of GPA_hlog1 was derived from the sequence alignment set forth in FIG. 21. An overall atomic model including plausible sidechain orientations was generated using the program LOOK (Levitt, 1992). The three dimensional model for GPAT_hlog5 is defined by the set of structure coordinates as set forth in Table V and is shown in FIGS. 22 and 23 rendered by backbone secondary structures.

[0411] In order to recognize errors in a three-dimensional structures knowledge based mean fields can be used to judge the quality of protein folds (Sippl 1993). The methods can be used to recognize misfolded structures as well as faulty parts of structural models. The technique generates an energy graph where the energy distribution for a given protein fold is displayed on the y-axis and residue position in the protein fold is displayed on the x-axis. The knowledge based mean fields compose a force field derived from a set of globular protein structures taken as a subset from the Protein Data Bank (Bernstein et. al. 1977). To analyze the quality of a model the energy distribution is plotted and compared to the energy distribution of the template from which the model was generated. FIG. 20 shows the energy graph for the GPAT_hlog3 model (dotted line) and the template (glycerol-3-phosphate acyltransferase from squash chloroplast) from which the model was generated. It is clear that the model has slightly higher energies but the model shows similar characteristics that suggest the overall three-dimensional fold is “native-like”. This graph supports the motif and sequence alignments in confirming that the three dimensional structure coordinates of GPAT_hlog3 are an accurate and useful representation for the polypeptide.

[0412] The term “structure coordinates” refers to Cartesian coordinates generated from the building of a homology model.

[0413] Those of skill in the art will understand that a set of structure coordinates for a protein is a relative set of points that define a shape in three dimensions. Thus, it is possible that an entirely different set of coordinates could define a similar or identical shape. Moreover, slight variations in the individual coordinates, as emanate from generation of similar homology models using different alignment templates (i.e., other than the structure coordinates of 1K30), and/or using different methods in generating the homology model, will have minor effects on the overall shape. Variations in coordinates may also be generated because of mathematical manipulations of the structure coordinates. For example, the structure coordinates set forth in Table IV could be manipulated by fractionalization of the structure coordinates; integer additions or subtractions to sets of the structure coordinates, inversion of the structure coordinates or any combination of the above.

[0414] Various computational analyses are therefore necessary to determine whether a molecule or a portion thereof is sufficiently similar to all or parts of GPAT_hlog3 described above as to be considered the same. Such analyses may be carried out in current software applications, such as INSIGHTII (Accelrys Inc., San Diego, Calif.) version 2000 as described in the User's Guide, online (www.accelrys.com) or software applications available in the SYBYL software suite (Tripos Inc., St. Louis, Mo.).

[0415] Using the superimposition tool in the program INSIGHTII comparisons can be made between different structures and different conformations of the same structure. The procedure used in INSIGHTII to compare structures is divided into four steps: 1) load the structures to be compared; 2) define the atom equivalencies in these structures; 3) perform a fitting operation; and 4) analyze the results. Each structure is identified by a name. One structure is identified as the target (i.e., the fixed structure); the second structure (i.e., moving structure) is identified as the source structure. Since atom equivalency within INSIGHTII is defined by user input, for the purpose of this invention we will define equivalent atoms as protein backbone atoms (N, Cα, C and O) for all conserved residues between the two structures being compared. We will also consider only rigid fitting operations. When a rigid fitting method is used, the working structure is translated and rotated to obtain an optimum fit with the target structure. The fitting operation uses an algorithm that computes the optimum translation and rotation to be applied to the moving structure, such that the root mean square difference of the fit over the specified pairs of equivalent atom is an absolute minimum. This number, given in angstroms, is reported by INSIGHTII. For the purpose of this invention, any homology model of a GPAT_hlog3 that has a root mean square deviation of conserved residue backbone atoms (N, Cα, C, O) of less than 3.0 A when superimposed on the relevant backbone atoms described by structure coordinates listed in Table IV are considered identical. More preferably, the root mean square deviation is less than 2.0, 1.5, 1.0, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, and/or 0.1 Å.

[0416] The term “root mean square deviation” means the square root of the arithmetic mean of the squares of the deviations from the mean. It is a way to express the deviation or variation from a trend or object. For purposes of this invention, the “root mean square deviation” defines the variation in the backbone of a protein from the relevant portion of the backbone of GPAT_hlog3 as defined by the structure coordinates described herein.

[0417] This invention as embodied by the three-dimensional model enables the structure-based design of modulators of the biological function of GPAT_hlog3, as well as mutants with altered biological function and/or specificity.

[0418] The manual sequence alignment used as a template for creating the three-dimensional model of GPAT_hlog3 has 11% sequence identity between catalytic domain of GPAT_hlog3 and the squash glycerol-3-phosphate acyltransferase, PDB code 1K30. For squash glycerol-3-phosphate acyltransferase, the functionally important residues are located in a cavity where several positively charged residues and the catalytic histidine, H139 and aspartate, D144 form a cluster at one end of the cleft. H139 and D144 correspond to the H(X)4D motif that has been identified as being important in the binding of glycerol-3-phosphate and catalysis of glycerolipid acyltransferases. These residues are highlighted in the sequence alignment in FIG. 21. The three-dimensional model of GPAT_hlog3 (FIGS. 22 and 23) shows that the catalytic histidine (H146) and aspartate (D151) are located in exactly the same position as the squash glycerol-3-phosphate acyltransferase. The conservation of the amino acids that are required for catalysis and substrate binding emphasize the significance of the active site three-dimensional model. The conserved residues are located in the active/functional site formed from the surface to a deep cleft which is at the core of domain II. These active site residues play critical roles in the mechanism of catalysis, substrate specificity and binding.

[0419] The structure coordinates of a GPAT_hlog3 homology model portion thereof are stored in a machine-readable storage medium. Such data may be used for a variety of purposes, such as drug discovery and target prioritization and validation.

[0420] Accordingly, in one embodiment of this invention is provided a machine-readable data storage medium comprising a data storage material encoded with the structure coordinates set forth in Table V.

[0421] For the first time, the present invention permits the use, through homology modeling based upon the sequence of GPAT_hlog3 (FIGS. 22 and 23) of structure-based or rational drug design techniques to design, select, and synthesizes chemical entities that are capable of modulating the biological function of GPAT_hlog3. Comparison of the GPAT_hlog3 homology model with the structures of other glycerol-3-phosphate acyltransferases enable the use of rational or structure based drug design methods to design, select or synthesize specific chemical modulators of GPAT_hlog3.

[0422] Accordingly, the present invention is also directed to the entire sequence in FIG. 4A-B (SEQ ID NO: 8) or any portion thereof for the purpose of generating a homology model for the purpose of three dimensional structure-based drug designs.

[0423] The three-dimensional model structure of the GPAT_hlog3 will also provide methods for identifying modulators of biological function. Various methods or combination thereof can be used to identify these compounds.

[0424] Structure coordinates of the active site region defined above can also be used to identify structural and chemical features. Identified structural or chemical features can then be employed to design or select compounds as potential GPAT_hlog3 modulators. By structural and chemical features it is meant to include, but is not limited to, van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic interactions, and dipole interaction. Alternatively, or in conjunction, the three-dimensional structural model can be employed to design or select compounds as potential GPAT_hlog3 modulators. Compounds identified as potential GPAT_hlog3 modulators can then be synthesized and screened in an assay characterized by binding of a test compound to the GPAT_hlog3, or in characterizing GPAT_hlog3 deactivation in the presence of a small molecule. Examples of assays useful in screening of potential GPAT_hlog3 modulators include, but are not limited to, screening in silico, in vitro assays and high throughput assays. Finally, these methods may also involve modifying or replacing one or more amino acids from GPAT_hlog3 according to Table V.

[0425] However, as will be understood by those of skill in the art upon this disclosure, other structure based design methods can be used. Various computational structure based design methods have been disclosed in the art.

[0426] For example, a number of computer modeling systems are available in which the sequence of the GPAT_hlog3 and the GPAT_hlog3 structure (i.e., atomic coordinates of GPAT_hlog3 and/or the atomic coordinates of the active site region as provided in Table V) can be input. The computer system then generates the structural details of one or more these regions in which a potential GPAT_hlog3 modulator binds so that complementary structural details of the potential modulators can be determined. Design in these modeling systems is generally based upon the compound being capable of physically and structurally associating with GPAT_hlog3. In addition, the compound must be able to assume a conformation that allows it to associate with GPAT_hlog3. Some modeling systems estimate the potential inhibitory or binding effect of a potential GPAT_hlog3 modulator prior to actual synthesis and testing.

[0427] Methods for screening chemical entities or fragments for their ability to associate with a given protein target are well known. Often these methods begin by visual inspection of the binding site on the computer screen. Selected fragments or chemical entities are then positioned in one or more positions and orientations within the active site region in GPAT_hlog3. Molecular docking is accomplished using software such as INSIGHTII, ICM (Molsoft LLC, La Jolla, Calif.), and SYBYL, following by energy minimization and molecular dynamics with standard molecular mechanic forcefields such as CHARMM and MMFF. Examples of computer programs which assist in the selection of chemical fragment or chemical entities useful in the present invention include, but are not limited to, GRID (Goodford, 1985), AUTODOCK (Goodsell, 1990), and DOCK (Kuntz et. al. 1982).

[0428] Alternatively, compounds may be designed de novo using either an empty active site or optionally including some portion of a known inhibitor. Methods of this type of design include, but are not limited to LUDI (Bohm 1992), LeapFrog (Tripos Associates, St. Louis Mo.) and DOCK (Kuntz et. al., 1982). Programs such as DOCK (Kuntz et. al. 1982) can be used with the atomic coordinates from the homology model to identify potential ligands from databases or virtual databases which potentially bind the in the active site region, and which may therefore be suitable candidates for synthesis and testing.

[0429] The computer programs may utilize a combination of the following steps:

[0430] 1) Selection of fragments or chemical entities from a database and then positioning the chemical entity in one or more orientations within the GPAT hlog3 active site defined by residues H146, D151, R189, K253, E284, F285 of SEQ ID NO: 8.

[0431] 2) Characterization of the structural and chemical features of the chemical entity and active site including van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic bonding interaction, and dipole interactions

[0432] 3) Search databases for molecular fragments which can be joined to or replace the docked chemical entity and spatially fit into regions defined by the said GPAT_hlog3 active site

[0433] 4) Evaluate the docked chemical entity and fragments using a combination of scoring schemes which account for van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic interactions

[0434] Databases that may be used include ACD (Molecular Designs Limited), Aldrich (Aldrich Chemical Company), NCI (National Cancer Institute), Maybridge(Maybridge Chemical Company Ltd), CCDC (Cambridge Crystallographic Data Center), CAST (Chemical Abstract Service), Derwent (Derwent Information Limited).

[0435] Upon selection of preferred chemical entities or fragments, their relationship to each other and GPAT_hlog3 can be visualized and then assembled into a single potential modulator. Programs useful in assembling the individual chemical entities include, but are not limited to SYBYL and LeapFrog (Tripos Associates, St. Louis Mo.), LUDI (Bohm 1992) as well as 3D Database systems (Martin 1992).

[0436] Additionally, the three-dimensional homology model of GPAT hlog3 will aid in the design of mutants with altered biological activity. Site directed mutagenesis can be used to generate proteins with similar or varying degrees of biological activity compared to native GPAT_hlog3. This invention also relates to the generation of mutants or homologues of GPAT_hlog3. It is clear that molecular modeling using the three dimensional structure coordinates set forth in Table V and visualization of the GPAT_hlog3 model, FIGS. 21 and 22 can be utilized to design homologues or mutant polypeptides of GPAT_hlog3 that have similar or altered biological activities, function or reactivities.

Mitochondrial GPAT

[0437] For mitochondrial GPAT a hand generated multiple sequence alignment coupled with and fold recognition methods (protein threading) were used to generate the sequence alignment for a portion (residues L43 to R422 of SEQ ID NO: 2) of mitochondrial GPAT aligned with the sequence of glycerol-3-phosphate acyltransferase from squash chloroplast (Protein Data Bank code 1K30) (SEQ ID NO: 204).

[0438] The alignment of mitochondrial GPAT with PDB entry 1K30 is set forth in FIG. 25. In this invention, the homology model of mitochondrial GPAT was derived from the sequence alignment set forth in FIG. 25. An overall atomic model including plausible sidechain orientations was generated using the program LOOK (Levitt, 1992). The three dimensional model for mitochondrial GPAT is defined by the set of structure coordinates as set forth in Table VI and is shown in FIGS. 26 and 27 rendered by backbone secondary structures.

[0439] In order to recognize errors in a three-dimensional structures knowledge based mean fields can be used to judge the quality of protein folds (Sippl 1993). The methods can be used to recognize misfolded structures as well as faulty parts of structural models. The technique generates an energy graph where the energy distribution for a given protein fold is displayed on the y-axis and residue position in the protein fold is displayed on the x-axis. The knowledge based mean fields compose a force field derived from a set of globular protein structures taken as a subset from the Protein Data Bank (Bernstein et. al. 1977). To analyze the quality of a model the energy distribution is plotted and compared to the energy distribution of the template from which the model was generated. FIG. 28 shows the energy graph for the mitochondrial GPAT model (dotted line) and the template (glycerol-3-phosphate acyltransferase from squash chloroplast) from which the model was generated. It is clear that the model has slightly higher energies but the model shows similar characteristics that suggest the overall three-dimensional fold is “native-like”. This graph supports the motif and sequence alignments in confirming that the three dimensional structure coordinates of mitochondrial GPAT are an accurate and useful representation for the polypeptide.

[0440] The term “structure coordinates” refers to Cartesian coordinates generated from the building of a homology model.

[0441] Those of skill in the art will understand that a set of structure coordinates for a protein is a relative set of points that define a shape in three dimensions. Thus, it is possible that an entirely different set of coordinates could define a similar or identical shape. Moreover, slight variations in the individual coordinates, as emanate from generation of similar homology models using different alignment templates (i.e., other than the structure coordinates of 1K30), and/or using different methods in generating the homology model, will have minor effects on the overall shape. Variations in coordinates may also be generated because of mathematical manipulations of the structure coordinates. For example, the structure coordinates set forth in Table VI could be manipulated by fractionalization of the structure coordinates; integer additions or subtractions to sets of the structure coordinates, inversion of the structure coordinates or any combination of the above.

[0442] Various computational analyses are therefore necessary to determine whether a molecule or a portion thereof is sufficiently similar to all or parts of mitochondrial GPAT described above as to be considered the same. Such analyses may be carried out in current software applications, such as INSIGHTII (Accelrys Inc., San Diego, Calif.) version 2000 as described in the User's Guide, online (www.acceirys.com) or software applications available in the SYBYL software suite (Tripos Inc., St. Louis, Mo.).

[0443] Using the superimposition tool in the program INSIGHTII comparisons can be made between different structures and different conformations of the same structure. The procedure used in INSIGHTII to compare structures is divided into four steps: 1) load the structures to be compared; 2) define the atom equivalencies in these structures; 3) perform a fitting operation; and 4) analyze the results. Each structure is identified by a name. One structure is identified as the target (i.e., the fixed structure); the second structure (i.e., moving structure) is identified as the source structure. Since atom equivalency within INSIGHTII is defined by user input, for the purpose of this invention we will define equivalent atoms as protein backbone atoms (N, Cα, C and O) for all conserved residues between the two structures being compared. We will also consider only rigid fitting operations. When a rigid fitting method is used, the working structure is translated and rotated to obtain an optimum fit with the target structure. The fitting operation uses an algorithm that computes the optimum translation and rotation to be applied to the moving structure, such that the root mean square difference of the fit over the specified pairs of equivalent atom is an absolute minimum. This number, given in angstroms, is reported by INSIGHTII. For the purpose of this invention, any homology model of a mitochondrial GPAT that has a root mean square deviation of conserved residue backbone atoms (N, Cα, C, O) of less than 3.0 A when superimposed on the relevant backbone atoms described by structure coordinates listed in Table VI are considered identical. More preferably, the root mean square deviation is less than 2.0, 1.5, 1.0, 0.9, 0.8, 0.7, 0.6, 0.5, 0.4, 0.3, 0.2, and/or 0.1 Å.

[0444] The term “root mean square deviation” means the square root of the arithmetic mean of the squares of the deviations from the mean. It is a way to express the deviation or variation from a trend or object. For purposes of this invention, the “root mean square deviation” defines the variation in the backbone of a protein from the relevant portion of the backbone of mitochondrial GPAT as defined by the structure coordinates described herein.

[0445] This invention as embodied by the three-dimensional model enables the structure-based design of modulators of the biological function of mitochondrial GPAT, as well as mutants with altered biological function and/or specificity.

[0446] The manual sequence alignment used as a template for creating the three-dimensional model of mitochondrial GPAT has 11% sequence identity between catalytic domain of mitochondrial GPAT and the squash glycerol-3-phosphate acyltransferase, PDB code 1K30. For squash glycerol-3-phosphate acyltransferase, the functionally important residues are located in a cavity where several positively charged residues and the catalytic histidine, H139 and aspartate, D144 form a cluster at one end of the cleft. H139 and D144 correspond to the H(X)4D motif that has been identified as being important in the binding of glycerol-3-phosphate and catalysis of glycerolipid acyltransferases. These residues are highlighted in the sequence alignment in FIG. 25. The three-dimensional model of Mitochondrial GPAT (FIGS. 26 and 27) shows that the catalytic histidine (H227) and aspartate (D232) are located in exactly the same position as the squash glycerol-3-phosphate acyltransferase. The conservation of the amino acids that are required for catalysis and substrate binding emphasize the significance of the active site three-dimensional model. The conserved residues are located in the active/functional site formed from the surface to a deep cleft which is at the core of domain II. These active site residues play critical roles in the mechanism of catalysis, substrate specificity and binding.

[0447] The structure coordinates of a mitochondrial GPAT homology model portion thereof are stored in a machine-readable storage medium. Such data may be used for a variety of purposes, such as drug discovery and target prioritization and validation.

[0448] Accordingly, in one embodiment of this invention is provided a machine-readable data storage medium comprising a data storage material encoded with the structure coordinates set forth in Table VI.

[0449] For the first time, the present invention permits the use, through homology modeling based upon the sequence of mitochondrial GPAT (FIGS. 26 and 27) of structure-based or rational drug design techniques to design, select, and synthesizes chemical entities that are capable of modulating the biological function of mitochondrial GPAT. Comparison of the mitochondrial GPAT homology model with the structures of other glycerol-3-phosphate acyltransferases enable the use of rational or structure based drug design methods to design, select or synthesize specific chemical modulators of mitochondrial GPAT.

[0450] Accordingly, the present invention is also directed to the entire sequence in FIG. 1A-C (SEQ ID NO: 2) or any portion thereof for the purpose of generating a homology model for the purpose of three dimensional structure-based drug designs.

[0451] The three-dimensional model structure of the mitochondrial GPAT will also provide methods for identifying modulators of biological function. Various methods or combination thereof can be used to identify these compounds.

[0452] Structure coordinates of the active site region defined above can also be used to identify structural and chemical features. Identified structural or chemical features can then be employed to design or select compounds as potential mitochondrial GPAT modulators. By structural and chemical features it is meant to include, but is not limited to, van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic interactions, and dipole interaction. Alternatively, or in conjunction, the three-dimensional structural model can be employed to design or select compounds as potential mitochondrial GPAT modulators. Compounds identified as potential mitochondrial GPAT modulators can then be synthesized and screened in an assay characterized by binding of a test compound to the mitochondrial GPAT, or in characterizing mitochondrial GPAT deactivation in the presence of a small molecule. Examples of assays useful in screening of potential mitochondrial GPAT modulators include, but are not limited to, screening in silico, in vitro assays and high throughput assays. Finally, these methods may also involve modifying or replacing one or more amino acids from mitochondrial GPAT according to Table VI.

[0453] However, as will be understood by those of skill in the art upon this disclosure, other structure based design methods can be used. Various computational structure based design methods have been disclosed in the art.

[0454] For example, a number of computer modeling systems are available in which the sequence of the mitochondrial GPAT and the mitochondrial GPAT structure (i.e., atomic coordinates of mitochondrial GPAT and/or the atomic coordinates of the active site region as provided in Table VI) can be input. The computer system then generates the structural details of one or more these regions in which a potential mitochondrial GPAT modulator binds so that complementary structural details of the potential modulators can be determined. Design in these modeling systems is generally based upon the compound being capable of physically and structurally associating with mitochondrial GPAT. In addition, the compound must be able to assume a conformation that allows it to associate with mitochondrial GPAT. Some modeling systems estimate the potential inhibitory or binding effect of a potential mitochondrial GPAT modulator prior to actual synthesis and testing.

[0455] Methods for screening chemical entities or fragments for their ability to associate with a given protein target are well known. Often these methods begin by visual inspection of the binding site on the computer screen. Selected fragments or chemical entities are then positioned in one or more positions and orientations within the active site region in mitochondrial GPAT. Molecular docking is accomplished using software such as INSIGHTII, ICM (Molsoft LLC, La Jolla, Calif.), and SYBYL, following by energy minimization and molecular dynamics with standard molecular mechanic forcefields such as CHARMM and MMFF. Examples of computer programs which assist in the selection of chemical fragment or chemical entities useful in the present invention include, but are not limited to, GRID (Goodford, 1985), AUTODOCK (Goodsell, 1990), and DOCK (Kuntz et. al. 1982).

[0456] Alternatively, compounds may be designed de novo using either an empty active site or optionally including some portion of a known inhibitor. Methods of this type of design include, but are not limited to LUDI (Bohm 1992), LeapFrog (Tripos Associates, St. Louis Mo.) and DOCK (Kuntz et. al., 1982). Programs such as DOCK (Kuntz et. al. 1982) can be used with the atomic coordinates from the homology model to identify potential ligands from databases or virtual databases which potentially bind the in the active site region, and which may therefore be suitable candidates for synthesis and testing.

[0457] The computer programs may utilize a combination of the following steps:

[0458] 1) Selection of fragments or chemical entities from a database and then positioning the chemical entity in one or more orientations within the mitochondrial GPAT active site defined by residues H227, R228, S229, H230, D232, R276, R276, R354, K402 of SEQ ID NO: 2

[0459] 2) Characterization of the structural and chemical features of the chemical entity and active site including van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic bonding interaction, and dipole interactions

[0460] 3) Search databases for molecular fragments which can be joined to or replace the docked chemical entity and spatially fit into regions defined by the said mitochondrial GPAT active site

[0461] 4) Evaluate the docked chemical entity and fragments using a combination of scoring schemes which account for van der Waals interactions, hydrogen bonding interactions, charge interaction, hydrophobic interactions

[0462] Databases that may be used include ACD (Molecular Designs Limited), Aldrich (Aldrich Chemical Company), NCI (National Cancer Institute), Maybridge(Maybridge Chemical Company Ltd), CCDC (Cambridge Crystallographic Data Center), CAST (Chemical Abstract Service), Derwent (Derwent Information Limited).

[0463] Upon selection of preferred chemical entities or fragments, their relationship to each other and mitochondrial GPAT can be visualized and then assembled into a single potential modulator. Programs useful in assembling the individual chemical entities include, but are not limited to SYBYL and LeapFrog (Tripos Associates, St. Louis Mo.), LUDI (Bohm 1992) as well as 3D Database systems (Martin 1992).

[0464] Additionally, the three-dimensional homology model of mitochondrial GPAT will aid in the design of mutants with altered biological activity. Site directed mutagenesis can be used to generate proteins with similar or varying degrees of biological activity compared to native mitochondrial GPAT. This invention also relates to the generation of mutants or homologues of mitochondrial GPAT. It is clear that molecular modeling using the three dimensional structure coordinates set forth in Table VI and visualization of the mitochondrial GPAT model, FIGS. 26 and 27 can be utilized to design homologues or mutant polypeptides of mitochondrial GPAT that have similar or altered biological activities, function or reactivities.

TABLE I
		ATCC		NT	Total	5′ NT
		Deposit		SEQ	NT Seq	of Start	3′ NT	AA Seq	Total
Gene	CDNA	No. Z and		ID.	of	Codon	of	ID No.	AA of
No.	CloneID	Date	Vector	No. X	Clone	of ORF	ORF	Y	ORF
1.	Mitochondrial	N/A	pTOPO	1	2478	1	2478	2	826
	GPAT
2.	Microsomal	N/A	pTOPO	3	1632	1	1629	4	542
	GPAT_hlog1
	(clone3.2 D8)
3.	Microsomal	N/A	pTOPO	5	1612	1	1506	6	502
	GPAT_hlog2
4.	Microsomal	N/A	pTOPO	7	1912	108	1739	8	544
	GPAT_hlog3
5.	Microsomal	PTA-4803	pTOPO	202	1875	146	1696	203	517
	GPAT_hlog3—	Nov. 14, 2002
	v1

[0465] Table 1 summarizes the information corresponding to each “Gene No.” described above. The nucleotide sequence identified as “NT SEQ ID NO: 1, 3, 5, 7, and/or 202” was assembled from partially homologous (“overlapping”) sequences obtained from the “cDNA clone ID” identified in Table 1 and, in some cases, from additional related DNA clones. The overlapping sequences were assembled into a single contiguous sequence of high redundancy (usually several overlapping sequences at each nucleotide position), resulting in a final sequence identified as SEQ ID NO: 1, 3, 5, 7, and/or 202.

[0466] The cDNA Clone ID was deposited on the date and given the corresponding deposit number listed in “ATCC Deposit No:Z and Date.” “Vector” refers to the type of vector contained in the cDNA Clone ID.

[0467] “Total NT Seq. Of Clone” refers to the total number of nucleotides in the clone contig identified by “Gene No.” The deposited clone may contain all or most of the sequence of SEQ ID NO: 1, 3, 5, 7, and/or 202. The nucleotide position of SEQ ID NO: 1, 3, 5, 7, and/or 202 of the putative start codon (methionine) is identified as “5′ NT of Start Codon of ORF.”

[0468] The translated amino acid sequence, beginning with the methionine, is identified as “AA SEQ ID NO: 2, 4, 6, 8, and/or 203,” although other reading frames can also be easily translated using known molecular biology techniques. The polypeptides produced by these alternative open reading frames are specifically contemplated by the present invention.

[0469] The total number of amino acids within the open reading frame of SEQ ID NO: 2, 4, 6, 8, and/or 203 is identified as “Total AA of ORF”.

[0470] SEQ ID NO: 1, 3, 5, 7, and/or 202 (where X may be any of the polynucleotide sequences disclosed in the sequence listing) and the translated SEQ ID NO: 2, 4, 6, 8, and/or 203 (where Y may be any of the polypeptide sequences disclosed in the sequence listing) are sufficiently accurate and otherwise suitable for a variety of uses well known in the art and described further herein. For instance, SEQ ID NO: 1, 3, 5, 7, and/or 202 is useful for designing nucleic acid hybridization probes that will detect nucleic acid sequences contained in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA contained in the deposited clone. These probes will also hybridize to nucleic acid molecules in biological samples, thereby enabling a variety of forensic and diagnostic methods of the invention. Similarly, polypeptides identified from SEQ ID NO: 2, 4, 6, 8, and/or 203 may be used, for example, to generate antibodies which bind specifically to proteins containing the polypeptides and the proteins encoded by the cDNA clones identified in Table 1.

[0471] Nevertheless, DNA sequences generated by sequencing reactions can contain sequencing errors. The errors exist as misidentified nucleotides, or as insertions or deletions of nucleotides in the generated DNA sequence. The erroneously inserted or deleted nucleotides may cause frame shifts in the reading frames of the predicted amino acid sequence. In these cases, the predicted amino acid sequence diverges from the actual amino acid sequence, even though the generated DNA sequence may be greater than 99.9% identical to the actual DNA sequence (for example, one base insertion or deletion in an open reading frame of over 1000 bases).

[0472] Accordingly, for those applications requiring precision in the nucleotide sequence or the amino acid sequence, the present invention provides not only the generated nucleotide sequence identified as SEQ ID NO: 1, 3, 5, 7, and/or 202 and the predicted translated amino acid sequence identified as SEQ ID NO: 2, 4, 6, 8, and/or 203, but also a sample of plasmid DNA containing a cDNA of the invention deposited with the ATCC, as set forth in Table 1. The nucleotide sequence of each deposited clone can readily be determined by sequencing the deposited clone in accordance with known methods. The predicted amino acid sequence can then be verified from such deposits. Moreover, the amino acid sequence of the protein encoded by a particular clone can also be directly determined by peptide sequencing or by expressing the protein in a suitable host cell containing the deposited cDNA, collecting the protein, and determining its sequence.

[0473] The present invention also relates to the genes corresponding to SEQ ID NO: 1, 3, 5, 7, and/or 202, SEQ ID NO: 2, 4, 6, 8, and/or 203, or the deposited clone. The corresponding gene can be isolated in accordance with known methods using the sequence information disclosed herein. Such methods include preparing probes or primers from the disclosed sequence and identifying or amplifying the corresponding gene from appropriate sources of genomic material.

[0474] Also provided in the present invention are species homologs, allelic variants, and/or orthologs. The skilled artisan could, using procedures well-known in the art, obtain the polynucleotide sequence corresponding to full-length genes (including, but not limited to the full-length coding region), allelic variants, splice variants, orthologs, and/or species homologues of genes corresponding to SEQ ID NO: 1, 3, 5, 7, and/or 202, SEQ ID NO: 2, 4, 6, 8, and/or 203, or a deposited clone, relying on the sequence from the sequences disclosed herein or the clones deposited with the ATCC. For example, allelic variants and/or species homologues may be isolated and identified by making suitable probes or primers which correspond to the 5′, 3′, or internal regions of the sequences provided herein and screening a suitable nucleic acid source for allelic variants and/or the desired homologue.

[0475] The polypeptides of the invention can be prepared in any suitable manner. Such polypeptides include isolated naturally occurring polypeptides, recombinantly produced polypeptides, synthetically produced polypeptides, or polypeptides produced by a combination of these methods. Means for preparing such polypeptides are well understood in the art.

[0476] The polypeptides may be in the form of the protein, or may be a part of a larger protein, such as a fusion protein (see below). It is often advantageous to include an additional amino acid sequence which contains secretory or leader sequences, pro-sequences, sequences which aid in purification, such as multiple histidine residues, or an additional sequence for stability during recombinant production.

[0477] The polypeptides of the present invention are preferably provided in an isolated form, and preferably are substantially purified. A recombinantly produced version of a polypeptide, can be substantially purified using techniques described herein or otherwise known in the art, such as, for example, by the one-step method described in Smith and Johnson, Gene 67:31-40 (1988). Polypeptides of the invention also can be purified from natural, synthetic or recombinant sources using protocols described herein or otherwise known in the art, such as, for example, antibodies of the invention raised against the full-length form of the protein.

[0478] The present invention provides a polynucleotide comprising, or alternatively consisting of, the sequence identified as SEQ ID NO: 1, 3, 5, 7, and/or 202, and/or a cDNA provided in ATCC Deposit No:Z. The present invention also provides a polypeptide comprising, or alternatively consisting of, the sequence identified as SEQ ID NO: 2, 4, 6, 8, and/or 203, and/or a polypeptide encoded by the cDNA provided in ATCC Deposit NO:Z. The present invention also provides polynucleotides encoding a polypeptide comprising, or alternatively consisting of the polypeptide sequence of SEQ ID NO: 2, 4, 6, 8, and/or 203, and/or a polypeptide sequence encoded by the cDNA contained in ATCC Deposit No:Z.

[0479] Preferably, the present invention is directed to a polynucleotide comprising, or alternatively consisting of, the sequence identified as SEQ ID NO: 1, 3, 5, 7, and/or 202, and/or a cDNA provided in ATCC Deposit No:Z that is less than, or equal to, a polynucleotide sequence that is 5 mega basepairs, 1 mega basepairs, 0.5 mega basepairs, 0.1 mega basepairs, 50,000 basepairs, 20,000 basepairs, or 10,000 basepairs in length.

[0480] The present invention encompasses polynucleotides with sequences complementary to those of the polynucleotides of the present invention disclosed herein. Such sequences may be complementary to the sequence disclosed as SEQ ID NO: 1, 3, 5, 7, and/or 202, the sequence contained in a deposit, and/or the nucleic acid sequence encoding the sequence disclosed as SEQ ID NO: 2, 4, 6, 8, and/or 203.

[0481] The present invention also encompasses polynucleotides capable of hybridizing, preferably under reduced stringency conditions, more preferably under stringent conditions, and most preferably under highly stingent conditions, to polynucleotides described herein. Examples of stringency conditions are shown in Table 2 below: highly stringent conditions are those that are at least as stringent as, for example, conditions A-F; stringent conditions are at least as stringent as, for example, conditions G-L; and reduced stringency conditions are at least as stringent as, for example, conditions M-R.

TABLE 2
			Hyridi-
Strin-			zation	Wash
gency	Polynu-		Temper-	Tempera-
Condi-	cleotide	Hybrid Length	ature and	ture and
tion	Hybrid ±	(bp) ‡	Buffer †	Buffer †
A	DNA:DNA	> or equal	65° C.;	65° C.;
		to 50	1xSSC -or-
			42° C.;	0.3xSSC
			1xSSC, 50%
			formamide
B	DNA:DNA	<50	Tb*; 1xSSC	Tb*; 1xSSC
C	DNA:RNA	> or equal	67° C.;	67° C.;
		to 50	1xSSC -or-
			45° C.;	0.3xSSC
			1xSSC, 50%
			formamide
D	DNA:RNA	<50	Td*; 1xSSC	Td*; 1xSSC
E	RNA:RNA	> or equal	70° C.;	70° C.;
		to 50	1xSSC -or-
			50° C.;	0.3xSSC
			1xSSC, 50%
			formamide
F	RNA:RNA	<50	Tf*; 1xSSC	Tf*; 1xSSC
G	DNA:DNA	> or equal	65° C.;	65° C.;
		to 50	4xSSC -or-	1xSSC
			45° C.;
			4xSSC, 50%
			formamide
H	DNA:DNA	<50	Th*; 4xSSC	Th*; 4xSSC
I	DNA:RNA	> or equal	67° C.;	67° C.;
		to 50	4xSSC -or-	1xSSC
			45° C.;
			4xSSC, 50%
			formamide
J	DNA:RNA	<50	Tj*; 4xSSC	Tj*; 4xSSC
K	RNA:RNA	> or equal	70° C.;	67° C.;
		to 50	4xSSC -or-	1xSSC
			40° C.;
			6xSSC,
			50% formamide
L	RNA:RNA	<50	Tl*; 2xSSC	Tl*; 2xSSC
M	DNA:DNA	> or equal	50° C.;	50° C.;
		to 50	4xSSC -or-	2xSSC
			40° C.
			6xSSC,
			50% formamide
N	DNA:DNA	<50	Tn*; 6xSSC	Tn*; 6xSSC
0	DNA:RNA	> or equal	55° C.;	55° C.;
		to 50	4xSSC -or-	2xSSC
			42° C.;
			6xSSC,
			50% formamide
P	DNA:RNA	<50	Tp*; 6xSSC	Tp*; 6xSSC
Q	RNA:RNA	> or equal	60° C.;	60° C.;
		to 50	4xSSC -or-	2xSSC
			45° C.;
			6xSSC,
			50% formamide
R	RNA:RNA	<50	Tr*; 4xSSC	Tr*; 4xSSC

[0482] ‡—The “hybrid length” is the anticipated length for the hybridized region(s) of the hybridizing polynucleotides. When hybridizing a polynucletotide of unknown sequence, the hybrid is assumed to be that of the hybridizing polynucleotide of the present invention. When polynucleotides of known sequence are hybridized, the hybrid length can be determined by aligning the sequences of the polynucleotides and identifying the region or regions of optimal sequence complementarity. Methods of aligning two or more polynucleotide sequences and/or determining the percent identity between two polynucleotide sequences are well known in the art (e.g., MegAlign program of the DNA*Star suite of programs, etc).

[0483] †—SSPE (1×SSPE is 0.15M NaCl, 10 mM NaH2PO4, and 1.25 mM EDTA, pH 7.4) can be substituted for SSC (1×SSC is 0.15M NaCl anmd 15 mM sodium citrate) in the hybridization and wash buffers; washes are performed for 15 minutes after hybridization is complete. The hydridizations and washes may additionally include 5×Denhardt's reagent, 0.5-1.0% SDS, 100 ug/ml denatured, fragmented salmon sperm DNA, 0.5% sodium pyrophosphate, and up to 50% formamide.

[0484] *Tb—Tr: The hybridization temperature for hybrids anticipated to be less than 50 base pairs in length should be 5-10° C. less than the melting temperature Tm of the hybrids there Tm is determined according to the following equations. For hybrids less than 18 base pairs in length, Tm(° C.)=2(# of A+T bases)+4(# of G+C bases). For hybrids between 18 and 49 base pairs in length, Tm(° C.)=81.5+16.6(log10[Na+])+0.41(%G+C)−(600/N), where N is the number of bases in the hybrid, and [Na+] is the concentration of sodium ions in the hybridization buffer ([NA+] for 1×SSC=0.165 M).

[0485] ±—The present invention encompasses the substitution of any one, or more DNA or RNA hybrid partners with either a PNA, or a modified polynucleotide. Such modified polynucleotides are known in the art and are more particularly described elsewhere herein.

[0486] Additional examples of stringency conditions for polynucleotide hybridization are provided, for example, in Sambrook, J., E. F. Fritsch, and T.Maniatis, 1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., chapters 9 and 11, and Current Protocols in Molecular Biology, 1995, F. M., Ausubel et al., eds, John Wiley and Sons, Inc., sections 2.10 and 6.3-6.4, which are hereby incorporated by reference herein.

[0487] Preferably, such hybridizing polynucleotides have at least 70% sequence identity (more preferably, at least 80% identity; and most preferably at least 90% or 95% identity) with the polynucleotide of the present invention to which they hybridize, where sequence identity is determined by comparing the sequences of the hybridizing polynucleotides when aligned so as to maximize overlap and identity while minimizing sequence gaps. The determination of identity is well known in the art, and discussed more specifically elsewhere herein.

[0488] The invention encompasses the application of PCR methodology to the polynucleotide sequences of the present invention, the clone deposited with the ATCC, and/or the cDNA encoding the polypeptides of the present invention. PCR techniques for the amplification of nucleic acids are described in U.S. Pat. No. 4, 683, 195 and Saiki et al., Science, 239:487-491 (1988). PCR, for example, may include the following steps, of denaturation of template nucleic acid (if double-stranded), annealing of primer to target, and polymerization. The nucleic acid probed or used as a template in the amplification reaction may be genomic DNA, cDNA, RNA, or a PNA. PCR may be used to amplify specific sequences from genomic DNA, specific RNA sequence, and/or cDNA transcribed from mRNA. References for the general use of PCR techniques, including specific method parameters, include Mullis et al., Cold Spring Harbor Symp. Quant. Biol., 51:263, (1987), Ehrlich (ed), PCR Technology, Stockton Press, NY, 1989; Ehrlich et al., Science, 252:1643-1650, (1991); and “PCR Protocols, A Guide to Methods and Applications”, Eds., Innis et al., Academic Press, New York, (1990).

Polynucleotide and Polypeptide Variants

[0489] The present invention also encompases variants (e.g., allelic variants, orthologs, etc.) of the polynucleotide sequence disclosed herein in SEQ ID NO: 1, 3, 5, 7, and/or 202, the complementary strand thereto, and/or the cDNA sequence contained in the deposited clone.

[0490] The present invention also encompasses variants of the polypeptide sequence, and/or fragments therein, disclosed in SEQ ID NO: 2, 4, 6, 8, and/or 203, a polypeptide encoded by the polunucleotide sequence in SEQ ID NO: 1, 3, 5, 7, and/or 202, and/or a polypeptide encoded by a cDNA in the deposited clone.

[0491] “Variant” refers to a polynucleotide or polypeptide differing from the polynucleotide or polypeptide of the present invention, but retaining essential properties thereof. Generally, variants are overall closely similar, and, in many regions, identical to the polynucleotide or polypeptide of the present invention.

[0492] Thus, one aspect of the invention provides an isolated nucleic acid molecule comprising, or alternatively consisting of, a polynucleotide having a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a Mitochondrial GPAT related polypeptide having an amino acid sequence as shown in the sequence listing and described in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA contained in ATCC deposit No:Z; (b) a nucleotide sequence encoding a mature Mitochondrial GPAT related polypeptide having the amino acid sequence as shown in the sequence listing and described in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA contained in ATCC deposit No:Z; (c) a nucleotide sequence encoding a biologically active fragment of a Mitochondrial GPAT related polypeptide having an amino acid sequence shown in the sequence listing and described in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA contained in ATCC deposit No:Z; (d) a nucleotide sequence encoding an antigenic fragment of a Mitochondrial GPAT related polypeptide having an amino acid sequence shown in the sequence listing and described in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA contained in ATCC deposit No:Z; (e) a nucleotide sequence encoding a Mitochondrial GPAT related polypeptide comprising the complete amino acid sequence encoded by a human cDNA plasmid containined in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA contained in ATCC deposit No:Z; (f) a nucleotide sequence encoding a mature Mitochondrial GPAT realted polypeptide having an amino acid sequence encoded by a human cDNA plasmid contained in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA contained in ATCC deposit No:Z; (g) a nucleotide sequence encoding a biologically active fragement of a Mitochondrial GPAT related polypeptide having an amino acid sequence encoded by a human cDNA plasmid contained in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA contained in ATCC deposit No:Z; (h) a nucleotide sequence encoding an antigenic fragment of a Mitochondrial GPAT related polypeptide having an amino acid sequence encoded by a human cDNA plasmid contained in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the cDNA contained in ATCC deposit No:Z; (I) a nucleotide sequence complimentary to any of the nucleotide sequences in (a), (b), (c), (d), (e), (f), (g), or (h), above.

[0493] The present invention is also directed to polynucleotide sequences which comprise, or alternatively consist of, a polynucleotide sequence which is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% identical to, for example, any of the nucleotide sequences in (a), (b), (c), (d), (e), (f), (g), or (h), above. Polynucleotides encoded by these nucleic acid molecules are also encompassed by the invention. In another embodiment, the invention encompasses nucleic acid molecule which comprise, or alternatively, consist of a polynucleotide which hybridizes under stringent conditions, or alternatively, under lower stringency conditions, to a polynucleotide in (a), (b), (c), (d), (e), (f), (g), or (h), above. Polynucleotides which hybridize to the complement of these nucleic acid molecules under stringent hybridization conditions or alternatively, under lower stringency conditions, are also encompassed by the invention, as are polypeptides encoded by these polypeptides.

[0494] Another aspect of the invention provides an isolated nucleic acid molecule comprising, or alternatively, consisting of, a polynucleotide having a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding a Mitochondrial GPAT related polypeptide having an amino acid sequence as shown in the sequence listing and described in Table 1; (b) a nucleotide sequence encoding a mature Mitochondrial GPAT related polypeptide having the amino acid sequence as shown in the sequence listing and described in Table 1; (c) a nucleotide sequence encoding a biologically active fragment of a Mitochondrial GPAT related polypeptide having an amino acid sequence as shown in the sequence listing and described in Table 1; (d) a nucleotide sequence encoding an antigenic fragment of a Mitochondrial GPAT related polypeptide having an amino acid sequence as shown in the sequence listing and described in Table 1; (e) a nucleotide sequence encoding a Mitochondrial GPAT related polypeptide comprising the complete amino acid sequence encoded by a human cDNA in a cDNA plasmid contained in the ATCC Deposit and described in Table 1; (f) a nucleotide sequence encoding a mature Mitochondrial GPAT related polypeptide having an amino acid sequence encoded by a human cDNA in a cDNA plasmid contained in the ATCC Deposit and described in Table 1: (g) a nucleotide sequence encoding a biologically active fragment of a Mitochondrial GPAT related polypeptide having an amino acid sequence encoded by a human cDNA in a cDNA plasmid contained in the ATCC Deposit and described in Table 1; (h) a nucleotide sequence encoding an antigenic fragment of a Mitochondrial GPAT related polypeptide having an amino acid sequence encoded by a human cDNA in a cDNA plasmid contained in the ATCC deposit and described in Table 1; (i) a nucleotide sequence complimentary to any of the nucleotide sequences in (a), (b), (c), (d), (e), (f), (g), or (h) above.

[0495] The present invention is also directed to nucleic acid molecules which comprise, or alternatively, consist of, a nucleotide sequence which is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% identical to, for example, any of the nucleotide sequences in (a), (b), (c), (d), (e), (f), (g), or (h), above.

[0496] The present invention encompasses polypeptide sequences which comprise, or alternatively consist of, an amino acid sequence which is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% identical to, the following non-limited examples, the polypeptide sequence identified as SEQ ID NO: 2, 4, 6, 8, and/or 203, the polypeptide sequence encoded by a cDNA provided in the deposited clone, and/or polypeptide fragments of any of the polypeptides provided herein. Polynucleotides encoded by these nucleic acid molecules are also encompassed by the invention. In another embodiment, the invention encompasses nucleic acid molecule which comprise, or alternatively, consist of a polynucleotide which hybridizes under stringent conditions, or alternatively, under lower stringency conditions, to a polynucleotide in (a), (b), (c), (d), (e), (f), (g), or (h), above. Polynucleotides which hybridize to the complement of these nucleic acid molecules under stringent hybridization conditions or alternatively, under lower stringency conditions, are also encompassed by the invention, as are polypeptides encoded by these polypeptides.

[0497] The present invention is also directed to polypeptides which comprise, or alternatively consist of, an amino acid sequence which is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% identical to, for example, the polypeptide sequence shown in SEQ ID NO: 2, 4, 6, 8, and/or 203, a polypeptide sequence encoded by the nucleotide sequence in SEQ ID NO: 1, 3, 5, 7, and/or 202, a polypeptide sequence encoded by the cDNA in cDNA plasmid:Z, and/or polypeptide fragments of any of these polypeptides (e.g., those fragments described herein). Polynucleotides which hybridize to the complement of the nucleic acid molecules encoding these polypeptides under stringent hybridization conditions or alternatively, under lower stringency conditions, are also encompasses by the present invention, as are the polypeptides encoded by these polynucleotides.

[0498] By a nucleic acid having a nucleotide sequence at least, for example, 95% “identical” to a reference nucleotide sequence of the present invention, it is intended that the nucleotide sequence of the nucleic acid is identical to the reference sequence except that the nucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence encoding the polypeptide. In other words, to obtain a nucleic acid having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence. The query sequence may be an entire sequence referenced in Table 1, the ORF (open reading frame), or any fragment specified as described herein.

[0499] As a practical matter, whether any particular nucleic acid molecule or polypeptide is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% identical to a nucleotide sequence of the present invention can be determined conventionally using known computer programs. A preferred method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the CLUSTALW computer program (Thompson, J. D., et al., Nucleic Acids Research, 2(22):4673-4680, (1994)), which is based on the algorithm of Higgins, D. G., et al., Computer Applications in the Biosciences (CABIOS), 8(2):189-191, (1992). In a sequence alignment the query and subject sequences are both DNA sequences. An RNA sequence can be compared by converting U's to T's. However, the CLUSTALW algorithm automatically converts U's to T's when comparing RNA sequences to DNA sequences. The result of said global sequence alignment is in percent identity. Preferred parameters used in a CLUSTALW alignment of DNA sequences to calculate percent identity via pairwise alignments are: Matrix=IUB, k-tuple=1, Number of Top Diagonals=5, Gap Penalty=3, Gap Open Penalty 10, Gap Extension Penalty=0.i, Scoring Method=Percent, Window Size=5 or the length of the subject nucleotide sequence, whichever is shorter. For multiple alignments, the following CLUSTALW parameters are preferred: Gap Opening Penalty=10; Gap Extension Parameter=0.05; Gap Separation Penalty Range=8; End Gap Separation Penalty=Off; % Identity for Alignment Delay=40%; Residue Specific Gaps:Off; Hydrophilic Residue Gap=Off; and Transition Weighting=O. The pairwise and multple alignment parameters provided for CLUSTALW above represent the default parameters as provided with the AlignX software program (Vector NTI suite of programs, version 6.0).

[0500] The present invention encompasses the application of a manual correction to the percent identity results, in the instance where the subject sequence is shorter than the query sequence because of 5′ or 3′ deletions, not because of internal deletions. If only the local pairwise percent identity is required, no manual correction is needed. However, a manual correction may be applied to determine the global percent identity from a global polynucleotide alignment. Percent identity calculations based upon global polynucleotide alignments are often preferred since they reflect the percent identity between the polynucleotide molecules as a whole (i.e., including any polynucleotide overhangs, not just overlapping regions), as opposed to, only local matching polynucleotides. Manual corrections for global percent identity determinations are required since the CLUSTALW program does not account for 5′ and 3′ truncations of the subject sequence when calculating percent identity. For subject sequences truncated at the 5′ or 3′ ends, relative to the query sequence, the percent identity is corrected by calculating the number of bases of the query sequence that are 5′ and 3′ of the subject sequence, which are not matched/aligned, as a percent of the total bases of the query sequence. Whether a nucleotide is matched/aligned is determined by results of the CLUSTALW sequence alignment. This percentage is then subtracted from the percent identity, calculated by the above CLUSTALW program using the specified parameters, to arrive at a final percent identity score. This corrected score may be used for the purposes of the present invention. Only bases outside the 5′ and 3′ bases of the subject sequence, as displayed by the CLUSTALW alignment, Which are not matched/aligned with the query sequence, are calculated for the purposes of manually adjusting the percent identity score.

[0501] For example, a 90 base subject sequence is aligned to a 100 base query sequence to determine percent identity. The deletions occur at the 5′ end of the subject sequence and therefore, the CLUSTALW alignment does not show a matched/alignment of the first 10 bases at 5′ end. The 10 unpaired bases represent 10% of the sequence (number of bases at the 5′ and 3′ ends not matched/total number of bases in the query sequence) so 10% is subtracted from the percent identity score calculated by the CLUSTALW program. If the remaining 90 bases were perfectly matched the final percent identity would be 90%. In another example, a 90 base subject sequence is compared with a 100 base query sequence. This time the deletions are internal deletions so that there are no bases on the 5′ or 3′ of the subject sequence which are not matched/aligned with the query. In this case the percent identity calculated by CLUSTALW is not manually corrected. Once again, only bases 5′ and 3′ of the subject sequence which are not matched/aligned with the query sequence are manually corrected for. No other manual corrections are required for the purposes of the present invention.

[0502] By a polypeptide having an amino acid sequence at least, for example, 95% “identical” to a query amino acid sequence of the present invention, it is intended that the amino acid sequence of the subject polypeptide is identical to the query sequence except that the subject polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the query amino acid sequence. In other words, to obtain a polypeptide having an amino acid sequence at least 95% identical to a query amino acid sequence, up to 5% of the amino acid residues in the subject sequence may be inserted, deleted, or substituted with another amino acid. These alterations of the reference sequence may occur at the amino- or carboxy-terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.

[0503] As a practical matter, whether any particular polypeptide is at least about 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% identical to, for instance, an amino acid sequence referenced in Table 1 (SEQ ID NO: 2) or to the amino acid sequence encoded by cDNA contained in a deposited clone, can be determined conventionally using known computer programs. A preferred method for determining the best overall match between a query sequence (a sequence of the present invention) and a subject sequence, also referred to as a global sequence alignment, can be determined using the CLUSTALW computer program (Thompson, J. D., et al., Nucleic Acids Research, 2(22):4673-4680, (1994)), which is based on the algorithm of Higgins, D. G., et al., Computer Applications in the Biosciences (CABIOS), 8(2):189-191, (1992). In a sequence alignment the query and subject sequences are both amino acid sequences. The result of said global sequence alignment is in percent identity. Preferred parameters used in a CLUSTALW alignment of polypeptide sequences to calculate percent identity via pairwise alignments are: Matrix=BLOSUM, k-tuple=1, Number of Top Diagonals=5, Gap Penalty=3, Gap Open Penalty 10, Gap Extension Penalty=0.1, Scoring Method=Percent, Window Size=5 or the length of the subject nucleotide sequence, whichever is shorter. For multiple alignments, the following CLUSTALW parameters are preferred: Gap Opening Penalty=10; Gap Extension Parameter=0.05; Gap Separation Penalty Range=8; End Gap Separation Penalty=Off; % Identity for Alignment Delay=40%; Residue Specific Gaps:Off; Hydrophilic Residue Gap=Off; and Transition Weighting=0. The pairwise and multple alignment parameters provided for CLUSTALW above represent the default parameters as provided with the AlignX software program (Vector NTI suite of programs, version 6.0).

[0504] The present invention encompasses the application of a manual correction to the percent identity results, in the instance where the subject sequence is shorter than the query sequence because of N- or C-terminal deletions, not because of internal deletions. If only the local pairwise percent identity is required, no manual correction is needed. However, a manual correction may be applied to determine the global percent identity from a global polypeptide alignment. Percent identity calculations based upon global polypeptide alignments are often preferred since they reflect the percent identity between the polypeptide molecules as a whole (i.e., including any polypeptide overhangs, not just overlapping regions), as opposed to, only local matching polypeptides. Manual corrections for global percent identity determinations are required since the CLUSTALW program does not account for N-and C-terminal truncations of the subject sequence when calculating percent identity. For subject sequences truncated at the N-and C-termini, relative to the query sequence, the percent identity is corrected by calculating the number of residues of the query sequence that are N-and C-terminal of the subject sequence, which are not matched/aligned with a corresponding subject residue, as a percent of the total bases of the query sequence. Whether a residue is matched/aligned is determined by results of the CLUSTALW sequence alignment. This percentage is then subtracted from the percent identity, calculated by the above CLUSTALW program using the specified parameters, to arrive at a final percent identity score. This final percent identity score is what may be used for the purposes of the present invention. Only residues to the N-and C-termini of the subject sequence, which are not matched/aligned with the query sequence, are considered for the purposes of manually adjusting the percent identity score. That is, only query residue positions outside the farthest N-and C-terminal residues of the subject sequence.

[0505] For example, a 90 amino acid residue subject sequence is aligned with a 100 residue query sequence to determine percent identity. The deletion occurs at the N-terminus of the subject sequence and therefore, the CLUSTALW alignment does not show a matching/alignment of the first 10 residues at the N-terminus. The 10 unpaired residues represent 10% of the sequence (number of residues at the N-and C-termini not matched/total number of residues in the query sequence) so 10% is subtracted from the percent identity score calculated by the CLUSTALW program. If the remaining 90 residues were perfectly matched the final percent identity would be 90%. In another example, a 90 residue subject sequence is compared with a 100 residue query sequence. This time the deletions are internal deletions so there are no residues at the N- or C-termini of the subject sequence, which are not matched/aligned with the query. In this case the percent identity calculated by CLUSTALW is not manually corrected. Once again, only residue positions outside the N-and C-terminal ends of the subject sequence, as displayed in the CLUSTALW alignment, which are not matched/aligned with the query sequence are manually corrected for. No other manual corrections are required for the purposes of the present invention.

[0506] In addition to the above method of aligning two or more polynucleotide or polypeptide sequences to arrive at a percent identity value for the aligned sequences, it may be desirable in some circumstances to use a modified version of the CLUSTALW algorithm which takes into account known structural features of the sequences to be aligned, such as for example, the SWISS-PROT designations for each sequence. The result of such a modifed CLUSTALW algorithm may provide a more accurate value of the percent identity for two polynucleotide or polypeptide sequences. Support for such a modified version of CLUSTALW is provided within the CLUSTALW algorithm and would be readily appreciated to one of skill in the art of bioinformatics.

[0507] The variants may contain alterations in the coding regions, non-coding regions, or both. Especially preferred are polynucleotide variants containing alterations which produce silent substitutions, additions, or deletions, but do not alter the properties or activities of the encoded polypeptide. Nucleotide variants produced by silent substitutions due to the degeneracy of the genetic code are preferred. Moreover, variants in which 5-10, 1-5, or 1-2 amino acids are substituted, deleted, or added in any combination are also preferred. Polynucleotide variants can be produced for a variety of reasons, e.g., to optimize codon expression for a particular host (change codons in the mRNA to those preferred by a bacterial host such as E. coli).

[0508] Naturally occurring variants are called “allelic variants,” and refer to one of several alternate forms of a gene occupying a given locus on a chromosome of an organism. (Genes II, Lewin, B., ed., John Wiley & Sons, New York (1985).) These allelic variants can vary at either the polynucleotide and/or polypeptide level and are included in the present invention. Alternatively, non-naturally occurring variants may be produced by mutagenesis techniques or by direct synthesis.

[0509] Using known methods of protein engineering and recombinant DNA technology, variants may be generated to improve or alter the characteristics of the polypeptides of the present invention. For instance, one or more amino acids can be deleted from the N-terminus or C-terminus of the protein without substantial loss of biological function. The authors of Ron et al., J. Biol. Chem. 268: 2984-2988 (1993), reported variant KGF proteins having heparin binding activity even after deleting 3, 8, or 27 amino-terminal amino acid residues. Similarly, Interferon gamma exhibited up to ten times higher activity after deleting 8-10 amino acid residues from the carboxy terminus of this protein (Dobeli et al., J. Biotechnology 7:199-216 (1988)).

[0510] Moreover, ample evidence demonstrates that variants often retain a biological activity similar to that of the naturally occurring protein. For example, Gayle and coworkers (J. Biol. Chem. 268:22105-22111 (1993)) conducted extensive mutational analysis of human cytokine IL-1a. They used random mutagenesis to generate over 3,500 individual IL-1a mutants that averaged 2.5 amino acid changes per variant over the entire length of the molecule. Multiple mutations were examined at every possible amino acid position. The investigators found that “[m]ost of the molecule could be altered with little effect on either [binding or biological activity].” In fact, only 23 unique amino acid sequences, out of more than 3,500 nucleotide sequences examined, produced a protein that significantly differed in activity from wild-type.

[0511] Furthermore, even if deleting one or more amino acids from the N-terminus or C-terminus of a polypeptide results in modification or loss of one or more biological functions, other biological activities may still be retained. For example, the ability of a deletion variant to induce and/or to bind antibodies which recognize the protein will likely be retained when less than the majority of the residues of the protein are removed from the N-terminus or C-terminus. Whether a particular polypeptide lacking N- or C-terminal residues of a protein retains such immunogenic activities can readily be determined by routine methods described herein and otherwise known in the art.

[0512] Alternatively, such N-terminus or C-terminus deletions of a polypeptide of the present invention may, in fact, result in a significant increase in one or more of the biological activities of the polypeptide(s). For example, biological activity of many polypeptides are governed by the presence of regulatory domains at either one or both termini. Such regulatory domains effectively inhibit the biological activity of such polypeptides in lieu of an activation event (e.g., binding to a cognate ligand or receptor, phosphorylation, proteolytic processing, etc.). Thus, by eliminating the regulatory domain of a polypeptide, the polypeptide may effectively be rendered biologically active in the absence of an activation event.

[0513] The invention further includes polypeptide variants that show substantial biological activity. Such variants include deletions, insertions, inversions, repeats, and substitutions selected according to general rules known in the art so as have little effect on activity. For example, guidance concerning how to make phenotypically silent amino acid substitutions is provided in Bowie et al., Science 247:1306-1310 (1990), wherein the authors indicate that there are two main strategies for studying the tolerance of an amino acid sequence to change.

[0514] The first strategy exploits the tolerance of amino acid substitutions by natural selection during the process of evolution. By comparing amino acid sequences in different species, conserved amino acids can be identified. These conserved amino acids are likely important for protein function. In contrast, the amino acid positions where substitutions have been tolerated by natural selection indicates that these positions are not critical for protein function. Thus, positions tolerating amino acid substitution could be modified while still maintaining biological activity of the protein.

[0515] The second strategy uses genetic engineering to introduce amino acid changes at specific positions of a cloned gene to identify regions critical for protein function. For example, site directed mutagenesis or alanine-scanning mutagenesis (introduction of single alanine mutations at every residue in the molecule) can be used. (Cunningham and Wells, Science 244:1081-1085 (1989).) The resulting mutant molecules can then be tested for biological activity.

[0516] As the authors state, these two strategies have revealed that proteins are surprisingly tolerant of amino acid substitutions. The authors further indicate which amino acid changes are likely to be permissive at certain amino acid positions in the protein. For example, most buried (within the tertiary structure of the protein) amino acid residues require nonpolar side chains, whereas few features of surface side chains are generally conserved. The invention encompasses polypeptides having a lower degree of identity but having sufficient similarity so as to perform one or more of the same functions performed by the polypeptide of the present invention. Similarity is determined by conserved amino acid substitution. Such substitutions are those that substitute a given amino acid in a polypeptide by another amino acid of like characteristics (e.g., chemical properties). According to Cunningham et al above, such conservative substitutions are likely to be phenotypically silent. Additional guidance concerning which amino acid changes are likely to be phenotypically silent are found in Bowie et al., Science 247:1306-1310 (1990).

[0517] Tolerated conservative amino acid substitutions of the present invention involve replacement of the aliphatic or hydrophobic amino acids Ala, Val, Leu and Ile; replacement of the hydroxyl residues Ser and Thr; replacement of the acidic residues Asp and Glu; replacement of the amide residues Asn and Gln, replacement of the basic residues Lys, Arg, and His; replacement of the aromatic residues Phe, Tyr, and Trp, and replacement of the small-sized amino acids Ala, Ser, Thr, Met, and Gly.

[0518] In addition, the present invention also encompasses the conservative substitutions provided in Table III below.

TABLE III
For Amino Acid	Code	Replace with any of:
Alanine	A	D-Ala, Gly, beta-Ala, L-Cys, D-Cys
Arginine	R	D-Arg, Lys, D-Lys, homo-Arg, D-homo-Arg, Met, Ile,
		D-Met, D-Ile, Orn, D-Orn
Asparagine	N	D-Asn, Asp, D-Asp, Glu, D-Glu, Gln, D-Gln
Aspartic Acid	D	D-Asp, D-Asn, Asn, Glu, D-Glu, Gln, D-Gln
Cysteine	C	D-Cys, S-Me-Cys, Met, D-Met, Thr, D-Thr
Glutamine	Q	D-Gln, Asn, D-Asn, Glu, D-Glu, Asp, D-Asp
Glutaimic Acid	E	D-Glu, D-Asp, Asp, Asn, D-Asn, Gin, D-Gln
Glycine	G	Ala, D-Ala, Pro, D-Pro, B-Ala, Acp
Isoleucine	I	D-IIe, Val, D-Val, Leu, D-Leu, Met, D-Met
Leucine	L	D-Leu, Val, D-Val, Met, D-Met
Lysine	K	D-Lys, Arg, D-Arg, homo-Arg, D-homo-Arg, Met, D-Met,
		Ile, D-Ile, Gm, D-Orn
Methionine	M	D-Met, S-Me-Cys, Ile, D-Ile, Leu, D-Leu, Val, D-Val
Phenylalanine	F	D-Phe, Tyr, D-Thr, L-Dopa, His, D-His, Trp, D-Trp,
		Trans-3,4, or 5-phenyiproline, cis-3,4, or 5-phenylproline
Proline	P	D-Pro, L-1-thioazolidine-4-carboxylic acid, D- or
		L-1-oxazolidine-4-carboxylic acid
Serine	S	D-Ser, Thr, D-Thr, allo-Thr, Met, D-Met, Met(O), D-Met(O),
		L-Cys, D-Cys
Threonine	T	D-Thr, Ser, D-Ser, allo-Thr, Met, D-Met, Met(O), D-Met(O),
		Val, D-Val
Tyrosine	Y	D-Tyr, Phe, D-Phe, L-Dopa, His, D-His
Valine	V	D-Val, Leu, D-Leu, Lie, D-Ile, Met, D-Met

[0519] Aside from the uses described above, such amino acid substitutions may also increase protein or peptide stability. The invention encompasses amino acid substitutions that contain, for example, one or more non-peptide bonds (which replace the peptide bonds) in the protein or peptide sequence. Also included are substitutions that include amino acid residues other than naturally occurring L-amino acids, e.g., D-amino acids or non-naturally occurring or synthetic amino acids, e.g., β or γ amino acids.

[0520] Both identity and similarity can be readily calculated by reference to the following publications: Computational Molecular Biology, Lesk, A. M., ed., Oxford University Press, New York, 1988; Biocomputing: Informatics and Genome Projects, Smith, D. W., ed., Academic Press, New York, 1993; Informatics Computer Analysis of Sequence Data, Part 1, Griffin, A. M., and Griffin, H. G., eds., Humana Press,New Jersey, 1994; Sequence Analysis in Molecular Biology, von Heinje, G., Academic Press, 1987; and Sequence Analysis Primer, Gribskov, M. and Devereux, J., eds., M Stockton Press, New York, 1991.

[0521] In addition, the present invention also encompasses substitution of amino acids based upon the probability of an amino acid substitution resulting in conservation of function. Such probabilities are determined by aligning multiple genes with related function and assessing the relative penalty of each substitution to proper gene function. Such probabilities are often described in a matrix and are used by some algorithms (e.g., BLAST, CLUSTALW, GAP, etc.) in calculating percent similarity wherein similarity refers to the degree by which one amino acid may substitute for another amino acid without lose of function. An example of such a matrix is the PAM250 or BLOSUM62 matrix.

[0522] Aside from the canonical chemically conservative substitutions referenced above, the invention also encompasses substitutions which are typically not classified as conservative, but that may be chemically conservative under certain circumstances. Analysis of enzymatic catalysis for proteases, for example, has shown that certain amino acids within the active site of some enzymes may have highly perturbed pKa's due to the unique microenvironment of the active site. Such perturbed pKa's could enable some amino acids to substitute for other amino acids while conserving enzymatic structure and function. Examples of amino acids that are known to have amino acids with perturbed pKa's are the Glu-35 residue of Lysozyme, the Ile-16 residue of Chymotrypsin, the His-159 residue of Papain, etc. The conservation of function relates to either anomalous protonation or anomalous deprotonation of such amino acids, relative to their canonical, non-perturbed pKa. The pKa perturbation may enable these amino acids to actively participate in general acid-base catalysis due to the unique ionization environment within the enzyme active site. Thus, substituting an amino acid capable of serving as either a general acid or general base within the microenvironment of an enzyme active site or cavity, as may be the case, in the same or similar capacity as the wild-type amino acid, would effectively serve as a conservative amino substitution.

[0523] Besides conservative amino acid substitution, variants of the present invention include, but are not limited to, the following: (i) substitutions with one or more of the non-conserved amino acid residues, where the substituted amino acid residues may or may not be one encoded by the genetic code, or (ii) substitution with one or more of amino acid residues having a substituent group, or (iii) fusion of the mature polypeptide with another compound, such as a compound to increase the stability and/or solubility of the polypeptide (for example, polyethylene glycol), or (iv) fusion of the polypeptide with additional amino acids, such as, for example, an IgG Fc fusion region peptide, or leader or secretory sequence, or a sequence facilitating purification. Such variant polypeptides are deemed to be within the scope of those skilled in the art from the teachings herein.

[0524] For example, polypeptide variants containing amino acid substitutions of charged amino acids with other charged or neutral amino acids may produce proteins with improved characteristics, such as less aggregation. Aggregation of pharmaceutical formulations both reduces activity and increases clearance due to the aggregate's immunogenic activity. (Pinckard et al., Clin. Exp. Immunol. 2:331-340 (1967); Robbins et al., Diabetes 36: 838-845 (1987); Cleland et al., Crit. Rev. Therapeutic Drug Carrier Systems 10:307-377 (1993).)

[0525] Moreover, the invention further includes polypeptide variants created through the application of molecular evolution (“DNA Shuffling”) methodology to the polynucleotide disclosed as SEQ ID NO: 1, 3, 5, 7, and/or 202, the sequence of the clone submitted in a deposit, and/or the cDNA encoding the polypeptide disclosed as SEQ ID NO: 2, 4, 6, 8, and/or 203. Such DNA Shuffling technology is known in the art and more particularly described elsewhere herein (e.g., WPC, Stemmer, PNAS, 91:10747, (1994)), and in the Examples provided herein).

[0526] A further embodiment of the invention relates to a polypeptide which comprises the amino acid sequence of the present invention having an amino acid sequence which contains at least one amino acid substitution, but not more than 50 amino acid substitutions, even more preferably, not more than 40 amino acid substitutions, still more preferably, not more than 30 amino acid substitutions, and still even more preferably, not more than 20 amino acid substitutions. Of course, in order of ever-increasing preference, it is highly preferable for a peptide or polypeptide to have an amino acid sequence which comprises the amino acid sequence of the present invention, which contains at least one, but not more than 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 amino acid substitutions. In specific embodiments, the number of additions, substitutions, and/or deletions in the amino acid sequence of the present invention or fragments thereof (e.g., the mature form and/or other fragments described herein), is 1-5, 5-10, 5-25, 5-50, 10-50 or 50-150, conservative amino acid substitutions are preferable.

Polynucleotide and Polypeptide Fragments

[0527] The present invention is directed to polynucleotide fragments of the polynucleotides of the invention, in addition to polypeptides encoded therein by said polynucleotides and/or fragments.

[0528] In the present invention, a “polynucleotide fragment” refers to a short polynucleotide having a nucleic acid sequence which: is a portion of that contained in a deposited clone, or encoding the polypeptide encoded by the cDNA in a deposited clone; is a portion of that shown in SEQ ID NO: 1, 3, 5, 7, and/or 202 or the complementary strand thereto, or is a portion of a polynucleotide sequence encoding the polypeptide of SEQ ID NO: 2, 4, 6, 8, and/or 203. The nucleotide fragments of the invention are preferably at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt, at least about 50 nt, at least about 75 nt, or at least about 150 nt in length. A fragment “at least 20 nt in length,” for example, is intended to include 20 or more contiguous bases from the cDNA sequence contained in a deposited clone or the nucleotide sequence shown in SEQ ID NO: 1, 3, 5, 7, and/or 202. In this context “about” includes the particularly recited value, a value larger or smaller by several (5, 4, 3, 2, or 1) nucleotides, at either terminus, or at both termini. These nucleotide fragments have uses that include, but are not limited to, as diagnostic probes and primers as discussed herein. Of course, larger fragments (e.g., 50, 150, 500, 600, 2000 nucleotides) are preferred.

[0529] Moreover, representative examples of polynucleotide fragments of the invention, include, for example, fragments comprising, or alternatively consisting of, a sequence from about nucleotide number 1-50, 51-100, 101-150, 151-200, 201-250, 251-300, 301-350, 351-400, 401-450, 451-500, 501-550, 551-600, 651-700, 701-750, 751-800, 800-850, 851-900, 901-950, 951-1000, 1001-1050, 1051-1100, 1101-1150, 1151-1200, 1201-1250, 1251-1300, 1301-1350, 1351-1400, 1401-1450, 1451-1500, 1501-1550, 1551-1600, 1601-1650, 1651-1700, 1701-1750, 1751-1800, 1801-1850, 1851-1900, 1901-1950, 1951-2000, or 2001 to the end of SEQ ID NO: 1, 3, 5, 7, and/or 202, or the complementary strand thereto, or the cDNA contained in a deposited clone. In this context “about” includes the particularly recited ranges, and ranges larger or smaller by several (5, 4, 3, 2, or 1) nucleotides, at either terminus or at both termini. Preferably, these fragments encode a polypeptide which has biological activity. More preferably, these polynucleotides can be used as probes or primers as discussed herein. Also encompassed by the present invention are polynucleotides which hybridize to these nucleic acid molecules under stringent hybridization conditions or lower stringency conditions, as are the polypeptides encoded by these polynucleotides.

[0530] In the present invention, a “polypeptide fragment” refers to an amino acid sequence which is a portion of that contained in SEQ ID NO: 2, 4, 6, 8, and/or 203 or encoded by the cDNA contained in a deposited clone. Protein (polypeptide) fragments may be “free-standing,” or comprised within a larger polypeptide of which the fragment forms a part or region, most preferably as a single continuous region. Representative examples of polypeptide fragments of the invention, include, for example, fragments comprising, or alternatively consisting of, from about amino acid number 1-20, 21-40, 41-60, 61-80, 81-100, 102-120, 121-140, 141-160, or 161 to the end of the coding region. Moreover, polypeptide fragments can be about 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, or 150 amino acids in length. In this context “about” includes the particularly recited ranges or values, and ranges or values larger or smaller by several (5, 4, 3, 2, or 1) amino acids, at either extreme or at both extremes. Polynucleotides encoding these polypeptides are also encompassed by the invention.

[0531] Preferred polypeptide fragments include the full-length protein. Further preferred polypeptide fragments include the full-length protein having a continuous series of deleted residues from the amino or the carboxy terminus, or both. For example, any number of amino acids, ranging from 1-60, can be deleted from the amino terminus of the full-length polypeptide. Similarly, any number of amino acids, ranging from 1-30, can be deleted from the carboxy terminus of the full-length protein. Furthermore, any combination of the above amino and carboxy terminus deletions are preferred. Similarly, polynucleotides encoding these polypeptide fragments are also preferred.

[0532] Also preferred are polypeptide and polynucleotide fragments characterized by structural or functional domains, such as fragments that comprise alpha-helix and alpha-helix forming regions, beta-sheet and beta-sheet-forming regions, turn and turn-forming regions, coil and coil-forming regions, hydrophilic regions, hydrophobic regions, alpha amphipathic regions, beta amphipathic regions, flexible regions, surface-forming regions, substrate binding region, and high antigenic index regions. Polypeptide fragments of SEQ ID NO: 2, 4, 6, 8, and/or 203 falling within conserved domains are specifically contemplated by the present invention. Moreover, polynucleotides encoding these domains are also contemplated.

[0533] Other preferred polypeptide fragments are biologically active fragments. Biologically active fragments are those exhibiting activity similar, but not necessarily identical, to an activity of the polypeptide of the present invention. The biological activity of the fragments may include an improved desired activity, or a decreased undesirable activity. Polynucleotides encoding these polypeptide fragments are also encompassed by the invention.

[0534] In a preferred embodiment, the functional activity displayed by a polypeptide encoded by a polynucleotide fragment of the invention may be one or more biological activities typically associated with the full-length polypeptide of the invention. Illustrative of these biological activities includes the fragments ability to bind to at least one of the same antibodies which bind to the full-length protein, the fragments ability to interact with at lease one of the same proteins which bind to the full-length, the fragments ability to elicit at least one of the same immune responses as the full-length protein (i.e., to cause the immune system to create antibodies specific to the same epitope, etc.), the fragments ability to bind to at least one of the same polynucleotides as the full-length protein, the fragments ability to bind to a receptor of the full-length protein, the fragments ability to bind to a ligand of the full-length protein, and the fragments ability to multimerize with the full-length protein. However, the skilled artisan would appreciate that some fragments may have biological activities which are desirable and directly inapposite to the biological activity of the full-length protein. The functional activity of polypeptides of the invention, including fragments, variants, derivatives, and analogs thereof can be determined by numerous methods available to the skilled artisan, some of which are described elsewhere herein.

[0535] The present invention encompasses polypeptides comprising, or alternatively consisting of, an epitope of the polypeptide having an amino acid sequence of SEQ ID NO: 2, 4, 6, 8, and/or 203, or an epitope of the polypeptide sequence encoded by a polynucleotide sequence contained in ATCC deposit No. Z or encoded by a polynucleotide that hybridizes to the complement of the sequence of SEQ ID NO: 1, 3, 5, 7, and/or 202 or contained in ATCC deposit No. Z under stringent hybridization conditions or lower stringency hybridization conditions as defined supra. The present invention further encompasses polynucleotide sequences encoding an epitope of a polypeptide sequence of the invention (such as, for example, the sequence disclosed in SEQ ID NO: 1), polynucleotide sequences of the complementary strand of a polynucleotide sequence encoding an epitope of the invention, and polynucleotide sequences which hybridize to the complementary strand under stringent hybridization conditions or lower stringency hybridization conditions defined supra.

[0536] The term “epitopes,” as used herein, refers to portions of a polypeptide having antigenic or immunogenic activity in an animal, preferably a mammal, and most preferably in a human. In a preferred embodiment, the present invention encompasses a polypeptide comprising an epitope, as well as the polynucleotide encoding this polypeptide. An “immunogenic epitope,” as used herein, is defined as a portion of a protein that elicits an antibody response in an animal, as determined by any method known in the art, for example, by the methods for generating antibodies described infra. (See, for example, Geysen et al., Proc. Natl. Acad. Sci. USA 81:3998-4002 (1983)). The term “antigenic epitope,” as used herein, is defined as a portion of a protein to which an antibody can immunospecifically bind its antigen as determined by any method well known in the art, for example, by the immunoassays described herein. Immunospecific binding excludes non-specific binding but does not necessarily exclude cross-reactivity with other antigens. Antigenic epitopes need not necessarily be immunogenic.

[0537] Fragments which function as epitopes may be produced by any conventional means. (See, e.g., Houghten, Proc. Natl. Acad. Sci. USA 82:5131-5135 (1985), further described in U.S. Pat. No. 4,631,211).

[0538] In the present invention, antigenic epitopes preferably contain a sequence of at least 4, at least 5, at least 6, at least 7, more preferably at least 8, at least 9, at least 10, at least I1, at least 12, at least 13, at least 14, at least 15, at least 20, at least 25, at least 30, at least 40, at least 50, and, most preferably, between about 15 to about 30 amino acids. Preferred polypeptides comprising immunogenic or antigenic epitopes are at least 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 100 amino acid residues in length, or longer. Additional non-exclusive preferred antigenic epitopes include the antigenic epitopes disclosed herein, as well as portions thereof. Antigenic epitopes are useful, for example, to raise antibodies, including monoclonal antibodies, that specifically bind the epitope. Preferred antigenic epitopes include the antigenic epitopes disclosed herein, as well as any combination of two, three, four, five or more of these antigenic epitopes. Antigenic epitopes can be used as the target molecules in immunoassays. (See, for instance, Wilson et al., Cell 37:767-778 (1984); Sutcliffe et al., Science 219:660-666 (1983)).

[0539] Similarly, immunogenic epitopes can be used, for example, to induce antibodies according to methods well known in the art. (See, for instance, Sutcliffe et al., supra; Wilson et al., supra; Chow et al., Proc. Natl. Acad. Sci. USA 82:910-914; and Bittle et al., J. Gen. Virol. 66:2347-2354 (1985). Preferred immunogenic epitopes include the immunogenic epitopes disclosed herein, as well as any combination of two, three, four, five or more of these immunogenic epitopes. The polypeptides comprising one or more immunogenic epitopes may be presented for eliciting an antibody response together with a carrier protein, such as an albumin, to an animal system (such as rabbit or mouse), or, if the polypeptide is of sufficient length (at least about 25 amino acids), the polypeptide may be presented without a carrier. However, immunogenic epitopes comprising as few as 8 to 10 amino acids have been shown to be sufficient to raise antibodies capable of binding to, at the very least, linear epitopes in a denatured polypeptide (e.g., in Western blotting).

[0540] Epitope-bearing polypeptides of the present invention may be used to induce antibodies according to methods well known in the art including, but not limited to, in vivo immunization, in vitro immunization, and phage display methods. See, e.g., Sutcliffe et al., supra; Wilson et al., supra, and Bittle et al., J. Gen. Virol., 66:2347-2354 (1985). If in vivo immunization is used, animals may be immunized with free peptide; however, anti-peptide antibody titer may be boosted by coupling the peptide to a macromolecular carrier, such as keyhole limpet hemacyanin (KLH) or tetanus toxoid. For instance, peptides containing cysteine residues may be coupled to a carrier using a linker such as maleimidobenzoyl-N-hydroxysuccinimide ester (MBS), while other peptides may be coupled to carriers using a more general linking agent such as glutaraldehyde. Animals such as rabbits, rats and mice are immunized with either free or carrier-coupled peptides, for instance, by intraperitoneal and/or intradermal injection of emulsions containing about 100 μg of peptide or carrier protein and Freund's adjuvant or any other adjuvant known for stimulating an immune response. Several booster injections may be needed, for instance, at intervals of about two weeks, to provide a useful titer of anti-peptide antibody which can be detected, for example, by ELISA assay using free peptide adsorbed to a solid surface. The titer of anti-peptide antibodies in serum from an immunized animal may be increased by selection of anti-peptide antibodies, for instance, by adsorption to the peptide on a solid support and elution of the selected antibodies according to methods well known in the art.

[0541] As one of skill in the art will appreciate, and as discussed above, the polypeptides of the present invention comprising an immunogenic or antigenic epitope can be fused to other polypeptide sequences. For example, the polypeptides of the present invention may be fused with the constant domain of immunoglobulins (IgA, IgE, IgG, IgM), or portions thereof (CH1, CH2, CH3, or any combination thereof and portions thereof) resulting in chimeric polypeptides. Such fusion proteins may facilitate purification and may increase half-life in vivo. This has been shown for chimeric proteins consisting of the first two domains of the human CD4-polypeptide and various domains of the constant regions of the heavy or light chains of mammalian immunoglobulins. See, e.g., EP 394,827; Traunecker et al., Nature, 331:84-86 (1988). Enhanced delivery of an antigen across the epithelial barrier to the immune system has been demonstrated for antigens (e.g., insulin) conjugated to an FcRn binding partner such as IgG or Fe fragments (see, e.g., PCT Publications WO 96/22024 and WO 99/04813). IgG Fusion proteins that have a disulfide-linked dimeric structure due to the IgG portion disulfide bonds have also been found to be more efficient in binding and neutralizing other molecules than monomeric polypeptides or fragments thereof alone. See, e.g., Fountoulakis et al., J. Biochem., 270:3958-3964 (1995). Nucleic acids encoding the above epitopes can also be recombined with a gene of interest as an epitope tag (e.g., the hemagglutinin (“HA”) tag or flag tag) to aid in detection and purification of the expressed polypeptide. For example, a system described by Janknecht et al. allows for the ready purification of non-denatured fusion proteins expressed in human cell lines (Janknecht et al., 1991, Proc. Natl. Acad. Sci. USA 88:8972-897). In this system, the gene of interest is subcloned into a vaccinia recombination plasmid such that the open reading frame of the gene is translationally fused to an amino-terminal tag consisting of six histidine residues. The tag serves as a matrix binding domain for the fusion protein. Extracts from cells infected with the recombinant vaccinia virus are loaded onto Ni2+nitriloacetic acid-agarose column and histidine-tagged proteins can be selectively eluted with imidazole-containing buffers.

[0542] Additional fusion proteins of the invention may be generated through the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as “DNA shuffling”). DNA shuffling may be employed to modulate the activities of polypeptides of the invention, such methods can be used to generate polypeptides with altered activity, as well as agonists and antagonists of the polypeptides. See, generally, U.S. Pat. Nos. 5,605,793; 5,811,238; 5,830,721; 5,834,252; and 5,837,458, and Patten et al., Curr. Opinion Biotechnol. 8:724-33 (1997); Harayama, Trends Biotechnol. 16(2):76-82 (1998); Hansson, et al., J. Mol. Biol. 287:265-76 (1999); and Lorenzo and Blasco, Biotechniques 24(2):308-13 (1998) (each of these patents and publications are hereby incorporated by reference in its entirety). In one embodiment, alteration of polynucleotides corresponding to SEQ ID NO: 1, 3, 5, 7, and/or 202 and the polypeptides encoded by these polynucleotides may be achieved by DNA shuffling. DNA shuffling involves the assembly of two or more DNA segments by homologous or site-specific recombination to generate variation in the polynucleotide sequence. In another embodiment, polynucleotides of the invention, or the encoded polypeptides, may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion or other methods prior to recombination. In another embodiment, one or more components, motifs, sections, parts, domains, fragments, etc., of a polynucleotide encoding a polypeptide of the invention may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules.

Antibodies

[0543] Further polypeptides of the invention relate to antibodies and T-cell antigen receptors (TCR) which immunospecifically bind a polypeptide, polypeptide fragment, or variant of SEQ ID NO: 2, 4, 6, 8, and/or 203, and/or an epitope, of the present invention (as determined by immunoassays well known in the art for assaying specific antibody-antigen binding). Antibodies of the invention include, but are not limited to, polyclonal, monoclonal, monovalent, bispecific, heteroconjugate, multispecific, human, humanized or chimeric antibodies, single chain antibodies, Fab fragments, F(ab′) fragments, fragments produced by a Fab expression library, anti-idiotypic (anti-Id) antibodies (including, e.g., anti-Id antibodies to antibodies of the invention), and epitope-binding fragments of any of the above. The term “antibody,” as used herein, refers to immunoglobulin molecules and immunologically active portions of immunoglobulin molecules, i.e., molecules that contain an antigen binding site that immunospecifically binds an antigen. The immunoglobulin molecules of the invention can be of any type (e.g., IgG, IgE, IgM, IgD, IgA and IgY), class (e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass of immunoglobulin molecule. Moreover, the term “antibody” (Ab) or “monoclonal antibody” (Mab) is meant to include intact molecules, as well as, antibody fragments (such as, for example, Fab and F(ab′)2 fragments) which are capable of specifically binding to protein. Fab and F(ab′)2 fragments lack the Fc fragment of intact antibody, clear more rapidly from the circulation of the animal or plant, and may have less non-specific tissue binding than an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983)). Thus, these fragments are preferred, as well as the products of a FAB or other immunoglobulin expression library. Moreover, antibodies of the present invention include chimeric, single chain, and humanized antibodies.

[0544] Most preferably the antibodies are human antigen-binding antibody fragments of the present invention and include, but are not limited to, Fab, Fab′ and F(ab′)2, Fd, single-chain Fvs (scFv), single-chain antibodies, disulfide-linked Fvs (sdFv) and fragments comprising either a VL or VH domain. Antigen-binding antibody fragments, including single-chain antibodies, may comprise the variable region(s) alone or in combination with the entirety or a portion of the following: hinge region, CH1, CH2, and CH3 domains. Also included in the invention are antigen-binding fragments also comprising any combination of variable region(s) with a hinge region, CH1, CH2, and CH3 domains. The antibodies of the invention may be from any animal origin including birds and mammals. Preferably, the antibodies are human, murine (e.g., mouse and rat), donkey, ship rabbit, goat, guinea pig, camel, horse, or chicken. As used herein, “human” antibodies include antibodies having the amino acid sequence of a human immunoglobulin and include antibodies isolated from human immunoglobulin libraries or from animals transgenic for one or more human immunoglobulin and that do not express endogenous immunoglobulins, as described infra and, for example in, U.S. Pat. No. 5,939,598 by Kucherlapati et al.

[0545] The antibodies of the present invention may be monospecific, bispecific, trispecific or of greater multispecificity. Multispecific antibodies may be specific for different epitopes of a polypeptide of the present invention or may be specific for both a polypeptide of the present invention as well as for a heterologous epitope, such as a heterologous polypeptide or solid support material. See, e.g., PCT publications WO 93/17715; WO 92/08802; WO 91/00360; WO 92/05793; Tutt, et al., J. Immunol. 147:60-69 (1991); U.S. Pat. Nos. 4,474,893; 4,714,681; 4,925,648; 5,573,920; 5,601,819; Kostelny et al., J. Immunol. 148:1547-1553 (1992).

[0546] Antibodies of the present invention may be described or specified in terms of the epitope(s) or portion(s) of a polypeptide of the present invention which they recognize or specifically bind. The epitope(s) or polypeptide portion(s) may be specified as described herein, e.g., by N-terminal and C-terminal positions, by size in contiguous amino acid residues, or listed in the Tables and Figures. Antibodies which specifically bind any epitope or polypeptide of the present invention may also be excluded. Therefore, the present invention includes antibodies that specifically bind polypeptides of the present invention, and allows for the exclusion of the same.

[0547] Antibodies of the present invention may also be described or specified in terms of their cross-reactivity. Antibodies that do not bind any other analog, ortholog, or homologue of a polypeptide of the present invention are included. Antibodies that bind polypeptides with at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 65%, at least 60%, at least 55%, and at least 50% identity (as calculated using methods known in the art and described herein) to a polypeptide of the present invention are also included in the present invention. In specific embodiments, antibodies of the present invention cross-react with murine, rat and/or rabbit homologues of human proteins and the corresponding epitopes thereof. Antibodies that do not bind polypeptides with less than 95%, less than 90%, less than 85%, less than 80%, less than 75%, less than 70%, less than 65%, less than 60%, less than 55%, and less than 50% identity (as calculated using methods known in the art and described herein) to a polypeptide of the present invention are also included in the present invention. In a specific embodiment, the above-described cross-reactivity is with respect to any single specific antigenic or immunogenic polypeptide, or combination(s) of 2, 3, 4, 5, or more of the specific antigenic and/or immunogenic polypeptides disclosed herein. Further included in the present invention are antibodies which bind polypeptides encoded by polynucleotides which hybridize to a polynucleotide of the present invention under stringent hybridization conditions (as described herein). Antibodies of the present invention may also be described or specified in terms of their binding affinity to a polypeptide of the invention. Preferred binding affinities include those with a dissociation constant or Kd less than 5×10-2 M, 10-2 M, 5×10-3 M, 10-3 M, 5×10-4 M, 10-4 M, 5×10-5 M, 5×10-5 M, 5×10-6 M, 10-6M, 5×10-7 M, 107 M, 5×10-8 M, 10-8 M, 5×10-9 M, 5×10-9 M, 5×10-10 M, 10-10 M, 5×10-11 M, 10-11 M, 5×10-12 M, 10-12 M, 5×10-13 M, 5×10-13 M, 5×10-14 M, 10-14 M, 5×10-15 M, or 10-15 M.

[0548] The invention also provides antibodies that competitively inhibit binding of an antibody to an epitope of the invention as determined by any method known in the art for determining competitive binding, for example, the immunoassays described herein. In preferred embodiments, the antibody competitively inhibits binding to the epitope by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, or at least 50%.

[0549] Antibodies of the present invention may act as agonists or antagonists of the polypeptides of the present invention. For example, the present invention includes antibodies which disrupt the receptor/ligand interactions with the polypeptides of the invention either partially or fully. Preferably, antibodies of the present invention bind an antigenic epitope disclosed herein, or a portion thereof. The invention features both receptor-specific antibodies and ligand-specific antibodies. The invention also features receptor-specific antibodies which do not prevent ligand binding but prevent receptor activation. Receptor activation (i.e., signaling) may be determined by techniques described herein or otherwise known in the art. For example, receptor activation can be determined by detecting the phosphorylation (e.g., tyrosine or serine/threonine) of the receptor or its substrate by immunoprecipitation followed by western blot analysis (for example, as described supra). In specific embodiments, antibodies are provided that inhibit ligand activity or receptor activity by at least 95%, at least 90%, at least 85%, at least 80%, at least 75%, at least 70%, at least 60%, or at least 50% of the activity in absence of the antibody.

[0550] The invention also features receptor-specific antibodies which both prevent ligand binding and receptor activation as well as antibodies that recognize the receptor-ligand complex, and, preferably, do not specifically recognize the unbound receptor or the unbound ligand. Likewise, included in the invention are neutralizing antibodies which bind the ligand and prevent binding of the ligand to the receptor, as well as antibodies which bind the ligand, thereby preventing receptor activation, but do not prevent the ligand from binding the receptor. Further included in the invention are antibodies which activate the receptor. These antibodies may act as receptor agonists, i.e., potentiate or activate either all or a subset of the biological activities of the ligand-mediated receptor activation, for example, by inducing dimerization of the receptor. The antibodies may be specified as agonists, antagonists or inverse agonists for biological activities comprising the specific biological activities of the peptides of the invention disclosed herein. The above antibody agonists can be made using methods known in the art. See, e.g., PCT publication WO 96/40281; U.S. Pat. No. 5,811,097; Deng et al., Blood 92(6):1981-1988 (1998); Chen et al., Cancer Res. 58(16):3668-3678 (1998); Harrop et al., J. Immunol. 161(4):1786-1794 (1998); Zhu et al., Cancer Res. 58(15):3209-3214 (1998); Yoon et al., J. Immunol. 160(7):3170-3179 (1998); Prat et al., J. Cell. Sci. 111(Pt2):237-247 (1998); Pitard et al., J. Immunol. Methods 205(2):177-190 (1997); Liautard et al., Cytokine 9(4):233-241 (1997); Carlson et al., J. Biol. Chem. 272(17):11295-11301 (1997); Taryman et al., Neuron 14(4):755-762 (1995); Muller et al., Structure 6(9):1153-1167 (1998); Bartunek et a Cytokine 8(1):14-20 (1996) (which are all incorporated by reference herein in their entireties).

[0551] Antibodies of the present invention may be used, for example, but not limited to, to purify, detect, and target the polypeptides of the present invention, including both in vitro and in vivo diagnostic and therapeutic methods. For example, the antibodies have use in immunoassays for qualitatively and quantitatively measuring levels of the polypeptides of the present invention in biological samples. See, e.g., Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988) (incorporated by reference herein in its entirety).

[0552] As discussed in more detail below, the antibodies of the present invention may be used either alone or in combination with other compositions. The antibodies may further be recombinantly fused to a heterologous polypeptide at the N- or C-terminus or chemically conjugated (including covalently and non-covalently conjugations) to polypeptides or other compositions. For example, antibodies of the present invention may be recombinantly fused or conjugated to molecules useful as labels in detection assays and effector molecules such as heterologous polypeptides, drugs, radionucleotides, or toxins. See, e.g., PCT publications WO 92/08495; WO 91/14438; WO 89/12624; U.S. Pat. No. 5,314,995; and EP 396,387.

[0553] The antibodies of the invention include derivatives that are modified, i.e., by the covalent attachment of any type of molecule to the antibody such that covalent attachment does not prevent the antibody from generating an anti-idiotypic response. For example, but not by way of limitation, the antibody derivatives include antibodies that have been modified, e.g., by glycosylation, acetylation, pegylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to a cellular ligand or other protein, etc. Any of numerous chemical modifications may be carried out by known techniques, including, but not limited to specific chemical cleavage, acetylation, formylation, metabolic synthesis of tunicamycin, etc. Additionally, the derivative may contain one or more non-classical amino acids.

[0554] The antibodies of the present invention may be generated by any suitable method known in the art.

[0555] The antibodies of the present invention may comprise polyclonal antibodies. Methods of preparing polyclonal antibodies are known to the skilled artisan (Harlow, et al., Antibodies: A Laboratory Manual, (Cold spring Harbor Laboratory Press, 2nd ed. (1988); and Current Protocols, Chapter 2; which are hereby incorporated herein by reference in its entirety). In a preferred method, a preparation of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 protein is prepared and purified to render it substantially free of natural contaminants. Such a preparation is then introduced into an animal in order to produce polyclonal antisera of greater specific activity. For example, a polypeptide of the invention can be administered to various host animals including, but not limited to, rabbits, mice, rats, etc. to induce the production of sera containing polyclonal antibodies specific for the antigen. The administration of the polypeptides of the present invention may entail one or more injections of an immunizing agent and, if desired, an adjuvant. Various adjuvants may be used to increase the immunological response, depending on the host species, and include but are not limited to, Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanins, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and corynebacterium parvum. Such adjuvants are also well known in the art. For the purposes of the invention, “immunizing agent” may be defined as a polypeptide of the invention, including fragments, variants, and/or derivatives thereof, in addition to fusions with heterologous polypeptides and other forms of the polypeptides described herein.

[0556] Typically, the immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections, though they may also be given intramuscularly, and/or through IV). The immunizing agent may include polypeptides of the present invention or a fusion protein or variants thereof. Depending upon the nature of the polypeptides (i.e., percent hydrophobicity, percent hydrophilicity, stability, net charge, isoelectric point etc.), it may be useful to conjugate the immunizing agent to a protein known to be immunogenic in the mammal being immunized. Such conjugation includes either chemical conjugation by derivitizing active chemical functional groups to both the polypeptide of the present invention and the immunogenic protein such that a covalent bond is formed, or through fusion-protein based methodology, or other methods known to the skilled artisan. Examples of such immunogenic proteins include, but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. Various adjuvants may be used to increase the immunological response, depending on the host species, including but not limited to Freund's (complete and incomplete), mineral gels such as aluminum hydroxide, surface active substances such as lysolecithin, pluronic polyols, polyanions, peptides, oil emulsions, keyhole limpet hemocyanin, dinitrophenol, and potentially useful human adjuvants such as BCG (bacille Calmette-Guerin) and Corynebacterium parvum. Additional examples of adjuvants which may be employed includes the MPL-TDM adjuvant (monophosphoryl lipid A, synthetic trehalose dicorynomycolate). The immunization protocol may be selected by one skilled in the art without undue experimentation.

[0557] The antibodies of the present invention may comprise monoclonal antibodies. Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975) and U.S. Pat. No. 4,376,110, by Harlow, et al., Antibodies: A Laboratory Manual, (Cold spring Harbor Laboratory Press, 2nd ed. (1988), by Hammerling, et al., Monoclonal Antibodies and T-Cell Hybridomas (Elsevier, N.Y., pp. 563-681 (1981); Kohler et al., Eur. J. Immunol. 6:511 (1976); Kohler et al., Eur. J. Immunol. 6:292 (1976), or other methods known to the artisan. Other examples of methods which may be employed for producing monoclonal antibodies includes, but are not limited to, the human B-cell hybridoma technique (Kosbor et al., 1983, Immunology Today 4:72; Cole et al., 1983, Proc. Natl. Acad. Sci. USA 80:2026-2030), and the EBV-hybridoma technique (Cole et al., 1985, Monoclonal Antibodies And Cancer Therapy, Alan R. Liss, Inc., pp. 77-96). Such antibodies may be of any immunoglobulin class including IgG, IgM, IgE, IgA, IgD and any subclass thereof. The hybridoma producing the mAb of this invention may be cultivated in vitro or in vivo. Production of high titers of mAbs in vivo makes this the presently preferred method of production.

[0558] In a hybridoma method, a mouse, a humanized mouse, a mouse with a human immune system, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro.

[0559] The immunizing agent will typically include polypeptides of the present invention or a fusion protein thereof. Preferably, the immunizing agent consists of an Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide or, more preferably, with a Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide-expressing cell. Such cells may be cultured in any suitable tissue culture medium; however, it is preferable to culture cells in Earle's modified Eagle's medium supplemented with 10% fetal bovine serum (inactivated at about 56 degrees C), and supplemented with about 10 g/l of nonessential amino acids, about 1,000 U/ml of penicillin, and about 100 ug/ml of streptomycin. Generally, either peripheral blood lymphocytes (“PBLs”) are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The fymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell (Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, (1986), pp. 59-103). Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. For example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine (“HAT medium”), which substances prevent the growth of HGPRT-deficient cells.

[0560] Preferred immortalized cell lines are those that fuse efficiently, support stable high level expression of antibody by the selected antibody-producing cells, and are sensitive to a medium such as HAT medium. More preferred immortalized cell lines are murine myeloma lines, which can be obtained, for instance, from the Salk Institute Cell Distribution Center, San Diego, Calif. and the American Type Culture Collection, Manassas, Va. More preferred are the parent myeloma cell line (SP20) as provided by the ATCC. As inferred throughout the specification, human myeloma and mouse-human heteromyeloma cell lines also have been described for the production of human monoclonal antibodies (Kozbor, J. Immunol., 133:3001 (1984); Brodeur et al., Monoclonal Antibody Production Techniques and Applications, Marcel Dekker, Inc., New York, (1987) pp. 51-63).

[0561] The culture medium in which the hybridoma cells are cultured can then be assayed for the presence of monoclonal antibodies directed against the polypeptides of the present invention. Preferably, the binding specificity of monoclonal antibodies produced by the hybridoma cells is determined by immunoprecipitation or by an in vitro binding assay, such as radioimmunoassay (RIA) or enzyme-linked immunoabsorbant assay (ELISA). Such techniques are known in the art and within the skill of the artisan. The binding affinity of the monoclonal antibody can, for example, be determined by the Scatchard analysis of Munson and Pollart, Anal. Biochem., 107:220 (1980).

[0562] After the desired hybridoma cells are identified, the clones may be subcloned by limiting dilution procedures and grown by standard methods (Goding, supra, and/or according to Wands et al. (Gastroenterology 80:225-232 (1981)). Suitable culture media for this purpose include, for example, Dulbecco's Modified Eagle's Medium and RPMI-1640. Alternatively, the hybridoma cells may be grown in vivo as ascites in a mammal.

[0563] The monoclonal antibodies secreted by the subclones may be isolated or purified from the culture medium or ascites fluid by conventional immunoglobulin purification procedures such as, for example, protein A-sepharose, hydroxyapatite chromatography, gel exclusion chromatography, gel electrophoresis, dialysis, or affinity chromatography.

[0564] The skilled artisan would acknowledge that a variety of methods exist in the art for the production of monoclonal antibodies and thus, the invention is not limited to their sole production in hydridomas. For example, the monoclonal antibodies may be made by recombinant DNA methods, such as those described in U.S. Pat. No. 4,816,567. In this context, the term “monoclonal antibody” refers to an antibody derived from a single eukaryotic, phage, or prokaryotic clone. The DNA encoding the monoclonal antibodies of the invention can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of murine antibodies, or such chains from human, humanized, or other sources). The hydridoma cells of the invention serve as a preferred source of such DNA. Once isolated, the DNA may be placed into expression vectors, which are then transformed into host cells such as Simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. The DNA also may be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences (U.S. Pat. No. 4,816,567; Morrison et al, supra) or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. Such a non-immunoglobulin polypeptide can be substituted for the constant domains of an antibody of the invention, or can be substituted for the variable domains of one antigen-combining site of an antibody of the invention to create a chimeric bivalent antibody.

[0565] The antibodies may be monovalent antibodies. Methods for preparing monovalent antibodies are well known in the art. For example, one method involves recombinant expression of immunoglobulin light chain and modified heavy chain. The heavy chain is truncated generally at any point in the Fc region so as to prevent heavy chain crosslinking. Alternatively, the relevant cysteine residues are substituted with another amino acid residue or are deleted so as to prevent crosslinking.

[0566] In vitro methods are also suitable for preparing monovalent antibodies. Digestion of antibodies to produce fragments thereof, particularly, Fab fragments, can be accomplished using routine techniques known in the art. Monoclonal antibodies can be prepared using a wide variety of techniques known in the art including the use of hybridoma, recombinant, and phage display technologies, or a combination thereof. For example, monoclonal antibodies can be produced using hybridoma techniques including those known in the art and taught, for example, in Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling, et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981) (said references incorporated by reference in their entireties). The term “monoclonal antibody” as used herein is not limited to antibodies produced through hybridoma technology. The term “monoclonal antibody” refers to an antibody that is derived from a single clone, including any eukaryotic, prokaryotic, or phage clone, and not the method by which it is produced.

[0567] Methods for producing and screening for specific antibodies using hybridoma technology are routine and well known in the art and are discussed in detail in the Examples described herein. In a non-limiting example, mice can be immunized with a polypeptide of the invention or a cell expressing such peptide. Once an immune response is detected, e.g., antibodies specific for the antigen are detected in the mouse serum, the mouse spleen is harvested and splenocytes isolated. The splenocytes are then fused by well known techniques to any suitable myeloma cells, for example cells from cell line SP20 available from the ATCC. Hybridomas are selected and cloned by limited dilution. The hybridoma clones are then assayed by methods known in the art for cells that secrete antibodies capable of binding a polypeptide of the invention. Ascites fluid, which generally contains high levels of antibodies, can be generated by immunizing mice with positive hybridoma clones.

[0568] Accordingly, the present invention provides methods of generating monoclonal antibodies as well as antibodies produced by the method comprising culturing a hybridoma cell secreting an antibody of the invention wherein, preferably, the hybridoma is generated by fusing splenocytes isolated from a mouse immunized with an antigen of the invention with myeloma cells and then screening the hybridomas resulting from the fusion for hybridoma clones that secrete an antibody able to bind a polypeptide of the invention.

[0569] Antibody fragments which recognize specific epitopes may be generated by known techniques. For example, Fab and F(ab′)2 fragments of the invention may be produced by proteolytic cleavage of immunoglobulin molecules, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab′)2 fragments). F(ab′)2 fragments contain the variable region, the light chain constant region and the CH1 domain of the heavy chain.

[0570] For example, the antibodies of the present invention can also be generated using various phage display methods known in the art. In phage display methods, functional antibody domains are displayed on the surface of phage particles which carry the polynucleotide sequences encoding them. In a particular embodiment, such phage can be utilized to display antigen binding domains expressed from a repertoire or combinatorial antibody library (e.g., human or murine). Phage expressing an antigen binding domain that binds the antigen of interest can be selected or identified with antigen, e.g., using labeled antigen or antigen bound or captured to a solid surface or bead. Phage used in these methods are typically filamentous phage including fd and M13 binding domains expressed from phage with Fab, Fv or disulfide stabilized Fv antibody domains recombinantly fused to either the phage gene III or gene VIII protein. Examples of phage display methods that can be used to make the antibodies of the present invention include those disclosed in Brinkman et al., J. Immunol. Methods 182:41-50 (1995); Ames et al., J. Immunol. Methods 184:177-186 (1995); Kettleborough et al., Eur. J. Immunol. 24:952-958 (1994); Persic et al., Gene 187 9-18 (1997); Burton et al., Advances in Immunology 57:191-280 (1994); PCT application No. PCT/GB91/01134; PCT publications WO 90/02809; WO 91/10737; WO 92/01047; WO 92/18619; WO 93/11236; WO 95/15982; WO 95/20401; and U.S. Pat. Nos. 5,698,426; 5,223,409; 5,403,484; 5,580,717; 5,427,908; 5,750,753; 5,821,047; 5,571,698; 5,427,908; 5,516,637; 5,780,225; 5,658,727; 5,733,743 and 5,969,108; each of which is incorporated herein by reference in its entirety.

[0571] As described in the above references, after phage selection, the antibody coding regions from the phage can be isolated and used to generate whole antibodies, including human antibodies, or any other desired antigen binding fragment, and expressed in any desired host, including mammalian cells, insect cells, plant cells, yeast, and bacteria, e.g., as described in detail below. For example, techniques to recombinantly produce Fab, Fab′ and F(ab′)2 fragments can also be employed using methods known in the art such as those disclosed in PCT publication WO 92/22324; Mullinax et al., BioTechniques 12(6):864-869 (1992); and Sawai et al., AJRI 34:26-34 (1995); and Better et al., Science 240:1041-1043 (1988) (said references incorporated by reference in their entireties). Examples of techniques which can be used to produce single-chain Fvs and antibodies include those described in U.S. Pat. Nos. 4,946,778 and 5,258,498; Huston et al., Methods in Enzymology 203:46-88 (1991); Shu et al., PNAS 90:7995-7999 (1993); and Skerra et al., Science 240:1038-1040 (1988).

[0572] For some uses, including in vivo use of antibodies in humans and in vitro detection assays, it may be preferable to use chimeric, humanized, or human antibodies. A chimeric antibody is a molecule in which different portions of the antibody are derived from different animal species, such as antibodies having a variable region derived from a murine monoclonal antibody and a human immunoglobulin constant region. Methods for producing chimeric antibodies are known in the art. See e.g., Morrison, Science 229:1202 (1985); Oi et al., BioTechniques 4:214 (1986); Gillies et al., (1989) J. Immunol. Methods 125:191-202; Cabilly et al., Taniguchi et al., EP 171496; Morrison et al., EP 173494; Neuberger et al., WO 8601533; Robinson et al., WO 8702671; Boulianne et al., Nature 312:643 (1984); Neuberger et al., Nature 314:268 (1985); U.S. Pat. Nos. 5,807,715; 4,816,567; and 4,816397, which are incorporated herein by reference in their entirety. Humanized antibodies are antibody molecules from non-human species antibody that binds the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and a framework regions from a human immunoglobulin molecule. Often, framework residues in the human framework regions will be substituted with the corresponding residue from the CDR donor antibody to alter, preferably improve, antigen binding. These framework substitutions are identified by methods well known in the art, e.g., by modeling of the interactions of the CDR and framework residues to identify framework residues important for antigen binding and sequence comparison to identify unusual framework residues at particular positions. (See, e.g., Queen et al., U.S. Pat. No. 5,585,089; Riechmann et al., Nature 332:323 (1988), which are incorporated herein by reference in their entireties.) Antibodies can be humanized using a variety of techniques known in the art including, for example, CDR-grafting (EP 239,400; PCT publication WO 91/09967; U.S. Pat. Nos. 5,225,539; 5,530,101; and 5,585,089), veneering or resurfacing (EP 592,106; EP 519,596; Padlan, Molecular Immunology 28(4/5):489-498 (1991); Studnicka et al., Protein Engineering 7(6):805-814 (1994); Roguska. et al., PNAS 91:969-973 (1994)), and chain shuffling (U.S. Pat. No. 5,565,332). Generally, a humanized antibody has one or more amino acid residues introduced into it from a source that is non-human. These non-human amino acid residues are often referred to as “import” residues, which are typically taken from an “import” variable domain. Humanization can be essentially performed following the methods of Winter and co-workers (Jones et al., Nature, 321:522-525 (1986); Reichmann et al., Nature, 332:323-327 (1988); Verhoeyen et al., Science, 239:1534-1536 (1988), by substituting rodent CDRs or CDR sequences for the corresponding sequences of a human antibody. Accordingly, such “humanized” antibodies are chimeric antibodies (U.S. Pat. No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possible some FR residues are substituted from analogous sites in rodent antibodies.

[0573] In general, the humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin (Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988)1 and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992).

[0574] Completely human antibodies are particularly desirable for therapeutic treatment of human patients. Human antibodies can be made by a variety of methods known in the art including phage display methods described above using antibody libraries derived from human immunoglobulin sequences. See also, U.S. Pat. Nos. 4,444,887 and 4,716,111; and PCT publications WO 98/46645, WO 98/50433, WO 98/24893, WO 98/16654, WO 96/34096, WO 96/33735, and WO 91/10741; each of which is incorporated herein by reference in its entirety. The techniques of cole et al., and Boerder et al., are also available for the preparation of human monoclonal antibodies (cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Riss, (1985); and Boerner et al., J. Immunol., 147(1):86-95, (1991)).

[0575] Human antibodies can also be produced using transgenic mice which are incapable of expressing functional endogenous immunoglobulins, but which can express human immunoglobulin genes. For example, the human heavy and light chain immunoglobulin gene complexes may be introduced randomly or by homologous recombination into mouse embryonic stem cells. Alternatively, the human variable region, constant region, and diversity region may be introduced into mouse embryonic stem cells in addition to the human heavy and light chain genes. The mouse heavy and light chain immunoglobulin genes may be rendered non-functional separately or simultaneously with the introduction of human immunoglobulin loci by homologous recombination. In particular, homozygous deletion of the JH region prevents endogenous antibody production. The modified embryonic stem cells are expanded and microinjected into blastocysts to produce chimeric mice. The chimeric mice are then bred to produce homozygous offspring which express human antibodies. The transgenic mice are immunized in the normal fashion with a selected antigen, e.g., all or a portion of a polypeptide of the invention. Monoclonal antibodies directed against the antigen can be obtained from the immunized, transgenic mice using conventional hybridoma technology. The human immunoglobulin transgenes harbored by the transgenic mice rearrange during B cell differentiation, and subsequently undergo class switching and somatic mutation. Thus, using such a technique, it is possible to produce therapeutically useful IgG, IgA, IgM and IgE antibodies. For an overview of this technology for producing human antibodies, see Lonberg and Huszar, Int. Rev. Immunol. 13:65-93 (1995). For a detailed discussion of this technology for producing human antibodies and human monoclonal antibodies and protocols for producing such antibodies, see, e.g., PCT publications WO 98/24893; WO 92/01047; WO 96/34096; WO 96/33735; European Pat. No. 0 598 877; U.S. Pat. Nos. 5,413,923; 5,625,126; 5,633,425; 5,569,825; 5,661,016; 5,545,806; 5,814,318; 5,885,793; 5,916,771; and 5,939,598, which are incorporated by reference herein in their entirety. In addition, companies such as Abgenix, Inc. (Freemont, Calif.), Genpharm (San Jose, Calif.), and Medarex, Inc. (Princeton, N.J.) can be engaged to provide human antibodies directed against a selected antigen using technology similar to that described above.

[0576] Similarly, human antibodies can be made by introducing human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated. Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and creation of an antibody repertoire. This approach is described, for example, in U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; 5,661,106, and in the following scientific publications: Marks et al., Biotechnol., 10:779-783 (1992); Lonberg et al., Nature 368:856-859 (1994); Fishwild et al., Nature Biotechnol., 14:845-51 (1996); Neuberger, Nature Biotechnol., 14:826 (1996); Lonberg and Huszer, Intern. Rev. Immunol., 13:65-93 (1995).

[0577] Completely human antibodies which recognize a selected epitope can be generated using a technique referred to as “guided selection.” In this approach a selected non-human monoclonal antibody, e.g., a mouse antibody, is used to guide the selection of a completely human antibody recognizing the same epitope. (Jespers et al., Bio/technology 12:899-903 (1988)).

[0578] Further, antibodies to the polypeptides of the invention can, in turn, be utilized to generate anti-idiotype antibodies that “mimic” polypeptides of the invention using techniques well known to those skilled in the art. (See, e.g., Greenspan & Bona, FASEB J. 7(5):437-444; (1989) and Nissinoff, J. Immunol. 147(8):2429-2438 (1991)). For example, antibodies which bind to and competitively inhibit polypeptide multimerization and/or binding of a polypeptide of the invention to a ligand can be used to generate anti-idiotypes that “mimic” the polypeptide multimerization and/or binding domain and, as a consequence, bind to and neutralize polypeptide and/or its ligand. Such neutralizing anti-idiotypes or Fab fragments of such anti-idiotypes can be used in therapeutic regimens to neutralize polypeptide ligand. For example, such anti-idiotypic antibodies can be used to bind a polypeptide of the invention and/or to bind its ligands/receptors, and thereby block its biological activity.

[0579] Such anti-idiotypic antibodies capable of binding to the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide can be produced in a two-step procedure. Such a method makes use of the fact that antibodies are themselves antigens, and therefore, it is possible to obtain an antibody that binds to a second antibody. In accordance with this method, protein specific antibodies are used to immunize an animal, preferably a mouse. The splenocytes of such an animal are then used to produce hybridoma cells, and the hybridoma cells are screened to identify clones that produce an antibody whose ability to bind to the protein-specific antibody can be blocked by the polypeptide. Such antibodies comprise anti-idiotypic antibodies to the protein-specific antibody and can be used to immunize an animal to induce formation of further protein-specific antibodies.

[0580] The antibodies of the present invention may be bispecific antibodies. Bispecific antibodies are monoclonal, Preferably human or humanized, antibodies that have binding specificities for at least two different antigens. In the present invention, one of the binding specificities may be directed towards a polypeptide of the present invention, the other may be for any other antigen, and preferably for a cell-surface protein, receptor, receptor subunit, tissue-specific antigen, virally derived protein, virally encoded envelope protein, bacterially derived protein, or bacterial surface protein, etc.

[0581] Methods for making bispecific antibodies are known in the art. Traditionally, the recombinant production of bispecific antibodies is based on the co-expression of two immunoglobulin heavy-chain/light-chain pairs, where the two heavy chains have different specificities (Milstein and Cuello, Nature, 305:537-539 (1983). Because of the random assortment of immunoglobulin heavy and light chains, these hybridomas (quadromas) produce a potential mixture of ten different antibody molecules, of which only one has the correct bispecific structure. The purification of the correct molecule is usually accomplished by affinity chromatography steps. Similar procedures are disclosed in WO 93/08829, published 13 May 1993, and in Traunecker et al., EMBO J., 10:3655-3659 (1991).

[0582] Antibody variable domains with the desired binding specificities (antibody-antigen combining sites) can be fused to immunoglobulin constant domain sequences. The fusion preferably is with an immunoglobulin heavy-chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. It is preferred to have the first heavy-chain constant region (CH1) containing the site necessary for light-chain binding present in at least one of the fusions. DNAs encoding the immunoglobulin heavy-chain fusions and, if desired, the immunoglobulin light chain, are inserted into separate expression vectors, and are co-transformed into a suitable host organism. For further details of generating bispecific antibodies see, for example Suresh et al., Meth. In Enzym., 121:210 (1986).

[0583] Heteroconjugate antibodies are also contemplated by the present invention. Heteroconjugate antibodies are composed of two covalently joined antibodies. Such antibodies have, for example, been proposed to target immune system cells to unwanted cells (U.S. Pat. No. 4,676,980), and for the treatment of HIV infection (WO 91/00360; WO 92/20373; and EP03089). It is contemplated that the antibodies may be prepared in vitro using known methods in synthetic protein chemistry, including those involving crosslinking agents. For example, immunotoxins may be constructed using a disulfide exchange reaction or by forming a thioester bond. Examples of suitable reagents for this purpose include iminothiolate and methyl-4-mercaptobutyrimidate and those disclosed, for example, in U.S. Pat. No. 4,676,980.

Polynucleotides Encoding Antibodies

[0584] The invention further provides polynucleotides comprising a nucleotide sequence encoding an antibody of the invention and fragments thereof. The invention also encompasses polynucleotides that hybridize under stringent or lower stringency hybridization conditions, e.g., as defined supra, to polynucleotides that encode an antibody, preferably, that specifically binds to a polypeptide of the invention, preferably, an antibody that binds to a polypeptide having the amino acid sequence of SEQ ID NO: 2, 4, 6, 8, and/or 203.

[0585] The polynucleotides may be obtained, and the nucleotide sequence of the polynucleotides determined, by any method known in the art. For example, if the nucleotide sequence of the antibody is known, a polynucleotide encoding the antibody may be assembled from chemically synthesized oligonucleotides (e.g., as described in Kutmeier et al., BioTechniques 17:242 (1994)), which, briefly, involves the synthesis of overlapping oligonucleotides containing portions of the sequence encoding the antibody, annealing and ligating of those oligonucleotides, and then amplification of the ligated oligonucleotides by PCR.

[0586] Alternatively, a polynucleotide encoding an antibody may be generated from nucleic acid from a suitable source. If a clone containing a nucleic acid encoding a particular antibody is not available, but the sequence of the antibody molecule is known, a nucleic acid encoding the immunoglobulin may be chemically synthesized or obtained from a suitable source (e.g., an antibody cDNA library, or a cDNA library generated from, or nucleic acid, preferably poly A+ RNA, isolated from, any tissue or cells expressing the antibody, such as hybridoma cells selected to express an antibody of the invention) by PCR amplification using synthetic primers hybridizable to the 3′ and 5′ ends of the sequence or by cloning using an oligonucleotide probe specific for the particular gene sequence to identify, e.g., a cDNA clone from a cDNA library that encodes the antibody. Amplified nucleic acids generated by PCR may then be cloned into replicable cloning vectors using any method well known in the art.

[0587] Once the nucleotide sequence and corresponding amino acid sequence of the antibody is determined, the nucleotide sequence of the antibody may be manipulated using methods well known in the art for the manipulation of nucleotide sequences, e.g., recombinant DNA techniques, site directed mutagenesis, PCR, etc. (see, for example, the techniques described in Sambrook et al., 1990, Molecular Cloning, A Laboratory Manual, 2d Ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. and Ausubel et al., eds., 1998, Current Protocols in Molecular Biology, John Wiley & Sons, NY, which are both incorporated by reference herein in their entireties), to generate antibodies having a different amino acid sequence, for example to create amino acid substitutions, deletions, and/or insertions.

[0588] In a specific embodiment, the amino acid sequence of the heavy and/or light chain variable domains may be inspected to identify the sequences of the complementarity determining regions (CDRs) by methods that are well know in the art, e.g., by comparison to known amino acid sequences of other heavy and light chain variable regions to determine the regions of sequence hypervariability. Using routine recombinant DNA techniques, one or more of the CDRs may be inserted within framework regions, e.g., into human framework regions to humanize a non-human antibody, as described supra. The framework regions may be naturally occurring or consensus framework regions, and preferably human framework regions (see, e.g., Chothia et al., J. Mol. Biol. 278: 457-479 (1998) for a listing of human framework regions). Preferably, the polynucleotide generated by the combination of the framework regions and CDRs encodes an antibody that specifically binds a polypeptide of the invention. Preferably, as discussed supra, one or more amino acid substitutions may be made within the framework regions, and, preferably, the amino acid substitutions improve binding of the antibody to its antigen. Additionally, such methods may be used to make amino acid substitutions or deletions of one or more variable region cysteine residues participating in an intrachain disulfide bond to generate antibody molecules lacking one or more intrachain disulfide bonds. Other alterations to the polynucleotide are encompassed by the present invention and within the skill of the art.

[0589] In addition, techniques developed for the production of “chimeric antibodies” (Morrison et al., Proc. Natl. Acad. Sci. 81:851-855 (1984); Neuberger et al., Nature 312:604-608 (1984); Takeda et al., Nature 314:452-454 (1985)) by splicing genes from a mouse antibody molecule of appropriate antigen specificity together with genes from a human antibody molecule of appropriate biological activity can be used. As described supra, a chimeric antibody is a molecule in which different portions are derived from different animal species, such as those having a variable region derived from a murine mAb and a human immunoglobulin constant region, e.g., humanized antibodies.

[0590] Alternatively, techniques described for the production of single chain antibodies (U.S. Pat. No. 4,946,778; Bird, Science 242:423-42 (1988); Huston et al., Proc. Natl. Acad. Sci. USA 85:5879-5883 (1988); and Ward et al., Nature 334:544-54 (1989)) can be adapted to produce single chain antibodies. Single chain antibodies are formed by linking the heavy and light chain fragments of the Fv region via an amino acid bridge, resulting in a single chain polypeptide. Techniques for the assembly of functional Fv fragments in E. coli may also be used (Skerra et al., Science 242:1038-1041 (1988)).

[0591] More preferably, a clone encoding an antibody of the present invention may be obtained according to the method described in the Example section herein.

Methods of Producing Antibodies

[0592] The antibodies of the invention can be produced by any method known in the art for the synthesis of antibodies, in particular, by chemical synthesis or preferably, by recombinant expression techniques.

[0593] Recombinant expression of an antibody of the invention, or fragment, derivative or analog thereof, (e.g., a heavy or light chain of an antibody of the invention or a single chain antibody of the invention), requires construction of an expression vector containing a polynucleotide that encodes the antibody. Once a polynucleotide encoding an antibody molecule or a heavy or light chain of an antibody, or portion thereof (preferably containing the heavy or light chain variable domain), of the invention has been obtained, the vector for the production of the antibody molecule may be produced by recombinant DNA technology using techniques well known in the art. Thus, methods for preparing a protein by expressing a polynucleotide containing an antibody encoding nucleotide sequence are described herein. Methods which are well known to those skilled in the art can be used to construct expression vectors containing antibody coding sequences and appropriate transcriptional and translational control signals. These methods include, for example, in vitro recombinant DNA techniques, synthetic techniques, and in vivo genetic recombination. The invention, thus, provides replicable vectors comprising a nucleotide sequence encoding an antibody molecule of the invention, or a heavy or light chain thereof, or a heavy or light chain variable domain, operably linked to a promoter. Such vectors may include the nucleotide sequence encoding the constant region of the antibody molecule (see, e.g., PCT Publication WO 86/05807; PCT Publication WO 89/01036; and U.S. Pat. No. 5,122,464) and the variable domain of the antibody may be cloned into such a vector for expression of the entire heavy or light chain.

[0594] The expression vector is transferred to a host cell by conventional techniques and the transfected cells are then cultured by conventional techniques to produce an antibody of the invention. Thus, the invention includes host cells containing a polynucleotide encoding an antibody of the invention, or a heavy or light chain thereof, or a single chain antibody of the invention, operably linked to a heterologous promoter. In preferred embodiments for the expression of double-chained antibodies, vectors encoding both the heavy and light chains may be co-expressed in the host cell for expression of the entire immunoglobulin molecule, as detailed below.

[0595] A variety of host-expression vector systems may be utilized to express the antibody molecules of the invention. Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected with the appropriate nucleotide coding sequences, express an antibody molecule of the invention in situ. These include but are not limited to microorganisms such as bacteria (e.g., E. coli, B. subtilis) transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing antibody coding sequences; yeast (e.g., Saccharomyces, Pichia) transformed with recombinant yeast expression vectors containing antibody coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing antibody coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing antibody coding sequences; or mammalian cell systems (e.g., COS, CHO, BHK, 293, 3T3 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the vaccinia virus 7.5K promoter). Preferably, bacterial cells such as Escherichia coli, and more preferably, eukaryotic cells, especially for the expression of whole recombinant antibody molecule, are used for the expression of a recombinant antibody molecule. For example, mammalian cells such as Chinese hamster ovary cells (CHO), in conjunction with a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system for antibodies (Foecking et al., Gene 45:101 (1986); Cockett et al., Bio/Technology 8:2 (1990)).

[0596] In bacterial systems, a number of expression vectors may be advantageously selected depending upon the use intended for the antibody molecule being expressed. For example, when a large quantity of such a protein is to be produced, for the generation of pharmaceutical compositions of an antibody molecule, vectors which direct the expression of high levels of fusion protein products that are readily purified may be desirable. Such vectors include, but are not limited, to the E. coli expression vector pUR278 (Ruther et al., EMBO J. 2:1791 (1983)), in which the antibody coding sequence may be ligated individually into the vector in frame with the lac Z coding region so that a fusion protein is produced; pIN vectors (Inouye & Inouye, Nucleic Acids Res. 13:3101-3109 (1985); Van Heeke & Schuster, J. Biol. Chem. 24:5503-5509 (1989)); and the like. pGEX vectors may also be used to express foreign polypeptides as fusion proteins with glutathione S-transferase (GST). In general, such fusion proteins are soluble and can easily be purified from lysed cells by adsorption and binding to matrix glutathione-agarose beads followed by elution in the presence of free glutathione. The pGEX vectors are designed to include thrombin or factor Xa protease cleavage sites so that the cloned target gene product can be released from the GST moiety.

[0597] In an insect system, Autographa californica nuclear polyhedrosis virus (AcNPV) is used as a vector to express foreign genes. The virus grows in Spodoptera frugiperda cells. The antibody coding sequence may be cloned individually into non-essential regions (for example the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (for example the polyhedrin promoter).

[0598] In mammalian host cells, a number of viral-based expression systems may be utilized. In cases where an adenovirus is used as an expression vector, the antibody coding sequence of interest may be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence. This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination. Insertion in a non-essential region of the viral genome (e.g., region El or E3) will result in a recombinant virus that is viable and capable of expressing the antibody molecule in infected hosts. (e.g., see Logan & Shenk, Proc. Natl. Acad. Sci. USA 81:355-359 (1984)). Specific initiation signals may also be required for efficient translation of inserted antibody coding sequences. These signals include the ATG initiation codon and adjacent sequences. Furthermore, the initiation codon must be in phase with the reading frame of the desired coding sequence to ensure translation of the entire insert. These exogenous translational control signals and initiation codons can be of a variety of origins, both natural and synthetic. The efficiency of expression may be enhanced by the inclusion of appropriate transcription enhancer elements, transcription terminators, etc. (see Bittner et al., Methods in Enzymol. 153:51-544 (1987)).

[0599] In addition, a host cell strain may be chosen which modulates the expression of the inserted sequences, or modifies and processes the gene product in the specific fashion desired. Such modifications (e.g., glycosylation) and processing (e.g., cleavage) of protein products may be important for the function of the protein. Different host cells have characteristic and specific mechanisms for the post-translational processing and modification of proteins and gene products. Appropriate cell lines or host systems can be chosen to ensure the correct modification and processing of the foreign protein expressed. To this end, eukaryotic host cells which possess the cellular machinery for proper processing of the primary transcript, glycosylation, and phosphorylation of the gene product may be used. Such mammalian host cells include but are not limited to CHO, VERY, BHK, Hela, COS, MDCK, 293, 3T3, W138, and in particular, breast cancer cell lines such as, for example, BT483, Hs578T, HTB2, BT20 and T47D, and normal mammary gland cell line such as, for example, CRL7030 and Hs578Bst.

[0600] For long-term, high-yield production of recombinant proteins, stable expression is preferred. For example, cell lines which stably express the antibody molecule may be engineered. Rather than using expression vectors which contain viral origins of replication, host cells can be transformed with DNA controlled by appropriate expression control elements (e.g., promoter, enhancer, sequences, transcription terminators, polyadenylation sites, etc.), and a selectable marker. Following the introduction of the foreign DNA, engineered cells may be allowed to grow for 1-2 days in an enriched media, and then are switched to a selective media. The selectable marker in the recombinant plasmid confers resistance to the selection and allows cells to stably integrate the plasmid into their chromosomes and grow to form foci which in turn can be cloned and expanded into cell lines. This method may advantageously be used to engineer cell lines which express the antibody molecule. Such engineered cell lines may be particularly useful in screening and evaluation of compounds that interact directly or indirectly with the antibody molecule.

[0601] A number of selection systems may be used, including but not limited to the herpes simplex virus thymidine kinase (Wigler et al., Cell 11:223 (1977)), hypoxanthine-guanine phosphoribosyltransferase (Szybalska & Szybalski, Proc. Natl. Acad. Sci. USA 48:202 (1992)), and adenine phosphoribosyltransferase (Lowy et al., Cell 22:817 (1980)) genes can be employed in tk-, hgprt- or aprt-cells, respectively. Also, antimetabolite resistance can be used as the basis of selection for the following genes: dhfr, which confers resistance to methotrexate (Wigler et al., Natl. Acad. Sci. USA 77:357 (1980); O'Hare et al., Proc. Natl. Acad. Sci. USA 78:1527 (1981)); gpt, which confers resistance to mycophenolic acid (Mulligan & Berg, Proc. Natl. Acad. Sci. USA 78:2072 (1981)); neo, which confers resistance to the aminoglycoside G-418 Clinical Pharmacy 12:488-505; Wu and Wu, Biotherapy 3:87-95 (1991); Tolstoshev, Ann. Rev. Pharmacol. Toxicol. 32:573-596 (1993); Mulligan, Science 260:926-932 (1993); and Morgan and Anderson, Ann. Rev. Biochem. 62:191-217 (1993); May, 1993, TIB TECH 11(5):155-215); and hygro, which confers resistance to hygromycin (Santerre et al., Gene 30:147 (1984)). Methods commonly known in the art of recombinant DNA technology may be routinely applied to select the desired recombinant clone, and such methods are described, for example, in Ausubel et al. (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, NY (1993); Kriegler, Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY (1990); and in Chapters 12 and 13, Dracopoli et al. (eds), Current Protocols in Human Genetics, John Wiley & Sons, NY (1994); Colberre-Garapin et al., J. Mol. Biol. 150:1 (1981), which are incorporated by reference herein in their entireties.

[0602] The expression levels of an antibody molecule can be increased by vector amplification (for a review, see Bebbington and Hentschel, The use of vectors based on gene amplification for the expression of cloned genes in mammalian cells in DNA cloning, Vol. 3. (Academic Press, New York, 1987)). When a marker in the vector system expressing antibody is amplifiable, increase in the level of inhibitor present in culture of host cell will increase the number of copies of the marker gene. Since the amplified region is associated with the antibody gene, production of the antibody will also increase (Crouse et al., Mol. Cell. Biol. 3:257 (1983)).

[0603] The host cell may be co-transfected with two expression vectors of the invention, the first vector encoding a heavy chain derived polypeptide and the second vector encoding a light chain derived polypeptide. The two vectors may contain identical selectable markers which enable equal expression of heavy and light chain polypeptides. Alternatively, a single vector may be used which encodes, and is capable of expressing, both heavy and light chain polypeptides. In such situations, the light chain should be placed before the heavy chain to avoid an excess of toxic free heavy chain (Proudfoot, Nature 322:52 (1986); Kohler, Proc. Natl. Acad. Sci. USA 77:2197 (1980)). The coding sequences for the heavy and light chains may comprise cDNA or genomic DNA.

[0604] Once an antibody molecule of the invention has been produced by an animal, chemically synthesized, or recombinantly expressed, it may be purified by any method known in the art for purification of an immunoglobulin molecule, for example, by chromatography (e.g., ion exchange, affinity, particularly by affinity for the specific antigen after Protein A, and sizing column chromatography), centrifugation, differential solubility, or by any other standard technique for the purification of proteins. In addition, the antibodies of the present invention or fragments thereof can be fused to heterologous polypeptide sequences described herein or otherwise known in the art, to facilitate purification.

[0605] The present invention encompasses antibodies recombinantly fused or chemically conjugated (including both covalently and non-covalently conjugations) to a polypeptide (or portion thereof, preferably at least 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 amino acids of the polypeptide) of the present invention to generate fusion proteins. The fusion does not necessarily need to be direct, but may occur through linker sequences. The antibodies may be specific for antigens other than polypeptides (or portion thereof, preferably at least 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 amino acids of the polypeptide) of the present invention. For example, antibodies may be used to target the polypeptides of the present invention to particular cell types, either in vitro or in vivo, by fusing or conjugating the polypeptides of the present invention to antibodies specific for particular cell surface receptors. Antibodies fused or conjugated to the polypeptides of the present invention may also be used in in vitro immunoassays and purification methods using methods known in the art. See e.g., Harbor et al., supra, and PCT publication WO 93/21232; EP 439,095; Naramura et al., Immunol. Lett. 39:91-99 (1994); U.S. Pat. No. 5,474,981; Gillies et al., PNAS 89:1428-1432 (1992); Fell et al., J. Immunol. 146:2446-2452(1991), which are incorporated by reference in their entireties.

[0606] The present invention further includes compositions comprising the polypeptides of the present invention fused or conjugated to antibody domains other than the variable regions. For example, the polypeptides of the present invention may be fused or conjugated to an antibody Fc region, or portion thereof. The antibody portion fused to a polypeptide of the present invention may comprise the constant region, hinge region, CH1 domain, CH2 domain, and CH3 domain or any combination of whole domains or portions thereof. The polypeptides may also be fused or conjugated to the above antibody portions to form multimers. For example, Fc portions fused to the polypeptides of the present invention can form dimers through disulfide bonding between the Fc portions. Higher multimeric forms can be made by fusing the polypeptides to portions of IgA and IgM. Methods for fusing or conjugating the polypeptides of the present invention to antibody portions are known in the art. See, e.g., U.S. Pat. Nos. 5,336,603; 5,622,929; 5,359,046; 5,349,053; 5,447,851; 5,112,946; EP 307,434; EP 367,166; PCT publications WO 96/04388; WO 91/06570; Ashkenazi et al., Proc. Natl. Acad. Sci. USA 88:10535-10539 (1991); Zheng et al., J. Immunol. 154:5590-5600 (1995); and Vil et al., Proc. Natl. Acad. Sci. USA 89:11337-11341(1992) (said references incorporated by reference in their entireties).

[0607] As discussed, supra, the polypeptides corresponding to a polypeptide, polypeptide fragment, or a variant of SEQ ID NO: 2, 4, 6, 8, and/or 203 may be fused or conjugated to the above antibody portions to increase the in vivo half life of the polypeptides or for use in immunoassays using methods known in the art. Further, the polypeptides corresponding to SEQ ID NO: 2, 4, 6, 8, and/or 203 may be fused or conjugated to the above antibody portions to facilitate purification. One reported example describes chimeric proteins consisting of the first two domains of the human CD4-polypeptide and various domains of the constant regions of the heavy or light chains of mammalian immunoglobulins. (EP 394,827; Traunecker et al., Nature 331:84-86 (1988). The polypeptides of the present invention fused or conjugated to an antibody having disulfide-linked dimeric structures (due to the IgG) may also be more efficient in binding and neutralizing other molecules, than the monomeric secreted protein or protein fragment alone. (Fountoulakis et al., J. Biochem. 270:3958-3964 (1995)). In many cases, the Fc part in a fusion protein is beneficial in therapy and diagnosis, and thus can result in, for example, improved pharmacokinetic properties. (EP A 232,262). Alternatively, deleting the Fc part after the fusion protein has been expressed, detected, and purified, would be desired. For example, the Fc portion may hinder therapy and diagnosis if the fusion protein is used as an antigen for immunizations. In drug discovery, for example, human proteins, such as hIL-5, have been fused with Fe portions for the purpose of high-throughput screening assays to identify antagonists of hIL-5. (See, Bennett et al., J. Molecular Recognition 8:52-58 (1995); Johanson et al., J. Biol. Chem. 270:9459-9471 (1995).

[0608] Moreover, the antibodies or fragments thereof of the present invention can be fused to marker sequences, such as a peptide to facilitate purification. In preferred embodiments, the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311), among others, many of which are commercially available. As described in Gentz et al., Proc. Natl. Acad. Sci. USA 86:821-824 (1989), for instance, hexa-histidine provides for convenient purification of the fusion protein. Other peptide tags useful for purification include, but are not limited to, the “HA” tag, which corresponds to an epitope derived from the influenza hemagglutinin protein (Wilson et al., Cell 37:767 (1984)) and the “flag” tag.

[0609] The present invention further encompasses antibodies or fragments thereof conjugated to a diagnostic or therapeutic agent. The antibodies can be used diagnostically to, for example, monitor the development or progression of a tumor as part of a clinical testing procedure to, e.g., determine the efficacy of a given treatment regimen. Detection can be facilitated by coupling the antibody to a detectable substance. Examples of detectable substances include various enzymes, prosthetic groups, fluorescent materials, luminescent materials, bioluminescent materials, radioactive materials, positron emitting metals using various positron emission tomographies, and nonradioactive paramagnetic metal ions. The detectable substance may be coupled or conjugated either directly to the antibody (or fragment thereof) or indirectly, through an intermediate (such as, for example, a linker known in the art) using techniques known in the art. See, for example, U.S. Pat. No. 4,741,900 for metal ions which can be conjugated to antibodies for use as diagnostics according to the present invention. Examples of suitable enzymes include horseradish peroxidase, alkaline phosphatase, beta-galactosidase, or acetylcholinesterase; examples of suitable prosthetic group complexes include streptavidin/biotin and avidin/biotin; examples of suitable fluorescent materials include umbelliferone, fluorescein, fluorescein isothiocyanate, rhodamine, dichlorotriazinylamine fluorescein, dansyl chloride or phycoerythrin; an example of a luminescent material includes luminol; examples of bioluminescent materials include luciferase, luciferin, and aequorin; and examples of suitable radioactive material include 125I, 131I, 111In or 99Tc.

[0610] Further, an antibody or fragment thereof may be conjugated to a therapeutic moiety such as a cytotoxin, e.g., a cytostatic or cytocidal agent, a therapeutic agent or a radioactive metal ion, e.g., alpha-emitters such as, for example, 213Bi. A cytotoxin or cytotoxic agent includes any agent that is detrimental to cells. Examples include paclitaxol, cytochalasin B, gramicidin D, ethidium bromide, emetine, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicin, doxorubicin, daunorubicin, dihydroxy anthracin dione, mitoxantrone, mithramycin, actinomycin D, 1-dehydrotestosterone, glucocorticoids, procaine, tetracaine, lidocaine, propranolol, and puromycin and analogs or homologues thereof. Therapeutic agents include, but are not limited to, antimetabolites (e.g., methotrexate, 6-mercaptopurine, 6-thioguanine, cytarabine, 5-fluorouracil decarbazine), alkylating agents (e.g., mechloretharmine, thioepa chlorambucil, melphalan, carmustine (BSNU) and lomustine (CCNU), cyclothosphamide, busulfan, dibromomannitol, streptozotocin, mitomycin C, and cis-dichlorodiamine platinum (II) (DDP) cisplatin), anthracyclines (e.g., daunorubicin (formerly daunomycin) and doxorubicin), antibiotics (e.g., dactinomycin (formerly actinomycin), bleomycin, mithramycin, and anthramycin (AMC)), and anti-mitotic agents (e.g., vincristine and vinblastine).

[0611] The conjugates of the invention can be used for modifying a given biological response, the therapeutic agent or drug moiety is not to be construed as limited to classical chemical therapeutic agents. For example, the drug moiety may be a protein or polypeptide possessing a desired biological activity. Such proteins may include, for example, a toxin such as abrin, ricin A, pseudomonas exotoxin, or diphtheria toxin; a protein such as tumor necrosis factor, a-interferon, β-interferon, nerve growth factor, platelet derived growth factor, tissue plasminogen activator, an apoptotic agent, e.g., TNF-alpha, TNF-beta, AIM I (See, International Publication No. WO 97/33899), AIM II (See, International Publication No. WO 97/34911), Fas Ligand (Takahashi et al., Int. Immunol., 6:1567-1574 (1994)), VEGI (See, International Publication No. WO 99/23105), a thrombotic agent or an anti-angiogenic agent, e.g., angiostatin or endostatin; or, biological response modifiers such as, for example, lymphokines, interleukin-1 (“IL-1”), interleukin-2 (“IL-2”), interleukin-6 (“IL-6”), granulocyte macrophage colony stimulating factor (“GM-CSF”), granulocyte colony stimulating factor (“G-CSF”), or other growth factors.

[0612] Antibodies may also be attached to solid supports, which are particularly useful for immunoassays or purification of the target antigen. Such solid supports include, but are not limited to, glass, cellulose, polyacrylamide, nylon, polystyrene, polyvinyl chloride or polypropylene.

[0613] Techniques for conjugating such therapeutic moiety to antibodies are well known, see, e.g., Arnon et al., “Monoclonal Antibodies For Immunotargeting Of Drugs In Cancer Therapy”, in Monoclonal Antibodies And Cancer Therapy, Reisfeld et al. (eds.), pp. 243-56 (Alan R. Liss, Inc. 1985); Helistrom et al., “Antibodies For Drug Delivery”, in Controlled Drug Delivery (2nd Ed.), Robinson et al. (eds.), pp. 623-53 (Marcel Dekker, Inc. 1987); Thorpe, “Antibody Carriers Of Cytotoxic Agents In Cancer Therapy: A Review”, in Monoclonal Antibodies '84: Biological And Clinical Applications, Pinchera et al. (eds.), pp. 475-506 (1985); “Analysis, Results, And Future Prospective Of The Therapeutic Use Of Radiolabeled Antibody In Cancer Therapy”, in Monoclonal Antibodies For Cancer Detection And Therapy, Baldwin et al. (eds.), pp. 303-16 (Academic Press 1985), and Thorpe et al., “The Preparation And Cytotoxic Properties Of Antibody-Toxin Conjugates”, Immunol. Rev. 62:119-58 (1982).

[0614] Alternatively, an antibody can be conjugated to a second antibody to form an antibody heteroconjugate as described by Segal in U.S. Pat. No. 4,676,980, which is incorporated herein by reference in its entirety.

[0615] An antibody, with or without a therapeutic moiety conjugated to it, administered alone or in combination with cytotoxic factor(s) and/or cytokine(s) can be used as a therapeutic.

[0616] The present invention also encompasses the creation of synthetic antibodies directed against the polypeptides of the present invention. One example of synthetic antibodies is described in Radrizzani, M., et al., Medicina, (Aires), 59(6):753-8, (1999)). Recently, a new class of synthetic antibodies has been described and are referred to as molecularly imprinted polymers (MIPs) (Semorex, Inc.). Antibodies, peptides, and enzymes are often used as molecular recognition elements in chemical and biological sensors. However, their lack of stability and signal transduction mechanisms limits their use as sensing devices. Molecularly imprinted polymers (MIPs) are capable of mimicking the function of biological receptors but with less stability constraints. Such polymers provide high sensitivity and selectivity while maintaining excellent thermal and mechanical stability. MIPs have the ability to bind to small molecules and to target molecules such as organics and proteins' with equal or greater potency than that of natural antibodies. These “super” MIPs have higher affinities for their target and thus require lower concentrations for efficacious binding.

[0617] During synthesis, the MIPs are imprinted so as to have complementary size, shape, charge and functional groups of the selected target by using the target molecule itself (such as a polypeptide, antibody, etc.), or a substance having a very similar structure, as its “print” or “template.” MIPs can be derivatized with the same reagents afforded to antibodies. For example, fluorescent ‘super’ MIPs can be coated onto beads or wells for use in highly sensitive separations or assays, or for use in high throughput screening of proteins.

[0618] Moreover, MIPs based upon the structure of the polypeptide(s) of the present invention may be useful in screening for compounds that bind to the polypeptide(s) of the invention. Such a MIP would serve the role of a synthetic “receptor” by minimicking the native architecture of the polypeptide. In fact, the ability of a MIP to serve the role of a synthetic receptor has already been demonstrated for the estrogen receptor (Ye, L., Yu, Y., Mosbach, K, Analyst., 126(6):760-5, (2001); Dickert, F, L., Hayden, O., Halikias, K, P, Analyst., 126(6):766-71, (2001)). A synthetic receptor may either be mimicked in its entirety (e.g., as the entire protein), or mimicked as a series of short peptides corresponding to the protein (Rachkov, A., Minoura, N, Biochim, Biophys, Acta., 1544(1-2):255-66, (2001)). Such a synthetic receptor MIPs may be employed in any one or more of the screening methods described elsewhere herein.

[0619] MIPs have also been shown to be useful in “sensing” the presence of its mimicked molecule (Cheng, Z., Wang, E., Yang, X, Biosens, Bioelectron., 16(3):179-85, (2001); Jenkins, A, L., Yin, R., Jensen, J. L, Analyst., 126(6):798-802, (2001); Jenkins, A, L., Yin, R., Jensen, J. L, Analyst., 126(6):798-802, (2001)). For example, a MIP designed using a polypeptide of the present invention may be used in assays designed to identify, and potentially quantitate, the level of said polypeptide in a sample. Such a MIP may be used as a substitute for any component described in the assays, or kits, provided herein (e.g., ELISA, etc.).

[0620] A number of methods may be employed to create MIPs to a specific receptor, ligand, polypeptide, peptide, organic molecule. Several preferred methods are described by Esteban et al in J. Anal, Chem., 370(7):795-802, (2001), which is hereby incorporated herein by reference in its entirety in addition to any references cited therein. Additional methods are known in the art and are encompassed by the present invention, such as for example, Hart, B, R., Shea, K, J. J. Am. Chem, Soc., 123(9):2072-3, (2001); and Quaglia, M., Chenon, K., Hall, A, J., De, Lorenzi, E., Sellergren, B, J. Am. Chem, Soc., 123(10):2146-54, (2001); which are hereby incorporated by reference in their entirety herein.

Uses for Antibodies Directed Against Polypeptides of the Invention

[0621] The antibodies of the present invention have various utilities. For example, such antibodies may be used in diagnostic assays to detect the presence or quantification of the polypeptides of the invention in a sample. Such a diagnostic assay may be comprised of at least two steps. The first, subjecting a sample with the antibody, wherein the sample is a tissue (e.g., human, animal, etc.), biological fluid (e.g., blood, urine, sputum, semen, amniotic fluid, saliva, etc.), biological extract (e.g., tissue or cellular homogenate, etc.), a protein microchip (e.g., See Arenkov P, et al., Anal Biochem., 278(2):123-131 (2000)), or a chromatography column, etc. And a second step involving the quantification of antibody bound to the substrate. Alternatively, the method may additionally involve a first step of attaching the antibody, either covalently, electrostatically, or reversibly, to a solid support, and a second step of subjecting the bound antibody to the sample, as defined above and elsewhere herein.

[0622] Various diagnostic assay techniques are known in the art, such as competitive binding assays, direct or indirect sandwich assays and immunoprecipitation assays conducted in either heterogeneous or homogenous phases (Zola, Monoclonal Antibodies: A Manual of Techniques, CRC Press, Inc., (1987), ppl47-158). The antibodies used in the diagnostic assays can be labeled with a detectable moiety. The detectable moiety should be capable of producing, either directly or indirectly, a detectable signal. For example, the detectable moiety may be a radioisotope, such as 2H, 14C, 32P, or 125I, a florescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin, or an enzyme, such as alkaline phosphatase, beta-galactosidase, green fluorescent protein, or horseradish peroxidase. Any method known in the art for conjugating the antibody to the detectable moiety may be employed, including those methods described by Hunter et al., Nature, 144:945 (1962); Dafvid et al., Biochem., 13:1014 (1974); Pain et al., J. Immunol. Metho., 40:219(1981); and Nygren, J. Histochem. And Cytochem., 30:407 (1982).

[0623] Antibodies directed against the polypeptides of the present invention are useful for the affinity purification of such polypeptides from recombinant cell culture or natural sources. In this process, the antibodies against a particular polypeptide are immobilized on a suitable support, such as a Sephadex resin or filter paper, using methods well known in the art. The immobilized antibody then is contacted with a sample containing the polypeptides to be purified, and thereafter the support is washed with a suitable solvent that will remove substantially all the material in the sample except for the desired polypeptides, which are bound to the immobilized antibody. Finally, the support is washed with another suitable solvent that will release the desired polypeptide from the antibody.

Immunophenotyping

[0624] The antibodies of the invention may be utilized for immunophenotyping of cell lines and biological samples. The translation product of the gene of the present invention may be useful as a cell specific marker, or more specifically as a cellular marker that is differentially expressed at various stages of differentiation and/or maturation of particular cell types. Monoclonal antibodies directed against a specific epitope, or combination of epitopes, will allow for the screening of cellular populations expressing the marker. Various techniques can be utilized using monoclonal antibodies to screen for cellular populations expressing the marker(s), and include magnetic separation using antibody-coated magnetic beads, “panning” with antibody attached to a solid matrix (i.e., plate), and flow cytometry (See, e.g., U.S. Pat. No. 5,985,660; and Morrison et al., Cell, 96:737-49 (1999)).

[0625] These techniques allow for the screening of particular populations of cells, such as might be found with hematological malignancies (i.e. minimal residual disease (MRD) in acute leukemic patients) and “non-self” cells in transplantations to prevent Graft-versus-Host Disease (GVHD). Alternatively, these techniques allow for the screening of hematopoietic stem and progenitor cells capable of undergoing proliferation and/or differentiation, as might be found in human umbilical cord blood.

Assays for Antibody Binding

[0626] The antibodies of the invention may be assayed for immunospecific binding by any method known in the art. The immunoassays which can be used include but are not limited to competitive and non-competitive assay systems using techniques such as western blots, radioimmunoassays, ELISA (enzyme linked immunosorbent assay), “sandwich” immunoassays, immunoprecipitation assays, precipitin reactions, gel diffusion precipitin reactions, immunodiffusion assays, agglutination assays, complement-fixation assays, immunoradiometric assays, fluorescent immunoassays, protein A immunoassays, to name but a few. Such assays are routine and well known in the art (see, e.g., Ausubel et al, eds, 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York, which is incorporated by reference herein in its entirety). Exemplary immunoassays are described briefly below (but are not intended by way of limitation).

[0627] Immunoprecipitation protocols generally comprise lysing a population of cells in a lysis buffer such as RIPA buffer (1% NP-40 or Triton X-100, 1% sodium deoxycholate, 0.1% SDS, 0.15 M NaCl, 0.01 M sodium phosphate at pH 7.2, 1% Trasylol) supplemented with protein phosphatase and/or protease inhibitors (e.g., EDTA, PMSF, aprotinin, sodium vanadate), adding the antibody of interest to the cell lysate, incubating for a period of time (e.g., 1-4 hours) at 4° C., adding protein A and/or protein G sepharose beads to the cell lysate, incubating for about an hour or more at 4° C., washing the beads in lysis buffer and resuspending the beads in SDS/sample buffer. The ability of the antibody of interest to immunoprecipitate a particular antigen can be assessed by, e.g., western blot analysis. One of skill in the art would be knowledgeable as to the parameters that can be modified to increase the binding of the antibody to an antigen and decrease the background (e.g., pre-clearing the cell lysate with sepharose beads). For further discussion regarding immunoprecipitation protocols see, e.g., Ausubel et al, eds, 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York at 10.16.1.

[0628] Western blot analysis generally comprises preparing protein samples, electrophoresis of the protein samples in a polyacrylamide gel (e.g., 8%-20% SDS-PAGE depending on the molecular weight of the antigen), transferring the protein sample from the polyacrylamide gel to a membrane such as nitrocellulose, PVDF or nylon, blocking the membrane in blocking solution (e.g., PBS with 3% BSA or non-fat milk), washing the membrane in washing buffer (e.g., PBS-Tween 20), blocking the membrane with primary antibody (the antibody of interest) diluted in blocking buffer, washing the membrane in washing buffer, blocking the membrane with a secondary antibody (which recognizes the primary antibody, e.g., an anti-human antibody) conjugated to an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase) or radioactive molecule (e.g., 32P or 125I) diluted in blocking buffer, washing the membrane in wash buffer, and detecting the presence of the antigen. One of skill in the art would be knowledgeable as to the parameters that can be modified to increase the signal detected and to reduce the background noise. For further discussion regarding western blot protocols see, e.g., Ausubel et al, eds, 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York at 10.8.1.

[0629] ELISAs comprise preparing antigen, coating the well of a 96 well microtiter plate with the antigen, adding the antibody of interest conjugated to a detectable compound such as an enzymatic substrate (e.g., horseradish peroxidase or alkaline phosphatase) to the well and incubating for a period of time, and detecting the presence of the antigen. In ELISAs the antibody of interest does not have to be conjugated to a detectable compound; instead, a second antibody (which recognizes the antibody of interest) conjugated to a detectable compound may be added to the well. Further, instead of coating the well with the antigen, the antibody may be coated to the well. In this case, a second antibody conjugated to a detectable compound may be added following the addition of the antigen of interest to the coated well. One of skill in the art would be knowledgeable as to the parameters that can be modified to increase the signal detected as well as other variations of ELISAs known in the art. For further discussion regarding ELISAs see, e.g., Ausubel et al, eds, 1994, Current Protocols in Molecular Biology, Vol. 1, John Wiley & Sons, Inc., New York at 11.2.1.

[0630] The binding affinity of an antibody to an antigen and the off-rate of an antibody-antigen interaction can be determined by competitive binding assays. One example of a competitive binding assay is a radioimmunoassay comprising the incubation of labeled antigen (e.g., 3H or 125I) with the antibody of interest in the presence of increasing amounts of unlabeled antigen, and the detection of the antibody bound to the labeled antigen. The affinity of the antibody of interest for a particular antigen and the binding off-rates can be determined from the data by scatchard plot analysis. Competition with a second antibody can also be determined using radioimmunoassays. In this case, the antigen is incubated with antibody of interest conjugated to a labeled compound (e.g., 3H or 125I in the presence of increasing amounts of an unlabeled second antibody.

Therapeutic Uses of Antibodies

[0631] The present invention is further directed to antibody-based therapies which involve administering antibodies of the invention to an animal, preferably a mammal, and most preferably a human, patient for treating one or more of the disclosed diseases, disorders, or conditions. Therapeutic compounds of the invention include, but are not limited to, antibodies of the invention (including fragments, analogs and derivatives thereof as described herein) and nucleic acids encoding antibodies of the invention (including fragments, analogs and derivatives thereof and anti-idiotypic antibodies as described herein). The antibodies of the invention can be used to treat, inhibit or prevent diseases, disorders or conditions associated with aberrant expression and/or activity of a polypeptide of the invention, including, but not limited to, any one or more of the diseases, disorders, or conditions described herein. The treatment and/or prevention of diseases, disorders, or conditions associated with aberrant expression and/or activity of a polypeptide of the invention includes, but is not limited to, alleviating symptoms associated with those diseases, disorders or conditions. Antibodies of the invention may be provided in pharmaceutically acceptable compositions as known in the art or as described herein.

[0632] A summary of the ways in which the antibodies of the present invention may be used therapeutically includes binding polynucleotides or polypeptides of the present invention locally or systemically in the body or by direct cytotoxicity of the antibody, e.g. as mediated by complement (CDC) or by effector cells (ADCC). Some of these approaches are described in more detail below. Armed with the teachings provided herein, one of ordinary skill in the art will know how to use the antibodies of the present invention for diagnostic, monitoring or therapeutic purposes without undue experimentation.

[0633] The antibodies of this invention may be advantageously utilized in combination with other monoclonal or chimeric antibodies, or with lymphokines or hematopoietic growth factors (such as, e.g., IL-2, IL-3 and IL-7), for example, which serve to increase the number or activity of effector cells which interact with the antibodies.

[0634] The antibodies of the invention may be administered alone or in combination with other types of treatments (e.g., radiation therapy, chemotherapy, hormonal therapy, immunotherapy and anti-tumor agents). Generally, administration of products of a species origin or species reactivity (in the case of antibodies) that is the same species as that of the patient is preferred. Thus, in a preferred embodiment, human antibodies, fragments derivatives, analogs, or nucleic acids, are administered to a human patient for therapy or prophylaxis.

[0635] It is preferred to use high affinity and/or potent in vivo inhibiting and/or neutralizing antibodies against polypeptides or polynucleotides of the present invention, fragments or regions thereof, for both immunoassays directed to and therapy of disorders related to polynucleotides or polypeptides, including fragments thereof, of the present invention. Such antibodies, fragments, or regions, will preferably have an affinity for polynucleotides or polypeptides of the invention, including fragments thereof. Preferred binding affinities include those with a dissociation constant or Kd less than 5×10-2 M, 10-2 M, 5×10-3 M, 10-3 M, 5×10-4 M, 10-4 M, 5×10-5 M, 10-5 M, 5×10-6 M, 10-6 M, 5×10-7 M, 10-7 M, 5×10-8 M, 10-8 M, 5×10-9 M, 10-9 M, 5×10-10 M, 10-10 M, 5×10-11 M, 10-11 M, 5×10-12 M, 10-12 M, 5×10-13 M, 10-13 M, 5×10-14 M, 10-14 M, 5×10-15 M, and 10-15 M.

[0636] Antibodies directed against polypeptides of the present invention are useful for inhibiting allergic reactions in animals. For example, by administering a therapeutically acceptable dose of an antibody, or antibodies, of the present invention, or a cocktail of the present antibodies, or in combination with other antibodies of varying sources, the animal may not elicit an allergic response to antigens.

[0637] Likewise, one could envision cloning the gene encoding an antibody directed against a polypeptide of the present invention, said polypeptide having the potential to elicit an allergic and/or immune response in an organism, and transforming the organism with said antibody gene such that it is expressed (e.g., constitutively, inducibly, etc.) in the organism. Thus, the organism would effectively become resistant to an allergic response resulting from the ingestion or presence of such an immune/allergic reactive polypeptide. Moreover, such a use of the antibodies of the present invention may have particular utility in preventing and/or ameliorating autoimmune diseases and/or disorders, as such conditions are typically a result of antibodies being directed against endogenous proteins. For example, in the instance where the polypeptide of the present invention is responsible for modulating the immune response to auto-antigens, transforming the organism and/or individual with a construct comprising any of the promoters disclosed herein or otherwise known in the art, in addition, to a polynucleotide encoding the antibody directed against the polypeptide of the present invention could effective inhibit the organisms immune system from eliciting an immune response to the auto-antigen(s). Detailed descriptions of therapeutic and/or gene therapy applications of the present invention are provided elsewhere herein.

[0638] Alternatively, antibodies of the present invention could be produced in a plant (e.g., cloning the gene of the antibody directed against a polypeptide of the present invention, and transforming a plant with a suitable vector comprising said gene for constitutive expression of the antibody within the plant), and the plant subsequently ingested by an animal, thereby conferring temporary immunity to the animal for the specific antigen the antibody is directed towards (See, for example, U.S. Pat. Nos. 5,914,123 and 6,034,298).

[0639] In another embodiment, antibodies of the present invention, preferably polyclonal antibodies, more preferably monoclonal antibodies, and most preferably single-chain antibodies, can be used as a means of inhibiting gene expression of a particular gene, or genes, in a human, mammal, and/or other organism. See, for example, International Publication Number WO 00/05391, published Feb. 3, 2000, to Dow Agrosciences LLC. The application of such methods for the antibodies of the present invention are known in the art, and are more particularly described elsewhere herein.

[0640] In yet another embodiment, antibodies of the present invention may be useful for multimerizing the polypeptides of the present invention. For example, certain proteins may confer enhanced biological activity when present in a multimeric state (i.e., such enhanced activity may be due to the increased effective concentration of such proteins whereby more protein is available in a localized location).

Antibody-based Gene Therapy

[0641] In a specific embodiment, nucleic acids comprising sequences encoding antibodies or functional derivatives thereof, are administered to treat, inhibit or prevent a disease or disorder associated with aberrant expression and/or activity of a polypeptide of the invention, by way of gene therapy. Gene therapy refers to therapy performed by the administration to a subject of an expressed or expressible nucleic acid. In this embodiment of the invention, the nucleic acids produce their encoded protein that mediates a therapeutic effect.

[0642] Any of the methods for gene therapy available in the art can be used according to the present invention. Exemplary-methods are described below.

[0643] For general reviews of the methods of gene therapy, see Goldspiel et al., Clinical Pharmacy 12:488-505 (1993); Wu and Wu, Biotherapy 3:87-95 (1991); Tolstoshev, Ann. Rev. Pharmacol. Toxicol. 32:573-596 (1993); Mulligan, Science 260:926-932 (1993); and Morgan and Anderson, Ann. Rev. Biochem. 62:191-217 (1993); May, TIBTECH 11(5):155-215 (1993). Methods commonly known in the art of recombinant DNA technology which can be used are described in Ausubel et al. (eds.), Current Protocols in Molecular Biology, John Wiley & Sons, NY (1993); and Kriegler, Gene Transfer and Expression, A Laboratory Manual, Stockton Press, NY (1990).

[0644] In a preferred aspect, the compound comprises nucleic acid sequences encoding an antibody, said nucleic acid sequences being part of expression vectors that express the antibody or fragments or chimeric proteins or heavy or light chains thereof in a suitable host. In particular, such nucleic acid sequences have promoters operably linked to the antibody coding region, said promoter being inducible or constitutive, and, optionally, tissue- specific. In another particular embodiment, nucleic acid molecules are used in which the antibody coding sequences and any other desired sequences are flanked by regions that promote homologous recombination at a desired site in the genome, thus providing for intrachromosomal expression of the antibody encoding nucleic acids (Koller and Smithies, Proc. Natl. Acad. Sci. USA 86:8932-8935 (1989); Zijlstra et al., Nature 342:435-438 (1989). In specific embodiments, the expressed antibody molecule is a single chain antibody; alternatively, the nucleic acid sequences include sequences encoding both the heavy and light chains, or fragments thereof, of the antibody.

[0645] Delivery of the nucleic acids into a patient may be either direct, in which case the patient is directly exposed to the nucleic acid or nucleic acid- carrying vectors, or indirect, in which case, cells are first transformed with the nucleic acids in vitro, then transplanted into the patient. These two approaches are known, respectively, as in vivo or ex vivo gene therapy.

[0646] In a specific embodiment, the nucleic acid sequences are directly administered in vivo, where it is expressed to produce the encoded product. This can be accomplished by any of numerous methods known in the art, e.g., by constructing them as part of an appropriate nucleic acid expression vector and administering it so that they become intracellular, e.g., by infection using defective or attenuated retrovirals or other viral vectors (see U.S. Pat. No. 4,980,286), or by direct injection of naked DNA, or by use of microparticle bombardment (e.g., a gene gun; Biolistic, Dupont), or coating with lipids or cell-surface receptors or transfecting agents, encapsulation in liposomes, microparticles, or microcapsules, or by administering them in linkage to a peptide which is known to enter the nucleus, by administering it in linkage to a ligand subject to receptor-mediated endocytosis (see, e.g., Wu and Wu, J. Biol. Chem. 262:4429-4432 (1987)) (which can be used to target cell types specifically expressing the receptors), etc. In another embodiment, nucleic acid-ligand complexes can be formed in which the ligand comprises a fusogenic viral peptide to disrupt endosomes, allowing the nucleic acid to avoid lysosomal degradation. In yet another embodiment, the nucleic acid can be targeted in vivo for cell specific uptake and expression, by targeting a specific receptor (see, e.g., PCT Publications WO 92/06180; WO 92/22635; WO 92/20316; WO 93/14188, WO 93/20221). Alternatively, the nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination (Koller and Smithies, Proc. Natl. Acad. Sci. USA 86:8932-8935 (1989); Zijlstra et al., Nature 342:435-438 (1989)).

[0647] In a specific embodiment, viral vectors that contains nucleic acid sequences encoding an antibody of the invention are used. For example, a retroviral vector can be used (see Miller et al., Meth. Enzymol. 217:581-599 (1993)). These retroviral vectors contain the components necessary for the correct packaging of the viral genome and integration into the host cell DNA. The nucleic acid sequences encoding the antibody to be used in gene therapy are cloned into one or more vectors, which facilitates delivery of the gene into a patient. More detail about retroviral vectors can be found in Boesen et al., Biotherapy 6:291-302 (1994), which describes the use of a retroviral vector to deliver the mdr1 gene to hematopoietic stem cells in order to make the stem cells more resistant to chemotherapy. Other references illustrating the use of retroviral vectors in gene therapy are: Clowes et al., J. Clin. Invest. 93:644-651 (1994); Kiem et al., Blood 83:1467-1473 (1994); Salmons and Gunzberg, Human Gene Therapy 4:129-141 (1993); and Grossman and Wilson, Curr. Opin. in Genetics and Devel. 3:110-114 (1993).

[0648] Adenoviruses are other viral vectors that can be used in gene therapy. Adenoviruses are especially attractive vehicles for delivering genes to respiratory epithelia. Adenoviruses naturally infect respiratory epithelia where they cause a mild disease. Other targets for adenovirus-based delivery systems are liver, the central nervous system, endothelial cells, and muscle. Adenoviruses have the advantage of being capable of infecting non-dividing cells. Kozarsky and Wilson, Current Opinion in Genetics and Development 3:499-503 (1993) present a review of adenovirus-based gene therapy. Bout et al., Human Gene Therapy 5:3-10 (1994) demonstrated the use of adenovirus vectors to transfer genes to the respiratory epithelia of rhesus monkeys. Other instances of the use of adenoviruses in gene therapy can be found in Rosenfeld et al., Science 252:431-434 (1991); Rosenfeld et al., Cell 68:143-155 (1992); Mastrangeli et al., J. Clin. Invest. 91:225-234 (1993); PCT Publication WO 94/12649; and Wang, et al., Gene Therapy 2:775-783 (1995). In a preferred embodiment, adenovirus vectors are used.

[0649] Adeno-associated virus (AAV) has also been proposed for use in gene therapy (Walsh et al., Proc. Soc. Exp. Biol. Med. 204:289-300 (1993); U.S. Pat. No. 5,436,146).

[0650] Another approach to gene therapy involves transferring a gene to cells in tissue culture by such methods as electroporation, lipofection, calcium phosphate mediated transfection, or viral infection. Usually, the method of transfer includes the transfer of a selectable marker to the cells. The cells are then placed under selection to isolate those cells that have taken up and are expressing the transferred gene. Those cells are then delivered to a patient.

[0651] In this embodiment, the nucleic acid is introduced into a cell prior to administration in vivo of the resulting recombinant cell. Such introduction can be carried out by any method known in the art, including but not limited to transfection, electroporation, microinjection, infection with a viral or bacteriophage vector containing the nucleic acid sequences, cell fusion, chromosome-mediated gene transfer, microcell-mediated gene transfer, spheroplast fusion, etc. Numerous techniques are known in the art for the introduction of foreign genes into cells (see, e.g., Loeffler and Behr, Meth. Enzymol. 217:599-618 (1993); Cohen et al., Meth. Enzymol. 217:618-644 (1993); Cline, Pharmac. Ther. 29:69-92m (1985) and may be used in accordance with the present invention, provided that the necessary developmental and physiological functions of the recipient cells are not disrupted. The technique should provide for the stable transfer of the nucleic acid to the cell, so that the nucleic acid is expressible by the cell and preferably heritable and expressible by its cell progeny.

[0652] The resulting recombinant cells can be delivered to a patient by various methods known in the art. Recombinant blood cells (e.g., hematopoietic stem or progenitor cells) are preferably administered intravenously. The amount of cells envisioned for use depends on the desired effect, patient state, etc., and can be determined by one skilled in the art.

[0653] Cells into which a nucleic acid can be introduced for purposes of gene therapy encompass any desired, available cell type, and include but are not limited to epithelial cells, endothelial cells, keratinocytes, fibroblasts, muscle cells, hepatocytes; blood cells such as Tlymphocytes, Blymphocytes, monocytes, macrophages, neutrophils, eosinophils, megakaryocytes, granulocytes; various stem or progenitor cells, in particular hematopoietic stem or progenitor cells, e.g., as obtained from bone marrow, umbilical cord blood, peripheral blood, fetal liver, etc.

[0654] In a preferred embodiment, the cell used for gene therapy is autologous to the patient.

[0655] In an embodiment in which recombinant cells are used in gene therapy, nucleic acid sequences encoding an antibody are introduced into the cells such that they are expressible by the cells or their progeny, and the recombinant cells are then administered in vivo for therapeutic effect. In a specific embodiment, stem or progenitor cells are used. Any stem and/or progenitor cells which can be isolated and maintained in vitro can potentially be used in accordance with this embodiment of the present invention (see e.g. PCT Publication WO 94/08598; Stemple and Anderson, Cell 71:973-985 (1992); Rheinwald, Meth. Cell Bio. 21A:229 (1980); and Pittelkow and Scott, Mayo Clinic Proc. 61:771 (1986)).

[0656] In a specific embodiment, the nucleic acid to be introduced for purposes of gene therapy comprises an inducible promoter operably linked to the coding region, such that expression of the nucleic acid is controllable by controlling the presence or absence of the appropriate inducer of transcription. Demonstration of Therapeutic or Prophylactic Activity

[0657] The compounds or pharmaceutical compositions of the invention are preferably tested in vitro, and then in vivo for the desired therapeutic or prophylactic activity, prior to use in humans. For example, in vitro assays to demonstrate the therapeutic or prophylactic utility of a compound or pharmaceutical composition include, the effect of a compound on a cell line or a patient tissue sample. The effect of the compound or composition on the cell line and/or tissue sample can be determined utilizing techniques known to those of skill in the art including, but not limited to, rosette formation assays and cell lysis assays. In accordance with the invention, in vitro assays which can be used to determine whether administration of a specific compound is indicated, include in vitro cell culture assays in which a patient tissue sample is grown in culture, and exposed to or otherwise administered a compound, and the effect of such compound upon the tissue sample is observed.

Therapeutic/Prophylactic Administration and Compositions

[0658] The invention provides methods of treatment, inhibition and prophylaxis by administration to a subject of an effective amount of a compound or pharmaceutical composition of the invention, preferably an antibody of the invention. In a preferred aspect, the compound is substantially purified (e.g., substantially free from substances that limit its effect or produce undesired side-effects). The subject is preferably an animal, including but not limited to animals such as cows, pigs, horses, chickens, cats, dogs, etc., and is preferably a mammal, and most preferably human.

[0659] Formulations and methods of administration that can be employed when the compound comprises a nucleic acid or an immunoglobulin are described above; additional appropriate formulations and routes of administration can be selected from among those described herein below.

[0660] Various delivery systems are known and can be used to administer a compound of the invention, e.g., encapsulation in liposomes, microparticles, microcapsules, recombinant cells capable of expressing the compound, receptor-mediated endocytosis (see, e.g., Wu and Wu, J. Biol. Chem. 262:4429-4432 (1987)), construction of a nucleic acid as part of a retroviral or other vector, etc. Methods of introduction include but are not limited to intradermal, intramuscular, intraperitoneal, intravenous, subcutaneous, intranasal, epidural, and oral routes. The compounds or compositions may be administered by any convenient route, for example by infusion or bolus injection, by absorption through epithelial or mucocutaneous linings (e.g., oral mucosa, rectal and intestinal mucosa, etc.) and may be administered together with other biologically active agents. Administration can be systemic or local. In addition, it may be desirable to introduce the pharmaceutical compounds or compositions of the invention into the central nervous system by any suitable route, including intraventricular and intrathecal injection; intraventricular injection may be facilitated by an intraventricular catheter, for example, attached to a reservoir, such as an Ommaya reservoir. Pulmonary administration can also be employed, e.g., by use of an inhaler or nebulizer, and formulation with an aerosolizing agent.

[0661] In a specific embodiment, it may be desirable to administer the pharmaceutical compounds or compositions of the invention locally to the area in need of treatment; this may be achieved by, for example, and not by way of limitation, local infusion during surgery, topical application, e.g., in conjunction with a wound dressing after surgery, by injection, by means of a catheter, by means of a suppository, or by means of an implant, said implant being of a porous, non-porous, or gelatinous material, including membranes, such as sialastic membranes, or fibers. Preferably, when administering a protein, including an antibody, of the invention, care must be taken to use materials to which the protein does not absorb.

[0662] In another embodiment, the compound or composition can be delivered in a vesicle, in particular a liposome (see Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, N.Y., pp. 353-365 (1989); Lopez-Berestein, ibid., pp. 317-327; see generally ibid.)

[0663] In yet another embodiment, the compound or composition can be delivered in a controlled release system. In one embodiment, a pump may be used (see Langer, supra; Sefton, CRC Crit. Ref. Biomed. Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); Saudek et al., N. Engl. J. Med. 321:574 (1989)). In another embodiment, polymeric materials can be used (see Medical Applications of Controlled Release, Langer and Wise (eds.), CRC Pres., Boca Raton, Fla. (1974); Controlled Drug Bioavailability, Drug Product Design and Performance, Smolen and Ball (eds.), Wiley, N.Y. (1984); Ranger and Peppas, J., Macromol. Sci. Rev. Macromol. Chem. 23:61 (1983); see also Levy et al., Science 228:190 (1985); During et al., Ann. Neurol. 25:351 (1989); Howard et al., J. Neurosurg. 71:105 (1989)). In yet another embodiment, a controlled release system can be placed in proximity of the therapeutic target, i.e., the brain, thus requiring only a fraction of the systemic dose (see, e.g., Goodson, in Medical Applications of Controlled Release, supra, vol. 2, pp. 115-138 (1984)).

[0664] Other controlled release systems are discussed in the review by Langer (Science 249:1527-1533 (1990)).

[0665] In a specific embodiment where the compound of the invention is a nucleic acid encoding a protein, the nucleic acid can be administered in vivo to promote expression of its encoded protein, by constructing it as part of an appropriate nucleic acid expression vector and administering it so that it becomes intracellular, e.g., by use of a retroviral vector (see U.S. Pat. No. 4,980,286), or by direct injection, or by use of microparticle bombardment (e.g., a gene gun; Biolistic, Dupont), or coating with lipids or cell-surface receptors or transfecting agents, or by administering it in linkage to a homeobox-like peptide which is known to enter the nucleus (see e.g., Joliot et al., Proc. Natl. Acad. Sci. USA 88:1864-1868 (1991)), etc. Alternatively, a nucleic acid can be introduced intracellularly and incorporated within host cell DNA for expression, by homologous recombination.

[0666] The present invention also provides pharmaceutical compositions. Such compositions comprise a therapeutically effective amount of a compound, and a pharmaceutically acceptable carrier. In a specific embodiment, the term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term “carrier” refers to a diluent, adjuvant, excipient, or vehicle with which the therapeutic is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water is a preferred carrier when the pharmaceutical composition is administered intravenously. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. Suitable pharmaceutical excipients include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The composition, if desired, can also contain minor amounts of wetting or emulsifying agents, or pH buffering agents. These compositions can take the form of solutions, suspensions, emulsion, tablets, pills, capsules, powders, sustained-release formulations and the like. The composition can be formulated as a suppository, with traditional binders and carriers such as triglycerides. Oral formulation can include standard carriers such as pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, etc. Examples of suitable pharmaceutical carriers are described in “Remington's Pharmaceutical Sciences” by E. W. Martin. Such compositions will contain a therapeutically effective amount of the compound, preferably in purified form, together with a suitable amount of carrier so as to provide the form for proper administration to the patient. The formulation should suit the mode of administration.

[0667] In a preferred embodiment, the composition is formulated in accordance with routine procedures as a pharmaceutical composition adapted for intravenous administration to human beings. Typically, compositions for intravenous administration are solutions in sterile isotonic aqueous buffer. Where necessary, the composition may also include a solubilizing agent and a local anesthetic such as lignocaine to ease pain at the site of the injection. Generally, the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water free concentrate in a hermetically sealed container such as an ampoule or sachette indicating the quantity of active agent. Where the composition is to be administered by infusion, it can be dispensed with an infusion bottle containing sterile pharmaceutical grade water or saline. Where the composition is administered by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.

[0668] The compounds of the invention can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.

[0669] The amount of the compound of the invention which will be effective in the treatment, inhibition and prevention of a disease or disorder associated with aberrant expression and/or activity of a polypeptide of the invention can be determined by standard clinical techniques. In addition, in vitro assays may optionally be employed to help identify optimal dosage ranges. The precise dose to be employed in the formulation will also depend on the route of administration, and the seriousness of the disease or disorder, and should be decided according to the judgment of the practitioner and each patient's circumstances. Effective doses may be extrapolated from dose-response curves derived from in vitro or animal model test systems.

[0670] For antibodies, the dosage administered to a patient is typically 0.1 mg/kg to 100 mg/kg of the patient's body weight. Preferably, the dosage administered to a patient is between 0.1 mg/kg and 20 mg/kg of the patient's body weight, more preferably 1 mg/kg to 10 mg/kg of the patient's body weight. Generally, human antibodies have a longer half-life within the human body than antibodies from other species due to the immune response to the foreign polypeptides. Thus, lower dosages of human antibodies and less frequent administration is often possible. Further, the dosage and frequency of administration of antibodies of the invention may be reduced by enhancing uptake and tissue penetration (e.g., into the brain) of the antibodies by modifications such as, for example, lipidation.

[0671] The invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention. Optionally associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.

Diagnosis and Imaging With Antibodies

[0672] Labeled antibodies, and derivatives and analogs thereof, which specifically bind to a polypeptide of interest can be used for diagnostic purposes to detect, diagnose, or monitor diseases, disorders, and/or conditions associated with the aberrant expression and/or activity of a polypeptide of the invention. The invention provides for the detection of aberrant expression of a polypeptide of interest, comprising (a) assaying the expression of the polypeptide of interest in cells or body fluid of an individual using one or more antibodies specific to the polypeptide interest and (b) comparing the level of gene expression with a standard gene expression level, whereby an increase or decrease in the assayed polypeptide gene expression level compared to the standard expression level is indicative of aberrant expression.

[0673] The invention provides a diagnostic assay for diagnosing a disorder, comprising (a) assaying the expression of the polypeptide of interest in cells or body fluid of an individual using one or more antibodies specific to the polypeptide interest and (b) comparing the level of gene expression with a standard gene expression level, whereby an increase or decrease in the assayed polypeptide gene expression level compared to the standard expression level is indicative of a particular disorder. With respect to cancer, the presence of a relatively high amount of transcript in biopsied tissue from an individual may indicate a predisposition for the development of the disease, or may provide a means for detecting the disease prior to the appearance of actual clinical symptoms. A more definitive diagnosis of this type may allow health professionals to employ preventative measures or aggressive treatment earlier thereby preventing the development or further progression of the cancer.

[0674] Antibodies of the invention can be used to assay protein levels in a biological sample using classical immunohistological methods known to those of skill in the art (e.g., see Jalkanen, et al., J. Cell. Biol. 101:976-985 (1985); Jalkanen, et al., J. Cell. Biol. 105:3087-3096 (1987)). Other antibody-based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA). Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase; radioisotopes, such as iodine (125I, 121I), carbon (14C), sulfur (35S), tritium (3H), indium (112In), and technetium (99Tc); luminescent labels, such as luminol; and fluorescent labels, such as fluorescein and rhodamine, and biotin.

[0675] One aspect of the invention is the detection and diagnosis of a disease or disorder associated with aberrant expression of a polypeptide of interest in an animal, preferably a mammal and most preferably a human. In one embodiment, diagnosis comprises: a) administering (for example, parenterally, subcutaneously, or intraperitoneally) to a subject an effective amount of a labeled molecule which specifically binds to the polypeptide of interest; b) waiting for a time interval following the administering for permitting the labeled molecule to preferentially concentrate at sites in the subject where the polypeptide is expressed (and for unbound labeled molecule to be cleared to background level); c) determining background level; and d) detecting the labeled molecule in the subject, such that detection of labeled molecule above the background level indicates that the subject has a particular disease or disorder associated with aberrant expression of the polypeptide of interest. Background level can be determined by various methods including, comparing the amount of labeled molecule detected to a standard value previously determined for a particular system.

[0676] It will be understood in the art that the size of the subject and the imaging system used will determine the quantity of imaging moiety needed to produce diagnostic images. In the case of a radioisotope moiety, for a human subject, the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of 99mTc. The labeled antibody or antibody fragment will then preferentially accumulate at the location of cells which contain the specific protein. In vivo tumor imaging is described in S. W. Burchiel et al., “Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments.” (Chapter 13 in Tumor Imaging: The Radiochemical Detection of Cancer, S. W. Burchiel and B. A. Rhodes, eds., Masson Publishing Inc. (1982).

[0677] Depending on several variables, including the type of label used and the mode of administration, the time interval following the administration for permitting the labeled molecule to preferentially concentrate at sites in the subject and for unbound labeled molecule to be cleared to background level is 6 to 48 hours or 6 to 24 hours or 6 to 12 hours. In another embodiment the time interval following administration is 5 to 20 days or 5 to 10 days.

[0678] In an embodiment, monitoring of the disease or disorder is carried out by repeating the method for diagnosing the disease or disease, for example, one month after initial diagnosis, six months after initial diagnosis, one year after initial diagnosis, etc.

[0679] Presence of the labeled molecule can be detected in the patient using methods known in the art for in vivo scanning. These methods depend upon the type of label used. Skilled artisans will be able to determine the appropriate method for detecting a particular label. Methods and devices that may be used in the diagnostic methods of the invention include, but are not limited to, computed tomography (CT), whole body scan such as position emission tomography (PET), magnetic resonance imaging (MRI), and sonography.

[0680] In a specific embodiment, the molecule is labeled with a radioisotope and is detected in the patient using a radiation responsive surgical instrument (Thurston et al., U.S. Pat. No. 5,441,050). In another embodiment, the molecule is labeled with a fluorescent compound and is detected in the patient using a fluorescence responsive scanning instrument. In another embodiment, the molecule is labeled with a positron emitting metal and is detected in the patent using positron emission-tomography. In yet another embodiment, the molecule is labeled with a paramagnetic label and is detected in a patient using magnetic resonance imaging (MRI).

Kits

[0681] The present invention provides kits that can be used in the above methods. In one embodiment, a kit comprises an antibody of the invention, preferably a purified antibody, in one or more containers. In a specific embodiment, the kits of the present invention contain a substantially isolated polypeptide comprising an epitope which is specifically immunoreactive with an antibody included in the kit. Preferably, the kits of the present invention further comprise a control antibody which does not react with the polypeptide of interest. In another specific embodiment, the kits of the present invention contain a means for detecting the binding of an antibody to a polypeptide of interest (e.g., the antibody may be conjugated to a detectable substrate such as a fluorescent compound, an enzymatic substrate, a radioactive compound or a luminescent compound, or a second antibody which recognizes the first antibody may be conjugated to a detectable substrate).

[0682] In another specific embodiment of the present invention, the kit is a diagnostic kit for use in screening serum containing antibodies specific against proliferative and/or cancerous polynucleotides and polypeptides. Such a kit may include a control antibody that does not react with the polypeptide of interest. Such a kit may include a substantially isolated polypeptide antigen comprising an epitope which is specifically immunoreactive with at least one anti-polypeptide antigen antibody. Further, such a kit includes means for detecting the binding of said antibody to the antigen (e.g., the antibody may be conjugated to a fluorescent compound such as fluorescein or rhodamine which can be detected by flow cytometry). In specific embodiments, the kit may include a recombinantly produced or chemically synthesized polypeptide antigen. The polypeptide antigen of the kit may also be attached to a solid support.

[0683] In a more specific embodiment the detecting means of the above-described kit includes a solid support to which said polypeptide antigen is attached. Such a kit may also include a non-attached reporter-labeled anti-human antibody. In this embodiment, binding of the antibody to the polypeptide antigen can be detected by binding of the said reporter-labeled antibody.

[0684] In an additional embodiment, the invention includes a diagnostic kit for use in screening serum containing antigens of the polypeptide of the invention. The diagnostic kit includes a substantially isolated antibody specifically immunoreactive with polypeptide or polynucleotide antigens, and means for detecting the binding of the polynucleotide or polypeptide antigen to the antibody. In one embodiment, the antibody is attached to a solid support. In a specific embodiment, the antibody may be a monoclonal antibody. The detecting means of the kit may include a second, labeled monoclonal antibody. Alternatively, or in addition, the detecting means may include a labeled, competing antigen.

[0685] In one diagnostic configuration, test serum is reacted with a solid phase reagent having a surface-bound antigen obtained by the methods of the present invention. After binding with specific antigen antibody to the reagent and removing unbound serum components by washing, the reagent is reacted with reporter-labeled anti-human antibody to bind reporter to the reagent in proportion to the amount of bound anti-antigen antibody on the solid support. The reagent is again washed to remove unbound labeled antibody, and the amount of reporter associated with the reagent is determined. Typically, the reporter is an enzyme which is detected by incubating the solid phase in the presence of a suitable fluorometric, luminescent or colorimetric substrate (Sigma, St. Louis, Mo.).

[0686] The solid surface reagent in the above assay is prepared by known techniques for attaching protein material to solid support material, such as polymeric beads, dip sticks, 96-well plate or filter material. These attachment methods generally include non-specific adsorption of the protein to the support or covalent attachment of the protein, typically through a free amine group, to a chemically reactive group on the solid support, such as an activated carboxyl, hydroxyl, or aldehyde group. Alternatively, streptavidin coated plates can be used in conjunction with biotinylated antigen(s).

[0687] Thus, the invention provides an assay system or kit for carrying out this diagnostic method. The kit generally includes a support with surface-bound recombinant antigens, and a reporter-labeled anti-human antibody for detecting surface-bound anti-antigen antibody.

Fusion Proteins

[0688] Any polypeptide of the present invention can be used to generate fusion proteins. For example, the polypeptide of the present invention, when fused to a second protein, can be used as an antigenic tag. Antibodies raised against the polypeptide of the present invention can be used to indirectly detect the second protein by binding to the polypeptide. Moreover, because certain proteins target cellular locations based on trafficking signals, the polypeptides of the present invention can be used as targeting molecules once fused to other proteins.

[0689] Examples of domains that can be fused to polypeptides of the present invention include not only heterologous signal sequences, but also other heterologous functional regions. The fusion does not necessarily need to be direct, but may occur through linker sequences.

[0690] Moreover, fusion proteins may also be engineered to improve characteristics of the polypeptide of the present invention. For instance, a region of additional amino acids, particularly charged amino acids, may be added to the N-terminus of the polypeptide to improve stability and persistence during purification from the host cell or subsequent handling and storage. Peptide moieties may be added to the polypeptide to facilitate purification. Such regions may be removed prior to final preparation of the polypeptide. Similarly, peptide cleavage sites can be introduced in-between such peptide moieties, which could additionally be subjected to protease activity to remove said peptide(s) from the protein of the present invention. The addition of peptide moieties, including peptide cleavage sites, to facilitate handling of polypeptides are familiar and routine techniques in the art.

[0691] Moreover, polypeptides of the present invention, including fragments, and specifically epitopes, can be combined with parts of the constant domain of immunoglobulins (IgA, IgE, IgG, IgM) or portions thereof (CH1, CH2, CH3, and any combination thereof, including both entire domains and portions thereof), resulting in chimeric polypeptides. These fusion proteins facilitate purification and show an increased half-life in vivo. One reported example describes chimeric proteins consisting of the first two domains of the human CD4-polypeptide and various domains of the constant regions of the heavy or light chains of mammalian immunoglobulins. (EP A 394,827; Traunecker et al., Nature 331:84-86 (1988).) Fusion proteins having disulfide-linked dimeric structures (due to the IgG) can also be more efficient in binding and neutralizing other molecules, than the monomeric secreted protein or protein fragment alone. (Fountoulakis et al., J. Biochem. 270:3958-3964 (1995).)

[0692] Similarly, EP-A-O 464 533 (Canadian counterpart 2045869) discloses fusion proteins comprising various portions of the constant region of immunoglobulin molecules together with another human protein or part thereof. In many cases, the Fc part in a fusion protein is beneficial in therapy and diagnosis, and thus can result in, for example, improved pharmacokinetic properties. (EP-A 0232 262.) Alternatively, deleting the Fc part after the fusion protein has been expressed, detected, and purified, would be desired. For example, the Fe portion may hinder therapy and diagnosis if the fusion protein is used as an antigen for immunizations. In drug discovery, for example, human proteins, such as hIL-5, have been fused with Fc portions for the purpose of high-throughput screening assays to identify antagonists of hIL-5. (See, D. Bennett et al., J. Molecular Recognition 8:52-58 (1995); K. Johanson et al., J. Biol. Chem. 270:9459-9471 (1995).)

[0693] Moreover, the polypeptides of the present invention can be fused to marker sequences (also referred to as “tags”). Due to the availability of antibodies specific to such “tags”, purification of the fused polypeptide of the invention, and/or its identification is significantly facilitated since antibodies specific to the polypeptides of the invention are not required. Such purification may be in the form of an affinity purification whereby an anti-tag antibody or another type of affinity matrix (e.g., anti-tag antibody attached to the matrix of a flow-thru column) that binds to the epitope tag is present. In preferred embodiments, the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311), among others, many of which are commercially available. As described in Gentz et al., Proc. Natl. Acad. Sci. USA 86:821-824 (1989), for instance, hexa-histidine provides for convenient purification of the fusion protein. Another peptide tag useful for purification, the “HA” tag, corresponds to an epitope derived from the influenza hemagglutinin protein. (Wilson et al., Cell 37:767 (1984)).

[0694] The skilled artisan would acknowledge the existence of other “tags” which could be readily substituted for the tags referred to supra for purification and/or identification of polypeptides of the present invention (Jones C., et al., J Chromatogr A. 707(1):3-22 (1995)). For example, the c-myc tag and the 8F9, 3C7, 6E10, G4m B7 and 9E10 antibodies thereto (Evan et al., Molecular and Cellular Biology 5:3610-3616 (1985)); the Herpes Simplex virus glycoprotein D (gD) tag and its antibody (Paborsky et al., Protein Engineering, 3(6):547-553 (1990), the Flag-peptide—i.e., the octapeptide sequence DYKDDDDK (SEQ ID NO: 157), (Hopp et al., Biotech. 6:1204-1210 (1988); the KT3 epitope peptide (Martin et al., Science, 255:192-194 (1992)); a-tubulin epitope peptide (Skinner et al., J. Biol. Chem., 266:15136-15166, (1991)); the T7 gene 10 protein peptide tag (Lutz-Freyermuth et al., Proc. Natl. Sci. USA, 87:6363-6397 (1990)), the FITC epitope (Zymed, Inc.), the GFP epitope (Zymed, Inc.), and the Rhodamine epitope (Zymed, Inc.).

[0695] The present invention also encompasses the attachment of up to nine codons encoding a repeating series of up to nine arginine amino acids to the coding region of a polynucleotide of the present invention. The invention also encompasses chemically derivitizing a polypeptide of the present invention with a repeating series of up to nine arginine amino acids. Such a tag, when attached to a polypeptide, has recently been shown to serve as a universal pass, allowing compounds access to the interior of cells without additional derivitization or manipulation (Wender, P., et al., unpublished data).

[0696] Protein fusions involving polypeptides of the present invention, including fragments and/or variants thereof, can be used for the following, non-limiting examples, subcellular localization of proteins, determination of protein-protein interactions via immunoprecipitation, purification of proteins via affinity chromatography, functional and/or structural characterization of protein. The present invention also encompasses the application of hapten specific antibodies for any of the uses referenced above for epitope fusion proteins. For example, the polypeptides of the present invention could be chemically derivatized to attach hapten molecules (e.g., DNP, (Zymed, Inc.)). Due to the availability of monoclonal antibodies specific to such haptens, the protein could be readily purified using immunoprecipation, for example.

[0697] Polypeptides of the present invention, including fragments and/or variants thereof, in addition to, antibodies directed against such polypeptides, fragments, and/or variants, may be fused to any of a number of known, and yet to be determined, toxins, such as ricin, saporin (Mashiba H, et al., Ann. N. Y. Acad. Sci. 1999;886:233-5), or HC toxin (Tonukari N J, et al., Plant Cell. 2000 Feb;12(2):237-248), for example. Such fusions could be used to deliver the toxins to desired tissues for which a ligand or a protein capable of binding to the polypeptides of the invention exists.

[0698] The invention encompasses the fusion of antibodies directed against polypeptides of the present invention, including variants and fragments thereof, to said toxins for delivering the toxin to specific locations in a cell, to specific tissues, and/or to specific species. Such bifunctional antibodies are known in the art, though a review describing additional advantageous fusions, including citations for methods of production, can be found in P. J. Hudson, Curr. Opp. In. Imm. 11:548-557, (1999); this publication, in addition to the references cited therein, are hereby incorporated by reference in their entirety herein. In this context, the term “toxin” may be expanded to include any heterologous protein, a small molecule, radionucleotides, cytotoxic drugs, liposomes, adhesion molecules, glycoproteins, ligands, cell or tissue-specific ligands, enzymes, of bioactive agents, biological response modifiers, anti-fungal agents, hormones, steroids, vitarmins, peptides, peptide analogs, anti-allergenic agents, anti-tubercular agents, anti-viral agents, antibiotics, anti-protozoan agents, chelates, radioactive particles, radioactive ions, X-ray contrast agents, monoclonal antibodies, polyclonal antibodies and genetic material. In view of the present disclosure, one skilled in the art could determine whether any particular “toxin” could be used in the compounds of the present invention. Examples of suitable “toxins” listed above are exemplary only and are not intended to limit the “toxins” that may be used in the present invention.

[0699] Thus, any of these above fusions can be engineered using the polynucleotides or the polypeptides of the present invention.

Vectors, Host Cells, and Protein Production

[0700] The present invention also relates to vectors containing the polynucleotide of the present invention, host cells, and the production of polypeptides by recombinant techniques. The vector may be, for example, a phage, plasmid, viral, or retroviral vector. Retroviral vectors may be replication competent or replication defective. In the latter case, viral propagation generally will occur only in complementing host cells.

[0701] The polynucleotides may be joined to a vector containing a selectable marker for propagation in a host. Generally, a plasnad vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. If the vector is a virus, it may be packaged in vitro using an appropriate packaging cell line and then transduced into host cells.

[0702] The polynucleotide insert should be operatively linked to an appropriate promoter, such as the phage lambda PL promoter, the E. coli lac, trp, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few. Other suitable promoters will be known to the skilled artisan. The expression constructs will further contain sites for transcription initiation, termination, and, in the transcribed region, a ribosome binding site for translation. The coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated.

[0703] As indicated, the expression vectors will preferably include at least one selectable marker. Such markers include dihydrofolate reductase, G418 or neomycin resistance for eukaryotic cell culture and tetracycline, kanamycin or ampicillin resistance genes for culturing in E. coli and other bacteria. Representative examples of appropriate hosts include, but are not limited to, bacterial cells, such as E. coli, Streptomyces and Salmonella typhimurium cells; fungal cells, such as yeast cells (e.g., Saccharomyces cerevisiae or Pichia pastoris (ATCC Accession No. 201178)); insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, 293, and Bowes melanoma cells; and plant cells. Appropriate culture mediums and conditions for the above-described host cells are known in the art.

[0704] Among vectors preferred for use in bacteria include pQE70, pQE60 and pQE-9, available from QIAGEN, Inc.; pBluescript vectors, Phagescript vectors, pNH8A, pNH16a, pNH18A, pNH46A, available from Stratagene Cloning Systems, Inc.; and ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 available from Pharmacia Biotech, Inc. Among preferred eukaryotic vectors are pWLNEO, pSV2CAT, pOG44, pXT1 and pSG available from Stratagene; and pSVK3, pBPV, pMSG and pSVL available from Pharmacia. Preferred expression vectors for use in yeast systems include, but are not limited to pYES2, pYD1, pTEF1/Zeo, pYES2/GS, pPICZ, pGAPZ, pGAPZalph, pPIC9, pPIC3.5, pHIL-D2, pHIL-S1, pPIC3.5K, pPIC9K, and PAO815 (all available from Invitrogen, Carlsbad, Calif.). Other suitable vectors will be readily apparent to the skilled artisan.

[0705] Introduction of the construct into the host cell can be effected by calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection, or other methods. Such methods are described in many standard laboratory manuals, such as Davis et al., Basic Methods In Molecular Biology (1986). It is specifically contemplated that the polypeptides of the present invention may in fact be expressed by a host cell lacking a recombinant vector.

[0706] A polypeptide of this invention can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, high performance liquid chromatography (“HPLC”) is employed for purification.

[0707] Polypeptides of the present invention, and preferably the secreted form, can also be recovered from: products purified from natural sources, including bodily fluids, tissues and cells, whether directly isolated or cultured; products of chemical synthetic procedures; and products produced by recombinant techniques from a prokaryotic or eukaryotic host, including, for example, bacterial, yeast, higher plant, insect, and mammalian cells. Depending upon the host employed in a recombinant production procedure, the polypeptides of the present invention may be glycosylated or may be non-glycosylated. In addition, polypeptides of the invention may also include an initial modified methionine residue, in some cases as a result of host-mediated processes. Thus, it is well known in the art that the N-terminal methionine encoded by the translation initiation codon generally is removed with high efficiency from any protein after translation in all eukaryotic cells. While the N-terminal methionine on most proteins also is efficiently removed in most prokaryotes, for some proteins, this prokaryotic removal process is inefficient, depending on the nature of the amino acid to which the N-terminal methionine is covalently linked.

[0708] In one embodiment, the yeast Pichia pastoris is used to express the polypeptide of the present invention in a eukaryotic system. Pichia pastoris is a methylotrophic yeast which can metabolize methanol as its sole carbon source. A main step in the methanol metabolization pathway is the oxidation of methanol to formaldehyde using O2. This reaction is catalyzed by the enzyme alcohol oxidase. In order to metabolize methanol as its sole carbon source, Pichia pastoris must generate high levels of alcohol oxidase due, in part, to the relatively low affinity of alcohol oxidase for O2. Consequently, in a growth medium depending on methanol as a main carbon source, the promoter region of one of the two alcohol oxidase genes (AOX1) is highly active. In the presence of methanol, alcohol oxidase produced from the AOX1 gene comprises up to approximately 30% of the total soluble protein in Pichia pastoris. See, Ellis, S. B., et al., Mol. Cell. Biol. 5:1111-21 (1985); Koutz, P. J, et al., Yeast 5:167-77 (1989); Tschopp, J. F., et al., Nucl. Acids Res. 15:3859-76 (1987). Thus, a heterologous coding sequence, such as, for example, a polynucleotide of the present invention, under the transcriptional regulation of all or part of the AOX1 regulatory sequence is expressed at exceptionally high levels in Pichia yeast grown in the presence of methanol.

[0709] In one example, the plasmid vector pPIC9K is used to express DNA encoding a polypeptide of the invention, as set forth herein, in a Pichea yeast system essentially as described in “Pichia Protocols: Methods in Molecular Biology,” D. R. Higgins and J. Cregg, eds. The Humana Press, Totowa, N.J., 1998. This expression vector allows expression and secretion of a protein of the invention by virtue of the strong AOX1 promoter linked to the Pichia pastoris alkaline phosphatase (PHO) secretory signal peptide (i.e., leader) located upstream of a multiple cloning site.

[0710] Many other yeast vectors could be used in place of pPIC9K, such as, pYES2, pYD1, pTEF1/Zeo, pYES2/GS, pPICZ, pGAPZ, pGAPZalpha, pPIC9, pPIC3.5, pHIL-D2, pHIL-S1, pPIC3.5K, and PAO815, as one skilled in the art would readily appreciate, as long as the proposed expression construct provides appropriately located signals for transcription, translation, secretion (if desired), and the like, including an in-frame AUG, as required.

[0711] In another embodiment, high-level expression of a heterologous coding sequence, such as, for example, a polynucleotide of the present invention, may be achieved by cloning the heterologous polynucleotide of the invention into an expression vector such as, for example, pGAPZ or pGAPZalpha, and growing the yeast culture in the absence of methanol.

[0712] In addition to encompassing host cells containing the vector constructs discussed herein, the invention also encompasses primary, secondary, and immortalized host cells of vertebrate origin, particularly mammalian origin, that have been engineered to delete or replace endogenous genetic material (e.g., coding sequence), and/or to include genetic material (e.g., heterologous polynucleotide sequences) that is operably associated with the polynucleotides of the invention, and which activates, alters, and/or amplifies endogenous polynucleotides. For example, techniques known in the art may be used to operably associate heterologous control regions (e.g., promoter and/or enhancer) and endogenous polynucleotide sequences via homologous recombination, resulting in the formation of a new transcription unit (see, e.g., U.S. Pat. No. 5,641,670, issued Jun. 24, 1997; U.S. Pat. No. 5,733,761, issued Mar. 31, 1998; International Publication No. WO 96/29411, published Sep. 26, 1996; International Publication No. WO 94/12650, published Aug. 4, 1994; Koller et al., Proc. Natl. Acad. Sci. USA 86:8932-8935 (1989); and Zijlstra et al., Nature 342:435-438 (1989), the disclosures of each of which are incorporated by reference in their entireties).

[0713] In addition, polypeptides of the invention can be chemically synthesized using techniques known in the art (e.g., see Creighton, 1983, Proteins: Structures and Molecular Principles, W.H. Freeman & Co., N.Y., and Hunkapiller et al., Nature, 310:105-111 (1984)). For example, a polypeptide corresponding to a fragment of a polypeptide sequence of the invention can be synthesized by use of a peptide synthesizer. Furthermore, if desired, nonclassical amino acids or chemical amino acid analogs can be introduced as a substitution or addition into the polypeptide sequence. Non-classical amino acids include, but are not limited to, to the D-isomers of the common amino acids, 2,4-diaminobutyric acid, a-amino isobutyric acid, 4-aminobutyric acid, Abu, 2-amino butyric acid, g-Abu, e-Ahx, 6-amino hexanoic acid, Aib, 2-amino isobutyric acid, 3-amino propionic acid, ornithine, norleucine, norvaline, hydroxyproline, sarcosine, citrulline, homocitrulline, cysteic acid, t-butylglycine, t-butylalanine, phenylglycine, cyclohexylalanine, b-alanine, fluoro-amino acids, designer amino acids such as b-methyl amino acids, Ca-methyl amino acids, Na-methyl amino acids, and amino acid analogs in general. Furthermore, the amino acid can be D (dextrorotary) or L (levorotary).

[0714] The invention encompasses polypeptides which are differentially modified during or after translation, e.g., by glycosylation, acetylation, phosphorylation, amidation, derivatization by known protecting/blocking groups, proteolytic cleavage, linkage to an antibody molecule or other cellular ligand, etc. Any of numerous chemical modifications may be carried out by known techniques, including but not limited, to specific chemical cleavage by cyanogen bromide, trypsin, chymotrypsin, papain, V8 protease, NaBH4; acetylation, formylation, oxidation, reduction; metabolic synthesis in the presence of tunicamycin; etc.

[0715] Additional post-translational modifications encompassed by the invention include, for example, e.g., N-linked or O-linked carbohydrate chains, processing of N-terminal or C-terminal ends), attachment of chemical moieties to the amino acid backbone, chemical modifications of N-linked or O-linked carbohydrate chains, and addition or deletion of an N-terminal methionine residue as a result of prokaryotic host cell expression. The polypeptides may also be modified with a detectable label, such as an enzymatic, fluorescent, isotopic or affinity label to allow for detection and isolation of the protein, the addition of epitope tagged peptide fragments (e.g., FLAG, HA, GST, thioredoxin, maltose binding protein, etc.), attachment of affinity tags such as biotin and/or streptavidin, the covalent attachment of chemical moieties to the amino acid backbone, N- or C-terminal processing of the polypeptides ends (e.g., proteolytic processing), deletion of the N-terminal methionine residue, etc.

[0716] Also provided by the invention are chemically modified derivatives of the polypeptides of the invention which may provide additional advantages such as increased solubility, stability and circulating time of the polypeptide, or decreased immunogenicity (see U.S. Pat. No. 4,179,337). The chemical moieties for derivitization may be selected from water soluble polymers such as polyethylene glycol, ethylene glycol/propylene glycol copolymers, carboxymethylcellulose, dextran, polyvinyl alcohol and the like. The polypeptides may be modified at random positions within the molecule, or at predetermined positions within the molecule and may include one, two, three or more attached chemical moieties.

[0717] The invention further encompasses chemical derivitization of the polypeptides of the present invention, preferably where the chemical is a hydrophilic polymer residue. Exemplary hydrophilic polymers, including derivatives, may be those that include polymers in which the repeating units contain one or more hydroxy groups (polyhydroxy polymers), including, for example, poly(vinyl alcohol); polymers in which the repeating units contain one or more amino groups (polyamine polymers), including, for example, peptides, polypeptides, proteins and lipoproteins, such as albumin and natural lipoproteins; polymers in which the repeating units contain one or more carboxy groups (polycarboxy polymers), including, for example, carboxymethylcellulose, alginic acid and salts thereof, such as sodium and calcium alginate, glycosaminoglycans and salts thereof, including salts of hyaluronic acid, phosphorylated and sulfonated derivatives of carbohydrates, genetic material, such as interleukin-2 and interferon, and phosphorothioate oligomers; and polymers in which the repeating units contain one or more saccharide moieties (polysaccharide polymers), including, for example, carbohydrates.

[0718] The molecular weight of the hydrophilic polymers may vary, and is generally about 50 to about 5,000,000, with polymers having a molecular weight of about 100 to about 50,000 being preferred. The polymers may be branched or unbranched. More preferred polymers have a molecular weight of about 150 to about 10,000, with molecular weights of 200 to about 8,000 being even more preferred.

[0719] For polyethylene glycol, the preferred molecular weight is between about 1 kDa and about 100 kDa (the term “about” indicating that in preparations of polyethylene glycol, some molecules will weigh more, some less, than the stated molecular weight) for ease in handling and manufacturing. Other sizes may be used, depending on the desired therapeutic profile (e.g., the duration of sustained release desired, the effects, if any on biological activity, the ease in handling, the degree or lack of antigenicity and other known effects of the polyethylene glycol to a therapeutic protein or analog).

[0720] Additional preferred polymers which may be used to derivatize polypeptides of the invention, include, for example, poly(ethylene glycol) (PEG), poly(vinylpyrrolidine), polyoxomers, polysorbate and poly(vinyl alcohol), with PEG polymers being particularly preferred. Preferred among the PEG polymers are PEG polymers having a molecular weight of from about 100 to about 10,000. More preferably, the PEG polymers have a molecular weight of from about 200 to about 8,000, with PEG 2,000, PEG 5,000 and PEG 8,000, which have molecular weights of 2,000, 5,000 and 8,000, respectively, being even more preferred. Other suitable hydrophilic polymers, in addition to those exemplified above, will be readily apparent to one skilled in the art based on the present disclosure. Generally, the polymers used may include polymers that can be attached to the polypeptides of the invention via alkylation or acylation reactions.

[0721] The polyethylene glycol molecules (or other chemical moieties) should be attached to the protein with consideration of effects on functional or antigenic domains of the protein. There are a number of attachment methods available to those skilled in the art, e.g., EP 0 401 384, herein incorporated by reference (coupling PEG to G-CSF), see also Malik et al., Exp. Hematol. 20:1028-1035 (1992) (reporting pegylation of GM-CSF using tresyl chloride). For example, polyethylene glycol may be covalently bound through amino acid residues via a reactive group, such as, a free amino or carboxyl group. Reactive groups are those to which an activated polyethylene glycol molecule may be bound. The amino acid residues having a free amino group may include lysine residues and the N-terminal amino acid residues; those having a free carboxyl group may include aspartic acid residues glutamic acid residues and the C-terminal amino acid residue. Sulfhydryl groups may also be used as a reactive group for attaching the polyethylene glycol molecules. Preferred for therapeutic purposes is attachment at an amino group, such as attachment at the N-terminus or lysine group.

[0722] One may specifically desire proteins chemically modified at the N-terminus. Using polyethylene glycol as an illustration of the present composition, one may select from a variety of polyethylene glycol molecules (by molecular weight, branching, etc.), the proportion of polyethylene glycol molecules to protein (polypeptide) molecules in the reaction mix, the type of pegylation reaction to be performed, and the method of obtaining the selected N-terminally pegylated protein. The method of obtaining the N-terminally pegylated preparation (i.e., separating this moiety from other monopegylated moieties if necessary) may be by purification of the N-terminally pegylated material from a population of pegylated protein molecules. Selective proteins chemically modified at the N-terminus modification may be accomplished by reductive alkylation which exploits differential reactivity of different types of primary amino groups (lysine versus the N-terminus) available for derivatization in a particular protein. Under the appropriate reaction conditions, substantially selective derivatization of the protein at the N-terminus with a carbonyl group containing polymer is achieved.

[0723] As with the various polymers exemplified above, it is contemplated that the polymeric residues may contain functional groups in addition, for example, to those typically involved in linking the polymeric residues to the polypeptides of the present invention. Such functionalities include, for example, carboxyl, amine, hydroxy and thiol groups. These functional groups on the polymeric residues can be further reacted, if desired, with materials that are generally reactive with such functional groups and which can assist in targeting specific tissues in the body including, for example, diseased tissue. Exemplary materials which can be reacted with the additional functional groups include, for example, proteins, including antibodies, carbohydrates, peptides, glycopeptides, glycolipids, lectins, and nucleosides.

[0724] In addition to residues of hydrophilic polymers, the chemical used to derivatize the polypeptides of the present invention can be a saccharide residue. Exemplary saccharides which can be derived include, for example, monosaccharides or sugar alcohols, such as erythrose, threose, ribose, arabinose, xylose, lyxose, fructose, sorbitol, mannitol and sedoheptulose, with preferred monosaccharides being fructose, mannose, xylose, arabinose, mannitol and sorbitol; and disaccharides, such as lactose, sucrose, maltose and cellobiose. Other saccharides include, for example, inositol and ganglioside head groups. Other suitable saccharides, in addition to those exemplified above, will be readily apparent to one skilled in the art based on the present disclosure. Generally, saccharides which may be used for derivitization include saccharides that can be attached to the polypeptides of the invention via alkylation or acylation reactions.

[0725] Moreover, the invention also encompasses derivitization of the polypeptides of the present invention, for example, with lipids (including cationic, anionic, polymerized, charged, synthetic, saturated, unsaturated, and any combination of the above, etc.). stabilizing agents.

[0726] The invention encompasses derivitization of the polypeptides of the present invention, for example, with compounds that may serve a stabilizing function (e.g., to increase the polypeptides half-life in solution, to make the polypeptides more water soluble, to increase the polypeptides hydrophilic or hydrophobic character, etc.). Polymers useful as stabilizing materials may be of natural, semi-synthetic (modified natural) or synthetic origin. Exemplary natural polymers include naturally occurring polysaccharides, such as, for example, arabinans, fructans, fucans, galactans, galacturonans, glucans, mannans, xylans (such as, for example, inulin), levan, fucoidan, carrageenan, galatocarolose, pectic acid, pectins, including amylose, pullulan, glycogen, amylopectin, cellulose, dextran, dextrin, dextrose, glucose, polyglucose, polydextrose, pustulan, chitin, agarose, keratin, chondroitin, dermatan, hyaluronic acid, alginic acid, xanthin gum, starch and various other natural homopolymer or heteropolymers, such as those containing one or more of the following aldoses, ketoses, acids or amines: erythose, threose, ribose, arabinose, xylose, lyxose, allose, altrose, glucose, dextrose, mannose, gulose, idose, galactose, talose, erythrulose, ribulose, xylulose, psicose, fructose, sorbose, tagatose, mannitol, sorbitol, lactose, sucrose, trehalose, maltose, cellobiose, glycine, serine, threonine, cysteine, tyrosine, asparagine, glutamine, aspartic acid, glutamic acid, lysine, arginine, histidine, glucuronic acid, gluconic acid, glucaric acid, galacturonic acid, mannuronic acid, glucosamine, galactosamine, and neuraminic acid, and naturally occurring derivatives thereof Accordingly, suitable polymers include, for example, proteins, such as albumin, polyalginates, and polylactide-coglycolide polymers. Exemplary semi-synthetic polymers include carboxymethylcellulose, hydroxymethylcellulose, hydroxypropylmethylcellulose, methylcellulose, and methoxycellulose. Exemplary synthetic polymers include polyphosphazenes, hydroxyapatites, fluoroapatite polymers, polyethylenes (such as, for example, polyethylene glycol (including for example, the class of compounds referred to as Pluronics.RTM., commercially available from BASF, Parsippany, N.J.), polyoxyethylene, and polyethylene terephthlate), polypropylenes (such as, for example, polypropylene glycol), polyurethanes (such as, for example, polyvinyl alcohol (PVA), polyvinyl chloride and polyvinylpyrrolidone), polyamides including nylon, polystyrene, polylactic acids, fluorinated hydrocarbon polymers, fluorinated carbon polymers (such as, for example, polytetrafluoroethylene), acrylate, methacrylate, and polymethylmethacrylate, and derivatives thereof. Methods for the preparation of derivatized polypeptides of the invention which employ polymers as stabilizing compounds will be readily apparent to one skilled in the art, in view of the present disclosure, when coupled with information known in the art, such as that described and referred to in Unger, U.S. Pat. No. 5,205,290, the disclosure of which is hereby incorporated by reference herein in its entirety.

[0727] Moreover, the invention encompasses additional modifications of the polypeptides of the present invention. Such additional modifications are known in the art, and are specifically provided, in addition to methods of derivitization, etc., in U.S. Pat. No. 6,028,066, which is hereby incorporated in its entirety herein.

[0728] The polypeptides of the invention may be in monomers or multimers (i.e., dimers, trimers, tetramers and higher multimers). Accordingly, the present invention relates to monomers and multimers of the polypeptides of the invention, their preparation, and compositions (preferably, Therapeutics) containing them. In specific embodiments, the polypeptides of the invention are monomers, dimers, trimers or tetramers. In additional embodiments, the multimers of the invention are at least dimers, at least trimers, or at least tetramers.

[0729] Multimers encompassed by the invention may be homomers or heteromers. As used herein, the term homomer, refers to a multimer containing only polypeptides corresponding to the amino acid sequence of SEQ ID NO: 2, 4, 6, 8, and/or 203 or encoded by the cDNA contained in a deposited clone (including fragments, variants, splice variants, and fusion proteins, corresponding to these polypeptides as described herein). These homomers may contain polypeptides having identical or different amino acid sequences. In a specific embodiment, a homomer of the invention is a multimer containing only polypeptides having an identical amino acid sequence. In another specific embodiment, a homomer of the invention is a multimer containing polypeptides having different amino acid sequences. In specific embodiments, the multimer of the invention is a homodimer (e.g., containing polypeptides having identical or different amino acid sequences) or a homotrimer (e.g., containing polypeptides having identical and/or different amino acid sequences). In additional embodiments, the homomeric multimer of the invention is at least a homodimer, at least a homotrimer, or at least a homotetramer.

[0730] As used herein, the term heteromer refers to a multimer containing one or more heterologous polypeptides (i.e., polypeptides of different proteins) in addition to the polypeptides of the invention. In a specific embodiment, the multimer of the invention is a heterodimer, a heterotrimer, or a heterotetramer. In additional embodiments, the heteromeric multimer of the invention is at least a heterodimer, at least a heterotrimer, or at least a heterotetramer.

[0731] Multimers of the invention may be the result of hydrophobic, hydrophilic, ionic and/or covalent associations and/or may be indirectly linked, by for example, liposome formation. Thus, in one embodiment, multimers of the invention, such as, for example, homodimers or homotrimers, are formed when polypeptides of the invention contact one another in solution. In another embodiment, heteromultimers of the invention, such as, for example, heterotrimers or heterotetramers, are formed when polypeptides of the invention contact antibodies to the polypeptides of the invention (including antibodies to the heterologous polypeptide sequence in a fusion protein of the invention) in solution. In other embodiments, multimers of the invention are formed by covalent associations with and/or between the polypeptides of the invention. Such covalent associations may involve one or more amino acid residues contained in the polypeptide sequence (e.g., that recited in the sequence listing, or contained in the polypeptide encoded by a deposited clone). In one instance, the covalent associations are cross-linking between cysteine residues located within the polypeptide sequences which interact in the native (i.e., naturally occurring) polypeptide. In another instance, the covalent associations are the consequence of chemical or recombinant manipulation. Alternatively, such covalent associations may involve one or more amino acid residues contained in the heterologous polypeptide sequence in a fusion protein of the invention.

[0732] In one example, covalent associations are between the heterologous sequence contained in a fusion protein of the invention (see, e.g., U.S. Pat. No. 5,478,925). In a specific example, the covalent associations are between the heterologous sequence contained in an Fc fusion protein of the invention (as described herein). In another specific example, covalent associations of fusion proteins of the invention are between heterologous polypeptide sequence from another protein that is capable of forming covalently associated multimers, such as for example, osteoprotegerin (see, e.g., International Publication NO: WO 98/49305, the contents of which are herein incorporated by reference in its entirety). In another embodiment, two or more polypeptides of the invention are joined through peptide linkers. Examples include those peptide linkers described in U.S. Pat. No. 5,073,627 (hereby incorporated by reference). Proteins comprising multiple polypeptides of the invention separated by peptide linkers may be produced using conventional recombinant DNA technology.

[0733] Another method for preparing multimer polypeptides of the invention involves use of polypeptides of the invention fused to a leucine zipper or isoleucine zipper polypeptide sequence. Leucine zipper and isoleucine zipper domains are polypeptides that promote multimerization of the proteins in which they are found. Leucine zippers were originally identified in several DNA-binding proteins (Landschulz et al., Science 240:1759, (1988)), and have since been found in a variety of different proteins. Among the known leucine zippers are naturally occurring peptides and derivatives thereof that dimerize or trimerize. Examples of leucine zipper domains suitable for producing soluble multimeric proteins of the invention are those described in PCT application WO 94/10308, hereby incorporated by reference. Recombinant fusion proteins comprising a polypeptide of the invention fused to a polypeptide sequence that dimerizes or trimerizes in solution are expressed in suitable host cells, and the resulting soluble multimeric fusion protein is recovered from the culture supernatant using techniques known in the art.

[0734] Trimeric polypeptides of the invention may offer the advantage of enhanced biological activity. Preferred leucine zipper moieties and isoleucine moieties are those that preferentially form trimers. One example is a leucine zipper derived from lung surfactant protein D (SPD), as described in Hoppe et al. (FEBS Letters 344:191, (1994)) and in U.S. patent application Ser. No. 08/446,922, hereby incorporated by reference. Other peptides derived from naturally occurring trimeric proteins may be employed in preparing trimeric polypeptides of the invention.

[0735] In another example, proteins of the invention are associated by interactions between Flag® polypeptide sequence contained in fusion proteins of the invention containing Flag® polypeptide sequence. In a further embodiment, associations proteins of the invention are associated by interactions between heterologous polypeptide sequence contained in Flag® fusion proteins of the invention and anti-Flag® antibody.

[0736] The multimers of the invention may be generated using chemical techniques known in the art. For example, polypeptides desired to be contained in the multimers of the invention may be chemically cross-linked using linker molecules and linker molecule length optimization techniques known in the art (see, e.g., U.S. Pat. No. 5,478,925, which is herein incorporated by reference in its entirety). Additionally, multimers of the invention may be generated using techniques known in the art to form one or more inter-molecule cross-links between the cysteine residues located within the sequence of the polypeptides desired to be contained in the multimer (see, e.g., U.S. Pat. No. 5,478,925, which is herein incorporated by reference in its entirety). Further, polypeptides of the invention may be routinely modified by the addition of cysteine or biotin to the C terminus or N-terminus of the polypeptide and techniques known in the art may be applied to generate multimers containing one or more of these modified polypeptides (see, e.g., U.S. Pat. No. 5,478,925, which is herein incorporated by reference in its entirety). Additionally, techniques known in the art may be applied to generate liposomes containing the polypeptide components desired to be contained in the multimer of the invention (see, e.g., U.S. Pat. No. 5,478,925, which is herein incorporated by reference in its entirety).

[0737] Alternatively, multimers of the invention may be generated using genetic engineering techniques known in the art. In one embodiment, polypeptides contained in multimers of the invention are produced recombinantly using fusion protein technology described herein or otherwise known in the art (see, e.g., U.S. Pat. No. 5,478,925, which is herein incorporated by reference in its entirety). In a specific embodiment, polynucleotides coding for a homodimer of the invention are generated by ligating a polynucleotide sequence encoding a polypeptide of the invention to a sequence encoding a linker polypeptide and then further to a synthetic polynucleotide encoding the translated product of the polypeptide in the reverse orientation from the original C-terminus to the N-terminus (lacking the leader sequence) (see, e.g., U.S. Pat. No. 5,478,925, which is herein incorporated by reference in its entirety). In another embodiment, recombinant techniques described herein or otherwise known in the art are applied to generate recombinant polypeptides of the invention which contain a transmembrane domain (or hydrophobic or signal peptide) and which can be incorporated by membrane reconstitution techniques into liposomes (see, e.g., U.S. Pat. No. 5,478,925, which is herein incorporated by reference in its entirety).

[0738] In addition, the polynucleotide insert of the present invention could be operatively linked to “artificial” or chimeric promoters and transcription factors. Specifically, the artificial promoter could comprise, or alternatively consist, of any combination of cis-acting DNA sequence elements that are recognized by trans-acting transcription factors. Preferably, the cis acting DNA sequence elements and trans-acting transcription factors are operable in mammals. Further, the trans-acting transcription factors of such “artificial” promoters could also be “artificial” or chimeric in design themselves and could act as activators or repressors to said “artificial” promoter.

Uses of the Polynucleotides

[0739] Each of the polynucleotides identified herein can be used in numerous ways as reagents. The following description should be considered exemplary and utilizes known techniques.

[0740] The polynucleotides of the present invention are useful for chromosome identification. There exists an ongoing need to identify new chromosome markers, since few chromosome marking reagents, based on actual sequence data (repeat polymorphisms), are presently available. Each polynucleotide of the present invention can be used as a chromosome marker.

[0741] Briefly, sequences can be mapped to chromosomes by preparing sdPCR primers (preferably 15-25 bp) from the sequences shown in SEQ ID NO: 1, 3, 5, 7, and/or 202. Primers can be selected using computer analysis so that primers do not span more than one predicted exon in the genomic DNA. These primers are then used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the SEQ ID NO: 1, 3, 5, 7, and/or 202 will yield an amplified fragment.

[0742] Similarly, somatic hybrids provide a rapid method of PCR mapping the polynucleotides to particular chromosomes. Three or more clones can be assigned per day using a single thermal cycler. Moreover, sublocalization of the polynucleotides can be achieved with panels of specific chromosome fragments. Other gene mapping strategies that can be used include in situ hybridization, prescreening with labeled flow-sorted chromosomes, and preselection by hybridization to construct chromosome specific-cDNA libraries.

[0743] Precise chromosomal location of the polynucleotides can also be achieved using fluorescence in situ hybridization (FISH) of a metaphase chromosomal spread. This technique uses polynucleotides as short as 500 or 600 bases; however, polynucleotides 2,000-4,000 bp are preferred. For a review of this technique, see Verma et al., “Human Chromosomes: a Manual of Basic Techniques,” Pergamon Press, New York (1988).

[0744] For chromosome mapping, the polynucleotides can be used individually (to mark a single chromosome or a single site on that chromosome) or in panels (for marking multiple sites and/or multiple chromosomes). Preferred polynucleotides correspond to the noncoding regions of the cDNAs because the coding sequences are more likely conserved within gene families, thus increasing the chance of cross hybridization during chromosomal mapping.

[0745] Once a polynucleotide has been mapped to a precise chromosomal location, the physical position of the polynucleotide can be used in linkage analysis. Linkage analysis establishes coinheritance between a chromosomal location and presentation of a particular disease. Disease mapping data are known in the art. Assuming 1 megabase mapping resolution and one gene per 20 kb, a cDNA precisely localized to a chromosomal region associated with the disease could be one of 50-500 potential causative genes.

[0746] Thus, once coinheritance is established, differences in the polynucleotide and the corresponding gene between affected and unaffected organisms can be examined. First, visible structural alterations in the chromosomes, such as deletions or translocations, are examined in chromosome spreads or by PCR. If no structural alterations exist, the presence of point mutations are ascertained. Mutations observed in some or all affected organisms, but not in normal organisms, indicates that the mutation may cause the disease. However, complete sequencing of the polypeptide and the corresponding gene from several normal organisms is required to distinguish the mutation from a polymorphism. If a new polymorphism is identified, this polymorphic polypeptide can be used for further linkage analysis.

[0747] Furthermore, increased or decreased expression of the gene in affected organisms as compared to unaffected organisms can be assessed using polynucleotides of the present invention. Any of these alterations (altered expression, chromosomal rearrangement, or mutation) can be used as a diagnostic or prognostic marker.

[0748] Thus, the invention also provides a diagnostic method useful during diagnosis of a disorder, involving measuring the expression level of polynucleotides of the present invention in cells or body fluid from an organism and comparing the measured gene expression level with a standard level of polynucleotide expression level, whereby an increase or decrease in the gene expression level compared to the standard is indicative of a disorder.

[0749] By “measuring the expression level of a polynucleotide of the present invention” is intended qualitatively or quantitatively measuring or estimating the level of the polypeptide of the present invention or the level of the mRNA encoding the polypeptide in a first biological sample either directly (e.g., by determining or estimating absolute protein level or mRNA level) or relatively (e.g., by comparing to the polypeptide level or mRNA level in a second biological sample). Preferably, the polypeptide level or mRNA level in the first biological sample is measured or estimated and compared to a standard polypeptide level or mRNA level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of organisms not having a disorder. As will be appreciated in the art, once a standard polypeptide level or mRNA level is known, it can be used repeatedly as a standard for comparison.

[0750] By “biological sample” is intended any biological sample obtained from an organism, body fluids, cell line, tissue culture, or other source which contains the polypeptide of the present invention or mRNA. As indicated, biological samples include body fluids (such as the following non-limiting examples, sputum, amniotic fluid, urine, saliva, breast milk, secretions, interstitial fluid, blood, serum, spinal fluid, etc.) which contain the polypeptide of the present invention, and other tissue sources found to express the polypeptide of the present invention. Methods for obtaining tissue biopsies and body fluids from organisms are well known in the art. Where the biological sample is to include mRNA, a tissue biopsy is the preferred source.

[0751] The method(s) provided above may Preferably be applied in a diagnostic method and/or kits in which polynucleotides and/or polypeptides are attached to a solid support. In one exemplary method, the support may be a “gene chip” or a “biological chip” as described in U.S. Pat. Nos. 5,837,832, 5,874,219, and 5,856,174. Further, such a gene chip with polynucleotides of the present invention attached may be used to identify polymorphisms between the polynucleotide sequences, with polynucleotides isolated from a test subject. The knowledge of such polymorphisms (i.e. their location, as well as, their existence) would be beneficial in identifying disease loci for many disorders, including proliferative diseases and conditions. Such a method is described in U.S. Pat. Nos. 5,858,659 and 5,856,104. The U.S. Patents referenced supra are hereby incorporated by reference in their entirety herein.

[0752] The present invention encompasses polynucleotides of the present invention that are chemically synthesized, or reproduced as peptide nucleic acids (PNA), or according to other methods known in the art. The use of PNAs would serve as the preferred form if the polynucleotides are incorporated onto a solid support, or gene chip. For the purposes of the present invention, a peptide nucleic acid (PNA) is a polyamide type of DNA analog and the monomeric units for adenine, guanine, thymine and cytosine are available commercially (Perceptive Biosystems). Certain components of DNA, such as phosphorus, phosphorus oxides, or deoxyribose derivatives, are not present in PNAs. As disclosed by P. E. Nielsen, M. Egholm, R. H. Berg and O. Buchardt, Science 254, 1497 (1991); and M. Egholm, O. Buchardt, L.Christensen, C. Behrens, S. M. Freier, D. A. Driver, R. H. Berg, S. K. Kim, B. Norden, and P. E. Nielsen, Nature 365, 666 (1993), PNAs bind specifically and tightly to complementary DNA strands and are not degraded by nucleases. In fact, PNA binds more strongly to DNA than DNA itself does. This is probably because there is no electrostatic repulsion between the two strands, and also the polyamide backbone is more flexible. Because of this, PNA/DNA duplexes bind under a wider range of stringency conditions than DNA/DNA duplexes, making it easier to perform multiplex hybridization. Smaller probes can be used than with DNA due to the stronger binding characteristics of PNA:DNA hybrids. In addition, it is more likely that single base mismatches can be determined with PNA/DNA hybridization because a single mismatch in a PNA/DNA 15-mer lowers the melting point (T.sub.m) by 8°-20° C., vs. 4°-16° C. for the DNA/DNA 15-mer duplex. Also, the absence of charge groups in PNA means that hybridization can be done at low ionic strengths and reduce possible interference by salt during the analysis.

[0753] In addition to the foregoing, a polynucleotide can be used to control gene expression through triple helix formation or antisense DNA or RNA. Antisense techniques are discussed, for example, in Okano, J. Neurochem. 56: 560 (1991); “Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988). Triple helix formation is discussed in, for instance Lee et al., Nucleic Acids Research 6: 3073 (1979); Cooney et al., Science 241: 456 (1988); and Dervan et al., Science 251: 1360 (1991). Both methods rely on binding of the polynucleotide to a complementary DNA or RNA. For these techniques, preferred polynucleotides are usually oligonucleotides 20 to 40 bases in length and complementary to either the region of the gene involved in transcription (triple helix—see Lee et al., Nucl. Acids Res. 6:3073 (1979); Cooney et al., Science 241:456 (1988); and Dervan et al., Science 251:1360 (1991)) or to the mRNA itself (antisense—Okano, J. Neurochem. 56:560 (1991); Oligodeoxy-nucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988).) Triple helix formation optimally results in a shut-off of RNA transcription from DNA, while antisense RNA hybridization blocks translation of an mRNA molecule into polypeptide. Both techniques are effective in model systems, and the information disclosed herein can be used to design antisense or triple helix polynucleotides in an effort to treat or prevent disease.

[0754] The present invention encompasses the addition of a nuclear localization signal, operably linked to the 5′ end, 3′ end, or any location therein, to any of the oligonucleotides, antisense oligonucleotides, triple helix oligonucleotides, ribozymes, PNA oligonucleotides, and/or polynucleotides, of the present invention. See, for example, G. Cutrona, et al., Nat. Biotech., 18:300-303, (2000); which is hereby incorporated herein by reference.

[0755] Polynucleotides of the present invention are also useful in gene therapy. One goal of gene therapy is to insert a normal gene into an organism having a defective gene, in an effort to correct the genetic defect. The polynucleotides disclosed in the present invention offer a means of targeting such genetic defects in a highly accurate manner. Another goal is to insert a new gene that was not present in the host genome, thereby producing a new trait in the host cell. In one example, polynucleotide sequences of the present invention may be used to construct chimeric RNA/DNA oligonucleotides corresponding to said sequences, specifically designed to induce host cell mismatch repair mechanisms in an organism upon systemic injection, for example (Bartlett, R. J., et al., Nat. Biotech, 18:615-622 (2000), which is hereby incorporated by reference herein in its entirety). Such RNA/DNA oligonucleotides could be designed to correct genetic defects in certain host strains, and/or to introduce desired phenotypes in the host (e.g., introduction of a specific polymorphism within an endogenous gene corresponding to a polynucleotide of the present invention that may ameliorate and/or prevent a disease symptom and/or disorder, etc.). Alternatively, the polynucleotide sequence of the present invention may be used to construct duplex oligonucleotides corresponding to said sequence, specifically designed to correct genetic defects in certain host strains, and/or to introduce desired phenotypes into the host (e.g., introduction of a specific polymorphism within an endogenous gene corresponding to a polynucleotide of the present invention that may ameliorate and/or prevent a disease symptom and/or disorder, etc). Such methods of using duplex oligonucleotides are known in the art and are encompassed by the present invention (see EP1007712, which is hereby incorporated by reference herein in its entirety).

[0756] The polynucleotides are also useful for identifying organisms from minute biological samples. The United States military, for example, is considering the use of restriction fragment length polymorphism (RFLP) for identification of its personnel. In this technique, an individual's genomic DNA is digested with one or more restriction enzymes, and probed on a Southern blot to yield unique bands for identifying personnel. This method does not suffer from the current limitations of “Dog Tags” which can be lost, switched, or stolen, making positive identification difficult. The polynucleotides of the present invention can be used as additional DNA markers for RFLP.

[0757] The polynucleotides of the present invention can also be used as an alternative to RFLP, by determining the actual base-by-base DNA sequence of selected portions of an organisms genome. These sequences can be used to prepare PCR primers for amplifying and isolating such selected DNA, which can then be sequenced. Using this technique, organisms can be identified because each organism will have a unique set of DNA sequences. Once an unique ID database is established for an organism, positive identification of that organism, living or dead, can be made from extremely small tissue samples. Similarly, polynucleotides of the present invention can be used as polymorphic markers, in addition to, the identification of transformed or non-transformed cells and/or tissues.

[0758] There is also a need for reagents capable of identifying the source of a particular tissue. Such need arises, for example, when presented with tissue of unknown origin. Appropriate reagents can comprise, for example, DNA probes or primers specific to particular tissue prepared from the sequences of the present invention. Panels of such reagents can identify tissue by species and/or by organ type. In a similar fashion, these reagents can be used to screen tissue cultures for contamination. Moreover, as mentioned above, such reagents can be used to screen and/or identify transformed and non-transformed cells and/or tissues.

[0759] In the very least, the polynucleotides of the present invention can be used as, molecular weight markers on Southern gels, as diagnostic probes for the presence of a specific MRNA in a particular cell type, as a probe to “subtract-out” known sequences in the process of discovering novel polynucleotides, for selecting and making oligomers for attachment to a “gene chip” or other support, to raise anti-DNA antibodies using DNA immunization techniques, and as an antigen to elicit an immune response.

Uses of the Polypeptides

[0760] Each of the polypeptides identified herein can be used in numerous ways. The following description should be considered exemplary and utilizes known techniques.

[0761] A polypeptide of the present invention can be used to assay protein levels in a biological sample using antibody-based techniques. For example, protein expression in tissues can be studied with classical immunohistological methods. (Jalkanen, M., et al., J. Cell. Biol. 101:976-985 (1985); Jalkanen, M., et al., J. Cell . Biol. 105:3087-3096 (1987).) Other antibody-based methods useful for detecting protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA). Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes, such as iodine (125I, 121I), carbon (14C), sulfur (35S), tritium (3H), indium (112In), and technetium (99mTc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.

[0762] In addition to assaying protein levels in a biological sample, proteins can also be detected in vivo by imaging. Antibody labels or markers for in vivo imaging of protein include those detectable by X-radiography, NMR or ESR. For X-radiography, suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject. Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which may be incorporated into the antibody by labeling of nutrients for the relevant hybridoma.

[0763] A protein-specific antibody or antibody fragment which has been labeled with an appropriate detectable imaging moiety, such as a radioisotope (for example, 131I, 112In, 99mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance, is introduced (for example, parenterally, subcutaneously, or intraperitoneally) into the mammal. It will be understood in the art that the size of the subject and the imaging system used will determine the quantity of imaging moiety needed to produce diagnostic images. In the case of a radioisotope moiety, for a human subject, the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of 99mTc. The labeled antibody or antibody fragment will then preferentially accumulate at the location of cells which contain the specific protein. In vivo tumor imaging is described in S. W. Burchiel et al., “Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments.” (Chapter 13 in Tumor Imaging: The Radiochemical Detection of Cancer, S. W. Burchiel and B. A. Rhodes, eds., Masson Publishing Inc. (1982).)

[0764] Thus, the invention provides a diagnostic method of a disorder, which involves (a) assaying the expression of a polypeptide of the present invention in cells or body fluid of an individual; (b) comparing the level of gene expression with a standard gene expression level, whereby an increase or decrease in the assayed polypeptide gene expression level compared to the standard expression level is indicative of a disorder. With respect to cancer, the presence of a relatively high amount of transcript in biopsied tissue from an individual may indicate a predisposition for the development of the disease, or may provide a means for detecting the disease prior to the appearance of actual clinical symptoms. A more definitive diagnosis of this type may allow health professionals to employ preventative measures or aggressive treatment earlier thereby preventing the development or further progression of the cancer.

[0765] Moreover, polypeptides of the present invention can be used to treat, prevent, and/or diagnose disease. For example, patients can be administered a polypeptide of the present invention in an effort to replace absent or decreased levels of the polypeptide (e.g., insulin), to supplement absent or decreased levels of a different polypeptide (e.g., hemoglobin S for hemoglobin B, SOD, catalase, DNA repair proteins), to inhibit the activity of a polypeptide (e.g., an oncogene or tumor suppressor), to activate the activity of a polypeptide (e.g., by binding to a receptor), to reduce the activity of a membrane bound receptor by competing with it for free ligand (e.g., soluble TNF receptors used in reducing inflammation), or to bring about a desired response (e.g., blood vessel growth inhibition, enhancement of the immune response to proliferative cells or tissues).

[0766] Similarly, antibodies directed to a polypeptide of the present invention can also be used to treat, prevent, and/or diagnose disease. For example, administration of an antibody directed to a polypeptide of the present invention can bind and reduce overproduction of the polypeptide. Similarly, administration of an antibody can activate the polypeptide, such as by binding to a polypeptide bound to a membrane (receptor).

[0767] At the very least, the polypeptides of the present invention can be used as molecular weight markers on SDS-PAGE gels or on molecular sieve gel filtration columns using methods well known to those of skill in the art. Polypeptides can also be used to raise antibodies, which in turn are used to measure protein expression from a recombinant cell, as a way of assessing transformation of the host cell. Moreover, the polypeptides of the present invention can be used to test the following biological activities.

Gene Therapy Methods

[0768] Another aspect of the present invention is to gene therapy methods for treating or preventing disorders, diseases and conditions. The gene therapy methods relate to the introduction of nucleic acid (DNA, RNA and antisense DNA or RNA) sequences into an animal to achieve expression of a polypeptide of the present invention. This method requires a polynucleotide which codes for a polypeptide of the invention that operatively linked to a promoter and any other genetic elements necessary for the expression of the polypeptide by the target tissue. Such gene therapy and delivery techniques are known in the art, see, for example, WO 90/11092, which is herein incorporated by reference.

[0769] Thus, for example, cells from a patient may be engineered with a polynucleotide (DNA or RNA) comprising a promoter operably linked to a polynucleotide of the invention ex vivo, with the engineered cells then being provided to a patient to be treated with the polypeptide. Such methods are well-known in the art. For example, see Belldegrun et al., J. Natl. Cancer Inst., 85:207-216 (1993); Ferrantini et al., Cancer Research, 53:107-1112 (1993); Ferrantini et al., J. Immunology 153: 4604-4615 (1994); Kaido, T., et al., Int. J. Cancer 60: 221-229 (1995); Ogura et al., Cancer Research 50: 5102-5106 (1990); Santodonato, et al., Human Gene Therapy 7:1-10 (1996); Santodonato, et al., Gene Therapy 4:1246-1255 (1997); and Zhang, et al., Cancer Gene Therapy 3: 31-38 (1996)), which are herein incorporated by reference. In one embodiment, the cells which are engineered are arterial cells. The arterial cells may be reintroduced into the patient through direct injection to the artery, the tissues surrounding the artery, or through catheter injection.

[0770] As discussed in more detail below, the polynucleotide constructs can be delivered by any method that delivers injectable materials to the cells of an animal, such as, injection into the interstitial space of tissues (heart, muscle, skin, lung, liver, and the like). The polynucleotide constructs may be delivered in a pharmaceutically acceptable liquid or aqueous carrier.

[0771] In one embodiment, the polynucleotide of the invention is delivered as a naked polynucleotide. The term “naked” polynucleotide, DNA or RNA refers to sequences that are free from any delivery vehicle that acts to assist, promote or facilitate entry into the cell, including viral sequences, viral particles, liposome formulations, lipofectin or precipitating agents and the like. However, the polynucleotides of the invention can also be delivered in liposome formulations and lipofectin formulations and the like can be prepared by methods well known to those skilled in the art. Such methods are described, for example, in U.S. Pat. Nos. 5,593,972, 5,589,466, and 5,580,859, which are herein incorporated by reference.

[0772] The polynucleotide vector constructs of the invention used in the gene therapy method are preferably constructs that will not integrate into the host genome nor will they contain sequences that allow for replication. Appropriate vectors include pWLNEO, pSV2CAT, pOG44, pXT1 and pSG available from Stratagene; pSVK3, pBPV, pMSG and pSVL available from Pharmacia; and pEF1/V5, pcDNA3.1, and pRc/CMV2 available from Invitrogen. Other suitable vectors will be readily apparent to the skilled artisan.

[0773] Any strong promoter known to those skilled in the art can be used for driving the expression of polynucleotide sequence of the invention. Suitable promoters include adenoviral promoters, such as the adenoviral major late promoter; or heterologous promoters, such as the cytomegalovirus (CMV) promoter; the respiratory syncytial virus (RSV) promoter; inducible promoters, such as the MMT promoter, the metallothionein promoter; heat shock promoters; the albumin promoter; the ApoAI promoter; human globin promoters; viral thymidine kinase promoters, such as the Herpes Simplex thymidine kinase promoter; retroviral LTRs; the b-actin promoter; and human growth hormone promoters. The promoter also may be the native promoter for the polynucleotides of the invention.

[0774] Unlike other gene therapy techniques, one major advantage of introducing naked nucleic acid sequences into target cells is the transitory nature of the polynuclthe cells. Studies have shown that non-replicating DNA sequences can be introduced into cells to provide production of the desired polypeptide for periods of up to six months.

[0775] The polynucleotide coneotide synthesis in struct of the invention can be delivered to the interstitial space of tissues within the an animal, including of muscle, skin, brain, lung, liver, spleen, bone marrow, thymus, heart, lymph, blood, bone, cartilage, pancreas, kidney, gall bladder, stomach, intestine, testis, ovary, uterus, rectum, nervous system, eye, gland, and connective tissue. Interstitial space of the tissues comprises the intercellular, fluid, mucopolysaccharide matrix among the reticular fibers of organ tissues, elastic fibers in the walls of vessels or chambers, collagen fibers of fibrous tissues, or that same matrix within connective tissue ensheathing muscle cells or in the lacunae of bone. It is similarly the space occupied by the plasma of the circulation and the lymph fluid of the lymphatic channels. Delivery to the interstitial space of muscle tissue is preferred for the reasons discussed below. They may be conveniently delivered by injection into the tissues comprising these cells. They are preferably delivered to and expressed in persistent, non-dividing cells which are differentiated, although delivery and expression may be achieved in non-differentiated or less completely differentiated cells, such as, for example, stem cells of blood or skin fibroblasts. In vivo muscle cells are particularly competent in their ability to take up and express polynucleotides.

[0776] For the naked nucleic acid sequence injection, an effective dosage amount of DNA or RNA will be in the range of from about 0.05 mg/kg body weight to about 50 mg/kg body weight. Preferably the dosage will be from about 0.005 mg/kg to about 20 mg/kg and more preferably from about 0.05 mg/kg to about 5 mg/kg. Of course, as the artisan of ordinary skill will appreciate, this dosage will vary according to the tissue site of injection. The appropriate and effective dosage of nucleic acid sequence can readily be determined by those of ordinary skill in the art and may depend on the condition being treated and the route of administration.

[0777] The preferred route of administration is by the parenteral route of injection into the interstitial space of tissues. However, other parenteral routes may also be used, such as, inhalation of an aerosol formulation particularly for delivery to lungs or bronchial tissues, throat or mucous membranes of the nose. In addition, naked DNA constructs can be delivered to arteries during angioplasty by the catheter used in the procedure.

[0778] The naked polynucleotides are delivered by any method known in the art, including, but not limited to, direct needle injection at the delivery site, intravenous injection, topical administration, catheter infusion, and so-called “gene guns”. These delivery methods are known in the art.

[0779] The constructs may also be delivered with delivery vehicles such as viral sequences, viral particles, liposome formulations, lipofectin, precipitating agents, etc. Such methods of delivery are known in the art.

[0780] In certain embodiments, the polynucleotide constructs of the invention are complexed in a liposome preparation. Liposomal preparations for use in the instant invention include cationic (positively charged), anionic (negatively charged) and neutral preparations. However, cationic liposomes are particularly preferred because a tight charge complex can be formed between the cationic liposome and the polyanionic nucleic acid. Cationic liposomes have been shown to mediate intracellular delivery of plasmid DNA (Felgner et al., Proc. Natl. Acad. Sci. U.S.A, 84:7413-7416 (1987), which is herein incorporated by reference); mRNA (Malone et al., Proc. Natl. Acad. Sci. USA , 86:6077-6081 (1989), which is herein incorporated by reference); and purified transcription factors (Debs et al., J. Biol. Chem., 265:10189-10192 (1990), which is herein incorporated by reference), in functional form.

[0781] Cationic liposomes are readily available. For example, N[1-2,3-dioleyloxy)propyl]-N,N,N-triethylammonium (DOTMA) liposomes are particularly useful and are available under the trademark Lipofectin, from GIBCO BRL, Grand Island, N.Y. (See, also, Felgner et al., Proc. Natl. Acad. Sci. U.S.A , 84:7413-7416 (1987), which is herein incorporated by reference). Other commercially available liposomes include transfectace (DDAB/DOPE) and DOTAP/DOPE (Boehringer).

[0782] Other cationic liposomes can be prepared from readily available materials using techniques well known in the art. See, e.g. PCT Publication NO: WO 90/11092 (which is herein incorporated by reference) for a description of the synthesis of DOTAP (1,2-bis(oleoyloxy)-3-(trimethylammonio)propane) liposomes. Preparation of DOTMA liposomes is explained in the literature, see, e.g., Felgner et al., Proc. Natl. Acad. Sci. U.S.A, 84:7413-7417, which is herein incorporated by reference. Similar methods can be used to prepare liposomes from other cationic lipid materials.

[0783] Similarly, anionic and neutral liposomes are readily available, such as from Avanti Polar Lipids (Birmingham, Ala.), or can be easily prepared using readily available materials. Such materials include phosphatidyl, choline, cholesterol, phosphatidyl ethanolamine, dioleoylphosphatidyl choline (DOPC), dioleoylphosphatidyl glycerol (DOPG), dioleoylphoshatidyl ethanolamine (DOPE), among others. These materials can also be mixed with the DOTMA and DOTAP starting materials in appropriate ratios. Methods for making liposomes using these materials are well known in the art.

[0784] For example, commercially dioleoylphosphatidyl choline (DOPC), dioleoylphosphatidyl glycerol (DOPG), and dioleoylphosphatidyl ethanolamine (DOPE) can be used in various combinations to make conventional liposomes, with or without the addition of cholesterol. Thus, for example, DOPG/DOPC vesicles can be prepared by drying 50 mg each of DOPG and DOPC under a stream of nitrogen gas into a sonication vial. The sample is placed under a vacuum pump overnight and is hydrated the following day with deionized water. The sample is then sonicated for 2 hours in a capped vial, using a Heat Systems model 350 sonicator equipped with an inverted cup (bath type) probe at the maximum setting while the bath is circulated at 15EC. Alternatively, negatively charged vesicles can be prepared without sonication to produce multilamellar vesicles or by extrusion through nucleopore membranes to produce unilamellar vesicles of discrete size. Other methods are known and available to those of skill in the art.

[0785] The liposomes can comprise multilamellar vesicles (MLVs), small unilamellar vesicles (SUVs), or large unilamellar vesicles (LUVs), with SUVs being preferred. The various liposome-nucleic acid complexes are prepared using methods well known in the art. See, e.g.; Straubinger et al., Methods of Immunology, 101:512-527 (1983), which is herein incorporated by reference. For example, MLVs containing nucleic acid can be prepared by depositing a thin film of phospholipid on the walls of a glass tube and subsequently hydrating with a solution of the material to be encapsulated. SUVs are prepared by extended sonication of MLVs to produce a homogeneous population of unilamellar liposomes. The material to be entrapped is added to a suspension of preformed MLVs and then sonicated. When using liposomes containing cationic lipids, the dried lipid film is resuspended in an appropriate solution such as sterile water or an isotonic buffer solution such as 10 mM Tris/NaCl, sonicated, and then the preformed liposomes are mixed directly with the DNA. The liposome and DNA form a very stable complex due to binding of the positively charged liposomes to the cationic DNA. SUVs find use with small nucleic acid fragments. LUVs are prepared by a number of methods, well known in the art. Commonly used methods include Ca2+-EDTA chelation (Papahadjopoulos et al., Biochim. Biophys. Acta, 394:483 (1975); Wilson et al., Cell, 17:77 (1979)); ether injection (Deamer et al., Biochim. Biophys. Acta, 443:629 (1976); Ostro et al., Biochem. Biophys. Res. Commun., 76:836 (1977); Fraley et al., Proc. Natl. Acad. Sci. U.S.A, 76:3348 (1979)); detergent dialysis (Enoch et al., Proc. Natl. Acad. Sci. U.S.A, 76:145 (1979)); and reverse-phase evaporation (REV) (Fraley et al., J. Biol. Chem., 255:10431 (1980); Szoka et al., Proc. Natl. Acad. Sci. U.S.A, 75:145 (1978); Schaefer-Ridder et al., Science, 215:166 (1982)), which are herein incorporated by reference.

[0786] Generally, the ratio of DNA to liposomes will be from about 10:1 to about 1:10. Preferably, the ration will be from about 5:1 to about 1:5. More preferably, the ration will be about 3:1 to about 1:3. Still more preferably, the ratio will be about 1:1.

[0787] U.S. Pat. No. 5,676,954 (which is herein incorporated by reference) reports on the injection of genetic material, complexed with cationic liposomes carriers, into mice. U.S. Pat. Nos. 4,897,355, 4,946,787, 5,049,386, 5,459,127, 5,589,466, 5,693,622, 5,580,859, 5,703,055, and international publication NO: WO 94/9469 (which are herein incorporated by reference) provide cationic lipids for use in transfecting DNA into cells and mammals. U.S. Pat. Nos. 5,589,466, 5,693,622, 5,580,859, 5,703,055, and international publication NO: WO 94/9469 (which are herein incorporated by reference) provide methods for delivering DNA-cationic lipid complexes to mammals.

[0788] In certain embodiments, cells are engineered, ex vivo or in vivo, using a retroviral particle containing RNA which comprises a sequence encoding polypeptides of the invention. Retroviruses from which the retroviral plasmid vectors may be derived include, but are not limited to, Moloney Murine Leukemia Virus, spleen necrosis virus, Rous sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, gibbon ape leukemia virus, human immunodeficiency virus, Myeloproliferative Sarcoma Virus, and mammary tumor virus.

[0789] The retroviral plasmid vector is employed to transduce packaging cell lines to form producer cell lines. Examples of packaging cells which may be transfected include, but are not limited to, the PE501, PA317, R-2, R-AM, PA12, T19-14X, VT-19-17-H2, RCRE, RCRIP, GP+E-86, GP+envAm12, and DAN cell lines as described in Miller, Human Gene Therapy, 1:5-14 (1990), which is incorporated herein by reference in its entirety. The vector may transduce the packaging cells through any means known in the art. Such means include, but are not limited to, electroporation, the use of liposomes, and CaPO4 precipitation. In one alternative, the retroviral plasmid vector may be encapsulated into a liposome, or coupled to a lipid, and then administered to a host.

[0790] The producer cell line generates infectious retroviral vector particles which include polynucleotide encoding polypeptides of the invention. Such retroviral vector particles then may be employed, to transduce eukaryotic cells, either in vitro or in vivo. The transduced eukaryotic cells will express polypeptides of the invention.

[0791] In certain other embodiments, cells are engineered, ex vivo or in vivo, with polynucleotides of the invention contained in an adenovirus vector. Adenovirus can be manipulated such that it encodes and expresses polypeptides of the invention, and at the same time is inactivated in terms of its ability to replicate in a normal lytic viral life cycle. Adenovirus expression is achieved without integration of the viral DNA into the host cell chromosome, thereby alleviating concerns about insertional mutagenesis. Furthermore, adenoviruses have been used as live enteric vaccines for many years with an excellent safety profile (Schwartzet al., Am. Rev. Respir. Dis., 109:233-238 (1974)). Finally, adenovirus mediated gene transfer has been demonstrated in a number of instances including transfer of alpha-1-antitrypsin and CFTR to the lungs of cotton rats (Rosenfeld et al., Science, 252:431-434 (1991); Rosenfeld et al., Cell, 68:143-155 (1992)). Furthermore, extensive studies to attempt to establish adenovirus as a causative agent in human cancer were uniformly negative (Green et al. Proc. Natl. Acad. Sci. U.S.A, 76:6606 (1979)).

[0792] Suitable adenoviral vectors useful in the present invention are described, for example, in Kozarsky and Wilson, Curr. Opin. Genet. Devel., 3:499-503 (1993); Rosenfeld et al., Cell , 68:143-155 (1992); Engelhardt et al., Human Genet. Ther., 4:759-769 (1993); Yang et al., Nature Genet., 7:362-369 (1994); Wilson et al., Nature, 365:691-692 (1993); and U.S. Pat. No. 5,652,224, which are herein incorporated by reference. For example, the adenovirus vector Ad2 is useful and can be grown in human 293 cells. These cells contain the E1 region of adenovirus and constitutively express E1a and E1b, which complement the defective adenoviruses by providing the products of the genes deleted from the vector. In addition to Ad2, other varieties of adenovirus (e.g., Ad3, Ad5, and Ad7) are also useful in the present invention.

[0793] Preferably, the adenoviruses used in the present invention are replication deficient. Replication deficient adenoviruses require the aid of a helper virus and/or packaging cell line to form infectious particles. The resulting virus is capable of infecting cells and can express a polynucleotide of interest which is operably linked to a promoter, but cannot replicate in most cells. Replication deficient adenoviruses may be deleted in one or more of all or a portion of the following genes: E1a, E1b, E3, E4, E2a, or L1 through L5.

[0794] In certain other embodiments, the cells are engineered, ex vivo or in vivo, using an adeno-associated virus (AAV). AAVs are naturally occurring defective viruses that require helper viruses to produce infectious particles (Muzyczka, Curr. Topics in Microbiol. Immunol., 158:97 (1992)). It is also one of the few viruses that may integrate its DNA into non-dividing cells. Vectors containing as little as 300 base pairs of AAV can be packaged and can integrate, but space for exogenous DNA is limited to about 4.5 kb. Methods for producing and using such AAVs are known in the art. See, for example, U.S. Pat. Nos. 5,139,941, 5,173,414, 5,354,678, 5,436,146, 5,474,935, 5,478,745, and 5,589,377.

[0795] For example, an appropriate AAV vector for use in the present invention will include all the sequences necessary for DNA replication, encapsidation, and host-cell integration. The polynucleotide construct containing polynucleotides of the invention is inserted into the AAV vector using standard cloning methods, such as those found in Sambrook et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press (1989). The recombinant AAV vector is then transfected into packaging cells which are infected with a helper virus, using any standard technique, including lipofection, electroporation, calcium phosphate precipitation, etc. Appropriate helper viruses include adenoviruses, cytomegaloviruses, vaccinia viruses, or herpes viruses. Once the packaging cells are transfected and infected, they will produce infectious AAV viral particles which contain the polynucleotide construct of the invention. These viral particles are then used to transduce eukaryotic cells, either ex vivo or in vivo. The transduced cells will contain the polynucleotide construct integrated into its genome, and will express the desired gene product.

[0796] Another method of gene therapy involves operably associating heterologous control regions and endogenous polynucleotide sequences (e.g. encoding the polypeptide sequence of interest) via homologous recombination (see, e.g., U.S. Pat. No: 5,641,670, issued Jun. 24, 1997; International Publication NO: WO 96/29411, published Sep. 26, 1996; International Publication NO: WO 94/12650, published Aug. 4, 1994; Koller et al., Proc. Natl. Acad. Sci. U.S.A, 86:8932-8935 (1989); and Zijlstra et al., Nature, 342:435-438 (1989). This method involves the activation of a gene which is present in the target cells, but which is not normally expressed in the cells, or is expressed at a lower level than desired.

[0797] Polynucleotide constructs are made, using standard techniques known in the art, which contain the promoter with targeting sequences flanking the promoter. Suitable promoters are described herein. The targeting sequence is sufficiently complementary to an endogenous sequence to permit homologous recombination of the promoter-targeting sequence with the endogenous sequence. The targeting sequence will be sufficiently near the 5′ end of the desired endogenous polynucleotide sequence so the promoter will be operably linked to the endogenous sequence upon homologous recombination.

[0798] The promoter and the targeting sequences can be amplified using PCR. Preferably, the amplified promoter contains distinct restriction enzyme sites on the 5′ and 3′ ends. Preferably, the 3′ end of the first targeting sequence contains the same restriction enzyme site as the 5′ end of the amplified promoter and the 5′ end of the second targeting sequence contains the same restriction site as the 3′ end of the amplified promoter. The amplified promoter and targeting sequences are digested and ligated together.

[0799] The promoter-targeting sequence construct is delivered to the cells, either as naked polynucleotide, or in conjunction with transfection-facilitating agents, such as liposomes, viral sequences, viral particles, whole viruses, lipofection, precipitating agents, etc., described in more detail above. The P promoter-targeting sequence can be delivered by any method, included direct needle injection, intravenous injection, topical administration, catheter infusion, particle accelerators, etc. The methods are described in more detail below.

[0800] The promoter-targeting sequence construct is taken up by cells. Homologous recombination between the construct and the endogenous sequence takes place, such that an endogenous sequence is placed under the control of the promoter. The promoter then drives the expression of the endogenous sequence.

[0801] The polynucleotides encoding polypeptides of the present invention may be administered along with other polynucleotides encoding angiogenic proteins. Angiogenic proteins include, but are not limited to, acidic and basic fibroblast growth factors, VEGF-1, VEGF-2 (VEGF-C), VEGF-3 (VEGF-B), epidermal growth factor alpha and beta, platelet-derived endothelial cell growth factor, platelet-derived growth factor, tumor necrosis factor alpha, hepatocyte growth factor, insulin like growth factor, colony stimulating factor, macrophage colony stimulating factor, granulocyte/macrophage colony stimulating factor, and nitric oxide synthase.

[0802] Preferably, the polynucleotide encoding a polypeptide of the invention contains a secretory signal sequence that facilitates secretion of the protein. Typically, the signal sequence is positioned in the coding region of the polynucleotide to be expressed towards or at the 5′ end of the coding region. The signal sequence may be homologous or heterologous to the polynucleotide of interest and may be homologous or heterologous to the cells to be transfected. Additionally, the signal sequence may be chemically synthesized using methods known in the art.

[0803] Any mode of administration of any of the above-described polynucleotides constructs can be used so long as the mode results in the expression of one or more molecules in an amount sufficient to provide a therapeutic effect. This includes direct needle injection, systemic injection, catheter infusion, biolistic injectors, particle accelerators (i.e., “gene guns”), gelfoam sponge depots, other commercially available depot materials, osmotic pumps (e.g., Alza minipumps), oral or suppositorial solid (tablet or pill) pharmaceutical formulations, and decanting or topical applications during surgery. For example, direct injection of naked calcium phosphate-precipitated plasmid into rat liver and rat spleen or a protein-coated plasmid into the portal vein has resulted in gene expression of the foreign gene in the rat livers. (Kaneda et al., Science, 243:375 (1989)).

[0804] A preferred method of local administration is by direct injection. Preferably, a recombinant molecule of the present invention complexed with a delivery vehicle is administered by direct injection into or locally within the area of arteries. Administration of a composition locally within the area of arteries refers to injecting the composition centimeters and preferably, millimeters within arteries.

[0805] Another method of local administration is to contact a polynucleotide construct of the present invention in or around a surgical wound. For example, a patient can undergo surgery and the polynucleotide construct can be coated on the surface of tissue inside the wound or the construct can be injected into areas of tissue inside the wound.

[0806] Therapeutic compositions useful in systemic administration, include recombinant molecules of the present invention complexed to a targeted delivery vehicle of the present invention. Suitable delivery vehicles for use with systemic administration comprise liposomes comprising ligands for targeting the vehicle to a particular site.

[0807] Preferred methods of systemic administration, include intravenous injection, aerosol, oral and percutaneous (topical) delivery. Intravenous injections can be performed using methods standard in the art. Aerosol delivery can also be performed using methods standard in the art (see, for example, Stribling et al., Proc. Natl. Acad. Sci. U.S.A, 189:11277-11281 (1992), which is incorporated herein by reference). Oral delivery can be performed by complexing a polynucleotide construct of the present invention to a carrier capable of withstanding degradation by digestive enzymes in the gut of an animal. Examples of such carriers, include plastic capsules or tablets, such as those known in the art. Topical delivery can be performed by mixing a polynucleotide construct of the present invention with a lipophilic reagent (e.g., DMSO) that is capable of passing into the skin.

[0808] Determining an effective amount of substance to be delivered can depend upon a number of factors including, for example, the chemical structure and biological activity of the substance, the age and weight of the animal, the precise condition requiring treatment and its severity, and the route of administration. The frequency of treatments depends upon a number of factors, such as the amount of polynucleotide constructs administered per dose, as well as the health and history of the subject. The precise amount, number of doses, and timing of doses will be determined by the attending physician or veterinarian. Therapeutic compositions of the present invention can be administered to any animal, preferably to mammals and birds. Preferred mammals include humans, dogs, cats, mice, rats, rabbits sheep, cattle, horses and pigs, with humans being particularly preferred.

Biological Activities

[0809] The polynucleotides or polypeptides, or agonists or antagonists of the present invention can be used in assays to test for one or more biological activities. If these polynucleotides and polypeptides do exhibit activity in a particular assay, it is likely that these molecules may be involved in the diseases associated with the biological activity. Thus, the polynucleotides or polypeptides, or agonists or antagonists could be used to treat the associated disease.

Immune Activity

[0810] The polynucleotides or polypeptides, or agonists or antagonists of the present invention may be useful in treating, preventing, and/or diagnosing diseases, disorders, and/or conditions of the immune system, by activating or inhibiting the proliferation, differentiation, or mobilization (chemotaxis) of immune cells. Immune cells develop through a process called hematopoiesis, producing myeloid (platelets, red blood cells, neutrophils, and macrophages) and lymphoid (B and T lymphocytes) cells from pluripotent stem cells. The etiology of these immune diseases, disorders, and/or conditions may be genetic, somatic, such as cancer or some autoimmune diseases, disorders, and/or conditions, acquired (e.g., by chemotherapy or toxins), or infectious. Moreover, a polynucleotides or polypeptides, or agonists or antagonists of the present invention can be used as a marker or detector of a particular immune system disease or disorder.

[0811] A polynucleotides or polypeptides, or agonists or antagonists of the present invention may be useful in treating, preventing, and/or diagnosing diseases, disorders, and/or conditions of hematopoietic cells. A polynucleotides or polypeptides, or agonists or antagonists of the present invention could be used to increase differentiation and proliferation of hematopoietic cells, including the pluripotent stem cells, in an effort to treat or prevent those diseases, disorders, and/or conditions associated with a decrease in certain (or many) types hematopoietic cells. Examples of immunologic deficiency syndromes include, but are not limited to: blood protein diseases, disorders, and/or conditions (e.g. agammaglobulinemia, dysgammaglobulinemia), ataxia telangiectasia, common variable immunodeficiency, Digeorge Syndrome, HIV infection, HTLV-BLV infection, leukocyte adhesion deficiency syndrome, lymphopenia, phagocyte bactericidal dysfunction, severe combined immunodeficiency (SCIDs), Wiskott-Aldrich Disorder, anemia, thrombocytopenia, or hemoglobinuria.

[0812] Moreover, a polynucleotides or polypeptides, or agonists or antagonists of the present invention could also be used to modulate hemostatic (the stopping of bleeding) or thrombolytic activity (clot formation). For example, by increasing hemostatic or thrombolytic activity, a polynucleotides or polypeptides, or agonists or antagonists of the present invention could be used to treat or prevent blood coagulation diseases, disorders, and/or conditions (e.g., afibrinogenemia, factor deficiencies), blood platelet diseases, disorders, and/or conditions (e.g. thrombocytopenia), or wounds resulting from trauma, surgery, or other causes. Alternatively, a polynucleotides or polypeptides, or agonists or antagonists of the present invention that can decrease hemostatic or thrombolytic activity could be used to inhibit or dissolve clotting. These molecules could be important in the treatment or prevention of heart attacks (infarction), strokes, or scarring.

[0813] A polynucleotides or polypeptides, or agonists or antagonists of the present invention may also be useful in treating, preventing, and/or diagnosing autoimmune diseases, disorders, and/or conditions. Many autoimmune diseases, disorders, and/or conditions result from inappropriate recognition of self as foreign material by immune cells. This inappropriate recognition results in an immune response leading to the destruction of the host tissue. Therefore, the administration of a polynucleotides or polypeptides, or agonists or antagonists of the present invention that inhibits an immune response, particularly the proliferation, differentiation, or chemotaxis of T-cells, may be an effective therapy in preventing autoimmune diseases, disorders, and/or conditions.

[0814] Examples of autoimmune diseases, disorders, and/or conditions that can be treated, prevented, and/or diagnosed or detected by the present invention include, but are not limited to: Addison's Disease, hemolytic anemia, antiphospholipid syndrome, rheumatoid arthritis, dermatitis, allergic encephalomyelitis, glomerulonephritis, Goodpasture's Syndrome, Graves' Disease, Multiple Sclerosis, Myasthenia Gravis, Neuritis, Ophthalmia, Bullous Pemphigoid, Pemphigus, Polyendocrinopathies, Purpura, Reiter's Disease, Stiff-Man Syndrome, Autoimmune Thyroiditis, Systemic Lupus Erythematosus, Autoimmune Pulmonary Inflammation, Guillain-Barre Syndrome, insulin dependent diabetes mellitis, and autoimmune inflammatory eye disease.

[0815] Similarly, allergic reactions and conditions, such as asthma (particularly allergic asthma) or other respiratory problems, may also be treated, prevented, and/or diagnosed by polynucleotides or polypeptides, or agonists or antagonists of the present invention. Moreover, these molecules can be used to treat anaphylaxis, hypersensitivity to an antigenic molecule, or blood group incompatibility.

[0816] A polynucleotides or polypeptides, or agonists or antagonists of the present invention may also be used to treat, prevent, and/or diagnose organ rejection or graft-versus-host disease (GVHD). Organ rejection occurs by host immune cell destruction of the transplanted tissue through an immune response. Similarly, an immune response is also involved in GVHD, but, in this case, the foreign transplanted immune cells destroy the host tissues. The administration of a polynucleotides or polypeptides, or agonists or antagonists of the present invention that inhibits an immune response, particularly the proliferation, differentiation, or chemotaxis of T-cells, may be an effective therapy in preventing organ rejection or GVHD.

[0817] Similarly, a polynucleotides or polypeptides, or agonists or antagonists of the present invention may also be used to modulate inflammation. For example, the polypeptide or polynucleotide or agonists or antagonist may inhibit the proliferation and differentiation of cells involved in an inflammatory response. These molecules can be used to treat, prevent, and/or diagnose inflammatory conditions, both chronic and acute conditions, including chronic prostatitis, granulomatous prostatitis and malacoplakia, inflammation associated with infection (e.g., septic shock, sepsis, or systemic inflammatory response syndrome (SIRS)), ischemia-reperfusion injury, endotoxin lethality, arthritis, complement-mediated hyperacute rejection, nephritis, cytokine or chemokine induced lung injury, inflammatory bowel disease, Crohn's disease, or resulting from over production of cytokines (e.g., TNF or IL-1.)

Hyperproliferative Disorders

[0818] A polynucleotides or polypeptides, or agonists or antagonists of the invention can be used to treat, prevent, and/or diagnose hyperproliferative diseases, disorders, and/or conditions, including neoplasms. A polynucleotides or polypeptides, or agonists or antagonists of the present invention may inhibit the proliferation of the disorder through direct or indirect interactions. Alternatively, a polynucleotides or polypeptides, or agonists or antagonists of the present invention may proliferate other cells which can inhibit the hyperproliferative disorder.

[0819] For example, by increasing an immune response, particularly increasing antigenic qualities of the hyperproliferative disorder or by proliferating, differentiating, or mobilizing T-cells, hyperproliferative diseases, disorders, and/or conditions can be treated, prevented, and/or diagnosed. This immune response may be increased by either enhancing an existing immune response, or by initiating a new immune response. Alternatively, decreasing an immune response may also be a method of treating, preventing, and/or diagnosing hyperproliferative diseases, disorders, and/or conditions, such as a chemotherapeutic agent.

[0820] Examples of hyperproliferative diseases, disorders, and/or conditions that can be treated, prevented, and/or diagnosed by polynucleotides or polypeptides, or agonists or antagonists of the present invention include, but are not limited to neoplasms located in the: colon, abdomen, bone, breast, digestive system, liver, pancreas, peritoneum, endocrine glands (adrenal, parathyroid, pituitary, testicles, ovary, thymus, thyroid), eye, head and neck, nervous (central and peripheral), lymphatic system, pelvic, skin, soft tissue, spleen, thoracic, and urogenital.

[0821] Similarly, other hyperproliferative diseases, disorders, and/or conditions can also be treated, prevented, and/or diagnosed by a polynucleotides or polypeptides, or agonists or antagonists of the present invention. Examples of such hyperproliferative diseases, disorders, and/or conditions include, but are not limited to: hypergammaglobulinemia, lymphoproliferative diseases, disorders, and/or conditions, paraproteinemias, purpura, sarcoidosis, Sezary Syndrome, Waldenstron's Macroglobulinemia, Gaucher's Disease, histiocytosis, and any other hyperproliferative disease, besides neoplasia, located in an organ system listed above.

[0822] One preferred embodiment utilizes polynucleotides of the present invention to inhibit aberrant cellular division, by gene therapy using the present invention, and/or protein fusions or fragments thereof.

[0823] Thus, the present invention provides a method for treating or preventing cell proliferative diseases, disorders, and/or conditions by inserting into an abnormally proliferating cell a polynucleotide of the present invention, wherein said polynucleotide represses said expression.

[0824] Another embodiment of the present invention provides a method of treating or preventing cell-proliferative diseases, disorders, and/or conditions in individuals comprising administration of one or more active gene copies of the present invention to an abnormally proliferating cell or cells. In a preferred embodiment, polynucleotides of the present invention is a DNA construct comprising a recombinant expression vector effective in expressing a DNA sequence encoding said polynucleotides. In another preferred embodiment of the present invention, the DNA construct encoding the polynucleotides of the present invention is inserted into cells to be treated utilizing a retrovirus, or more Preferably an adenoviral vector (See G J. Nabel, et. al., PNAS 1999 96: 324-326, which is hereby incorporated by reference). In a most preferred embodiment, the viral vector is defective and will not transform non-proliferating cells, only proliferating cells. Moreover, in a preferred embodiment, the polynucleotides of the present invention inserted into proliferating cells either alone, or in combination with or fused to other polynucleotides, can then be modulated via an external stimulus (i.e. magnetic, specific small molecule, chemical, or drug administration, etc.), which acts upon the promoter upstream of said polynucleotides to induce expression of the encoded protein product. As such the beneficial therapeutic affect of the present invention may be expressly modulated (i.e. to increase, decrease, or inhibit expression of the present invention) based upon said external stimulus.

[0825] Polynucleotides of the present invention may be useful in repressing expression of oncogenic genes or antigens. By “repressing expression of the oncogenic genes” is intended the suppression of the transcription of the gene, the degradation of the gene transcript (pre-message RNA), the inhibition of splicing, the destruction of the messenger RNA, the prevention of the post-translational modifications of the protein, the destruction of the protein, or the inhibition of the normal function of the protein.

[0826] For local administration to abnormally proliferating cells, polynucleotides of the present invention may be administered by any method known to those of skill in the art including, but not limited to transfection, electroporation, microinjection of cells, or in vehicles such as liposomes, lipofectin, or as naked polynucleotides, or any other method described throughout the specification. The polynucleotide of the present invention may be delivered by known gene delivery systems such as, but not limited to, retroviral vectors (Gilboa, J. Virology 44:845 (1982); Hocke, Nature 320:275 (1986); Wilson, et al., Proc. Natl. Acad. Sci. U.S.A. 85:3014), vaccinia virus system (Chakrabarty et al., Mol. Cell Biol. 5:3403 (1985) or other efficient DNA delivery systems (Yates et al., Nature 313:812 (1985)) known to those skilled in the art. These references are exemplary only and are hereby incorporated by reference. In order to specifically deliver or transfect cells which are abnormally proliferating and spare non-dividing cells, it is preferable to utilize a retrovirus, or adenoviral (as described in the art and elsewhere herein) delivery system known to those of skill in the art. Since host DNA replication is required for retroviral DNA to integrate and the retrovirus will be unable to self replicate due to the lack of the retrovirus genes needed for its life cycle. Utilizing such a retroviral delivery system for polynucleotides of the present invention will target said gene and constructs to abnormally proliferating cells and will spare the non-dividing normal cells.

[0827] The polynucleotides of the present invention may be delivered directly to cell proliferative disorder/disease sites in internal organs, body cavities and the like by use of imaging devices used to guide an injecting needle directly to the disease site. The polynucleotides of the present invention may also be administered to disease sites at the time of surgical intervention.

[0828] By “cell proliferative disease” is meant any human or animal disease or disorder, affecting any one or any combination of organs, cavities, or body parts, which is characterized by single or multiple local abnormal proliferations of cells, groups of cells, or tissues, whether benign or malignant.

[0829] Any amount of the polynucleotides of the present invention may be administered as long as it has a biologically inhibiting effect on the proliferation of the treated cells. Moreover, it is possible to administer more than one of the polynucleotide of the present invention simultaneously to the same site. By “biologically inhibiting” is meant partial or total growth inhibition as well as decreases in the rate of proliferation or growth of the cells. The biologically inhibitory dose may be determined by assessing the effects of the polynucleotides of the present invention on target malignant or abnormally proliferating cell growth in tissue culture, tumor growth in animals and cell cultures, or any other method known to one of ordinary skill in the art.

[0830] The present invention is further directed to antibody-based therapies which involve administering of anti-polypeptides and anti-polynucleotide antibodies to a mammalian, preferably human, patient for treating, preventing, and/or diagnosing one or more of the described diseases, disorders, and/or conditions. Methods for producing anti-polypeptides and anti-polynucleotide antibodies polyclonal and monoclonal antibodies are described in detail elsewhere herein. Such antibodies may be provided in pharmaceutically acceptable compositions as known in the art or as described herein.

[0831] A summary of the ways in which the antibodies of the present invention may be used therapeutically includes binding polynucleotides or polypeptides of the present invention locally or systemically in the body or by direct cytotoxicity of the antibody, e.g. as mediated by complement (CDC) or by effector cells (ADCC). Some of these approaches are described in more detail below. Armed with the teachings provided herein, one of ordinary skill in the art will know how to use the antibodies of the present invention for diagnostic, monitoring or therapeutic purposes without undue experimentation.

[0832] In particular, the antibodies, fragments and derivatives of the present invention are useful for treating, preventing, and/or diagnosing a subject having or developing cell proliferative and/or differentiation diseases, disorders, and/or conditions as described herein. Such treatment comprises administering a single or multiple doses of the antibody, or a fragment, derivative, or a conjugate thereof.

[0833] The antibodies of this invention may be advantageously utilized in combination with other monoclonal or. chimeric antibodies, or with lymphokines or hematopoietic growth factors, for example, which serve to increase the number or activity of effector cells which interact with the antibodies.

[0834] It is preferred to use high affinity and/or potent in vivo inhibiting and/or neutralizing antibodies against polypeptides or polynucleotides of the present invention, fragments or regions thereof, for both immunoassays directed to and therapy of diseases, disorders, and/or conditions related to polynucleotides or polypeptides, including fragments thereof, of the present invention. Such antibodies, fragments, or regions, will preferably have an affinity for polynucleotides or polypeptides, including fragments thereof. Preferred binding affinities include those with a dissociation constant or Kd less than 5×10-6M, 10-6M, 5×10-7M, 10-7M, 5×10-8M, 10-8M, 5×10-9M, 10-9M, 5×10-10M, 10-10M, 5×10-11M, 10-11M, 5×10-12M, 10-12M, 5×10-13M, 10-13M, 5×10-14M, 10-14M, 5×10-15M, and 10-15M.

[0835] Moreover, polypeptides of the present invention may be useful in inhibiting the angiogenesis of proliferative cells or tissues, either alone, as a protein fusion, or in combination with other polypeptides directly or indirectly, as described elsewhere herein. In a most preferred embodiment, said anti-angiogenesis effect may be achieved indirectly, for example, through the inhibition of hematopoietic, tumor-specific cells, such as tumor-associated macrophages (See Joseph I B, et al. J Natl Cancer Inst, 90(21):1648-53 (1998), which is hereby incorporated by reference). Antibodies directed to polypeptides or polynucleotides of the present invention may also result in inhibition of angiogenesis directly, or indirectly (See Witte L, et al., Cancer Metastasis Rev. 17(2):155-61 (1998), which is hereby incorporated by reference)).

[0836] Polypeptides, including protein fusions, of the present invention, or fragments thereof may be useful in inhibiting proliferative cells or tissues through the induction of apoptosis. Said polypeptides may act either directly, or indirectly to induce apoptosis of proliferative cells and tissues, for example in the activation of a death-domain receptor, such as tumor necrosis factor (TNF) receptor-1, CD95 (Fas/APO-1), TNF-receptor-related apoptosis-mediated protein (TRAMP) and TNF-related apoptosis-inducing ligand (TRAIL) receptor-1 and -2 (See Schulze-Osthoff K, et al., Eur J Biochem 254(3):439-59 (1998), which is hereby incorporated by reference). Moreover, in another preferred embodiment of the present invention, said polypeptides may induce apoptosis through other mechanisms, such as in the activation of other proteins which will activate apoptosis, or through stimulating the expression of said proteins, either alone or in combination with small molecule drugs or adjuvants, such as apoptonin, galectins, thioredoxins, antuinflammatory proteins (See for example, Mutat. Res. 400(1-2):447-55 (1998), Med Hypotheses.50(5):423-33 (1998), Chem. Biol. Interact. Apr 24;111-112:23-34 (1998), J Mol Med.76(6):402-12 (1998), Int. J. Tissue React. 20(1):3-15 (1998), which are all hereby incorporated by reference).

[0837] Polypeptides, including protein fusions to, or fragments thereof, of the present invention are useful in inhibiting the metastasis of proliferative cells or tissues. Inhibition may occur as a direct result of administering polypeptides, or antibodies directed to said polypeptides as described elsewhere herein, or indirectly, such as activating the expression of proteins known to inhibit metastasis, for example alpha 4 integrins, (See, e.g., Curr Top Microbiol Inuunol 1998;231:125-41, which is hereby incorporated by reference). Such therapeutic affects of the present invention may be achieved either alone, or in combination with small molecule drugs or adjuvants.

[0838] In another embodiment, the invention provides a method of delivering compositions containing the polypeptides of the invention (e.g., compositions containing polypeptides or polypeptide antibodies associated with heterologous polypeptides, heterologous nucleic acids, toxins, or prodrugs) to targeted cells expressing the polypeptide of the present invention. Polypeptides or polypeptide antibodies of the invention may be associated with heterologous polypeptides, heterologous nucleic acids, toxins, or prodrugs via hydrophobic, hydrophilic, ionic and/or covalent interactions.

[0839] Polypeptides, protein fusions to, or fragments thereof, of the present invention are useful in enhancing the immunogenicity and/or antigenicity of proliferating cells or tissues, either directly, such as would occur if the polypeptides of the present invention ‘vaccinated’ the immune response to respond to proliferative antigens and immunogens, or indirectly, such as in activating the expression of proteins known to enhance the immune response (e.g. chemokines), to said antigens and immunogens.

Cardiovascular Disorders

[0840] Polynucleotides or polypeptides, or agonists or antagonists of the invention may be used to treat, prevent, and/or diagnose cardiovascular diseases, disorders, and/or conditions, including peripheral artery disease, such as limb ischemia.

[0841] Cardiovascular diseases, disorders, and/or conditions include cardiovascular abnormalities, such as arterio-arterial fistula, arteriovenous fistula, cerebral arteriovenous malformations, congenital heart defects, pulmonary atresia, and Scimitar Syndrome. Congenital heart defects include aortic coarctation, cor triatriatum, coronary vessel anomalies, crisscross heart, dextrocardia, patent ductus arteriosus, Ebstein's anomaly, Eisenmenger complex, hypoplastic left heart syndrome, levocardia, tetralogy of fallot, transposition of great vessels, double outlet right ventricle, tricuspid atresia, persistent truncus arteriosus, and heart septal defects, such as aortopulmonary septal defect, endocardial cushion defects, Lutembacher's Syndrome, trilogy of Fallot, ventricular heart septal defects.

[0842] Cardiovascular diseases, disorders, and/or conditions also include heart disease, such as arrhythmias, carcinoid heart disease, high cardiac output, low cardiac output, cardiac tamponade, endocarditis (including bacterial), heart aneurysm, cardiac arrest, congestive heart failure, congestive cardiomyopathy, paroxysmal dyspnea, cardiac edema, heart hypertrophy, congestive cardiomyopathy, left ventricular hypertrophy, right ventricular hypertrophy, post-infarction heart rupture, ventricular septal rupture, heart valve diseases, myocardial diseases, myocardial ischemia, pericardial effusion, pericarditis (including constrictive and tuberculous), pneumopericardium, postpericardiotomy syndrome, pulmonary heart disease, rheumatic heart disease, ventricular dysfunction, hyperemia, cardiovascular pregnancy complications, Scimitar Syndrome, cardiovascular syphilis, and cardiovascular tuberculosis.

[0843] Arrhythmias include sinus anfhythmia, atrial fibrillation, atrial flutter, bradycardia, extrasystole, Adams-Stokes Syndrome, bundle-branch block, sinoatrial block, long QT syndrome, parasystole, Lown-Ganong-Levine Syndrome, Mahaim-type pre-excitation syndrome, Wolff-Parkinson-White syndrome, sick sinus syndrome, tachycardias, and ventricular fibrillation. Tachycardias include paroxysmal tachycardia, supraventricular tachycardia, accelerated idioventricular rhythm, atrioventricular nodal reentry tachycardia, ectopic atrial tachycardia, ectopic junctional tachycardia, sinoatrial nodal reentry tachycardia, sinus tachycardia, Torsades de Pointes, and ventricular tachycardia.

[0844] Heart valve disease include aortic valve insufficiency, aortic valve stenosis, hear murmurs, aortic valve prolapse, mitral valve prolapse, tricuspid valve prolapse, mitral valve insufficiency, mitral valve stenosis, pulmonary atresia, pulmonary valve insufficiency, pulmonary valve stenosis, tricuspid atresia, tricuspid valve insufficiency, and tricuspid valve stenosis.

[0845] Myocardial diseases include alcoholic cardiomyopathy, congestive cardiomyopathy, hypertrophic cardiomyopathy, aortic subvalvular stenosis, pulmonary subvalvular stenosis, restrictive cardiomyopathy, Chagas cardiomyopathy, endocardial fibroelastosis, endomyocardial fibrosis, Kearns Syndrome, myocardial reperfusion injury, and myocarditis.

[0846] Myocardial ischemias include coronary disease, such as angina pectoris, coronary aneurysm, coronary arteriosclerosis, coronary thrombosis, coronary vasospasm, myocardial infarction and myocardial stunning.

[0847] Cardiovascular diseases also include vascular diseases such as aneurysms, angiodysplasia, angiomatosis, bacillary angiomatosis, Hippel-Lindau Disease, Klippel-Trenaunay-Weber Syndrome, Sturge-Weber Syndrome, angioneurotic edema, aortic diseases, Takayasu's Arteritis, aortitis, Leriche's Syndrome, arterial occlusive diseases, arteritis, enarteritis, polyarteritis nodosa, cerebrovascular diseases, disorders, and/or conditions, diabetic angiopathies, diabetic retinopathy, embolisms, thrombosis, erythromelalgia, hemorrhoids, hepatic veno-occlusive disease, hypertension, hypotension, ischemia, peripheral vascular diseases, phlebitis, pulmonary veno-occlusive disease, Raynaud's disease, CREST syndrome, retinal vein occlusion, Scimitar syndrome, superior vena cava syndrome, telangiectasia, atacia telangiectasia, hereditary hemorrhagic telangiectasia, varicocele, varicose veins, varicose ulcer, vasculitis, and venous insufficiency.

[0848] Aneurysms include dissecting aneurysms, false aneurysms, infected aneurysms, ruptured aneurysms, aortic aneurysms, cerebral aneurysms, coronary aneurysms, heart aneurysms, and iliac aneurysms.

[0849] Arterial occlusive diseases include arteriosclerosis, intermittent claudication, carotid stenosis, fibromuscular dysplasias, mesenteric vascular occlusion, Moyamoya disease, renal artery obstruction, retinal artery occlusion, and thromboangiitis obliterans.

[0850] Cerebrovascular diseases, disorders, and/or conditions include carotid artery diseases, cerebral amyloid angiopathy, cerebral aneurysm, cerebral anoxia, cerebral arteriosclerosis, cerebral arteriovenous malformation, cerebral artery diseases, cerebral embolism and thrombosis, carotid artery thrombosis, sinus thrombosis, Wallenberg's syndrome, cerebral hemorrhage, epidural hematoma, subdural hematoma, subaraxhnoid hemorrhage, cerebral infarction, cerebral ischemia (including transient), subclavian steal syndrome, periventricular leukomalacia, vascular headache, cluster headache, migraine, and vertebrobasilar insufficiency.

[0851] Embolisms include air embolisms, amniotic fluid embolisms, cholesterol embolisms, blue toe syndrome, fat embolisms, pulmonary embolisms, and thromoboembolisms. Thrombosis include coronary thrombosis, hepatic vein thrombosis, retinal vein occlusion, carotid artery thrombosis, sinus thrombosis, Wallenberg's syndrome, and thrombophlebitis.

[0852] Ischemia includes cerebral ischemia, ischemic colitis, compartment syndromes, anterior compartment syndrome, myocardial ischemia, reperfusion injuries, and peripheral limb ischemia. Vasculitis includes aortitis, arteritis, Behcet's Syndrome, Churg-Strauss Syndrome, mucocutaneous lymph node syndrome, thromboanguitis obliterans, hypersensitivity vasculitis, Schoenlein-Henoch purpura, allergic cutaneous vasculitis, and Wegener's granulomatosis.

[0853] Polynucleotides or polypeptides, or agonists or antagonists of the invention, are especially effective for the treatment of critical limb ischemia and coronary disease.

[0854] Polypeptides may be administered using any method known in the art, including, but not limited to, direct needle injection at the delivery site, intravenous injection, topical administration, catheter infusion, biolistic injectors, particle accelerators, gelfoam sponge depots, other commercially available depot materials, osmotic pumps, oral or suppositorial solid pharmaceutical formulations, decanting or topical applications during surgery, aerosol delivery. Such methods are known in the art. Polypeptides of the invention may be administered as part of a Therapeutic, described in more detail below. Methods of delivering polynucleotides of the invention are described in more detail herein.

Anti-Angiogenesis Activity

[0855] The naturally occurring balance between endogenous stimulators and inhibitors of angiogenesis is one in which inhibitory influences predominate. Rastinejad et al., Cell 56:345-355 (1989). In those rare instances in which neovascularization occurs under normal physiological conditions, such as wound healing, organ regeneration, embryonic development, and female reproductive processes, angiogenesis is stringently regulated and spatially and temporally delimited. Under conditions of pathological angiogenesis such as that characterizing solid tumor growth, these regulatory controls fail. Unregulated angiogenesis becomes pathologic and sustains progression of many neoplastic and non-neoplastic diseases. A number of serious diseases are dominated by abnormal neovascularization including solid tumor growth and metastases, arthritis, some types of eye diseases, disorders, and/or conditions, and psoriasis. See, e.g., reviews by Moses et al., Biotech. 9:630-634 (1991); Folkman et al., N. Engl. J. Med., 333:1757-1763 (1995); Auerbach et al., J. Microvasc. Res. 29:401-411 (1985); Folkman, Advances in Cancer Research, eds. Klein and Weinhouse, Academic Press, New York, pp. 175-203 (1985); Patz, Am. J. Opthalmol. 94:715-743 (1982); and Folkman et al., Science 221:719-725 (1983). In a number of pathological conditions, the process of angiogenesis contributes to the disease state. For example, significant data have accumulated which suggest that the growth of solid tumors is dependent on angiogenesis. Folkman and Klagsbrun, Science 235:442-447 (1987).

[0856] The present invention provides for treatment of diseases, disorders, and/or conditions associated with neovascularization by administration of the polynucleotides and/or polypeptides of the invention, as well as agonists or antagonists of the present invention. Malignant and metastatic conditions which can be treated with the polynucleotides and polypeptides, or agonists or antagonists of the invention include, but are not limited to, malignancies, solid tumors, and cancers described herein and otherwise known in the art (for a review of such disorders, see Fishman et al., Medicine, 2d Ed., J. B. Lippincott Co., Philadelphia (1985)). Thus, the present invention provides a method of treating, preventing, and/or diagnosing an angiogenesis-related disease and/or disorder, comprising administering to an individual in need thereof a therapeutically effective amount of a polynucleotide, polypeptide, antagonist and/or agonist of the invention. For example, polynucleotides, polypeptides, antagonists and/or agonists may be utilized in a variety of additional methods in order to therapeutically treat or prevent a cancer or tumor. Cancers which may be treated, prevented, and/or diagnosed with polynucleotides, polypeptides, antagonists and/or agonists include, but are not limited to solid tumors, including prostate, lung, breast, ovarian, stomach, pancreas, larynx, esophagus, testes, liver, parotid, biliary tract, colon, rectum, cervix, uterus, endometrium, kidney, bladder, thyroid cancer; primary tumors and metastases; melanomas; glioblastoma; Kaposi's sarcoma; leiomyosarcoma; non- small cell lung cancer; colorectal cancer; advanced malignancies; and blood born tumors such as leukemias. For example, polynucleotides, polypeptides, antagonists and/or agonists may be delivered topically, in order to treat or prevent cancers such as skin cancer, head and neck tumors, breast tumors, and Kaposi's sarcoma.

[0857] Within yet other aspects, polynucleotides, polypeptides, antagonists and/or agonists may be utilized to treat superficial forms of bladder cancer by, for example, intravesical administration. Polynucleotides, polypeptides, antagonists and/or agonists may be delivered directly into the tumor, or near the tumor site, via injection or a catheter. Of course, as the artisan of ordinary skill will appreciate, the appropriate mode of administration will vary according to the cancer to be treated. Other modes of delivery are discussed herein.

[0858] Polynucleotides, polypeptides, antagonists and/or agonists may be useful in treating, preventing, and/or diagnosing other diseases, disorders, and/or conditions, besides cancers, which involve angiogenesis. These diseases, disorders, and/or conditions include, but are not limited to: benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas; artheroscleric plaques; ocular angiogenic diseases, for example, diabetic retinopathy, retinopathy of prematurity, macular degeneration, corneal graft rejection, neovascular glaucoma, retrolental fibroplasia, rubeosis, retinoblastoma, uvietis and Pterygia (abnormal blood vessel growth) of the eye; rheumatoid arthritis; psoriasis; delayed wound healing; endometriosis; vasculogenesis; granulations; hypertrophic scars (keloids); nonunion fractures; scleroderma; trachoma; vascular adhesions; myocardial angiogenesis; coronary collaterals; cerebral collaterals; arteriovenous malformations; ischemic limb angiogenesis; Osler-Webber Syndrome; plaque neovascularization; telangiectasia; hemophiliac joints; angiofibroma; fibromuscular dysplasia; wound granulation; Crohn's disease; and atherosclerosis.

[0859] For example, within one aspect of the present invention methods are provided for treating, preventing, and/or diagnosing hypertrophic scars and keloids, comprising the step of administering a polynucleotide, polypeptide, antagonist and/or agonist of the invention to a hypertrophic scar or keloid.

[0860] Within one embodiment of the present invention polynucleotides, polypeptides, antagonists and/or agonists are directly injected into a hypertrophic scar or keloid, in order to prevent the progression of these lesions. This therapy is of particular value in the prophylactic treatment of conditions which are known to result in the development of hypertrophic scars and keloids (e.g., burns), and is preferably initiated after the proliferative phase has had time to progress (approximately 14 days after the initial injury), but before hypertrophic scar or keloid development. As noted above, the present invention also provides methods for treating, preventing, and/or diagnosing neovascular diseases of the eye, including for example, corneal neovascularization, neovascular glaucoma, proliferative diabetic retinopathy, retrolental fibroplasia and macular degeneration.

[0861] Moreover, Ocular diseases, disorders, and/or conditions associated with neovascularization which can be treated, prevented, and/or diagnosed with the polynucleotides and polypeptides of the present invention (including agonists and/or antagonists) include, but are not limited to: neovascular glaucoma, diabetic retinopathy, retinoblastoma, retrolental fibroplasia, uveitis, retinopathy of prematurity macular degeneration, corneal graft neovascularization, as well as other eye inflammatory diseases, ocular tumors and diseases associated with choroidal or iris neovascularization. See, e.g., reviews by Waltman et al., Am. J. Ophthal. 85:704-710 (1978) and Gartner et al., Surv. Ophthal. 22:291-312 (1978).

[0862] Thus, within one aspect of the present invention methods are provided for treating or preventing neovascular diseases of the eye such as corneal neovascularization (including corneal graft neovascularization), comprising the step of administering to a patient a therapeutically effective amount of a compound (as described above) to the cornea, such that the formation of blood vessels is inhibited. Briefly, the cornea is a tissue which normally lacks blood vessels. In certain pathological conditions however, capillaries may extend into the cornea from the pericorneal vascular plexus of the limbus. When the cornea becomes vascularized, it also becomes clouded, resulting in a decline in the patient's visual acuity. Visual loss may become complete if the cornea completely opacitates. A wide variety of diseases, disorders, and/or conditions can result in corneal neovascularization, including for example, corneal infections (e.g., trachoma, herpes simplex keratitis, leishmaniasis and onchocerciasis), immunological processes (e.g., graft rejection and Stevens-Johnson's syndrome), alkali burns, trauma, inflanmation (of any cause), toxic and nutritional deficiency states, and as a complication of wearing contact lenses.

[0863] Within particularly preferred embodiments of the invention, may be prepared for topical administration in saline (combined with any of the preservatives and antimicrobial agents commonly used in ocular preparations), and administered in eyedrop form. The solution or suspension may be prepared in its pure form and administered several times daily. Alternatively, anti-angiogenic compositions, prepared as described above, may also be administered directly to the cornea. Within preferred embodiments, the anti-angiogenic composition is prepared with a muco-adhesive polymer which binds to cornea. Within further embodiments, the anti-angiogenic factors or anti-angiogenic compositions may be utilized as an adjunct to conventional steroid therapy. Topical therapy may also be useful prophylactically in corneal lesions which are known to have a high probability of inducing an angiogenic response (such as chemical burns). In these instances the treatment, likely in combination with steroids, may be instituted immediately to help prevent subsequent complications.

[0864] Within other embodiments, the compounds described above may be injected directly into the corneal stroma by an ophthalmologist under microscopic guidance. The preferred site of injection may vary with the morphology of the individual lesion, but the goal of the administration would be to place the composition at the advancing front of the vasculature (i.e., interspersed between the blood vessels and the normal cornea). In most cases this would involve perilimbic corneal injection to “protect” the cornea from the advancing blood vessels. This method may also be utilized shortly after a corneal insult in order to prophylactically prevent corneal neovascularization. In this situation the material could be injected in the perilimbic cornea interspersed between the corneal lesion and its undesired potential limbic blood supply. Such methods may also be utilized in a similar fashion to prevent capillary invasion of transplanted corneas. In a sustained-release form injections might only be required 2-3 times per year. A steroid could also be added to the injection solution to reduce inflammation resulting from the injection itself.

[0865] Within another aspect of the present invention, methods are provided for treating or preventing neovascular glaucoma, comprising the step of administering to a patient a therapeutically effective amount of a polynucleotide, polypeptide, antagonist and/or agonist to the eye, such that the formation of blood vessels is inhibited. In one embodiment, the compound may be administered topically to the eye in order to treat or prevent early forms of neovascular glaucoma. Within other embodiments, the compound may be implanted by injection into the region of the anterior chamber angle. Within other embodiments, the compound may also be placed in any location such that the compound is continuously released into the aqueous humor. Within another aspect of the present invention, methods are provided for treating or preventing proliferative diabetic retinopathy, comprising the step of administering to a patient a therapeutically effective amount of a polynucleotide, polypeptide, antagonist and/or agonist to the eyes, such that the formation of blood vessels is inhibited.

[0866] Within particularly preferred embodiments of the invention, proliferative diabetic retinopathy may be treated by injection into the aqueous humor or the vitreous, in order to increase the local concentration of the polynucleotide, polypeptide, antagonist and/or agonist in the retina. Preferably, this treatment should be initiated prior to the acquisition of severe disease requiring photocoagulation.

[0867] Within another aspect of the present invention, methods are provided for treating or preventing retrolental fibroplasia, comprising the step of administering to a patient a therapeutically effective amount of a polynucleotide, polypeptide, antagonist and/or agonist to the eye, such that the formation of blood vessels is inhibited. The compound may be administered topically, via intravitreous injection and/or via intraocular implants.

[0868] Additionally, diseases, disorders, and/or conditions which can be treated, prevented, and/or diagnosed with the polynucleotides, polypeptides, agonists and/or agonists include, but are not limited to, hemangioma, arthritis, psoriasis, angiofibroma, atherosclerotic plaques, delayed wound healing, granulations, hemophilic joints, hypertrophic scars, nonunion fractures, Osler-Weber syndrome, pyogenic granuloma, scleroderma, trachoma, and vascular adhesions.

[0869] Moreover, diseases, disorders, and/or conditions and/or states, which can be treated, prevented, and/or diagnosed with the polynucleotides, polypeptides, agonists and/or agonists include, but are not limited to, solid tumors, blood born tumors such as leukemias, tumor metastasis, Kaposi's sarcoma, benign tumors, for example hemangiomas, acoustic neuromas, neurofibromas, trachomas, and pyogenic granulomas, rheumatoid arthritis, psoriasis, ocular angiogenic diseases, for example, diabetic retinopathy, retinopathy of prematurity, macular degeneration, corneal graft rejection, neovascular glaucoma, retrolental fibroplasia, rubeosis, retinoblastoma, and uvietis, delayed wound healing, endometriosis, vascluogenesis, granulations, hypertrophic scars (keloids), nonunion fractures, scleroderma, trachoma, vascular adhesions, myocardial angiogenesis, coronary collaterals, cerebral collaterals, arteriovenous malformations, ischemic limb angiogenesis, Osler-Webber Syndrome, plaque neovascularization, telangiectasia, hemophiliac joints, angiofibroma fibromuscular dysplasia, wound granulation, Crohn's disease, atherosclerosis, birth control agent by preventing vascularization required for embryo implantation controlling menstruation, diseases that have angiogenesis as a pathologic consequence such as cat scratch disease (Rochele minalia quintosa), ulcers (Helicobacter pylori), Bartonellosis and bacillary angiomatosis.

[0870] In one aspect of the birth control method, an amount of the compound sufficient to block embryo implantation is administered before or after intercourse and fertilization have occurred, thus providing an effective method of birth control, possibly a “morning after” method. Polynucleotides, polypeptides, agonists and/or agonists may also be used in controlling menstruation or administered as either a peritoneal lavage fluid or for peritoneal implantation in the treatment of endometriosis.

[0871] Polynucleotides, polypeptides, agonists and/or agonists of the present invention may be incorporated into surgical sutures in order to prevent stitch granulomas.

[0872] Polynucleotides, polypeptides, agonists and/or agonists may be utilized in a wide variety of surgical procedures. For example, within one aspect of the present invention a compositions (in the form of, for example, a spray or film) may be utilized to coat or spray an area prior to removal of a tumor, in order to isolate normal surrounding tissues from malignant tissue, and/or to prevent the spread of disease to surrounding tissues. Within other aspects of the present invention, compositions (e.g., in the form of a spray) may be delivered via endoscopic procedures in order to coat tumors, or inhibit angiogenesis in a desired locale. Within yet other aspects of the present invention, surgical meshes which have been coated with anti-angiogenic compositions of the present invention may be utilized in any procedure wherein a surgical mesh might be utilized. For example, within one embodiment of the invention a surgical mesh laden with an anti-angiogenic composition may be utilized during abdominal cancer resection surgery (e.g., subsequent to colon resection) in order to provide support to the structure, and to release an amount of the anti-angiogenic factor.

[0873] Within further aspects of the present invention, methods are provided for treating tumor excision sites, comprising administering a polynucleotide, polypeptide, agonist and/or agonist to the resection margins of a tumor subsequent to excision, such that the local recurrence of cancer and the formation of new blood vessels at the site is inhibited. Within one embodiment of the invention, the anti-angiogenic compound is administered directly to the tumor excision site (e.g., applied by swabbing, brushing or otherwise coating the resection margins of the tumor with the anti-angiogenic compound). Alternatively, the anti-angiogenic compounds may be incorporated into known surgical pastes prior to administration. Within particularly preferred embodiments of the invention, the anti-angiogenic compounds are applied after hepatic resections for malignancy, and after neurosurgical operations.

[0874] Within one aspect of the present invention, polynucleotides, polypeptides, agonists and/or agonists may be administered to the resection margin of a wide variety of tumors, including for example, breast, colon, brain and hepatic tumors. For example, within one embodiment of the invention, anti-angiogenic compounds may be administered to the site of a neurological tumor subsequent to excision, such that the formation of new blood vessels at the site are inhibited.

[0875] The polynucleotides, polypeptides, agonists and/or agonists of the present invention may also be administered along with other anti-angiogenic factors. Representative examples of other anti-angiogenic factors include: Anti-Invasive Factor, retinoic acid and derivatives thereof, paclitaxel, Suramin, Tissue Inhibitor of Metalloproteinase-1, Tissue Inhibitor of Metalloproteinase-2, Plasminogen Activator Inhibitor-1, Plasminogen Activator Inhibitor-2, and various forms of the lighter “d group” transition metals.

[0876] Lighter “d group” transition metals include, for example, vanadium, molybdenum, tungsten, titanium, niobium, and tantalum species. Such transition metal species may form transition metal complexes. Suitable complexes of the above-mentioned transition metal species include oxo transition metal complexes.

[0877] Representative examples of vanadium complexes include oxo vanadium complexes such as vanadate and vanadyl complexes. Suitable vanadate complexes include metavanadate and orthovanadate complexes such as, for example, ammonium metavanadate, sodium metavanadate, and sodium orthovanadate. Suitable vanadyl complexes include, for example, vanadyl acetylacetonate and vanadyl sulfate including vanadyl sulfate hydrates such as vanadyl sulfate mono- and trihydrates.

[0878] Representative examples of tungsten and molybdenum complexes also include oxo complexes. Suitable oxo tungsten complexes include tungstate and tungsten oxide complexes. Suitable tungstate complexes include ammonium tungstate, calcium tungstate, sodium tungstate dihydrate, and tungstic acid. Suitable tungsten oxides include tungsten (IV) oxide and tungsten (VI) oxide. Suitable oxo molybdenum complexes include molybdate, molybdenum oxide, and molybdenyl complexes. Suitable molybdate complexes include ammonium molybdate and its hydrates, sodium molybdate and its hydrates, and potassium molybdate and its hydrates. Suitable molybdenum oxides include molybdenum (VI) oxide, molybdenum (VI) oxide, and molybdic acid. Suitable molybdenyl complexes include, for example, molybdenyl acetylacetonate. Other suitable tungsten and molybdenum complexes include hydroxo derivatives derived from, for example, glycerol, tartaric acid, and sugars.

[0879] A wide variety of other anti-angiogenic factors may also be utilized within the context of the present invention. Representative examples include platelet factor 4; protamine sulphate; sulphated chitin derivatives (prepared from queen crab shells), (Murata et al., Cancer Res. 51:22-26, 1991); Sulphated Polysaccharide Peptidoglycan Complex (SP-PG) (the function of this compound may be enhanced by the presence of steroids such as estrogen, and tamoxifen citrate); Staurosporine; modulators of matrix metabolism, including for example, proline analogs, cishydroxyproline, d,L-3,4-dehydroproline, Thiaproline, alpha,alpha-dipyridyl, aminopropionitrile fumarate; 4-propyl-5-(4-pyridinyl)-2(3H)-oxazolone; Methotrexate; Mitoxantrone; Heparin; Interferons; 2 Macroglobulin-serum; ChIMP-3 (Pavloff et al., J. Bio. Chem. 267:17321-17326, 1992); Chymostatin (Tomkinson et al., Biochem J. 286:475-480, 1992); Cyclodextrin Tetradecasulfate; Eponemycin; Camptothecin; Fumagillin (Ingber et al., Nature 348:555-557, 1990); Gold Sodium Thiomalate (“GST”; Matsubara and Ziff, J. Clin. Invest. 79:1440-1446, 1987); anticollagenase-serum; alpha2-antiplasmin (Holmes et al., J. Biol. Chem. 262(4):1659-1664, 1987); Bisantrene (National Cancer Institute); Lobenzarit disodium (N-(2)-carboxyphenyl-4-chloroanthronilic acid disodium or “CCA”; Takeuchi et al., Agents Actions 36:312-316, 1992); Thalidomide; Angostatic steroid; AGM-1470; carboxynaminolmidazole; and metalloproteinase inhibitors such as BB94.

Diseases at the Cellular Level

[0880] Diseases associated with increased cell survival or the inhibition of apoptosis that could be treated, prevented, and/or diagnosed by the polynucleotides or polypeptides and/or antagonists or agonists of the invention, include cancers (such as follicular lymphomas, carcinomas with p53 mutations, and hormone-dependent tumors, including, but not limited to colon cancer, cardiac tumors, pancreatic cancer, melanoma, retinoblastoma, glioblastoma, lung cancer, intestinal cancer, testicular cancer, stomach cancer, neuroblastoma, myxoma, myoma, lymphoma, endothelioma, osteoblastoma, osteoclastoma, osteosarcoma, chondrosarcoma, adenoma, breast cancer, prostate cancer, Kaposi's sarcoma and ovarian cancer); autoimmune diseases, disorders, and/or conditions (such as, multiple sclerosis, Sjogren's syndrome, Hashimoto's thyroiditis, biliary cirrhosis, Behcet's disease, Crohn's disease, polymyositis, systemic lupus erythematosus and immune-related glomerulonephritis and rheumatoid arthritis) and viral infections (such as herpes viruses, pox viruses and adenoviruses), inflammation, graft v. host disease, acute graft rejection, and chronic graft rejection. In preferred embodiments, the polynucleotides or polypeptides, and/or agonists or antagonists of the invention are used to inhibit growth, progression, and/or metastasis of cancers, in particular those listed above.

[0881] Additional diseases or conditions associated with increased cell survival that could be treated, prevented or diagnosed by the polynucleotides or polypeptides, or agonists or antagonists of the invention, include, but are not limited to, progression, and/or metastases of malignancies and related disorders such as leukemia (including acute leukemias (e.g., acute lymphocytic leukemia, acute myelocytic leukemia (including myeloblastic, promyelocytic, myelomonocytic, monocytic, and erythroleukemia)) and chronic leukemias (e.g., chronic myelocytic (granulocytic) leukemia and chronic lymphocytic leukemia)), polycythemia vera, lymphomas (e.g., Hodgkin's disease and non-Hodgkin's disease), multiple myeloma, Waldenstrom's macroglobulinemia, heavy chain disease, and solid tumors including, but not limited to, sarcomas and carcinomas such as fibrosarcoma, myxosarcoma, liposarcoma, chondrosarcoma, osteogenic sarcoma, chordoma, angiosarcoma, endotheliosarcoma, lymphangiosarcoma, lymphangioendotheliosarcoma, synovioma, mesothelioma, Ewing's tumor, leiomyosarcoma, rhabdomyosarcoma, colon carcinoma, pancreatic cancer, breast cancer, ovarian cancer, prostate cancer, squamous cell carcinoma, basal cell carcinoma, adenocarcinoma, sweat gland carcinoma, sebaceous gland carcinoma, papillary carcinoma, papillary adenocarcinomas, cystadenocarcinoma, medullary carcinoma, bronchogenic carcinoma, renal cell carcinoma, hepatoma, bile duct carcinoma, choriocarcinoma, seminoma, embryonal carcinoma, Wilm's tumor, cervical cancer, testicular tumor, lung carcinoma, small cell lung carcinoma, bladder carcinoma, epithelial carcinoma, glioma, astrocytoma, medulloblastoma, craniopharyngioma, ependymoma, pinealoma, hemangioblastoma, acoustic neuroma, oligodendroglioma, menangioma, melanoma, neuroblastoma, and retinoblastoma.

[0882] Diseases associated with increased apoptosis that could be treated, prevented, and/or diagnosed by the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, include AIDS; neurodegenerative diseases, disorders, and/or conditions (such as Alzheimer's disease, Parkinson's disease, Amyotrophic lateral sclerosis, Retinitis pigmentosa, Cerebellar degeneration and brain tumor or prior associated disease); autoimmune diseases, disorders, and/or conditions (such as, multiple sclerosis, Sjogren's syndrome, Hashimoto's thyroiditis, biliary cirrhosis, Behcet's disease, Crohn's disease, polymyositis, systemic lupus erythematosus and immune-related glomerulonephritis and rheumatoid arthritis) myelodysplastic syndromes (such as aplastic anemia), graft v. host disease, ischemic injury (such as that caused by myocardial infarction, stroke and reperfusion injury), liver injury (e.g., hepatitis related liver injury, ischemia/reperfusion injury, cholestosis (bile duct injury) and liver cancer); toxin-induced liver disease (such as that caused by alcohol), septic shock, cachexia and anorexia.

Wound Healing and Epithelial Cell Proliferation

[0883] In accordance with yet a further aspect of the present invention, there is provided a process for utilizing the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, for therapeutic purposes, for example, to stimulate epithelial cell proliferation and basal keratinocytes for the purpose of wound healing, and to stimulate hair follicle production and healing of dermal wounds. Polynucleotides or polypeptides, as well as agonists or antagonists of the invention, may be clinically useful in stimulating wound healing including surgical wounds, excisional wounds, deep wounds involving damage of the dermis and epidermis, eye tissue wounds, dental tissue wounds, oral cavity wounds, diabetic ulcers, dermal ulcers, cubitus ulcers, arterial ulcers, venous stasis ulcers, burns resulting from heat exposure or chemicals, and other abnormal wound healing conditions such as uremia, malnutrition, vitamin deficiencies and complications associated with systemic treatment with steroids, radiation therapy and antineoplastic drugs and antimetabolites. Polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used to promote dermal reestablishment subsequent to dermal loss The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used to increase the adherence of skin grafts to a wound bed and to stimulate re-epithelialization from the wound bed. The following are a non-exhaustive list of grafts that polynucleotides or polypeptides, agonists or antagonists of the invention, could be used to increase adherence to a wound bed: autografts, artificial skin, allografts, autodermic graft, autoepidermic grafts, avacular grafts, Blair-Brown grafts, bone graft, brephoplastic grafts, cutis graft, delayed graft, dermic graft, epidermic graft, fascia graft, full thickness graft, heterologous graft, xenograft, homologous graft, hyperplastic graft, lamellar graft, mesh graft, mucosal graft, Ollier-Thiersch graft, omenpal graft, patch graft, pedicle graft, penetrating graft, split skin graft, thick split graft. The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, can be used to promote skin strength and to improve the appearance of aged skin.

[0884] It is believed that the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, will also produce changes in hepatocyte proliferation, and epithelial cell proliferation in the lung, breast, pancreas, stomach, small intestine, and large intestine. The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could promote proliferation of epithelial cells such as sebocytes, hair follicles, hepatocytes, type II pneumocytes, mucin-producing goblet cells, and other epithelial cells and their progenitors contained within the skin, lung, liver, and gastrointestinal tract. The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, may promote proliferation of endothelial cells, keratinocytes, and basal keratinocytes.

[0885] The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could also be used to reduce the side effects of gut toxicity that result from radiation, chemotherapy treatments or viral infections. The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, may have a cytoprotective effect on the small intestine mucosa. The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, may also stimulate healing of mucositis (mouth ulcers) that result from chemotherapy and viral infections.

[0886] The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could further be used in full regeneration of skin in full and partial thickness skin defects, including burns, (i.e., repopulation of hair follicles, sweat glands, and sebaceous glands), treatment of other skin defects such as psoriasis. The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used to treat epidermolysis bullosa, a defect in adherence of the epidermis to the underlying dernius which results in frequent, open and painful blisters by accelerating reepithelialization of these lesions. The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could also be used to treat gastric and doudenal ulcers and help heal by scar formation of the mucosal lining and regeneration of glandular mucosa and duodenal mucosal lining more rapidly. Inflamamatory bowel diseases, such as Crohn's disease and ulcerative colitis, are diseases which result in destruction of the mucosal surface of the small or large intestine, respectively. Thus, the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used to promote the resurfacing of the mucosal surface to aid more rapid healing and to prevent progression of inflammatory bowel disease. Treatment with the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, is expected to have a significant effect on the production of mucus throughout the gastrointestinal tract and could be used to protect the intestinal mucosa from injurious substances that are ingested or following surgery. The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used to treat diseases associate with the under expression of the polynucleotides of the invention.

[0887] Moreover, the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used to prevent and heal damage to the lungs due to various pathological states. A growth factor such as the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, which could stimulate proliferation and differentiation and promote the repair of alveoli and brochiolar epithelium to prevent or treat acute or chronic lung damage. For example, emphysema, which results in the progressive loss of aveoli, and inhalation injuries, i.e., resulting from smoke inhalation and burns, that cause necrosis of the bronchiolar epithelium and alveoli could be effectively treated, prevented, and/or diagnosed using the polynucleotides or polypeptides, and/or agonists or antagonists of the invention. Also, the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used to stimulate the proliferation of and differentiation of type II pneumocytes, which may help treat or prevent disease such as hyaline membrane diseases, such as infant respiratory distress syndrome and bronchopulmonary displasia, in premature infants.

[0888] The polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could stimulate the proliferation and differentiation of hepatocytes and, thus, could be used to alleviate or treat liver diseases and pathologies such as fulminant liver failure caused by cirrhosis, liver damage caused by viral hepatitis and toxic substances (i.e., acetaminophen, carbon tetraholoride and other hepatotoxins known in the art).

[0889] In addition, the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used treat or prevent the onset of diabetes mellitus. In patients with newly diagnosed Types I and II diabetes, where some islet cell function remains, the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used to maintain the islet function so as to alleviate, delay or prevent permanent manifestation of the disease. Also, the polynucleotides or polypeptides, and/or agonists or antagonists of the invention, could be used as an auxiliary in islet cell transplantation to improve or promote islet cell function.

Neurological Diseases

[0890] Nervous system diseases, disorders, and/or conditions, which can be treated, prevented, and/or diagnosed with the compositions of the invention (e.g., polypeptides,; polynucleotides, and/or agonists or antagonists), include, but are not limited to, nervous system injuries, and diseases, disorders, and/or conditions which result in either a disconnection of axons, a diminution or degeneration of neurons, or demyelination. Nervous system lesions which may be treated, prevented, and/or diagnosed in a patient (including human and non-human mammalian patients) according to the invention, include but are not limited to, the following lesions of either the central (including spinal cord, brain) or peripheral nervous systems: (1) ischemic lesions, in which a lack of oxygen in a portion of the nervous system results in neuronal injury or death, including cerebral infarction or ischemia, or spinal cord infarction or ischemia; (2) traumatic lesions, including lesions caused by physical injury or associated with surgery, for example, lesions which sever a portion of the nervous system, or compression injuries; (3) malignant lesions, in which a portion of the nervous system is destroyed or injured by malignant tissue which is either a nervous system associated malignancy or a malignancy derived from non-nervous system tissue; (4) infectious lesions, in which a portion of the nervous system is destroyed or injured as a result of infection, for example, by an abscess or associated with infection by human immunodeficiency virus, herpes zoster, or herpes simplex virus or with Lyme disease, tuberculosis, syphilis; (5) degenerative lesions, in which a portion of the nervous system is destroyed or injured as a result of a degenerative process including but not limited to degeneration associated with Parkinson's disease, Alzheimer's disease, Huntington's chorea, or amyotrophic lateral sclerosis (ALS); (6) lesions associated with nutritional diseases, disorders, and/or conditions, in which a portion of the nervous system is destroyed or injured by a nutritional disorder or disorder of metabolism including but not limited to, vitamin B12 deficiency, folic acid deficiency, Wernicke disease, tobacco-alcohol amblyopia, Marchiafava-Bignami disease (primary degeneration of the corpus callosum), and alcoholic cerebellar degeneration; (7) neurological lesions associated with systemic diseases including, but not limited to, diabetes (diabetic neuropathy, Bell's palsy), systemic lupus erythematosus, carcinoma, or sarcoidosis; (8) lesions caused by toxic substances including alcohol, lead, or particular neurotoxins; and (9) demyelinated lesions in which a portion of the nervous system is destroyed or injured by a demyelinating disease including, but not limited to, multiple sclerosis, human immunodeficiency virus-associated myelopathy, transverse myelopathy or various etiologies, progressive multifocal leukoencephalopathy, and central pontine myelinolysis.

[0891] In a preferred embodiment, the polypeptides, polynucleotides, or agonists or antagonists of the invention are used to protect neural cells from the damaging effects of cerebral hypoxia. According to this embodiment, the compositions of the invention are used to treat, prevent, and/or diagnose neural cell injury associated with cerebral hypoxia. In one aspect of this embodiment, the polypeptides, polynucleotides, or agonists or antagonists of the invention are used to treat, prevent, and/or diagnose neural cell injury associated with cerebral ischemia. In another aspect of this embodiment, the polypeptides, polynucleotides, or agonists or antagonists of the invention are used to treat, prevent, and/or diagnose neural cell injury associated with cerebral infarction. In another aspect of this embodiment, the polypeptides, polynucleotides, or agonists or antagonists of the invention are used to treat, prevent, and/or diagnose or prevent neural cell injury associated with a stroke. In a further aspect of this embodiment, the polypeptides, polynucleotides, or agonists or antagonists of the invention are used to treat, prevent, and/or diagnose neural cell injury associated with a heart attack.

[0892] The compositions of the invention which are useful for treating or preventing a nervous system disorder may be selected by testing for biological activity in promoting the survival or differentiation of neurons. For example, and not by way of limitation, compositions of the invention which elicit any of the following effects may be useful according to the invention: (1) increased survival time of neurons in culture; (2) increased sprouting of neurons in culture or in vivo; (3) increased production of a neuron-associated molecule in culture or in vivo, e.g., choline acetyltransferase or acetylcholinesterase with respect to motor neurons; or (4) decreased symptoms of neuron dysfunction in vivo. Such effects may be measured by any method known in the art. In preferred, non-limiting embodiments, increased survival of neurons may routinely be measured using a method set forth herein or otherwise known in the art, such as, for example, the method set forth in Arakawa et al. (J. Neurosci. 10:3507-3515 (1990)); increased sprouting of neurons may be detected by methods known in the art, such as, for example, the methods set forth in Pestronk et al. (Exp. Neurol. 70:65-82 (1980)) or Brown et al. (Ann. Rev. Neurosci. 4:17-42 (1981)); increased production of neuron-associated molecules may be measured by bioassay, enzymatic assay, antibody binding, Northern blot assay, etc., using techniques known in the art and depending on the molecule to be measured; and motor neuron dysfunction may be measured by assessing the physical manifestation of motor neuron disorder, e.g., weakness, motor neuron conduction velocity, or functional disability.

[0893] In specific embodiments, motor neuron diseases, disorders, and/or conditions that may be treated, prevented, and/or diagnosed according to the invention include, but are not limited to, diseases, disorders, and/or conditions such as infarction, infection, exposure to toxin, trauma, surgical damage, degenerative disease or malignancy that may affect motor neurons as well as other components of the nervous system, as well as diseases, disorders, and/or conditions that selectively affect neurons such as amyotrophic lateral sclerosis, and including, but not limited to, progressive spinal muscular atrophy, progressive bulbar palsy, primary lateral sclerosis, infantile and juvenile muscular atrophy, progressive bulbar paralysis of childhood (Fazio-Londe syndrome), poliomyelitis and the post polio syndrome, and Hereditary Motorsensory Neuropathy (Charcot-Marie-Tooth Disease).

Infectious Disease

[0894] A polypeptide or polynucleotide and/or agonist or antagonist of the present invention can be used to treat, prevent, and/or diagnose infectious agents. For example, by increasing the immune response, particularly increasing the proliferation and differentiation of B and/or T cells, infectious diseases may be treated, prevented, and/or diagnosed. The immune response may be increased by either enhancing an existing immune response, or by initiating a new immune response. Alternatively, polypeptide or polynucleotide and/or agonist or antagonist of the present invention may also directly inhibit the infectious agent, without necessarily eliciting an immune response.

[0895] Viruses are one example of an infectious agent that can cause disease or symptoms that can be treated, prevented, and/or diagnosed by a polynucleotide or polypeptide and/or agonist or antagonist of the present invention. Examples of viruses, include, but are not limited to Examples of viruses, include, but are not limited to the following DNA and RNA viruses and viral families: Arbovirus, Adenoviridae, Arenaviridae, Arterivirus, Birnaviridae, Bunyaviridae, Caliciviridae, Circoviridae, Coronaviridae, Dengue, EBV, HIV, Flaviviridae, Hepadnaviridae (Hepatitis), Herpesviridae (such as, Cytomegalovirus, Herpes Simplex, Herpes Zoster), Mononegavirus (e.g., Paramyxoviridae, Morbillivirus, Rhabdoviridae), Orthomyxoviridae (e.g., Influenza A, Influenza B, and parainfluenza), Papiloma virus, Papovaviridae, Parvoviridae, Picornaviridae, Poxviridae (such as Smallpox or Vaccinia), Reoviridae (e.g., Rotavirus), Retroviridae (HTLV-I, HTLV-II, Lentivirus), and Togaviridae (e.g., Rubivirus). Viruses falling within these families can cause a variety of diseases or symptoms, including, but not limited to: arthritis, bronchiollitis, respiratory syncytial virus, encephalitis, eye infections (e.g., conjunctivitis, keratitis), chronic fatigue syndrome, hepatitis (A, B, C, E, Chronic Active, Delta), Japanese B encephalitis, Junin, Chikungunya, Rift Valley fever, yellow fever, meningitis, opportunistic infections (e.g., AIDS), pneumonia, Burkitt's Lymphoma, chickenpox, hemorrhagic fever, Measles, Mumps, Parainfluenza, Rabies, the common cold, Polio, leukemia, Rubella, sexually transmitted diseases, skin diseases (e.g., Kaposi's, warts), and viremia. polynucleotides or polypeptides, or agonists or antagonists of the invention, can be used to treat, prevent, and/or diagnose any of these symptoms or diseases. In specific embodiments, polynucleotides, polypeptides, or agonists or antagonists of the invention are used to treat, prevent, and/or diagnose: meningitis, Dengue, EBV, and/or hepatitis (e.g., hepatitis B). In an additional specific embodiment polynucleotides, polypeptides, or agonists or antagonists of the invention are used to treat patients nonresponsive to one or more other commercially available hepatitis vaccines. In a further specific embodiment polynucleotides, polypeptides, or agonists or antagonists of the invention are used to treat, prevent, and/or diagnose AIDS.

[0896] Similarly, bacterial or fungal agents that can cause disease or symptoms and that can be treated, prevented, and/or diagnosed by a polynucleotide or polypeptide and/or agonist or antagonist of the present invention include, but not limited to, include, but not limited to, the following Gram-Negative and Gram-positive bacteria and bacterial families and fungi: Actinomycetales (e.g., Corynebacteriun, Mycobacterium, Norcardia), Cryptococcus neoformans, Aspergillosis, Bacillaceae (e.g., Anthrax, Clostridium), Bacteroidaceae, Blastomycosis, Bordetella, Borrelia (e.g., Borrelia burgdorferi), Brucellosis, Candidiasis, Campylobacter, Coccidioidomycosis, Cryptococcosis, bermatocycoses, E. coli (e.g., Enterotoxigenic E. coli and Enterohemorrhagic E. coli), Enterobacteriaceae (Klebsiella, Salmonella (e.g., Salmonella typhi, and Salmonella paratyphi), Serratia, Yersinia), Erysipelothrix, Helicobacter, Legionellosis, Leptospirosis, Listeria, Mycoplasmatales, Mycobacterium leprae, Vibrio cholerae, Neisseriaceae (e.g., Acinetobacter, Gonorrhea, Menigococcal), Meisseria meningitidis, Pasteurellacea Infections (e.g., Actinobacillus, Heamophilus (e.g., Heamophilus influenza type B), Pasteurella), Pseudomonas, Rickettsiaceae, Chlamydiaceae, Syphilis, Shigella spp., Staphylococcal, Meningiococcal, Pneumococcal and Streptococcal (e.g., Streptococcus pneumoniae and Group B Streptococcus). These bacterial or fungal families can cause the following diseases or symptoms, including, but not limited to: bacteremia, endocarditis, eye infections (conjunctivitis, tuberculosis, uveitis), gingivitis, opportunistic infections (e.g., AIDS related infections), paronychia, prosthesis-related infections, Reiter's Disease, respiratory tract infections, such as Whooping Cough or Empyema, sepsis, Lyme Disease, Cat-Scratch Disease, Dysentery, Paratyphoid Fever, food poisoning, Typhoid, pneumonia, Gonorrhea, meningitis (e.g., mengitis types A and B), Chlamydia, Syphilis, Diphtheria, Leprosy, Paratuberculosis, Tuberculosis, Lupus, Botulism, gangrene, tetanus, impetigo, Rheumatic Fever, Scarlet Fever, sexually transmitted diseases, skin diseases (e.g., cellulitis, dermatocycoses), toxemia, urinary tract infections, wound infections. Polynucleotides or polypeptides, agonists or antagonists of the invention, can be used to treat, prevent, and/or diagnose any of these symptoms or diseases. In specific embodiments, polynucleotides, polypeptides, agonists or antagonists of the invention are used to treat, prevent, and/or diagnose: tetanus, Diptheria, botulism, and/or meningitis type B.

[0897] Moreover, parasitic agents causing disease or symptoms that can be treated, prevented, and/or diagnosed by a polynucleotide or polypeptide and/or agonist or antagonist of the present invention include, but not limited to, the following families or class: Amebiasis, Babesiosis, Coccidiosis, Cryptosporidiosis, Dientamoebiasis, Dourine, Ectoparasitic, Giardiasis, Helminthiasis, Leishmaniasis, Theileriasis, Toxoplasmosis, Trypanosomiasis, and Trichomonas and Sporozoans (e.g., Plasmodium virax, Plasmodium falciparium, Plasmodium malariae and Plasmodium ovale). These parasites can cause a variety of diseases or symptoms, including, but not limited to: Scabies, Trombiculiasis, eye infections, intestinal disease (e.g., dysentery, giardiasis), liver disease, lung disease, opportunistic infections (e.g., AIDS related), malaria, pregnancy complications, and toxoplasmosis. polynucleotides or polypeptides, or agonists or antagonists of the invention, can be used to treat, prevent, and/or diagnose any of these symptoms or diseases. In specific embodiments, polynucleotides, polypeptides, or agonists or antagonists of the invention are used to treat, prevent, and/or diagnose malaria.

[0898] Preferably, treatment or prevention using a polypeptide or polynucleotide and/or agonist or antagonist of the present invention could either be by administering an effective amount of a polypeptide to the patient, or by removing cells from the patient, supplying the cells with a polynucleotide of the present invention, and returning the engineered cells to the patient (ex vivo therapy). Moreover, the polypeptide or polynucleotide of the present invention can be used as an antigen in a vaccine to raise an immune response against infectious disease.

Regeneration

[0899] A polynucleotide or polypeptide and/or agonist or antagonist of the present invention can be used to differentiate, proliferate, and attract cells, leading to the regeneration of tissues. (See, Science 276:59-87 (1997).) The regeneration of tissues could be used to repair, replace, or protect tissue damaged by congenital defects, trauma (wounds, burns, incisions, or ulcers), age, disease (e.g. osteoporosis, osteocarthritis, periodontal disease, liver failure), surgery, including cosmetic plastic surgery, fibrosis, reperfusion injury, or systemic cytokine damage.

[0900] Tissues that could be regenerated using the present invention include organs (e.g., pancreas, liver, intestine, kidney, skin, endothelium), muscle (smooth, skeletal or cardiac), vasculature (including vascular and lymphatics), nervous, hematopoietic, and skeletal (bone, cartilage, tendon, and ligament) tissue. Preferably, regeneration occurs without or decreased scarring. Regeneration also may include angiogenesis.

[0901] Moreover, a polynucleotide or polypeptide and/or agonist or antagonist of the present invention may increase regeneration of tissues difficult to heal. For example, increased tendon/ligament regeneration would quicken recovery time after damage. A polynucleotide or polypeptide and/or agonist or antagonist of the present invention could also be used prophylactically in an effort to avoid damage. Specific diseases that could be treated, prevented, and/or diagnosed include of tendinitis, carpal tunnel syndrome, and other tendon or ligament defects. A further example of tissue regeneration of non-healing wounds includes pressure ulcers, ulcers associated with vascular insufficiency, surgical, and traumatic wounds.

[0902] Similarly, nerve and brain tissue could also be regenerated by using a polynucleotide or polypeptide and/or agonist or antagonist of the present invention to proliferate and differentiate nerve cells. Diseases that could be treated, prevented, and/or diagnosed using this method include central and peripheral nervous system diseases, neuropathies, or mechanical and traumatic diseases, disorders, and/or conditions (e.g., spinal cord disorders, head trauma, cerebrovascular disease, and stoke). Specifically, diseases associated with peripheral nerve injuries, peripheral neuropathy (e.g., resulting from chemotherapy or other medical therapies), localized neuropathies, and central nervous system diseases (e.g., Alzheimer's disease, Parkinson's disease, Huntington's disease, amyotrophic lateral sclerosis, and Shy-Drager syndrome), could all be treated, prevented, and/or diagnosed using the polynucleotide or polypeptide and/or agonist or antagonist of the present invention.

Chemotaxis

[0903] A polynucleotide or polypeptide and/or agonist or antagonist of the present invention may have chemotaxis activity. A chemotaxic molecule attracts or mobilizes cells (e.g., monocytes, fibroblasts, neutrophils, T-cells, mast cells, eosinophils, epithelial and/or endothelial cells) to a particular site in the body, such as inflammation, infection, or site of hyperproliferation. The mobilized cells can then fight off and/or heal the particular trauma or abnormality.

[0904] A polynucleotide or polypeptide and/or agonist or antagonist of the present invention may increase chemotaxic activity of particular cells. These chemotactic molecules can then be used to treat, prevent, and/or diagnose inflammation, infection, hyperproliferative diseases, disorders, and/or conditions, or any immune system disorder by increasing the number of cells targeted to a particular location in the body. For example, chemotaxic molecules can be used to treat, prevent, and/or diagnose wounds and other trauma to tissues by attracting immune cells to the injured location. Chemotactic molecules of the present invention can also attract fibroblasts, which can be used to treat, prevent, and/or diagnose wounds.

[0905] It is also contemplated that a polynucleotide or polypeptide and/or agonist or antagonist of the present invention may inhibit chemotactic activity. These molecules could also be used to treat, prevent, and/or diagnose diseases, disorders, and/or conditions. Thus, a polynucleotide or polypeptide and/or agonist or antagonist of the present invention could be used as an inhibitor of chemotaxis.

Binding Activity

[0906] A polypeptide of the present invention may be used to screen for molecules that bind to the polypeptide or for molecules to which the polypeptide binds. The binding of the polypeptide and the molecule may activate (agonist), increase, inhibit (antagonist), or decrease activity of the polypeptide or the molecule bound. Examples of such molecules include antibodies, oligonucleotides, proteins (e.g., receptors),or small molecules.

[0907] Preferably, the molecule is closely related to the natural ligand of the polypeptide, e.g., a fragment of the ligand, or a natural substrate, a ligand, a structural or functional mimetic. (See, Coligan et al., Current Protocols in Immunology 1(2):Chapter 5 (1991).) Similarly, the molecule can be closely related to the natural receptor to which the polypeptide binds, or at least, a fragment of the receptor capable of being bound by the polypeptide (e.g., active site). In either case, the molecule can be rationally designed using known techniques.

[0908] Preferably, the screening for these molecules involves producing appropriate cells which express the polypeptide, either as a secreted protein or on the cell membrane. Preferred cells include cells from mammals, yeast, Drosophila, or E. coli. Cells expressing the polypeptide (or cell membrane containing the expressed polypeptide) are then preferably contacted with a test compound potentially containing the molecule to observe binding, stimulation, or inhibition of activity of either the polypeptide or the molecule.

[0909] The assay may simply test binding of a candidate compound to the polypeptide, wherein binding is detected by a label, or in an assay involving competition with a labeled competitor. Further, the assay may test whether the candidate compound results in a signal generated by binding to the polypeptide.

[0910] Alternatively, the assay can be carried out using cell-free preparations, polypeptide/molecule affixed to a solid support, chemical libraries, or natural product mixtures. The assay may also simply comprise the steps of mixing a candidate compound with a solution containing a polypeptide, measuring polypeptide/molecule activity or binding, and comparing the polypeptide/molecule activity or binding to a standard.

[0911] Preferably, an ELISA assay can measure polypeptide level or activity in a sample (e.g., biological sample) using a monoclonal or polyclonal antibody. The antibody can measure polypeptide level or activity by either binding, directly or indirectly, to the polypeptide or by competing with the polypeptide for a substrate.

[0912] Additionally, the receptor to which a polypeptide of the invention binds can be identified by numerous methods known to those of skill in the art, for example, ligand panning and FACS sorting (Coligan, et al., Current Protocols in Immun., 1(2), Chapter 5, (1991)). For example, expression cloning is employed wherein polyadenylated RNA is prepared from a cell responsive to the polypeptides, for example, NIH3T3 cells which are known to contain multiple receptors for the FGF family proteins, and SC-3 cells, and a cDNA library created from this RNA is divided into pools and used to transfect COS cells or other cells that are not responsive to the polypeptides. Transfected cells which are grown on glass slides are exposed to the polypeptide of the present invention, after they have been labeled. The polypeptides can be labeled by a variety of means including iodination or inclusion of a recognition site for a site-specific protein kinase.

[0913] Following fixation and incubation, the slides are subjected to auto-radiographic analysis. Positive pools are identified and sub-pools are prepared and re-transfected using an iterative sub-pooling and re-screening process, eventually yielding a single clones that encodes the putative receptor.

[0914] As an alternative approach for receptor identification, the labeled polypeptides can be photoaffinity linked with cell membrane or extract preparations that express the receptor molecule. Cross-linked material is resolved by PAGE analysis and exposed to X-ray film. The labeled complex containing the receptors of the polypeptides can be excised, resolved into peptide fragments, and subjected to protein microsequencing. The amino acid sequence obtained from microsequencing would be used to design a set of degenerate oligonucleotide probes to screen a cDNA library to identify the genes encoding the putative receptors.

[0915] Moreover, the techniques of gene-shuffling, motif-shuffling, exon-shuffling, and/or codon-shuffling (collectively referred to as “DNA shuffling”) may be employed to modulate the activities of polypeptides of the invention thereby effectively generating agonists and antagonists of polypeptides of the invention. See generally, U.S. Pat. Nos. 5,605,793, 5,811,238, 5,830,721, 5,834,252, and 5,837,458, and Patten, P. A., et al., Curr. Opinion Biotechnol. 8:724-33 (1997); Harayama, S. Trends Biotechnol. 16(2):76-82 (1998); Hansson, L. O., et al., J. Mol. Biol. 287:265-76 (1999); and Lorenzo, M. M. and Blasco, R. Biotechniques 24(2):308-13 (1998) (each of these patents and publications are hereby incorporated by reference). In one embodiment, alteration of polynucleotides and corresponding polypeptides of the invention may be achieved by DNA shuffling. DNA shuffling involves the assembly of two or more DNA segments into a desired polynucleotide sequence of the invention molecule by homologous, or site-specific, recombination. In another embodiment, polynucleotides and corresponding polypeptides of the invention may be altered by being subjected to random mutagenesis by error-prone PCR, random nucleotide insertion or other methods prior to recombination. In another embodiment, one or more components, motifs, sections, parts, domains, fragments, etc., of the polypeptides of the invention may be recombined with one or more components, motifs, sections, parts, domains, fragments, etc. of one or more heterologous molecules. In preferred embodiments, the heterologous molecules are family members. In further preferred embodiments, the heterologous molecule is a growth factor such as, for example, platelet-derived growth factor (PDGF), insulin-like growth factor (IGF-I), transforming growth factor (TGF)-alpha, epidermal growth factor (EGF), fibroblast growth factor (FGF), TGF-beta, bone morphogenetic protein (BMP)-2, BMP-4, BMP-5, BMP-6, BMP-7, activins A and B, decapentaplegic(dpp), 60A, OP-2, dorsalin, growth differentiation factors (GDFs), nodal, MIS, inhibin-alpha, TGF-betal, TGF-beta2, TGF-beta3, TGF-beta5, and glial-derived neurotrophic factor (GDNF).

[0916] Other preferred fragments are biologically active fragments of the polypeptides of the invention. Biologically active fragments are those exhibiting activity similar, but not necessarily identical, to an activity of the polypeptide. The biological activity of the fragments may include an improved desired activity, or a decreased undesirable activity.

[0917] Additionally, this invention provides a method of screening compounds to identify those which modulate the action of the polypeptide of, the present invention. An example of such an assay comprises combining a mammalian fibroblast cell, a the polypeptide of the present invention, the compound to be screened and 3[H] thymidine under cell culture conditions where the fibroblast cell would normally proliferate. A control assay may be performed in the absence of the compound to be screened and compared to the amount of fibroblast proliferation in the presence of the compound to determine if the compound stimulates proliferation by determining the uptake of 3[H] thymidine in each case. The amount of fibroblast cell proliferation is measured by liquid scintillation chromatography which measures the incorporation of 3[H] thymidine. Both agonist and antagonist compounds may be identified by this procedure.

[0918] In another method, a mammalian cell or membrane preparation expressing a receptor for a polypeptide of the present invention is incubated with a labeled polypeptide of the present invention in the presence of the compound. The ability of the compound to enhance or block this interaction could then be measured. Alternatively, the response of a known second messenger system following interaction of a compound to be screened and the receptor is measured and the ability of the compound to bind to the receptor and elicit a second messenger response is measured to determine if the compound is. a potential agonist or antagonist. Such second messenger systems include but are not limited to, cAMP guanylate cyclase, ion channels or phosphoinositide hydrolysis.

[0919] All of these above assays can be used as diagnostic or prognostic markers. The molecules discovered using these assays can be used to treat, prevent, and/or diagnose disease or to bring about a particular result in a patient (e.g., blood vessel growth) by activating or inhibiting the polypeptide/molecule. Moreover, the assays can discover agents which may inhibit or enhance the production of the polypeptides of the invention from suitably manipulated cells or tissues. Therefore, the invention includes a method of identifying compounds which bind to the polypeptides of the invention comprising the steps of: (a) incubating a candidate binding compound with the polypeptide; and (b) determining if binding has occurred. Moreover, the invention includes a method of identifying agonists/antagonists comprising the steps of: (a) incubating a candidate compound with the polypeptide, (b) assaying a biological activity, and (b) determining if a biological activity of the polypeptide has been altered.

[0920] Also, one could identify molecules bind a polypeptide of the invention experimentally by using the beta-pleated sheet regions contained in the polypeptide sequence of the protein. Accordingly, specific embodiments of the invention are directed to polynucleotides encoding polypeptides which comprise, or alternatively consist of, the amino acid sequence of each beta pleated sheet regions in a disclosed polypeptide sequence. Additional embodiments of the invention are directed to polynucleotides encoding polypeptides which comprise, or alternatively consist of, any combination or all of contained in the polypeptide sequences of the invention. Additional preferred embodiments of the invention are directed to polypeptides which comprise, or alternatively consist of, the amino acid sequence of each of the beta pleated sheet regions in one of the polypeptide sequences of the invention. Additional embodiments of the invention are directed to polypeptides which comprise, or alternatively consist of, any combination or all of the beta pleated sheet regions in one of the polypeptide sequences of the invention.

Targeted Delivery

[0921] In another embodiment, the invention provides a method of delivering compositions to targeted cells expressing a receptor for a polypeptide of the invention, or cells expressing a cell bound form of a polypeptide of the invention.

[0922] As discussed herein, polypeptides or antibodies of the invention may be associated with heterologous polypeptides, heterologous nucleic acids, toxins, or prodrugs via hydrophobic, hydrophilic, ionic and/or covalent interactions. In one embodiment, the invention provides a method for the specific delivery of compositions of the invention to cells by administering polypeptides of the invention (including antibodies) that are associated with heterologous polypeptides or nucleic acids. In one example, the invention provides a method for delivering a therapeutic protein into the targeted cell. In another example, the invention provides a method for delivering a single stranded nucleic acid (e.g., antisense or ribozymes) or double stranded nucleic acid (e.g., DNA that can integrate into the cell's genome or replicate episomally and that can be transcribed) into the targeted cell.

[0923] In another embodiment, the invention provides a method for the specific destruction of cells (e.g., the destruction of tumor cells) by administering polypeptides of the invention (e.g., polypeptides of the invention or antibodies of the invention) in association with toxins or cytotoxic prodrugs.

[0924] By “toxin” is meant compounds that bind and activate endogenous cytotoxic effector systems, radioisotopes, holotoxins, modified toxins, catalytic subunits of toxins, or any molecules or enzymes not normally present in or on the surface of a cell that under defined conditions cause the cell's death. Toxins that may be used according to the methods of the invention include, but are not limited to, radioisotopes known in the art, compounds such as, for example, antibodies (or complement fixing containing portions thereof) that bind an inherent or induced endogenous cytotoxic effector system, thymidine kinase, endonuclease, RNAse, alpha toxin, ricin, abrin, Pseudomonas exotoxin A, diphtheria toxin, saporin, momordin, gelonin, pokeweed antiviral protein, alpha-sarcin and cholera toxin. By “cytotoxic prodrug” is meant a non-toxic compound that is converted by an enzyme, normally present in the cell, into a cytotoxic compound. Cytotoxic prodrugs that may be used according to the methods of the invention include, but are not limited to, glutamyl derivatives of benzoic acid mustard alkylating agent, phosphate derivatives of etoposide or mitomycin C, cytosine arabinoside, daunorubisin, and phenoxyacetamide derivatives of doxorubicin.

Drug Screening

[0925] Further contemplated is the use of the polypeptides of the present invention, or the polynucleotides encoding these polypeptides, to screen for molecules which modify the activities of the polypeptides of the present invention. Such a method would include contacting the polypeptide of the present invention with a selected compound(s) suspected of having antagonist or agonist activity, and assaying the activity of these polypeptides following binding.

[0926] This invention is particularly useful for screening therapeutic compounds by using the polypeptides of the present invention, or binding fragments thereof, in any of a variety of drug screening techniques. The polypeptide or fragment employed in such a test may be affixed to a solid support, expressed on a cell surface, free in solution, or located intracellularly. One method of drug screening utilizes eukaryotic or prokaryotic host cells which are stably transformed with recombinant nucleic acids expressing the polypeptide or fragment. Drugs are screened against such transformed cells in competitive binding assays. One may measure, for example, the formulation of complexes between the agent being tested and a polypeptide of the present invention.

[0927] Thus, the present invention provides methods of screening for drugs or any other agents which affect activities mediated by the polypeptides of the present invention. These methods comprise contacting such an agent with a polypeptide of the present invention or a fragment thereof and assaying for the presence of a complex between the agent and the polypeptide or a fragment thereof, by methods well known in the art. In such a competitive binding assay, the agents to screen are typically labeled. Following incubation, free agent is separated from that present in bound form, and the amount of free or uncomplexed label is a measure of the ability of a particular agent to bind to the polypeptides of the present invention.

[0928] Another technique for drug screening provides high throughput screening for compounds having suitable binding affinity to the polypeptides of the present invention, and is described in great detail in European Pat. Application 84/03564, published on Sep. 13, 1984, which is incorporated herein by reference herein. Briefly stated, large numbers of different small peptide test compounds are synthesized on a solid substrate, such as plastic pins or some other surface. The peptide test compounds are reacted with polypeptides of the present invention and washed. Bound polypeptides are then detected by methods well known in the art. Purified polypeptides are coated directly onto plates for use in the aforementioned drug screening techniques. In addition, non-neutralizing antibodies may be used to capture the peptide and immobilize it on the solid support.

[0929] This invention also contemplates the use of competitive drug screening assays in which neutralizing antibodies capable of binding polypeptides of the present invention specifically compete with a test compound for binding to the polypeptides or fragments thereof. In this manner, the antibodies are used to detect the presence of any peptide which shares one or more antigenic epitopes with a polypeptide of the invention.

[0930] The human Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides and/or peptides of the present invention, or immunogenic fragments or oligopeptides thereof, can be used for screening therapeutic drugs or compounds in a variety of drug screening techniques. The fragment employed in such a screening assay may be free in solution, affixed to a solid support, borne on a cell surface, or located intracellularly. The reduction or abolition of activity of the formation of binding complexes between the ion channel protein and the agent being tested can be measured. Thus, the present invention provides a method for screening or assessing a plurality of compounds for their specific binding affinity with a Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide, or a bindable peptide fragment, of this invention, comprising providing a plurality of compounds, combining the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide, or a bindable peptide fragment, with each of a plurality of compounds for a time sufficient to allow binding under suitable conditions and detecting binding of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide or peptide to each of the plurality of test compounds, thereby identifying the compounds that specifically bind to the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide or peptide.

[0931] Methods of identifying compounds that modulate the activity of the novel human Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides and/or peptides are provided by the present invention and comprise combining a potential or candidate compound or drug modulator of acyltransferases biological activity with an Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide or peptide, for example, the Mitochondrial GPAT, Microsomal GPAT_hlog 1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 amino acid sequence as set forth in SEQ ID NO: 2, and measuring an effect of the candidate compound or drug modulator on the biological activity of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide or peptide. Such measurable effects include, for example, physical binding interaction; the ability to cleave a suitable acyltransferases substrate; effects on native and cloned Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1-expressing cell line; and effects of modulators or other acyltransferases-mediated physiological measures.

[0932] Another method of identifying compounds that modulate the biological activity of the novel Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides of the present invention comprises combining a potential or candidate compound or drug modulator of a acyltransferases biological activity with a host cell that expresses the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide and measuring an effect of the candidate compound or drug modulator on the biological activity of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide. The host cell can also be capable of being induced to express the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide, e.g., via inducible expression. Physiological effects of a given modulator candidate on the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide can also be measured. Thus, cellular assays for particular acyltransferases modulators may be either direct measurement or quantification of the physical biological activity of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide, or they may be measurement or quantification of a physiological effect. Such methods preferably employ a Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide as described herein, or an overexpressed recombinant Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide in suitable host cells containing an expression vector as described herein, wherein the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide is expressed, overexpressed, or undergoes upregulated expression.

[0933] Another aspect of the present invention embraces a method of screening for a compound that is capable of modulating the biological activity of a Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide, comprising providing a host cell containing an expression vector harboring a nucleic acid sequence encoding a Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide, or a functional peptide or portion thereof (e.g., SEQ ID NOS: 2); determining the biological activity of the expressed Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide in the absence of a modulator compound; contacting the cell with the modulator compound and determining the biological activity of the expressed Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide in the presence of the modulator compound. In such a method, a difference between the activity of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide in the presence of the modulator compound and in the absence of the modulator compound indicates a modulating effect of the compound.

[0934] Essentially any chemical compound can be employed as a potential modulator or ligand in the assays according to the present invention. Compounds tested as acyltransferases modulators can be any small chemical compound, or biological entity (e.g., protein, sugar, nucleic acid, lipid). Test compounds will typically be small chemical molecules and peptides. Generally, the compounds used as potential modulators can be dissolved in aqueous or organic (e.g., DMSO-based) solutions. The assays are designed to screen large chemical libraries by automating the assay steps and providing compounds from any convenient source. Assays are typically run in parallel, for example, in microtiter formats on microtiter plates in robotic assays. There are many suppliers of chemical compounds, including Sigma (St. Louis, Mo.), Aldrich (St. Louis, Mo.), Sigma-Aldrich (St. Louis, Mo.), Fluka Chemika-Biochemica Analytika (Buchs, Switzerland), for example. Also, compounds may be synthesized by methods known in the art.

[0935] High throughput screening methodologies are particularly envisioned for the detection of modulators of the novel Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polynucleotides and polypeptides described herein. Such high throughput screening methods typically involve providing a combinatorial chemical or peptide library containing a large number of potential therapeutic compounds (e.g., ligand or modulator compounds). Such combinatorial chemical libraries or ligand libraries are then screened in one or more assays to identify those library members (e.g., particular chemical species or subclasses) that display a desired characteristic activity. The compounds so identified can serve as conventional lead compounds, or can themselves be used as potential or actual therapeutics.

[0936] A combinatorial chemical library is a collection of diverse chemical compounds generated either by chemical synthesis or biological synthesis, by combining a number of chemical building blocks (i.e., reagents such as amino acids). As an example, a linear combinatorial library, e.g., a polypeptide or peptide library, is formed by combining a set of chemical building blocks in every possible way for a given compound length (i.e., the number of amino acids in a polypeptide or peptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks.

[0937] The preparation and screening of combinatorial chemical libraries is well known to those having skill in the pertinent art. Combinatorial libraries include, without limitation, peptide libraries (e.g. U.S. Pat. No. 5,010,175; Furka, 1991, Int. J. Pept. Prot. Res., 37:487-493; and Houghton et al., 1991, Nature, 354:84-88). Other chemistries for generating chemical diversity libraries can also be used. Nonlimiting examples of chemical diversity library chemistries include, peptides (PCT Publication No. WO 91/019735), encoded peptides (PCT Publication No. WO 93/20242), random bio-oligomers (PCT Publication No. WO 92/00091), benzodiazepines (U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al., 1993, Proc. Natl. Acad. Sci. USA, 90:6909-6913), vinylogous polypeptides (Hagihara et al., 1992, J. Amer. Chem. Soc., 114:6568), nonpeptidal peptidomimetics with glucose scaffolding (Hirschmann et al., 1992, J. Amer. Chem. Soc., 114:9217-9218), analogous organic synthesis of small compound libraries (Chen et al., 1994, J. Amer. Chem. Soc., 116:2661), oligocarbamates (Cho et al., 1993, Science, 261:1303), and/or peptidyl phosphonates (Campbell et al., 1994, J. Org. Chem., 59:658), nucleic acid libraries (see Ausubel, Berger and Sambrook, all supra), peptide nucleic acid libraries (U.S. Pat. No. 5,539,083), antibody libraries (e.g., Vaughn et al., 1996, Nature Biotechnology, 14(3):309-314) and PCT/US96/10287), carbohydrate libraries (e.g., Liang et al., 1996, Science, 274-1520-1522) and U.S. Pat. No. 5,593,853), small organic molecule libraries (e.g., benzodiazepines, Baum C&EN, Jan. 18, 1993, page 33; and U.S. Pat. No. 5,288,514; isoprenoids, U.S. Pat. No. 5,569,588; thiazolidinones and metathiazanones, U.S. Pat. No. 5,549,974; pyrrolidines, U.S. Pat. Nos. 5,525,735 and 5,519,134; morpholino compounds, U.S. Pat. No. 5,506,337; and the like).

[0938] Devices for the preparation of combinatorial libraries are commercially available (e.g., 357 MPS, 390 MPS, Advanced Chem Tech, Louisville Ky.; Symphony, Rainin, Woburn, Mass.; 433A Applied Biosystems, Foster City, Calif.; 9050 Plus, Millipore, Bedford, Mass.). In addition, a large number of combinatorial libraries are commercially available (e.g., ComGenex, Princeton, N.J.; Asinex, Moscow, Russia; Tripos, Inc., St. Louis, Mo.; ChemStar, Ltd., Moscow, Russia; 3D Pharmaceuticals, Exton, Pa.; Martek Biosciences, Columbia, Md., and the like).

[0939] In one embodiment, the invention provides solid phase based in vitro assays in a high throughput format, where the cell or tissue expressing an ion channel is attached to a solid phase substrate. In such high throughput assays, it is possible to screen up to several thousand different modulators or ligands in a single day. In particular, each well of a microtiter plate can be used to perform a separate assay against a selected potential modulator, or, if concentration or incubation time effects are to be observed, every 5-10 wells can test a single modulator. Thus, a single standard microtiter plate can assay about 96 modulators. If 1536 well plates are used, then a single plate can easily assay from about 100 to about 1500 different compounds. It is possible to assay several different plates per day; thus, for example, assay screens for up to about 6,000-20,000 different compounds are possible using the described integrated systems.

[0940] In another of its aspects, the present invention encompasses screening and small molecule (e.g., drug) detection assays which involve the detection or identification of small molecules that can bind to a given protein, i.e., a Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide or peptide. Particularly preferred are assays suitable for high throughput screening methodologies.

[0941] In such binding-based detection, identification, or screening assays, a functional assay is not typically required. All that is needed is a target protein, preferably substantially purified, and a library or panel of compounds (e.g., ligands, drugs, small molecules) or biological entities to be screened or assayed for binding to the protein target. Preferably, most small molecules that bind to the target protein will modulate activity in some manner, due to preferential, higher affinity binding to functional areas or sites on the protein.

[0942] An example of such an assay is the fluorescence based thermal shift assay (3-Dimensional Pharmaceuticals, Inc., 3DP, Exton, Pa.) as described in U.S. Pat. Nos. 6,020,141 and 6,036,920 to Pantoliano et al.; see also, J. Zimmerman, 2000, Gen. Eng. News, 20(8)). The assay allows the detection of small molecules (e.g., drugs, ligands) that bind to expressed, and preferably purified, ion channel polypeptide based on affinity of binding determinations by analyzing thermal unfolding curves of protein-drug or ligand complexes. The drugs or binding molecules determined by this technique can be further assayed, if desired, by methods, such as those described herein, to determine if the molecules affect or modulate function or activity of the target protein.

[0943] To purify a Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide or peptide to measure a biological binding or ligand binding activity, the source may be a whole cell lysate that can be prepared by successive freeze-thaw cycles (e.g., one to three) in the presence of standard protease inhibitors. The Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide may be partially or completely purified by standard protein purification methods, e.g., affinity chromatography using specific antibody described infra, or by ligands specific for an epitope tag engineered into the recombinant Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide molecule, also as described herein. Binding activity can then be measured as described.

[0944] Compounds which are identified according to the methods provided herein, and which modulate or regulate the biological activity or physiology of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides according to the present invention are a preferred embodiment of this invention. It is contemplated that such modulatory compounds may be employed in treatment and therapeutic methods for treating a condition that is mediated by the novel Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides by administering to an individual in need of such treatment a therapeutically effective amount of the compound identified by the methods described herein.

[0945] In addition, the present invention provides methods for treating an individual in need of such treatment for a disease, disorder, or condition that is mediated by the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptides of the invention, comprising administering to the individual a therapeutically effective amount of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1-modulating compound identified by a method provided herein.

Antisense And Ribozyme (Antagonists)

[0946] In specific embodiments, antagonists according to the present invention are nucleic acids corresponding to the sequences contained in SEQ ID NO:1, 3, 5, 7, and/or 202, or the complementary strand thereof, and/or to nucleotide sequences contained a deposited clone. In one embodiment, antisense sequence is generated internally by the organism, in another embodiment, the antisense sequence is separately administered (see, for example, O'Connor, Neurochem., 56:560 (1991). Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988). Antisense technology can be used to control gene expression through antisense DNA or RNA, or through triple-helix formation. Antisense techniques are discussed for example, in Okano, Neurochem., 56:560 (1991); Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988). Triple helix formation is discussed in, for instance, Lee et al., Nucleic Acids Research, 6:3073 (1979); Cooney et al., Science, 241:456 (1988); and Dervan et al., Science, 251:1300 (1991). The methods are based on binding of a polynucleotide to a complementary DNA or RNA.

[0947] For example, the use of c-myc and c-myb antisense RNA constructs to inhibit the growth of the non-lymphocytic leukemia cell line HL-60 and other cell lines was previously described. (Wickstrom et al. (1988); Anfossi et al. (1989)). These experiments were performed in vitro by incubating cells with the oligoribonucleotide. A similar procedure for in vivo use is described in WO 91/15580. Briefly, a pair of oligonucleotides for a given antisense RNA is produced as follows: A sequence complimentary to the first 15 bases of the open reading frame is flanked by an EcoR1 site on the 5 end and a HindIII site on the 3 end. Next, the pair of oligonucleotides is heated at 90° C. for one minute and then annealed in 2× ligation buffer (20 mM TRIS HCl pH 7.5, 10 mM MgC12, 10 MM dithiothreitol (DTT) and 0.2 mM ATP) and then ligated to the EcoR1/Hind III site of the retroviral vector PMV7 (WO 91/15580).

[0948] For example, the 5′ coding portion of a polynucleotide that encodes the mature polypeptide of the present invention may be used to design an antisense RNA oligonucleotide of from about 10 to 40 base pairs in length. A DNA oligonucleotide is designed to be complementary to a region of the gene involved in transcription thereby preventing transcription and the production of the receptor. The antisense RNA oligonucleotide hybridizes to the mRNA in vivo and blocks translation of the mRNA molecule into receptor polypeptide.

[0949] In one embodiment, the antisense nucleic acid of the invention is produced intracellularly by transcription from an exogenous sequence. For example, a vector or a portion thereof, is transcribed, producing an antisense nucleic acid (RNA) of the invention. Such a vector would contain a sequence encoding the antisense nucleic acid of the invention. Such a vector can remain episomal or become chromosomally integrated, as long as it can be transcribed to produce the desired antisense RNA. Such vectors can be constructed by recombinant DNA technology methods standard in the art. Vectors can be plasmid, viral, or others known in the art, used for replication and expression in vertebrate cells. Expression of the sequence encoding a polypeptide of the invention, or fragments thereof, can be by any promoter known in the art to act in vertebrate, preferably human cells. Such promoters can be inducible or constitutive. Such promoters include, but are not limited to, the SV40 early promoter region (Bernoist and Chambon, Nature, 29:304-310 (1981), the promoter contained in the 3′ long terminal repeat of Rous sarcoma virus (Yamamoto et al., Cell, 22:787-797 (1980), the herpes thymidine promoter (Wagner et al., Proc. Natl. Acad. Sci. U.S.A., 78:1441-1445 (1981), the regulatory sequences of the metallothionein gene (Brinster et al., Nature, 296:39-42 (1982)), etc.

[0950] The antisense nucleic acids of the invention comprise a sequence complementary to at least a portion of an RNA transcript of a gene of interest. However, absolute complementarity, although preferred, is not required. A sequence “complementary to at least a portion of an RNA,” referred to herein, means a sequence having sufficient complementarity to be able to hybridize with the RNA, forming a stable duplex; in the case of double stranded antisense nucleic acids of the invention, a single strand of the duplex DNA may thus be tested, or triplex formation may be assayed. Antisense oligonucleotides may be single or double stranded. Double stranded RNA's may be designed based upon the teachings of Paddison et al., Proc. Nat. Acad. Sci., 99:1443-1448 (2002); and International Publication Nos. WO 01/29058, and WO 99/32619; which are hereby incorporated herein by reference. The ability to hybridize will depend on both the degree of complementarity and the length of the antisense nucleic acid Generally, the larger the hybridizing nucleic acid, the more base mismatches with a RNA sequence of the invention it may contain and still form a stable duplex (or triplex as the case may be). One skilled in the art can ascertain a tolerable degree of mismatch by use of standard procedures to determine the melting point of the hybridized complex.

[0951] Oligonucleotides that are complementary to the 5′ end of the message, e.g., the 5′ untranslated sequence up to and including the AUG initiation codon, should work most efficiently at inhibiting translation. However, sequences complementary to the 3 untranslated sequences of mRNAs have been shown to be effective at inhibiting translation of mRNAs as well. See generally, Wagner, R., Nature, 372:333-335 (1994). Thus, oligonucleotides complementary to either the 5′- or 3′- non-translated, non-coding regions of a polynucleotide sequence of the invention could be used in an antisense approach to inhibit translation of endogenous mRNA. Oligonucleotides complementary to the 5′ untranslated region of the mRNA should include the complement of the AUG start codon. Antisense oligonucleotides complementary to mRNA coding regions are less efficient inhibitors of translation but could be used in accordance with the invention. Whether designed to hybridize to the 5′-, 3′- or coding region of mRNA, antisense nucleic acids should be at least six nucleotides in length, and are preferably oligonucleotides ranging from 6 to about 50 nucleotides in length. In specific aspects the oligonucleotide is at least 10 nucleotides, at least 17 nucleotides, at least 25 nucleotides or at least 50 nucleotides.

[0952] The polynucleotides of the invention can be DNA or RNA or chimeric mixtures or derivatives or modified versions thereof, single-stranded or double-stranded. The oligonucleotide can be modified at the base moiety, sugar moiety, or phosphate backbone, for example, to improve stability of the molecule, hybridization, etc. The oligonucleotide may include other appended groups such as peptides (e.g., for targeting host cell receptors in vivo), or agents facilitating transport across the cell membrane (see, e.g., Letsinger et al., Proc. Natl. Acad. Sci. U.S.A. 86:6553-6556 (1989); Lemaitre et al., Proc. Natl. Acad. Sci., 84:648-652 (1987); PCT Publication NO: WO 88/09810, published Dec. 15, 1988) or the blood-brain barrier (see, e.g., PCT Publication NO: WO 89/10134, published Apr. 25, 1988), hybridization-triggered cleavage agents. (See, e.g., Krol et al., BioTechniques, 6:958-976 (1988)) or intercalating agents. (See, e.g., Zon, Pharm. Res., 5:539-549 (1988)). To this end, the oligonucleotide may be conjugated to another molecule, e.g., a peptide, hybridization triggered cross-linking agent, transport agent, hybridization-triggered cleavage agent, etc.

[0953] The antisense oligonucleotide may comprise at least one modified base moiety which is selected from the group including, but not limited to, 5-fluorouracil, 5-bromouracil, 5-chlorouracil, 5-iodouracil, hypoxanthine, xanthine, 4-acetylcytosine, 5-(carboxyhydroxylmethyl) uracil, 5-carboxymethylaminomethyl-2-thiouridine, 5-carboxymethylaminomethyluracil, dihydrouracil, beta-D-galactosylqueosine, inosine, N6-isopentenyladenine, 1-methylguanine, 1-methylinosine, 2,2-dimethylguanine, 2-methyladenine, 2-methylguanine, 3-methylcytosine, 5-methylcytosine, N6-adenine, 7-methylguanine, 5-methylaminomethyluracil, 5-methoxyaminomethyl-2-thiouracil, beta-D-mannosylqueosine, 5′-methoxycarboxymethyluracil, 5-methoxyuracil, 2-methylthio-N6-isopentenyladenine, uracil-5-oxyacetic acid (v), wybutoxosine, pseudouracil, queosine, 2-thiocytosine, 5-methyl-2-thiouracil, 2-thiouracil, 4-thiouracil, 5-methyluracil, uracil-5-oxyacetic acid methylester, uracil-5-oxyacetic acid (v), 5-methyl-2-thiouracil, 3-(3-amino-3-N-2-carboxypropyl) uracil, (acp3)w, and 2,6-diaminopurine.

[0954] The antisense oligonucleotide may also comprise at least one modified sugar moiety selected from the group including, but not limited to, arabinose, 2-fluoroarabinose, xylulose, and hexose.

[0955] In yet another embodiment, the antisense oligonucleotide comprises at least one modified phosphate backbone selected from the group including, but not limited to, a phosphorothioate, a phosphorodithioate, a phosphoramidothioate, a phosphorarmdate, a phosphordiamidate, a methylphosphonate, an alkyl phosphotriester, and a formacetal or analog thereof.

[0956] In yet another embodiment, the antisense oligonucleotide is an a-anomeric oligonucleotide. An a-anomeric oligonucleotide forms specific double-stranded hybrids with complementary RNA in which, contrary to the usual b-units, the strands run parallel to each other (Gautier et al., Nucl. Acids Res., 15:6625-6641 (1987)). The oligonucleotide is a 2-0-methylribonucleotide (Inoue et al., Nucl. Acids Res., 15:6131-6148 (1987)), or a chimeric RNA-DNA analogue (Inoue et al., FEBS Lett. 215:327-330 (1987)).

[0957] Polynucleotides of the invention may be synthesized by standard methods known in the art, e.g. by use of an automated DNA synthesizer (such as are commercially available from Biosearch, Applied Biosystems, etc.). As examples, phosphorothioate oligonucleotides may be synthesized by the method of Stein et al. (Nucl. Acids Res., 16:3209 (1988)), methylphosphonate oligonucleotides can be prepared by use of controlled pore glass polymer supports (Sarin et al., Proc. Natl. Acad. Sci. U.S.A., 85:7448-7451 (1988)), etc.

[0958] While antisense nucleotides complementary to the coding region sequence of the invention could be used, those complementary to the transcribed untranslated region are most preferred.

[0959] Potential antagonists according to the invention also include catalytic RNA, or a ribozyme (See, e.g., PCT International Publication WO 90/11364, published Oct. 4, 1990; Sarver et al, Science, 247:1222-1225 (1990). While ribozymes that cleave mRNA at site specific recognition sequences can be used to destroy mRNAs corresponding to the polynucleotides of the invention, the use of hammerhead ribozymes is preferred. Hammerhead ribozymes cleave mRNAs at locations dictated by flanking regions that form complementary base pairs with the target mRNA. The sole requirement is that the target mRNA have the following sequence of two bases: 5′-UG-3′. The construction and production of hammerhead ribozymes is well known in the art and is described more fully in Haseloff and Gerlach, Nature, 334:585-591 (1988). There are numerous potential hammerhead ribozyme cleavage sites within each nucleotide sequence disclosed in the sequence listing. Preferably, the ribozyme is engineered so that the cleavage recognition site is located near the 5′ end of the mRNA corresponding to the polynucleotides of the invention; i.e., to increase efficiency and minimize the intracellular accumulation of non-functional mRNA transcripts.

[0960] As in the antisense approach, the ribozymes of the invention can be composed of modified oligonucleotides (e.g. for improved stability, targeting, etch.) and should be delivered to cells which express the polynucleotides of the invention in vivo. DNA constructs encoding the ribozyme may be introduced into the cell in the same manner as described above for the introduction of antisense encoding DNA. A preferred method of delivery involves using a DNA construct “encoding” the ribozyme under the control of a strong constitutive promoter, such as, for example, pol III or pol II promoter, so that transfected cells will produce sufficient quantities of the ribozyme to destroy endogenous messages and inhibit translation. Since ribozymes unlike antisense molecules, are catalytic, a lower intracellular concentration is required for efficiency.

[0961] Antagonist/agonist compounds may be employed to inhibit the cell growth and proliferation effects of the polypeptides of the present invention on neoplastic cells and tissues, i.e. stimulation of angiogenesis of tumors, and, therefore, retard or prevent abnormal cellular growth and proliferation, for example, in tumor formation or growth.

[0962] The antagonist/agonist may also be employed to prevent hyper-vascular diseases, and prevent the proliferation of epithelial lens cells after extracapsular cataract surgery. Prevention of the mitogenic activity of the polypeptides of the present invention may also be desirous in cases such as restenosis after balloon angioplasty.

[0963] The antagonist/agonist may also be employed to prevent the growth of scar tissue during wound healing.

[0964] The antagonist/agonist may also be employed to treat, prevent, and/or diagnose the diseases described herein.

[0965] Thus, the invention provides a method of treating or preventing diseases, disorders, and/or conditions, including but not limited to the diseases, disorders, and/or conditions listed throughout this application, associated with overexpression of a polynucleotide of the present invention by administering to a patient (a) an antisense molecule directed to the polynucleotide of the present invention, and/or (b) a ribozyme directed to the polynucleotide of the present invention.

Biotic Associations

[0966] A polynucleotide or polypeptide and/or agonist or antagonist of the present invention may increase the organisms ability, either directly or indirectly, to initiate and/or maintain biotic associations with other organisms. Such associations may be symbiotic, nonsymbiotic, endosymbiotic, macrosymbiotic, and/or microsymbiotic in nature. In general, a polynucleotide or polypeptide and/or agonist or antagonist of the present invention may increase the organisms ability to form biotic associations with any member of the fungal, bacterial, lichen, mycorrhizal, cyanobacterial, dinoflaggellate, and/or algal, kingdom, phylums, families, classes, genuses, and/or species.

[0967] The mechanism by which a polynucleotide or polypeptide and/or agonist or antagonist of the present invention may increase the host organisms ability, either directly or indirectly, to initiate and/or maintain biotic associations is variable, though may include, modulating osmolarity to desirable levels for the symbiont, modulating pH to desirable levels for the symbiont, modulating secretions of organic acids, modulating the secretion of specific proteins, phenolic compounds, nutrients, or the increased expression of a protein required for host-biotic organisms interactions (e.g., a receptor, ligand, etc.). Additional mechanisms are known in the art and are encompassed by the invention (see, for example, “Microbial Signalling and Communication”, eds., R. England, G. Hobbs, N. Bainton, and D. McL. Roberts, Cambridge University Press, Cambridge, (1999); which is hereby incorporated herein by reference).

[0968] In an alternative embodiment, a polynucleotide or polypeptide and/or agonist or antagonist of the present invention may decrease the host organisms ability to form biotic associations with another organism, either directly or indirectly. The mechanism by which a polynucleotide or polypeptide and/or agonist or antagonist of the present invention may decrease the host organisms ability, either directly or indirectly, to initiate and/or maintain biotic associations with another organism is variable, though may include, modulating osmolarity to undesirable levels, modulating pH to undesirable levels, modulating secretions of organic acids, modulating the secretion of specific proteins, phenolic compounds, nutrients, or the decreased expression of a protein required for host-biotic organisms interactions (e.g., a receptor, ligand, etc.). Additional mechanisms are known in the art and are encompassed by the invention (see, for example, “Microbial Signalling and Communication”, eds., R. England, G. Hobbs, N. Bainton, and D. McL. Roberts, Cambridge University Press, Cambridge, (1999); which is hereby incorporated herein by reference).

[0969] The hosts ability to maintain biotic associations with a particular pathogen has significant implications for the overall health and fitness of the host. For example, human hosts have symbiosis with enteric bacteria in their gastrointestinal tracts, particularly in the small and large intestine. In fact, bacteria counts in feces of the distal colon often approach 1012 per milliliter of feces. Examples of bowel flora in the gastrointestinal tract are members of the Enterobacteriaceae, Bacteriodes, in addition to a-hemolytic streptococci, E. coli, Bifobacteria, Anaerobic cocci, Eubacteria, Costridia, lactobacilli, and yeasts. Such bacteria, among other things, assist the host in the assimilation of nutrients by breaking down food stuffs not typically broken down by the hosts digestive system, particularly in the hosts bowel. Therefore, increasing the hosts ability to maintain such a biotic association would help assure proper nutrition for the host.

[0970] Aberrations in the enteric bacterial population of mammals, particularly humans, has been associated with the following disorders: diarrhea, ileus, chronic inflammatory disease, bowel obstruction, duodenal diverticula, biliary calculous disease, and malnutrition. A polynucleotide or polypeptide and/or agonist or antagonist of the present invention are useful for treating, detecting, diagnosing, prognosing, and/or ameliorating, either directly or indirectly, and of the above mentioned diseases and/or disorders associated with aberrant enteric flora population.

[0971] The composition of the intestinal flora, for example, is based upon a variety of factors, which include, but are not limited to, the age, race, diet, malnutrition, gastric acidity, bile salt excretion, gut motility, and inmmune mechanisms. As a result, the polynucleotides and polypeptides, including agonists, antagonists, and fragments thereof, may modulate the ability of a host to form biotic associations by affecting, directly or indirectly, at least one or more of these factors.

[0972] Although the predominate intestinal flora comprises anaerobic organisms, an underlying percentage represents aerobes (e.g., E. coli). This is significant as such aerobes rapidly become the predominate organisms in intraabdominal infections—effectively becoming opportunistic early in infection pathogenesis. As a result, there is an intrinsic need to control aerobe populations, particularly for immune compromised individuals.

[0973] In a preferred embodiment, a polynucleotides and polypeptides, including agonists, antagonists, and fragments thereof, are useful for inhibiting biotic associations with specific enteric symbiont organisms in an effort to control the population of such organisms.

[0974] Biotic associations occur not only in the gastrointestinal tract, but also on an in the integument. As opposed to the gastrointestinal flora, the cutaneous flora is comprised almost equally with aerobic and anaerobic organisms. Examples of cutaneous flora are members of the gram-positive cocci (e.g., S. aureus, coagulase-negative staphylococci, micrococcus, M.sedentarius), gram-positive bacilli (e.g., Corynebacterium species, C. minutissimum, Brevibacterium species, Propoionibacterium species, P.acnes), gram-negative bacilli (e.g., Acinebacter species), and fungi (Pityrosporum orbiculare). The relatively low number of flora associated with the integument is based upon the inability of many organisms to adhere to the skin. The organisms referenced above have acquired this unique ability. Therefore, the polynucleotides and polypeptides of the present invention may have uses which include modulating the population of the cutaneous flora, either directly or indirectly.

[0975] Aberrations in the cutaneous flora are associated with a number of significant diseases and/or disorders, which include, but are not limited to the following: impetigo, ecthyma, blistering distal dactulitis, pustules, folliculitis, cutaneous abscesses, pitted keratolysis, trichomycosis axcillaris, dermatophytosis complex, axillary odor, erthyrasma, cheesy foot odor, acne, tinea versicolor, seborrheic derrmtitis, and Pityrosporum folliculitis, to name a few. A polynucleotide or polypeptide and/or agonist or antagonist of the present invention are useful for treating, detecting, diagnosing, prognosing, and/or ameliorating, either directly or indirectly, and of the above mentioned diseases and/or disorders associated with aberrant cutaneous flora population.

[0976] Additional biotic associations, including diseases and disorders associated with the aberrant growth of such associations, are known in the art and are encompassed by the invention. See, for example, “Infectious Disease”, Second Edition, Eds., S. L., Gorbach, J. G., Bartlett, and N. R., Blacklow, W. B. Saunders Company, Philadelphia, (1998); which is hereby incorporated herein by reference).

Pheromones

[0977] In another embodiment, a polynucleotide or polypeptide and/or agonist or antagonist of the present invention may increase the organisms ability to synthesize, release, and/or respond to a pheromone, either directly or indirectly. Such a pheromone may, for example, alter the organisms behavior and/or metabolism.

[0978] A polynucleotide or polypeptide and/or agonist or antagonist of the present invention may modulate the biosynthesis and/or release of pheromones, the organisms ability to respond to pheromones (e.g., behaviorally, and/or metabolically), and/or the organisms ability to detect pheromones, either directly or indirectly. Preferably, any of the pheromones, and/or volatiles released from the organism, or induced, by a polynucleotide or polypeptide and/or agonist or antagonist of the invention have behavioral effects on the organism.

[0979] For example, recent studies have shown that administration of picogram quantities of androstadienone, the most prominent androstene present on male human axillary hair and on the male axillary skin, to the female vomeronasal organ resulted in a significant reduction of nervousness, tension and other negative feelings in the female recipients (Grosser-BI, et al., Psychoneuroendocrinology, 25(3): 289-99 (2000)).

Other Activities

[0980] The polypeptide of the present invention, as a result of the ability to stimulate vascular endothelial cell growth, may be employed in treatment for stimulating re- vascularization of ischemic tissues due to various disease conditions such as thrombosis, arteriosclerosis, and other cardiovascular conditions. These polypeptide may also be employed to stimulate angiogenesis and limb regeneration, as discussed above.

[0981] The polypeptide may also be employed for treating wounds due to injuries, burns, post-operative tissue repair, and ulcers since they are mitogenic to various cells of different origins, such as fibroblast cells and skeletal muscle cells, and therefore, facilitate the repair or replacement of damaged or diseased tissue.

[0982] The polypeptide of the present invention may also be employed stimulate neuronal growth and to treat, prevent, and/or diagnose neuronal damage which occurs in certain neuronal disorders or neuro-degenerative conditions such as Alzheimer's disease, Parkinson's disease, and AIDS-related complex. The polypeptide of the invention may have the ability to stimulate chondrocyte growth, therefore, they may be employed to enhance bone and periodontal regeneration and aid in tissue transplants or bone grafts.

[0983] The polypeptide of the invention may also be employed to maintain organs before transplantation or for supporting cell culture of primary tissues.

[0984] The polypeptide of the present invention may also be employed for inducing tissue of mesodermal origin to differentiate in early embryos.

[0985] The polypeptide or polynucleotides and/or agonist or antagonists of the present invention may also increase or decrease the differentiation or proliferation of embryonic stem cells, besides, as discussed above, hematopoietic lineage.

[0986] The polypeptide or polynucleotides and/or agonist or antagonists of the present invention may also be used to modulate mammalian characteristics, such as body height, weight, hair color, eye color, skin, percentage of adipose tissue, pigmentation, size, and shape (e.g., cosmetic surgery). Similarly, polypeptides or polynucleotides and/or agonist or antagonists of the present invention may be used to modulate mammalian metabolism affecting catabolism, anabolism, processing, utilization, and storage of energy.

[0987] Polypeptide or polynucleotides and/or agonist or antagonists of the present invention may be used to change a mammal's mental state or physical state by influencing biorhythms, caricadic rhythms, depression (including depressive diseases, disorders, and/or conditions), tendency for violence, tolerance for pain, reproductive capabilities (preferably by Activin or Inhibin-like activity), hormonal or endocrine levels, appetite, libido, memory, stress, or other cognitive qualities.

[0988] Polypeptide or polynucleotides and/or agonist or antagonists of the present invention may also be used as a food additive or preservative, such as to increase or decrease storage capabilities, fat content, lipid, protein, carbohydrate, vitamins, minerals, cofactors or other nutritional components.

[0989] A polypeptide of the invention may also exhibit one or more of the following additional activities or effects: inhibiting the growth, infection or function of, or killing, infectious agents, including, without limitation, bacteria, viruses, fungi and other parasites; effecting (suppressing or enhancing) bodily characteristics, including, without limitation, height, weight, hair color, eye color, skin, fat to lean ratio or other tissue pigmentation, organ or body part size or shape (such as, for example, breast augmentation or diminution, change in bone form or shape); effecting biorhythms or circadian cycles or rhythms; effecting the fertility of male or female subjects; effecting the metabolism, catabolism, anabolism, processing, utilization, storage or elimination of dietary fat, lipid, protein, carbohydrate, vitamins. minerals, cofactors or other nutritional factors or component(s); effecting behavioral characteristics, including, without limitation, appetite, libido, stress, cognition (including cognitive disorders), depression (including depressive disorders) and violent behaviors, analgesic effects or other pain reducing effects; promoting differentiation and growth of embryonic stem cells in lineages other than hernatopoletic lineages; hormonal or endocrine activity; in the case of enzymes, correcting deficiencies of the enzyme and treating deficiency-related diseases; treatment of hyperproliferative disorders (such as, for example, psoriasis); immunoglobulin-like activity (such as, for example, the ability to bind antigens or complement); and the ability to act as an antigen in a vaccine composition to raise an immune response against such protein or another material or entity which is cross-reactive with such protein.

[0990] Polypeptide or polynucleotides and/or agonist or antagonists of the present invention may also be used to prepare individuals for extraterrestrial travel, low gravity environments, prolonged exposure to extraterrestrial radiation levels, low oxygen levels, reduction of metabolic activity, exposure to extraterrestrial pathogens, etc. Such a use may be administered either prior to an extraterrestrial event, during an extraterrestrial event, or both. Moreover, such a use may result in a number of beneficial changes in the recipient, such as, for example, any one of the following, non-limiting, effects: an increased level of hematopoietic cells, particularly red blood cells which would aid the recipient in coping with low oxygen levels; an increased level of B-cells, T-cells, antigen presenting cells, and/or macrophages, which would aid the recipient in coping with exposure to extraterrestrial pathogens, for example; a temporary (i.e., reversible) inhibition of hematopoietic cell production which would aid the recipient in coping with exposure to extraterrestrial radiation levels; increase and/or stability of bone mass which would aid the recipient in coping with low gravity environments; and/or decreased metabolism which would effectively facilitate the recipients ability to prolong their extraterrestrial travel by any one of the following, non-limiting means: (i) aid the recipient by decreasing their basal daily energy requirements; (ii) effectively lower the level of oxidative and/or metabolic stress in recipient (i.e., to enable recipient to cope with increased extraterrestial radiation levels by decreasing the level of internal oxidative/metabolic damage acquired during normal basal energy requirements; and/or (iii) enabling recipient to subsist at a lower metabolic temperature (i.e., cryogenic, and/or sub-cryogenic environment).

[0991] Polypeptide or polynucleotides and/or agonist or antagonists of the present invention may also be used to increase the efficacy of a pharmaceutical composition, either directly or indirectly. Such a use may be administered in simultaneous conjunction with said pharmaceutical, or separately through either the same or different route of administration (e.g., intravenous for the polynucleotide or polypeptide of the present invention, and orally for the pharmaceutical, among others described herein.).

REFERENCES

[0992] 1. Friedman, J. M., Obesity in the new millenium. Nature 404, pp. 632-634 (2000).

[0993] 2. World Health Organization, Obesity: Preventing and Managing the Global Epidemic. W. H. O., Geneva, (1998).

[0994] 3. Hill, J. O., and Peters, J. C., Environmental contributions to the obesity epidemic. Science 280, pp.1371-1374 (1998).

[0995] 4. Zhang, Y., Proenca, R., Maffei, M., Barone, M., Leopold, L., and Friedman, J. M., Positional cloning of the mouse obese gene and its human homolouge. Nature 372, pp. 425-432 (1994).

[0996] 5. Tartaglia, L. A., Dembski, M., Weng, X., Deng, N., Culpepper, J., Devos, R., Richards, G., Campfield, L. A., Clark, F. T., Deeds, J., Muir, C., Sanker, S., Moriarity, A., Moore, K. J., Smutko, J. S., Mays, G. G., Woolf, E. A., Monroe, C. A., Tepper, R. I., Identification and expression cloning of a leptin receptor, OB-R. Cell 83, pp.1263-1271 (1995).

[0997] 6. Chua Jr., S. C., White, D. W., Wu-Peng, X. S., Liu, S. M., Okada, N., Kershaw, E. E., Chung, W. K., Power-Kehoe, L., Chua, M., Tartaglia, L. A., Leibel, R. L, Phenotype of fatty due to Gln269Pro mutation in the leptin receptor (Lepr). Diabetes 45, pp. 1141-1143 (1996).

[0998] 7. Naggert, J. K., Fricker, L. D., Varlamov, O., Nishina, P. M., Rouille, Y., Steiner, D. F., Carroll, R. J., Paigen, B. J., Leiter, E. H., Hypoinsulinemia in obese fat/fat mice associated with a carboxypeptidase E mutation which reduces enzyme activity. Nature Genetics 10, pp. 135-141 (1995).

[0999] 8. Montague, C. T. , Farooqi, I. S., Whitehead, J. P., Soos, M. A., Rau, H., Wareham, N. J., Sewter, C. P., Digby, J. E., Mohammed, S. N., Hurst, J. A., Cheetham, C. H., Earley, A. R., Barnett, A. H., Prins, J. B., O'Rahilly, S., Congenital leptin deficiency is associated with severe early-onset obesity in humans. Nature 387, pp. 903-908 (1997).

[1000] 9. Yeo, G. S. H., Farooqi, I. S., Aminian, S., Halsall, D. J., Stanhope, R. G., O'Rahilly, S., A frameshift mutation in MC4R associated with dominantly inherited human obesity. Nature Genetics 20, pp. 111-112 (1998).

[1001] 10. Martinez-Botas, J., Anderson, J. B., Tessier, D., Lapillonne, A., Chang, B. H., Quast, M. J., Gorenstein, D., Chen, K. H., and Chan, L., Absence of perilipin results in leanness and reverses obesity in Lepr db/db mice. Nature Genetics 26, pp. 474-479 (2000).

[1002] 11. Tansey, J. T., Sztalyrd, C., Gruia-Gray, J., Roush, D. L., Zee, J. V., Gavrilova, O., Reitman, M. L., Deng, C. X., Li, C., Kimmel, A. R., and Londos, C, Perilipin ablation results in a lean mouse with aberrant adipocyte lipolysis, enhanced leptin production, and resistance to diet-induced obesity. Proc. Natl. Acad. Sci. USA 98, pp 6494-6499 (2001).

[1003] 12. Abu-Elheiga, L., Matzuk, M. M., Abo-Hashema, K, A, H., Wakli, S. J., Continuous fatty acid oxidation and reduced fat storage in mice lacking acetyl-CoA carboxylase 2. Science 291, pp. 2613-2616 (2001).

[1004] 13. Smith, S. J., Cases, S., Jensen, D. R., Chen, H. C., Sande, E., Tow, B., Sanan, D. A., Raber, J., Eckel, R. H., and Farese Jr., R. V., Obesity resistance and multiple mechanisms of triglyceride synthesis in mice lacking Dgat. Nature Genetics 25, pp.87-90 (2000).

[1005] 14. Davidson, M. H., Hauptman, J., and DiGirolamo, M., Foreyt, J. P., Halsted, C. H., Heber, D., Heimburger, D. C., Lucas, C. P., Robbins, D. C., Chung, J., and Heymsfield, S.B. Weight Control and Risk Factor Reduction in Obese Subjects Treated for 2 Years With Orlistat: A Randomized Controlled Trial. J. Am. Med. Assoc. 281, pp.235-242 (1999).

[1006] 15. Bray, G. A., Tartaglia, L.A., Medicinal strategies in the treatment of obesity. Nature, 404, pp.672-677 (2000).

[1007] 16. Yancopoulos, G. D., unpublished data presented at the Endocrine Society meeting, Denver, Colorado (2001).

[1008] 17. Lambert, P. D., Anderson, K. D., Sleeman, M. W., Wong, V., Tan, J., Hijarunguru, A., Corcoran, T. L., Murray, J. D., Thabet, K. E., Yancopoulos, G. D., and wiegand, S. J., Cilary neurotrophic factor activates leptin-like pathways and reduces body fat, without cachexia or rebound weight gain, even in leptin-resistant obesity. Proc. Natl. Acad. Sci., USA, 98, pp. 4652-4657 (2001).

[1009] 18. Loftus, T., Jaworsky, D. E., Frehywot, G. L., Townsend, C. A., Ronnett, G. V., Lane, M. D., Kuhajda, F. P. Reduced food intake and body weight in mice treated with fatty acid synthesis inhibitors. Science 288, pp. 2379-2381 (2000).

[1010] 19. Lehner, R., Kuksis, A. Biosynthesis of triacylglycerols. Prog. Lipid Res., 35, pp. 169-201 (1996).

[1011] 20. Dircks, L., Sul, H. S., Acyltransferases of de novo glycerolipid biosynthesis. Prog. In Lipid Res. 38, pp. 461-479 (1999).

[1012] 21. Athenstaedt, K., and Daum, G., Phosphatidic acid, a key intermediate in lipid metabolism. Eur. J. Biochem 266, pp.1-16 (1999).

[1013] 22. Wakelam, M. J. 0, Diacylglycerol—when is it an intracellular messenger. Biochim. Biophys. Acta 1436, pp. 117-126 (1998).

[1014] 23. Bell, R. M., Coleman, R. A., Enzymes of Triacylglycerol Formation in Mammals. In: The Enzymes, vol.16. New York Academic Press (1983).

[1015] 24. Haldar, D., Tso, W. W., Pullman, M. E., The acylation of sn-glycerol-3-phosphate in mammalian organs and Ehrlich ascites tumor cells. J. Biol. Chem. 254, pp.4502-4509 (1979).

[1016] 25. Ericsson, J., Jackson, S. M., Kim, J. B., Spieglman, B. M., Edwards, P. A., Identification of glycerol-3-phosphate acyltransferase as an adipocyte determination and differentiation factor-i and sterol regulatory element-binding protein-responsive gene. J. Biol. Chem. 272, pp. 7298-7305 (1997).

[1017] 26. Larson, T. J., Lightner, V. A., Green, P. R., Modrich, P., Bell, R. M., J. Biol. Chem. 255, pp 9421-9426 (1980).

[1018] 27. Shin, D. H., Paulauskis, J. D., Moustaid, N., Sul, H. S., Transcriptional regulation of p90 with sequence homology to E. coli glycerol-3-phosphate acyltransferase. J. Biol. Chem. 266, pp.23834-23839 (1991).

[1019] 28. Bhat, B. G., Wang, P., Kim, J. H., Black, T. M., Lewin, T. M., Fiedorek Jr., F. T., and Coleman, R. A., Rat sn-glycerol-3-phosphate acyltransferase: molecular cloning and characterization of the cDNA and expressed protein. Biochem. Biophys. Acta. 1439, pp. 415-423 (1999).

[1020] 29. Mishra, S. and Kamisaka, Y., Purification and characterization of the thiol-reagent-sensitive glycerol-3-phosphate acyltransferase from the membrane fraction of an oleaginous fungus. Biochem. J. 355, pp. 315-322 (2001).

[1021] 30. Balija, V. S., Chakraborty, T. R., Nikonov, A. I., Morimoto, T. and Haldar, D., Identification of two transmembranes regions and a cytosolic domain of rat mitochondrial glycerophosphate acyltransferase. J. Biol. Chem. 275, pp.31668-31673 (2000).

[1022] 31. Dircks, L. K. Ke, J., and Sul, H. S., A conserved seven amino acid stretch important for murine mitochondrial glycerol-3-phosphate acyltransferase activity. J. Biol. Chem. 274, pp.34728-34734 (1999).

[1023] 32. Lewin, T. M., Wang, P, Coleman, R., Analysis of amino acid motifs diagnostic for the sn-Glycerol-3-phosphate Acyltransferase reaction. Biochemistry 38, pp.5764-5771 (1999).

[1024] 33. Wetterau J R, Gregg R E, Harrity T W, Arbeeny C, Cap M, Connolly F, Chu C H, George R J, Gordon D A, Jamil H, Jolibois K G, Kunselman L K, Lan S J, Maccagnan T J, Ricci B, Yan M, Young D, Chen Y, Fryszman O M, Logan J V, Musial C L, Poss M A, Robl J A, Simpkins L M, and Biller S A, Science, 282, pp. 751-754 (1998).

[1025] 34. Miyazaki, M., Kim, Y. C., Gray-Keller, M. P., Attie, A. D., and Ntambi, J. M., The Biosynthesis of hepatic cholesterol esters and triglycerides is impaired in mice with a disruption of the gene for stearoyl-CoA desaturase 1. J. Biol. Chem. 275, pp.30132-30138 (2000).

[1026] 35. Kersten, S. Desvergne, B., and Wahli, W., Roles of PPARs in health and disease. Nature, 405, pp. 421-424 (2000).

[1027] 36. Muoio, D. M., Seefeld, K., Witters, L. A., Coleman, R. A., AMP-activated kinase reciprocally regulates triacylglycerol synthesis and fatty acid oxidation in liver and muscle: evidence that sn-glycerol-3-phosphate acyltransferase is a novel target. Biochem. J. 338, pp.783-791 (1999).

[1028] 37. Kopelman, P.G., Obesity as a medical problem. Nature 404, pp. 635-643 (2000).

[1029] 38. Larson, T. J., Lightner, V. A., Green, P. R., Modrich, P., Bell, R. M., J. Biol. Chem. 255, pp. 9421-9426 (1980).

[1030] 39. Jolly, C. A., Wilton, D. C., Schroeder, F., Microsomal fatty acyl-CoA transacylation and hydrolysis: fatty acyl-CoA species dependant modulation by liver fatt acyl-CoA binding proteins. Biochim. Biophys. Acta. 1483, pp.185-197 (2000).

[1031] 40. Altschul S. F., Gish, W., Miller W., Myers E. W., and Lipman D. J. Basic local alignment search tool. J. Mol. Biol., 215:403-10 (1990).

[1032] 41. Birney E., Durbin. R. Using GeneWise in the Drosophila annotation experiment. Genome Res. 10:547-8 (2000).

[1033] 42. Yada, R., Ide, H. and Nakazawa Y. In vitro effects of chloropromazine on glycerol-3-phosphate acyl-transferase and 1-acylglycerol-3-phosphate acyltransferase in rat liver microsomes. Biochim. Pharmac.35, pp. 4083-4087 (1986).

[1034] 43. Stein, T. A., Engel, R. R., and Tropp, B. E., Inhibition of glycerol-3-phosphate acyltransferase by analogs of glycerol-3-phosphate. Biochim. Biophys. Acta 1123, pp.249-256 (1992).

EXAMPLES

DESCRIPTION OF THE PREFERRED EMBODIMENTS

Example 1

Method used to Identify the Novel Mitochondrial GPAT Polynucleotide of the Present Invention

Bioinformatics Analysis

[1035] The novel human nmtochondrial GPAT of the present invention was identified by searching against the human genome database with the TBLASTN program (40) using the rat mitochondrial GPAT polypeptide sequence (Swiss-Prot Accession No: P97564; Genbank Accession No:gi|8393466; SEQ ID NO:10) as a template. The genomic sequence contained in BAC (bacteria artificial chromosome) AL359395 was found to contain putative exon sequences that were similar to the rat mitochondrial GPAT. The AL359395 polynucleotide sequence was then used to predict an initial sequence of the human mitochondrial GPAT of the present invention using the GENEWISEDB program (41). The final predicted exons were assembled and a consensus open reading frame of the human mitochondrial GPAT was obtained using the predicted exon sequences. The carboxyl-terminus of this predictived human mitochondrial GPAT was found to be 98% identical to a human partial protein sequence referred to as the KIAA1560 protein sequence (Genbank Accession No: gi|10047185; SEQ ID NO:155). Assembly of the predicted human GPAT and the KIAA1560 nucleotide sequence led to the final predicted human mitochondrial GPAT of the present invention as shown in FIGS. 1A-C (SEQ ID NO: 1).

[1036] A search to identify a novel human microsomal GPAT was initiated by using the Hidden Markov Model (HMM) of acyltransferase (Acyltransferase.hmm PF01553) as a template and searching against the ENSEMBL Genscan prediction human protein database using the GenewiseDB program(41). A total of 9 human proteins were found to contain domains similar to the Acyltransferase catalytic domain. All 9 proteins were searched against the Genbank non-redundant human protein database using BLASTP (40). As expected, the Mitochondrial human GPAT of the present invention (SEQ ID NO:2) was found to be one of the 9 Acyltransferase domain-containing proteins. In addition, the ENSEMBL protein AC025678.00020.264023 contained an Acyltransferase-like domain. This protein is referred to herein as the Microsomal GPAT_hlog1 and is provided in FIGS. 2A-B (SEQ ID NO:4).

[1037] In an effort to identify additional putative microsomal proteins, the polypeptide sequence of the Microsomal GPAT_hlog1 (SEQ ID NO:4) of the present invention was used to search against the human genomic DNA database using TBLASTN (40). Two genomic sequence contigs were found to contain genes with significant homology to GPAT_hlog1: NT—006611 (SEQ ID NO:157) and NT-010514 (SEQ ID NO: 158). The GENEWISEDB algorithm was applied to both the NT-006611 (SEQ ID NO:157) and NT-010514 (SEQ ID NO:158) sequences using the GPAT_hlog1 (SEQ ID NO:3) as a template. The predicted exons of both sequences were identified and the resulting encoding polynucleotide sequences of both were obtained. Only a partial sequence of the NT-006611 clone was obtained. The NT—006611 clone is referred to herein as the Microsomal GPAT_hlog2 and is provided in FIGS. 3A-B (SEQ ID NO:5). The full-length polynucleotide sequence of the NT—010514 was obtained. The NT—010514 clone is referred to herein as the Microsomal GPAT_hlog3 and is provided in FIGS. 4A-B (SEQ ID NO:7).

Example 2

Method for the Construction of a Size Fractionated Brain and Testis cDNA Library

[1038] Brain and testis poly A+RNA was purchased from Clontech and converted into double stranded cDNA using the SuperScriptTM Plasmid System for cDNA Synthesis and Plasmid Cloning (Life Technologies) except that no radioisotope was incorporated in either of the cDNA synthesis steps and that the cDNA was fractionated by HPLC. This was accomplished on a TransGenomics HPLC system equipped with a size exclusion column (TosoHass) with dimensions of 7.8 mm×30 cm and a particle size of 10 μm. Tris buffered saline was used as the mobile phase, and the column was run at a flow rate of 0.5 mL/min. The resulting chromatograms were analyzed to determine which fractions should be pooled to obtain the largest cDNA's; generally fractions that eluted in the range of 12 to 15 minutes were pooled. The cDNA was precipitated prior to ligation into the Sal I/Not I sites in the pSPORT 1 vector supplied with the kit. Using a combination of PCR with primers to the ends of the vector and Sal I/Not I restriction enzyme digestion of mini-prep DNA, it was determined that the average insert size of the library was greater the 3.5 Kb. The overall complexity of the library was greater that 107 independent clones. The library was amplified in semi-solid agar for 2 days at 30° C. An aliquot (200 microliters) of the amplified library was inoculated into a 200 ml culture for single-stranded DNA isolation by super-infection with a f1 helper phage. After overnight grow, the released phage particles with precipitated with PEG and the DNA isolated with proteinase K, SDS and phenol extractions. The single stranded circular DNA was concentrated by ethanol precipitation and used for the cDNA capture experiments.

Example 3

Method of Cloning the Novel Human Mitochondrial GPAT of the Present Invention

[1039] First strand cDNA synthesis was performed using total RNA isolated from the human hepatoma cell line HepG2 and from commercially available human liver mRNA (Clontech). Overlapping fragments of the predicted coding sequence for human mitochondrial GPAT were amplified with a proof reading polymerase (Platinum Pfx, Gibco-BRL) according to the manufacturer's directions, using the following PCR primer pairs (numbers are based on the A of the predicted ATG start sequence as 1 of SEQ ID NO: 1, sequences are given 5′ to 3′):

A)	forward primer,	-37 to -15,	CATCCCAGCACATGATTTGG,	(SEQ ID NO:159)
	reverse primer,	1480 to 1460,	TAGAGGAGCAGGCAAGCCACA	(SEQ ID NO:160)
B)	forward primer	1270 to 1290,	TGGAGCAAGCGTTGTTACCAG,	(SEQ ID NO:161)
	reverse primer,	2587 to 2566,	GATCACTTCGGGACAGGGCAG	(SEQ ID NO:162)

[1040] Single primary products of the correct predicted size were amplified as determined by agarose gel electrophoresis. Aliquots were subjected to restriction enzyme digestion (fragment A, NheI, HindIII; fragment B, NheI, EcoRV, PvuII, and HindIII) and fragments of the correct predicted sizes were obtained as assayed by agarose gel electrophoresis. Aliquots of the PCR products were then cloned using the TOPO cloning system (Invitrogen).

Example 4

Method of Cloning the Novel Human Microsomal GPATs (GPAT_hlog1, GPAT_hlog2, GPAT_hlog3) of the Present Invention

[1041] Using the predicted sequences from the bioinformatics analysis described in Example 1 herein, antisense 80 bp oligos with biotin on the 5′ end were designed with the following sequences:

Gene Name	80 mer Probe Sequence	SEQ ID NO:
GPAT_hlog1 probe	5′Biotin-	163
	CCTGTAATTGGCTCCTGAAGCTGCTCCTCACTAAG
	ACCGGCCACVTTGAAGCCAGGCAAAGGGCCAGAG
	GAGAAAGAGGAC-3′
GPAT_hlog2 probe	5′Biotin-	164
	ATGTCTCTGCTCTCTGCCTTCATCACGATGGAGGA
	CATCGTCATGGTCACAGGGATGGCGTCGAAGTAG
	GACGAGTGAGG-3′
GPAT_hlog3 probe	5′Biotin-	165
	ACACAGGCAATTCCATCAAAGAATGTTGAATGAG
	GGGCAGCAACAAAAACTGGTGCTTCCAAGGACT
	TGCAATCTTTCC-3′

[1042] One microliter (0.2 nanograms each probe) of the biotinylated oligo probe pool consisting of SEQ ID Nos 163, 164, and 165 was added to six microliters (six micrograms) of a mixture of several single-stranded covalently closed circular cDNA libraries (commercially available from Life Technologies, Rockville, Md., the brain and testis libraries were made according to the method described in Example 2) and seven microliters of 100% formamide in a 0.5 ml PCR tube. The mixture was heated in a thermal cycler to 95° C. for 2 mins. Fourteen microliters of 2× hybridization buffer (50% formamide, 1.5 M NaCl, 0.04 M NaPO4, pH 7.2, 5 mM EDTA, 0.2% SDS) was added to the heated probe/cDNA library mixture and incubated at 42° C. for 26 hours. Hybrids between the biotinylated oligos and the circular cDNA were isolated by diluting the hybridization mixture to 220 microliters in a solution containing 1 M NaCl, 10 mM Tris-HCl pH 7.5, 1 mM EDTA, pH 8.0 and adding 125 microliters of streptavidin magnetic beads. This solution was incubated at 42° C. for 60 mins, mixing every 5 mins to resuspend the beads. The beads were separated from the solution with a magnet and the beads washed three times in 200 microliters of 0.1 X SSPE, 0.1% SDS at 45° C.

[1043] The single stranded cDNA's were release from the biotinlyated oligo/streptavidin magnetic bead complex by adding 50 microliters of 0.1 N NaOH and incubating at room temperature for 10 mins. Six microliters of 3 M Sodium Acetate was added along with 15 micrograms of glycogen and the solution ethanol precipitated with 120 microliters of 100% ethanol. The DNA was resuspend in 12 microliters of TE (10 mM Tris-HCl, pH 8.0), In-iM EDTA, pH 8.0).

[1044] The single stranded cDNA was converted into double strands in a thermal cycler by mixing 5 microliters of the captured DNA with 1.5 microliters 10 micromolar (each) anti-sense gene specific primers mix (complementary to a sequence on the cDNA cloning vector) and 1.5 microliters of 10× PCR buffer. The mixture was heated to 95° C. for 20 seconds, then ramped down to 59° C. At this time 15 microliters of a repair mix, that was preheated to 70° C. (Repair mix contains 4 microliters of 5 mM dNTPs (1.25 mM each), 1.5 rmicroliters of 1OX PCR buffer, 9.25 microliters of water, and 0.25 microliters of Taq polymerase). The solution was ramped back to 73° C. and incubated for 23 mins. The repaired DNA was ethanol precipitate and resuspended in 10 microliters of TE.

[1045] Two microliters were electroporated in E. coli DH12S cells and resulting colonies were screened by PCR, using a primer pair designed from each predicted transcript sequence to identify the proper cDNAs. The right (antisense) primer listed below for each sequence was used for the gene specific repair outlined above.

Oligos used to identity the cDNA by PCR
Gene Primer Name	PCR Oligonucleotide Sequence
GPAT_holg1-L2	AACAAGAAGGCTTTGCTTAAGTTC	(SEQ ID NO:166)
GPAT_hlog1-R2	GTAAGCTCCCTACAAACTCACATTC	(SEQ ID NO:167)
GPAT_hlog2-L1	CATGACACTGACGCTCTTCC	(SEQ ID NO:168)
GPAT_hlog2-R1	CTGCTCGGGTTCCTTCTC	(SEQ ID NO: 169)
GPAT_hlog3-L1	TCTTGCTTCCAATTCGTGTC	(SEQ ID NO:170)
GPAT_hlog3-R1	GTTATTGGGTGGGTCAGCTT	(SEQ ID NO:171)

[1046] Several cDNA clones were positive by PCR. The inserts were sized and 2 clones for each transcript were sequenced.

Example 5

Expression Profiling of Novel Human Immunoglobulin Proteins, Mitochondrial GPAT, 3, AND 4

[1047] The following PCR primer pairs were designed from the predicted sequence and used to measure the steady state levels of the Mitochondrial GPAT mRNA by quantitative PCR:

Gene Primer Name	RT-PCR Oligonucleotide Sequence	SEQ ID No
Mitochondrial GPAT-L1	CTGCACTGACCCTTGGTACA	172
Mitochondrial GPAT-R1	TGGGTCTAAAGCCACACTCA	173
Microsomal GPAT_holg1-L2	AACAAGAAGGCTTTGCTTAAGTTC	166
Microsomal GPAT_hlog1-R2	GTAAGCTCCCTACAAACTCACATTC	167
Microsomal GPAT_hlog2-L1	CATGACACTGACGCTUTTCC	168
Microsomal GPAT_hlog2-R1	CTGCTCGGGTTCCTTCTC	169
Microsomal GPAT_hlog3-L1	TCTTGCTTCCAATTCGTGTC	170
Microsomal GPAT_hlog3-R1	GTTATTGGGTGGGTCAGCTT	171

[1048] Briefly, first strand cDNA was made from commercially available mRNA. The relative amount of cDNA used in each assay was determined by performing a parallel experiment using a primer pair for a gene expressed in equal amounts in all tissues, cyclophilin. The cyclophilin primer pair detected small variations in the amount of cDNA in each sample and these data were used for normalization of the data obtained with the primer pair for this gene. The PCR data was converted into a relative assessment of the difference in transcript abundance amongst the tissues tested and the data are presented in FIGS. 7, 8, 9, and 10.

[1049] Transcripts corresponding to the Mitochondrial GPAT were expressed predominately in liver tissue. (as shown in FIG. 7).

[1050] Transcripts corresponding to Microsomal GPAT_hlog1 were expressed predominately in small intestine, and significantly in lung and spleen (as shown in FIG. 8).

[1051] Transcripts corresponding to Microsomal GPAT_hlog2 were expressed predominately in lung (as shown in FIG. 9).

[1052] Transcripts corresponding to Microsomal GPAT_hlog3 were expressed predominately in bone marrow, and significantly in spinal cord (as shown in FIG. 10).

Example 6

Method of Assessing the Expression Profile of the Novel Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 Polypeptides of the Present Invention using Expanded mRNA Tissue and Cell Sources

[1053] Total RNA from tissues was isolated using the TriZol protocol (Invitrogen) and quantified by determining its absorbance at 260 nM. An assessment of the 18s and 28s ribosomal RNA bands was made by denaturing gel electrophoresis to determine RNA integrity.

[1054] The specific sequence to be measured was aligned with related genes found in GenBank to identity regions of significant sequence divergence to maximize primer and probe specificity. Gene-specific primers and probes were designed using the ABI primer express software to amplify small amplicons (150 base pairs or less) to maximize the likelihood that the primers function at 100% efficiency. All primer/probe sequences were searched against Public Genbank databases to ensure target specificity. Primers and probes were obtained from ABI.

[1055] For mitochondrial GPAT, the primer probe sequences were as follows:

Forward Primer	5′-GCAAGTCCTGTGCCATTATGTC-3′	(SEQ ID NO:190)
Reverse Primer	5′-CAATTCCCTGCCTGTGTCTGT-3′	(SEQ ID NO:191)
TaqMan Probe-	5′-ACACACATTGTGGCTTGCCTGCTCCT-3′	(SEQ ID NO:192)

[1056] For microsomal GPAT_hlog1, the primer probe sequences were as follows:

Forward Primer	5′-CGAATGTGAGTTJGTAGGGAGCTT-3′	(SEQ ID NO:193)
Reverse Primer	5′-TGGTTCCAACGCCACCTT-3′	(SEQ ID NO:194)
TaqMan Probe-	5′-AGCCGGCCCACCACAATCACAG-3′	(SEQ ID NO:195)

[1057] For microsomal GPAT_hlog2, the primer probe sequences were as follows:

Forward Primer	5′-TGTGGAGGAAGGTTGTGGACTT-3′	(SEQ ID NO:196)
Reverse Primer	5′-GCCGGCGAACCACATG-3′	(SEQ ID NO:197)
TaqMan Probe-	5′-TGCTGAAGGCCATCATGCGCA-3′	(SEQ ID NO:198)

[1058] For microsomal GPAT_hlog3, the primer probe sequences were as follows:

Forward Primer	5′-GAATGCACAAGTCCCTCTGATTG-3′	(SEQ ID NO:199)
Reverse Primer	5′-GGATCTACACGGGACACCAAA-3′	(SEQ ID NO:200)
TaqMan Probe-	5′-CTGGTTGCACAGCCCGTAACAGTCTG-3′	(SEQ ID NO:201)

DNA Contamination

[1059] To access the level of contaminating genomic DNA in the RNA, the RNA was divided into 2 aliquots and one half was treated with Rnase-free Dnase (Invitrogen). Samples from both the Dnase-treated and non-treated were then subjected to reverse transcription reactions with (RT+) and without (RT−) the presence of reverse transcriptase. TaqMan assays were carried out with gene-specific primers (see above) and the contribution of genomic DNA to the signal detected was evaluated by comparing the threshold cycles obtained with the RT+/RT− non-Dnase treated RNA to that on the RT+/RT− Dnase treated RNA. The amount of signal contributed by genomic DNA in the Dnased RT− RNA must be less that 10% of that obtained with Dnased RT+ RNA. If not the RNA was not used in actual experiments.

Reverse Transcription reaction and Sequence Detection

[1060] 100 ng of Dnase-treated total RNA was annealed to 2.5 μM of the respective gene-specific reverse primer in the presence of 5.5 nM Magnesium Chloride by heating the sample to 72° C. for 2 min and then cooling to 55° C. for 30 min. 1.25 U/μl of MuLv reverse transcriptase and 500 μM of each dNTP was added to the reaction and the tube was incubated at 37° C. for 30 min. The sample was then heated to 90° C. for 5 min to denature enzyme.

[1061] Quantitative sequence detection was carried out on an ABI PRISM 7700 by adding to the reverse transcribed reaction 2.5 μM forward and reverse primers, 2.0 μM of the TaqMan probe, 500 μM of each dNTP, buffer and 5U AmpliTaq Gold™. The PCR reaction was then held at 94° C. for 12 min, followed by 40 cycles of 94° C. for 15 sec and 60° C. for 30 sec.

Data Handling

[1062] The threshold cycle (Ct) of the lowest expressing tissue (the highest Ct value) was used as the baseline of expression and all other tissues were expressed as the relative abundance to that tissue by calculating the difference in Ct value between the baseline and the other tissues and using it as the exponent in 2(ΔCt)

[1063] The expanded expression profiles of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 polypeptide are provided in FIGS. 12, 13, 14, and 15, respectively, and described elsewhere herein.

Example 7

Method of Assessing the GPAT Activety of the Novel Mitochondrial and Microsomal GPAT Proteins of the Present Invention in Vitro

[1064] Non-limiting examples of assays for GPAT are well described in the art. (32, 33). Briefly, microsomes and/or nintochondria are isolated by standard techniques. Aliquots of the cellular fractions are added to a reaction mix containing 300 μM [3-H]glycerol-3-phosphate and 25 μM palmitoyl-CoA or oleyl-CoA, and incubating for 15 minutes at 37° C. The lipid fraction is then extracted and separated by thin layer chromatography. The bands corresponding to LPA or PA for mitochondrial or microsomal preps, respectively, are isolated and the radioactivity is determined by liquid scintillation counting.

[1065] Alternatively, cloned rat mitochondrial GPAT has been expressed in Sf21 insect cells using the baculovirus system and aliquots of the total particulate fraction are used as a source of active GPAT (31). A homogenous higher throughput assay for GPAT which elimijnates the need for separate lipid extraction and chromatography steps can be employed using the recently developed MicroScint-E cocktail (Packard) which allows for the in-situ partitioning of the radionuclide-containing lipid phase from the aqueous phase in microplate reactions, which can be read on a Top Count (Packard) plate reader.

[1066] Additionally, biotinylated CoA Scintillation Proximity Assays (Amersham), or Fluorescence Polarization high throughput screening assays can be developed using standard techniques. Also, the disappearance of G-3-P may be assayed in a coupled assay, G-3-P going to dihydroxyacetonephosphate (DHAP) via G-3-P dehydrogenase, monitoring the absorbance change of NAD+/NADH+H+. Such an assay may be employed using the purified enzyme due to the potential of competing and interfering enzymes present in the fractions, especially, in microsomes. Specifically, the presence of DHAP acyltransferase and reductase in peroxisomes might circumvent the GPAT pathway and produce lysophosphatitate.

[1067] A number of non-specific in vitro inhibitors of GPAT have already been reported, including, but not limited to the following: Chloropromazine was shown to be a competitive inhibitor with respect to palmitoyl-CoA, and a non-competitive inhibitor with respect to G-3-P (42). Analogs of G-3-P, (rac)-3,4-dihydroxybutyl-1-phosphonate, (rac)-glyceraldehyde-3-phosphate, (rac)-3-hydroxy-4-oxybutyl-1-phosphonate, (1S,3S)-1,3,4-trihydroxybutyl-1-phosphonate, and (1R,3S)-1,3,4trihydroxybutyl-1-phosphonate have been shown to be competitive inhibitors of both the nitochondrial and microsomal isoforms of GPAT (43). 4-hydroxy-3-oxobutyl-1-phosphonate, an anolog of dihydroxyacetone phosphate, was shown to be a stronger competitive inhibitor of the microsomal isoform, as are, the afore mentioned NEM, as well as diethylpyrocarbonate. Adaptation of enzyme activity assays to test for inhibitors and/or activators is standard practice and well known to those knowledgeable in the art of biochemistry and pharmacology, to screen for potential modulators of GPAT activity.

[1068] Modulators of GPAT activity can be assayed for their cellular effects in modulating GPAT activity by measuring parameters such as, for example, glycerolipid synthesis or fatty acid P-oxidation in cultured or primary cell lines expressing endogenous GPAT or recombinant mitochondrial GPAT. Cells which may be used include, but are not limited to: hepatocytes, such as mouse, rat, hamster, and human primary cells, or HepG2 a human hepatic carcinoma cell line; adipocytes such as mouse, rat, hamster, and human primary cells, or NIH 3T3L1 mouse preadipocyte cell line; CaCo-2 a human intestinal colon carcinoma cell line; Ehrlich ascites tumor cells which only express the microsomal GPAT.

Example 8

Method of Identifying Modulators of the GPAT Activity of the Novel Mitochondrial and Microsomal GPAT Proteins of the Presnet Invention in vivo

[1069] Modulators of GPAT activity which have been identified by in -vitro assays can be evaluated for their in-vivo efficacy by dosing animal models with the candidate modulator administered in an appropriate vehicle by any of a variety of standard means including but not limited to: oral gavage, interperitonial, intramuscular, or subcutaneous injection, or through absorption. Animal models may include, but are not limited to, mice, rat, hamster, rabbit, dog, monkey, or human. These models can include, but are not limited to lean, obese, diabetic, dyslipidemic, hypercholesterolemic, other or combinations of these phenotypes. These phenotypes may derive from environmental factors such as, but not limited to, a high fat or high sucrose/high fat diet, or from genetic factors such as, but not limited to, ob/ob, db/db, fa/fa, tubby, agouti, non-obese diabetic, apoe transgenic, or LDL receptor knockout mice, orfa/fa, or Zuker Diabetic Fatty rat, WHHL rabbit.

[1070] Changes in GPAT activity may be reflected in and measured by parameters such as, but not limited to, changes in body weight or body weight gain, BMI, hyper or hypophagia, fat mass or fat mass to lean mass ratio as determined by biopsy, necropsy, or DEXA analysis, plasma chemistry parameters such as, but not limited to, leptin, resistin , Acrp30/AdipoQ, TG, NEFA, insulin, glucose, cholesterol, BHT, and lactate, glucose and insulin tolerance, as well as macro and microscopic analysis of tissues for effect on parameters such as, but not limited to, hepatic, adipocyte, cardiac, and skeletal muscle lipid content and morphology, β-cell hyperplasia or hypertrophy, fatty streak or atherosclerotic plaque formation. Also, changes in gene expression analysis by Northern blot, quantitative PCR, or other means can be monitored.

Example 9

Isolation of a Specific Clone from the Deposited Sample

[1071] The deposited material in the sample assigned the ATCC Deposit Number cited in Table 1 for any given cDNA clone also may contain one or more additional plasmids, each comprising a cDNA clone different from that given clone. Thus, deposits sharing the same ATCC Deposit Number contain at least a plasmid for each cDNA clone identified in Table 1. Typically, each ATCC deposit sample cited in Table 1 comprises a mixture of approximately equal amounts (by weight) of about 1-10 plasmid DNAs, each containing a different cDNA clone and/or partial cDNA clone; but such a deposit sample may include plasmids for more or less than 2 cDNA clones.

[1072] Two approaches can be used to isolate a particular clone from the deposited sample of plasmid DNA(s) cited for that clone in Table 1. First, a plasmid is directly isolated by screening the clones using a polynucleotide probe corresponding to SEQ ID NO: 1, 3, 5, 7, and/or 202.

[1073] Particularly, a specific polynucleotide with 30-40 nucleotides is synthesized using an Applied Biosystems DNA synthesizer according to the sequence reported. The oligonucleotide is labeled, for instance, with 32P-(-ATP using T4 polynucleotide kinase and purified according to routine methods. (E.g., Maniatis et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring, N.Y. (1982).) The plasmid mixture is transformed into a suitable host, as indicated above (such as XL-1 Blue (Stratagene)) using techniques known to those of skill in the art, such as those provided by the vector supplier or in related publications or patents cited above. The transformants are plated on 1.5% agar plates (containing the appropriate selection agent, e.g., ampicillin) toga density of about 150 transformants (colonies) per plate. These plates are screened using Nylon membranes according to routine methods for bacterial colony screening (e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd Edit., (1989), Cold Spring Harbor Laboratory Press, pages 1.93 to 1.104), or other techniques known to those of skill in the art.

[1074] Alternatively, two primers of 17-20 nucleotides derived from both ends of the SEQ ID NO: 1, 3, 5, 7, and/or 202 (i.e., within the region of SEQ ID NO: 1, 3, 5, 7, and/or 202 bounded by the 5′ NT and the 3′ NT of the clone defined in Table 1) are synthesized and used to amplify the desired cDNA using the deposited cDNA plasmid as a template. The polymerase chain reaction is carried out under routine conditions, for instance, in 25 ul of reaction mixture with 0.5 ug of the above cDNA template. A convenient reaction mixture is 1.5-5 mM MgCl2, 0.01% (w/v) gelatin, 20 uM each of dATP, dCTP, dGTP, dTTP, 25 pmol of each primer and 0.25 Unit of Taq polymerase. Thirty five cycles of PCR (denaturation at 94 degree C for 1 min; annealing at 55 degree C for 1 min; elongation at 72 degree C for 1 min) are performed with a Perkin-Elmer Cetus automated thermal cycler. The amplified product is analyzed by agarose gel electrophoresis and the DNA band with expected molecular weight is excised and purified. The PCR product is verified to be the selected sequence by subcloning and sequencing the DNA product.

[1075] The polynucleotide(s) of the present invention, the polynucleotide encoding the polypeptide of the present invention, or the polypeptide encoded by the deposited clone may represent partial, or incomplete versions of the complete coding region (i.e., full-length gene). Several methods are known in the art for the identification of the 5′ or 3′ non-coding and/or coding portions of a gene which may not be present in the deposited clone. The methods that follow are exemplary and should not be construed as limiting the scope of the invention. These methods include but are not limited to, filter probing, clone enrichment using specific probes, and protocols similar or identical to 5′ and 3′ “RACE” protocols that are well known in the art. For instance, a method similar to 5′ RACE is available for generating the missing 5′ end of a desired full-length transcript. (Fromont-Racine et al., Nucleic Acids Res. 21(7):1683-1684 (1993)).

[1076] Briefly, a specific RNA oligonucleotide is ligated to the 5′ ends of a population of RNA presumably containing full-length gene RNA transcripts. A primer set containing a primer specific to the ligated RNA oligonucleotide and a primer specific to a known sequence of the gene of interest is used to PCR amplify the 5′ portion of the desired full-length gene. This amplified product may then be sequenced and used to generate the full-length gene.

[1077] This above method starts with total RNA isolated from the desired source, although poly-A+RNA can be used. The RNA preparation can then be treated with phosphatase if necessary to eliminate 5′ phosphate groups on degraded or damaged RNA that may interfere with the later RNA ligase step. The phosphatase should then be inactivated and the RNA treated with tobacco acid pyrophosphatase in order to remove the cap structure present at the 5′ ends of messenger RNAs. This reaction leaves a 5′ phosphate group at the 5′ end of the cap cleaved RNA which can then be ligated to an RNA oligonucleotide using T4 RNA ligase.

[1078] This modified RNA preparation is used as a template for first strand cDNA synthesis using a gene specific oligonucleotide. The first strand synthesis reaction is used as a template for PCR amplification of the desired 5′ end using a primer specific to the ligated RNA oligonucleotide and a primer specific to the known sequence of the gene of interest. The resultant product is then sequenced and analyzed to confirm that the 5′ end sequence belongs to the desired gene. Moreover, it may be advantageous to optimize the RACE protocol to increase the probability of isolating additional 5′ or 3′ coding or non-coding sequences. Various methods of optimizing a RACE protocol are known in the art, though a detailed description summarizing these methods can be found in B. C. Schaefer, Anal. Biochem., 227:255-273, (1995).

[1079] An alternative method for carrying out 5′ or 3′ RACE for the identification of coding or non-coding sequences is provided by Frohman, M. A., et al., Proc. Nat'l. Acad. Sci. USA, 85:8998-9002 (1988). Briefly, a cDNA clone missing either the 5′ or 3′ end can be reconstructed to include the absent base pairs extending to the translational start or stop codon, respectively. In some cases, cDNAs are missing the start of translation, therefor. The following briefly describes a modification of this original 5′ RACE procedure. Poly A+ or total RNAs reverse transcribed with Superscript II (Gibco/BRL) and an antisense or I complementary primer specific to the cDNA sequence. The primer is removed from the reaction with a Microcon Concentrator (Amicon). The first-strand cDNA is then tailed with dATP and terminal deoxynucleotide transferase (Gibco/BRL). Thus, an anchor sequence is produced which is needed for PCR amplification. The second strand is synthesized from the dA-tail in PCR buffer, Taq DNA polymerase (Perkin-Elmer Cetus), an oligo-dT primer containing three adjacent restriction sites (XhoIJ Sai1 and ClaI) at the 5′ end and a primer containing just these restriction sites. This double-stranded cDNA is PCR amplified for 40 cycles with the same primers as well as a nested cDNA-specific antisense primer. The PCR products are size-separated on an ethidium bromide-agarose gel and the region of gel containing cDNA products the predicted size of missing protein-coding DNA is removed. cDNA is purified from the agarose with the Magic PCR Prep kit (Promega), restriction digested with XhoI or Sa1I, and ligated to a plasmid such as pBluescript SKII (Stratagene) at XhoI and EcoRV sites. This DNA is transformed into bacteria and the plasmid clones sequenced to identify the correct protein-coding inserts. Correct 5′ ends are confirmed by comparing this sequence with the putatively identified homologue and overlap with the partial cDNA clone. Similar methods known in the art and/or commercial kits are used to amplify and recover 3′ ends.

[1080] Several quality-controlled kits are commercially available for purchase. Similar reagents and methods to those above are supplied in kit form from Gibco/BRL for both 5′ and 3′ RACE for recovery of full length genes. A second kit is available from Clontech which is a modification of a related technique, SLIC (single-stranded ligation to single-stranded cDNA), developed by Dumas et al., Nucleic Acids Res., 19:5227-32(1991). The major differences in procedure are that the RNA is alkaline hydrolyzed after reverse transcription and RNA ligase is used to join a restriction site-containing anchor primer to the first-strand cDNA. This obviates the necessity for the dA-tailing reaction which results in a polyT stretch that is difficult to sequence past.

[1081] An alternative to generating 5′ or 3′ cDNA from RNA is to use cDNA library double- stranded DNA. An asymmetric PCR-amplified antisense cDNA strand is synthesized with an antisense cDNA-specific primer and a plasmid-anchored primer. These primers are removed and a symmetric PCR reaction is performed with a nested cDNA-specific antisense primer and the plasmid-anchored primer.

RNA Ligase Protocol For Generating The 5′ or 3′ End Sequences to Obtain Full Length Genes

[1082] Once a gene of interest is identified, several methods are available for the identification of the 5′ or 3′ portions of the gene which may not be present in the original cDNA plasmid. These methods include, but are not limited to, filter probing, clone enrichment using specific probes and protocols similar and identical to 5′ and 3′ RACE. While the full-length gene may be present in the library and can be identified by probing, a useful method for generating the 5′ or 3′ end is to use the existing sequence information from the original cDNA to generate the missing information. A method similar to 5′ RACE is available for generating the missing 5′ end of a desired full-length gene. (This method was published by Fromont-Racine et al., Nucleic Acids Res., 21(7): 1683-1684 (1993)). Briefly, a specific RNA oligonucleotide is ligated to the 5′ ends of a population of RNA presumably 30 containing full-length gene RNA transcript and a primer set containing a primer specific to the ligated RNA oligonucleotide and a primer specific to a known sequence of the gene of interest, is used to PCR amplify the 5′ portion of the desired full length gene which may then be sequenced and used to generate the full length gene. This method starts with total RNA isolated from the desired source, poly A RNA may be used but is not a prerequisite for this procedure. The RNA preparation may then be treated with phosphatase if necessary to eliminate 5′ phosphate groups on degraded or damaged RNA which may interfere with the later RNA ligase step. The phosphatase if used is then inactivated and the RNA is treated with tobacco acid pyrophosphatase in order to remove the cap structure present at the 5′ ends of messenger RNAs. This reaction leaves a 5′ phosphate group at the 5′ end of the cap cleaved RNA which can then be ligated to an RNA oligonucleotide using T4 RNA ligase. This modified RNA preparation can then be used as a template for first strand cDNA synthesis using a gene specific oligonucleotide. The first strand synthesis reaction can then be used as a template for PCR amplification of the desired 5′ end using a primer specific to the ligated RNA oligonucleotide and a primer specific to the known sequence of the apoptosis related of interest. The resultant product is then sequenced and analyzed to confirm that the 5′ end sequence belongs to the relevant apoptosis related.

Example 10

Bacterial Expression of a Polypeptide

[1083] A polynucleotide encoding a polypeptide of the present invention is amplified using PCR oligonucleotide primers corresponding to the 5′ and 3′ ends of the DNA sequence, as outlined in Example 9, to synthesize insertion fragments. The primers used to amplify the cDNA insert should preferably contain restriction sites, such as BamHI and XbaI, at the 5′ end of the primers in order to clone the amplified product into the expression vector. For example, BamHI and XbaI correspond to the restriction enzyme sites on the bacterial expression vector pQE-9. (Qiagen, Inc., Chatsworth, Calif.). This plasmid vector encodes antibiotic resistance (Ampr), a bacterial origin of replication (orn), an IPTG-regulatable promoter/operator (P/O), a ribosome binding site (RBS), a 6-histidine tag (6-His), and restriction enzyme cloning sites.

[1084] The pQE-9 vector is digested with BamHI and XbaI and the amplified fragment is ligated into the pQE-9 vector maintaining the reading frame initiated at the bacterial RBS. The ligation mixture is then used to transform the E. coli strain M15/rep4 (Qiagen, Inc.) which contains multiple copies of the plasmid pREP4, that expresses the lacI repressor and also confers kanamycin resistance (Kanr). Transformants are identified by their ability to grow on LB plates and ampicillin/kanamycin resistant colonies are selected. Plasmid DNA is isolated and confirmed by restriction analysis.

[1085] Clones containing the desired constructs are grown overnight (O/N) in liquid culture in LB media supplemented with both Amp (100 ug/ml) and Kan (25 ug/ml). The O/N culture is used to inoculate a large culture at a ratio of 1:100 to 1:250. The cells are grown to an optical density 600 (O.D.600) of between 0.4 and 0.6. IPTG (Isopropyl-B-D-thiogalacto pyranoside) is then added to a final concentration of 1 mM. IPTG induces by inactivating the ladc repressor, clearing the P/O leading to increased gene expression.

[1086] Cells are grown for an extra 3 to 4 hours. Cells are then harvested by centrifugation (20 mins at 6000×g). The cell pellet is solubilized in the chaotropic agent 6 Molar Guanidine HCl by stirring for 3-4 hours at 4 degree C. The cell debris is removed by centrifugation, and the supernatant containing the polypeptide is loaded onto a nickel-nitrilo-tri-acetic acid (“Ni-NTA”) affinity resin column (available from QIAGEN, Inc., supra). Proteins with a 6 x His tag bind to the Ni-NTA resin with high affinity and can be purified in a simple one-step procedure (for details see: The QIAexpressionist (1995) QIAGEN, Inc., supra).

[1087] Briefly, the supernatant is loaded onto the column in 6 M guanidine-HCl, pH 8, the column is first washed with 10 volumes of 6 M guanidine-HCl, pH 8, then washed with 10 volumes of 6 M guanidine-HCl pH 6, and finally the polypeptide is eluted with 6 M guanidine-HCl, pH 5.

[1088] The purified protein is then renatured by dialyzing it against phosphate-buffered saline (PBS) or 50 mM Na-acetate, pH 6 buffer plus 200 mM NaCl. Alternatively, the protein can be successfully refolded while immobilized on the Ni-NTA column. The recommended conditions are as follows: renature using a linear 6 M-1 M urea gradient in 500 mM NaCl, 20% glycerol, 20 mM Tris/HCl pH 7.4, containing protease inhibitors. The renaturation should be performed over a period of 1.5 hours or more. After renaturation the proteins are eluted by the addition of 250 mM imidazole. Iindazole is removed by a final dialyzing step against PBS or 50 mM sodium acetate pH 6 buffer plus 200 mM NaCl. The purified protein is stored at 4 degree C or frozen at −80 degree C.

Example 11

Purification of a Polypeptide from an Inclusion Body

[1089] The following alternative method can be used to purify a polypeptide expressed in E coli when it is present in the form of inclusion bodies. Unless otherwise specified, all of the following steps are conducted at 4-10 degree C.

[1090] Upon completion of the production phase of the E. coli fermentation, the cell culture is cooled to 4-10 degree C and the cells harvested by continuous centrifugation at 15,000 rpm (Heraeus Sepatech). On the basis of the expected yield of protein per unit weight of cell paste and the amount of purified protein required, an appropriate amount of cell paste, by weight, is suspended in a buffer solution containing 100 mM Tris, 50 mM EDTA, pH 7.4. The cells are dispersed to a homogeneous suspension using a high shear mixer.

[1091] The cells are then lysed by passing the solution through a microfluidizer (Microfluidics, Corp. or APV Gaulin, Inc.) twice at 4000-6000 psi. The homogenate is then mixed with NaCl solution to a final concentration of 0.5 M NaCl, followed by centrifugation at 7000×g for 15 min. The resultant pellet is washed again using 0.5 M NaCl, 100 mM Tris, 50 mM EDTA, pH 7.4.

[1092] The resulting washed inclusion bodies are solubilized with 1.5 M guanidine hydrochloride (GuHCl) for 2-4 hours. After 7000×g centrifugation for 15 min., the pellet is discarded and the polypeptide containing supernatant is incubated at 4 degree C overnight to allow further GuHCl extraction.

[1093] Following high speed centrifugation (30,000×g) to remove insoluble particles, the GuHCl solubilized protein is refolded by quickly mixing the GuHCl extract with 20 volumes of buffer containing 50 mM sodium, pH 4.5, 150 mM NaCl, 2 mM EDTA by vigorous stirring. The refolded diluted protein solution is kept at 4 degree C without mixing for 12 hours prior to further purification steps.

[1094] To clarify the refolded polypeptide solution, a previously prepared tangential filtration unit equipped with 0.16 um membrane filter with appropriate surface area (e.g., Filtron), equilibrated with 40 mM sodium acetate, pH 6.0 is employed. The filtered sample is loaded onto a cation exchange resin (e.g., Poros HS-50, Perceptive Biosystems). The column is washed with 40 mM sodium acetate, pH 6.0 and eluted with 250 mM, 500 mM, 1000 mM, and 1500 nM NaCl in the same buffer, in a stepwise manner. The absorbance at 280 nm of the effluent is continuously monitored. Fractions are collected and further analyzed by SDS-PAGE.

[1095] Fractions containing the polypeptide are then pooled and mixed with 4 volumes of water. The diluted sample is then loaded onto a previously prepared set of tandem columns of strong anion (Poros HQ-50, Perceptive Biosystems) and weak anion (Poros CM-20, Perceptive Biosystems) exchange resins. The columns are equilibrated with 40 mM sodium acetate, pH 6.0. Both columns are washed with 40 mM sodium acetate, pH 6.0, 200 mM NaCl. The CM-20 column is then eluted using a 10 column volume linear gradient ranging from 0.2 M NaCl, 50 mM sodium acetate, pH 6.0 to 1.0 M NaCl, 50 mM sodium acetate, pH 6.5. Fractions are collected under constant A280 monitoring of the effluent. Fractions containing the polypeptide (determined, for instance, by 16% SDS-PAGE) are then pooled.

[1096] The resultant polypeptide should exhibit greater than 95% purity after the above refolding and purification -steps. No major contaminant bands should be observed from Coomassie blue stained 16% SDS-PAGE gel when 5 ug of purified protein is loaded. The purified protein can also be tested for endotoxin/LPS contamination, and typically the LPS content is less than 0.1 ng/ml according to LAL assays.

Example 12

Cloning and Expression of a Polypeptide in a Baculovirus Expression System

[1097] In this example, the plasmid shuttle vector pAc373 is used to insert a polynucleotide into a baculovirus to express a polypeptide. A typical baculovirus expression vector contains the strong polyhedrin promoter of the Autographa californica nuclear polyhedrosis virus (AcMNPV) followed by convenient restriction sites, which may include, for example BamHl, Xba I and Asp718. The polyadenylation site of the simian virus 40 (“SV40”) is often used for efficient polyadenylation. For easy selection of recombinant virus, the plasmid contains the beta-galactosidase gene from E. coli under control of a weak Drosophila promoter in the same orientation, followed by the polyadenylation signal of the polyhedrin gene. The inserted genes are flanked on both sides by viral sequences for cell-mediated homologous recombination with wild-type viral DNA to generate a viable virus that express the cloned polynucleotide.

[1098] Many other baculovirus vectors can be used in place of the vector above, such as pVL941 and pAcIM1, as one skilled in the art would readily appreciate, as long as the construct provides appropriately located signals for transcription, translation, secretion and the like, including a signal peptide and an in-frame AUG as required. Such vectors are described, for instance, in Luckow et al., Virology 170:31-39 (1989).

[1099] A polynucleotide encoding a polypeptide of the present invention is amplified using PCR oligonucleotide primers corresponding to the 5′ and 3′ ends of the DNA sequence, as outlined in Example 9, to synthesize insertion fragments. The primers used to amplify the cDNA insert should preferably contain restriction sites at the 5′ end of the primers in order to clone the amplified product into the expression vector. Specifically, the cDNA sequence contained in the deposited clone, including the AUG initiation codon and the naturally associated leader sequence identified elsewhere herein (if applicable), is amplified using the PCR protocol described in Example 9. If the naturally occurring signal sequence is used to produce the protein, the vector used does not need a second signal peptide. Alternatively, the vector can be modified to include a baculovirus leader sequence, using the standard methods described in Summers et al., “A Manual of Methods for Baculovirus Vectors and Insect Cell Culture Procedures,” Texas Agricultural Experimental Station Bulletin No. 1555 (1987).

[1100] The amplified fragment is isolated from a 1% agarose gel using a commercially available kit (“Geneclean,” BIO 101 Inc., La Jolla, Calif.). The fragment then is digested with appropriate restriction enzymes and again purified on a 1% agarose gel.

[1101] The plasmid is digested with the corresponding restriction enzymes and optionally, can be dephosphorylated using calf intestinal phosphatase, using routine procedures known in the art. The DNA is then isolated from a 1% agarose gel using a commercially available kit (“Geneclean” BIO 101 Inc., La Jolla, Calif.).

[1102] The fragment and the dephosphorylated plasmid are ligated together with T4 DNA ligase. E. coli HB101 or other suitable E. coli hosts such as XL-1 Blue (Stratagene Cloning Systems, La Jolla, Calif.) cells are transformed with the ligation mixture and spread on culture plates. Bacteria containing the plasmid are identified by digesting DNA from individual colonies and analyzing the digestion product by gel electrophoresis. The sequence of the cloned fragment is confirmed by DNA sequencing.

[1103] Five ug of a plasmid containing the polynucleotide is co-transformed with 1.0 ug of a commercially available linearized baculovirus DNA (“BaculoGold™ baculovirus DNA”, Pharmingen, San Diego, Calif.), using the lipofection method described by Felgner et al., Proc. Natl. Acad. Sci. USA 84:7413-7417 (1987). One ug of BaculoGoldtm virus DNA and 5 ug of the plasnud are mixed in a sterile well of a microtiter plate containing 50 ul of serum-free Grace's medium (Life Technologies Inc., Gaithersburg, Md.). Afterwards, 10 ul Lipofectin plus 90 ul Grace's medium are added, mixed and incubated for 15 minutes at room temperature. Then the transfection mixture is added drop-wise to Sf9 insect cells (ATCC CRL 1711) seeded in a 35 mm tissue culture plate with 1 ml Grace's medium without serum. The plate is then incubated for 5 hours at 27 degrees C. The transfection solution is then removed from the plate and 1 nm of Grace's insect medium supplemented with 10% fetal calf serum is added. Cultivation is then continued at 27 degrees C. for four days.

[1104] After four days the supernatant is collected and a plaque assay is performed, as described by Summers and Smith, supra. An agarose gel with “Blue Gal” (Life Technologies Inc., Gaithersburg) is used to allow easy identification and isolation of gal-expressing clones, which produce blue-stained plaques. (A detailed description of a “plaque assay” of this type can also be found in the user's guide for insect cell culture and baculovirology distributed by Life Technologies Inc., Gaithersburg, page 9-10.) After appropriate incubation, blue stained plaques are picked with the tip of a micropipettor (e.g., Eppendorf). The agar containing the recombinant viruses is then resuspended in a rmcrocentrifuge tube containing 200 ul of Grace's medium and the suspension containing the recombinant baculovirus is used to infect Sf9 cells seeded in 35 mm dishes. Four days later the supernatants of these culture dishes are harvested and then they are stored at 4 degree C.

[1105] To verify the expression of the polypeptide, Sf9 cells are grown in Grace's medium supplemented with 10% heat-inactivated FBS. The cells are infected with the recombinant baculovirus containing the polynucleotide at a multiplicity of infection (“MOI”) of about 2. If radiolabeled proteins are desired, 6 hours later the medium is removed and is replaced with SF900 II medium minus methionine and cysteine (available from Life Technologies Inc., Rockville, Md.). After 42 hours, 5 uCi of 35S-methionine and 5 uCi 35S-cysteine (available from Amersham) are added. The cells are further incubated for 16 hours and then are harvested by centrifugation. The proteins in the supernatant as well as the intracellular proteins are analyzed by SDS-PAGE followed by autoradiography (if radiolabeled).

[1106] Microsequencing of the amino acid sequence of the amino terminus of purified protein may be used to determine the amino terminal sequence of the produced protein.

Example 13

Expression of a Polypeptide in Mammalian Cells

[1107] The polypeptide of the present invention can be expressed in a mammalian cell. A typical mammalian expression vector contains a promoter element, which mediates the initiation of transcription of mRNA, a protein coding sequence, and signals required for the termination of transcription and polyadenylation of the transcript. Additional elements include enhancers, Kozak sequences and intervening sequences flanked by donor and acceptor sites for RNA splicing. Highly efficient transcription is achieved with the early and late promoters from SV40, the long terminal repeats (LTRs) from Retroviruses, e.g., RSV, HTLVI, HIVI and the early promoter of the cytomegalovirus (CMV). However, cellular elements can also be used (e.g., the human actin promoter).

[1108] Suitable expression vectors for use in practicing the present invention include, for example, vectors such as pSVL and pMSG (Pharmacia, Uppsala, Sweden), pRSVcat (ATCC 37152), pSV2dhfr (ATCC 37146), pBC12MI (ATCC 67109), pCMVSport 2.0, and pCMVSport 3.0. Mammalian host cells that could be used include, human Hela, 293, H9 and Jurkat cells, mouse NIH3T3 and C127 cells, Cos 1, Cos 7 and CV1, quail QC1-3 cells, mouse L cells and Chinese hamster ovary (CHO) cells.

[1109] Alternatively, the polypeptide can be expressed in stable cell lines containing the polynucleotide integrated into a chromosome. The co-transformation with a selectable marker such as dhfr, gpt, neomycin, hygromycin allows the identification and isolation of the transformed cells.

[1110] The transformed gene can also be amplified to express large amounts of the encoded protein. The DHFR (dihydrofolate reductase) marker is useful in developing cell lines that carry several hundred or even several thousand copies of the gene of interest. (See, e.g., Alt, F. W., et al., J. Biol. Chem. 253:1357-1370 (1978); Hamlin, J. L. and Ma, C., Biochem. et Biophys. Acta, 1097:107-143 (1990); Page, M. J. and Sydenham, M. A., Biotechnology 9:64-68 (1991).) Another useful selection marker is the enzyme glutamine synthase (GS) (Murphy et al., Biochem J. 227:277-279 (1991); Bebbington et al., Bio/Technology 10:169-175 (1992). Using these markers, the mammalian cells are grown in selective medium and the cells with the highest resistance are selected. These cell lines contain the amplified gene(s) integrated into a chromosome. Chinese hamster ovary (CHO) and NSO cells are often used for the production of proteins.

[1111] A polynucleotide of the present invention is amplified according to the protocol outlined in herein. If the naturally occurring signal sequence is used to produce the protein, the vector does not need a second signal peptide. Alternatively, if the naturally occurring signal sequence is not used, the vector can be modified to include a heterologous signal sequence. (See, e.g., WO 96/34891.) The amplified fragment is isolated from a 1% agarose gel using a commercially available kit (“Geneclean,” BIO 101 Inc., La Jolla, Calif.). The fragment then is digested with appropriate restriction enzymes and again purified on a 1% agarose gel.

[1112] The amplified fragment is then digested with the same restriction enzyme and purified on a 1% agarose gel. The isolated fragment and the dephosphorylated vector are then ligated with T4 DNA ligase. E. coli HB11 or XL-1 Blue cells are then transformed and bacteria are identified that contain the fragment inserted into plasmid pC6 using, for instance, restriction enzyme analysis.

[1113] Chinese hamster ovary cells lacking an active DHFR gene is used for transformation. Five μg of an expression plasmid is cotransformed with 0.5 ug of the plasmid pSVneo using lipofectin (Felgner et al., supra). The plasmid pSV2-neo contains a dominant selectable marker, the neo gene from Tn5 encoding an enzyme that confers resistance to a group of antibiotics including G418. The cells are seeded in alpha minus MEM supplemented with 1 mg/ml G418. After 2 days, the cells are trypsinized and seeded in hybridoma cloning plates (Greiner, Germany) in alpha minus MEM supplemented with 10, 25, or 50 ng/ml of methotrexate plus 1 mg/ml G418. After about 10-14 days single clones are trypsinized and then seeded in 6-well petri dishes or 10 ml flasks using different concentrations of methotrexate (50 nM, 100 nM, 200 nM, 400 nM, 800 nM). Clones growing at the highest concentrations of methotrexate are then transferred to new 6-well plates containing even higher concentrations of mnethotrexate (1 uM, 2 uM, 5 uM, 10 mM, 20 mM). The same procedure is repeated until clones are obtained which grow at a concentration of 100-200 uM. Expression of the desired gene product is analyzed, for instance, by SDS-PAGE and Western blot or by reversed phase HPLC analysis.

Example 14

Protein Fusions

[1114] The polypeptides of the present invention are preferably fused to other proteins. These fusion proteins can be used for a variety of applications. For example, fusion of the present polypeptides to His-tag, HA-tag, protein A, IgG domains, and maltose binding protein facilitates purification. (See Example described herein; see also EP A 394,827; Traunecker, et al., Nature 331:84-86 (1988).) Similarly, fusion to IgG-1, IgG-3, and albumin increases the half-life time in vivo. Nuclear localization signals fused to the polypeptides of the present invention can target the protein to a specific subcellular localization, while covalent heterodimer or homodimers can increase or decrease the activity of a fusion protein. Fusion proteins can also create chimeric molecules having more than one function. Finally, fusion proteins can increase solubility and/or stability of the fused protein compared to the non-fused protein. All of the types of fusion proteins described above can be made by modifying the following protocol, which outlines the fusion of a polypeptide to an IgG molecule.

[1115] Briefly, the human Fc portion of the IgG molecule can be PCR amplified, using primers that span the 5′ and 3′ ends of the sequence described below. These primers also should have convenient restriction enzyme sites that will facilitate cloning into an expression vector, preferably a mammalian expression vector. Note that the polynucleotide is cloned without a stop codon, otherwise a fusion protein will not be produced.

[1116] The naturally occurring signal sequence may be used to produce the protein (if applicable). Alternatively, if the naturally occurring signal sequence is not used, the vector can be modified to include a heterologous signal sequence. (See, e.g., WO 96/34891 and/or U.S. Pat. No. 6,066,781, supra.)

(SEQ ID NO: 158)
GGGATCCGGAGCCCAAATCTTCTGACAAAACTCACACATGCCCACCGTGC
CCAGCACCTGAATTCGAGGGTGCACCGTCAGTCTTCCTCTCCCCCCAAAA
CCCAAGGACACCCTCATGATCTCCCGGACTCCTGAGGTCACATGCGTGGT
GGTGGACGTAAGCCACGAAGACCCTGAGGTCAAGTTCAACTGGTACGTGG
ACGGCGTGGAGGTGCATAATGCCAAGACAAAGCCGCGGGGAGGAGCAGTA
CAACAGCACGTACCGTGTGGTCAGCGTCCTCACCGTCCTGCACCAGGACT
GGCTGAATGGCAAGGAGTACAAGTGCAAGGTCTCCAACAAAGCCCTCCCA
ACCCCCATCGAGAAAACCATCTCCAAAGCCAAAGGGCAGCCCCGAGAACC
ACAGGTGTACACCCTGCCCCCATCCCGGGATGAGCTGACCAAGAACCAGG
TCAGCCTGACCTGCCTGGTCAAAGGCTTCTATCCAAGCGACATCGCCGTG
GAGTGGGAGAGCAATGGGCAGCCGGAGAGACAACTACAAGACCACGCCTC
CCGTGCTGGACTCCGACGGCTCCTTCTCCTCTACAGCAAGCTCACCGTGG
ACAAGAGCAGGTGGCAGCAGGGGAACGTCTTCTCATGCTCCGTGATGCAT
GAGGCTCTGCACAACCACTACACGCAGAAGAGCCTCTCCCTGTCTCCGGG
TAAATGAGTGCGACGGCCGCGACTCTAGAGGAT

Example 15

Method of Creating N-and C-Terminal Deletion Mutants Corresponding to the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, and Microsomal GPAT_hlog3 Polypeptides of the Present Invention

[1117] As described elsewhere herein, the present invention encompasses the creation of N-and C-terminal deletion mutants, in addition to any combination of N-and C-terminal deletions thereof, corresponding to the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, and Microsomal GPAT_hlog3 polypeptides of the present invention. A number of methods are available to one skilled in the art for creating such mutants. Such methods may include a combination of PCR amplification and gene cloning methodology. Although one of skill in the art of molecular biology, through the use of the teachings provided or referenced herein, and/or otherwise known in the art as standard methods, could readily create each deletion mutant of the present invention, exemplary methods are described below.

[1118] Briefly, using the isolated cDNA clone encoding the full-length Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, and Microsomal GPAT_hlog3 polypeptides sequence (as described in Example 9, for example), appropriate primers of about 15-25 nucleotides derived from the desired 5′ and 3′ positions of SEQ ID NO: 1, 3, 5, 7, and/or 202 may be designed to PCR amplify, and subsequently clone, the intended N-and/or C-terminal deletion mutant. Such primers could comprise, for example, an inititation and stop codon for the 5′ and 3′ primer, respectively. Such primers may also comprise restriction sites to facilitate cloning of the deletion mutant post amplification. Moreover, the primers may comprise additional sequences, such as, for example, flag-tag sequences, kozac sequences, or other sequences discussed and/or referenced herein.

[1119] For example, in the case of the F224 to L826 Mitochondrial GPAT N-terminal deletion mutant, the following primers could be used to amplify a cDNA fragment corresponding to this deletion mutant:

5′ Primer	5′-GCAGCA GCGGCCGC TTTCTACCAGTTCATAGATCCC-3′	(SEQ ID NO:175)
	NotI
3′ Primer	5′-GCAGCA GTCGAC CAGCACCACAAAACTCAG-3′	(SEQ ID NO:176)

[1120] For example, in the case of the MI to N593 Mitochondrial GPAT C-terminal deletion mutant, the following primers could be used to amplify a cDNA fragment corresponding to this deletion mutant:

5′ Primer	5′-GCAGCA GCGGCCGC ATGGATGAATCTGCACTGACCCTTG-3′	(SEQ ID NO:177)
	NotI
3′ Primer	5′-GCAGCA GTCGAC GTTCAGAACTGCATAAAGGCTGC-3′	(SEQ ID NO:178)
	SalI

[1121] For example, in the case of the R99 to D543 Microsomal GPAT_hlog1 N-terminal deletion mutant, the following primers could be used to amplify a cDNA fragment corresponding to this deletion mutant:

5′ Primer	5′-GCAGCA GCGGCCGC CGAGTGCTTCTGGCCTTTATCGTCC-3′	(SEQ ID NO:179)
	NotI
3′ Primer	5′-GCAGCA GTCGAC GTCTCCCTTTCTGCTTTGGGTGCTTGC-3′	(SEQ ID NO:180)
	SalI

[1122] For example, in the case of the M1 to V278 Microsomal GPAT_hlog1 C-terminal deletion mutant, the following primers could be used to amplify a cDNA fragment corresponding to this deletion mutant:

5′ Primer	5′-GCAGCA GCGGCCGC ATGGCTGAGAGGCTTGCGGAGCGGG-3′	(SEQ ID NO:181)
	NotI
3′ Primer	5′-GCAGCA GTCGAC GACAGGCTGCACAGGCACCCCTGCG-3′	(SEQ ID NO:182)
	SalI

[1123] For example, in the case of the R25 to D502 Microsomal GPAT_hlog2 N-terminal deletion mutant, the following primers could be used to amplify a cDNA fragment corresponding to this deletion mutant:

5′ Primer	5′-GCAGCA GCGGCCGC CGGCTCCTGGTTGCCGCTGCCATG-3′	(SEQ ID NO:183)
	NotI
3′ Primer	5′-GCAGCA GTCGAC ATCCAGCTTCTTTGCGAACAGGCTTC-3′	(SEQ ID NO:184)
	SalI

[1124] For example, in the case of the M1 to G202 Microsomal GPAT_hlog2 C-terminal deletion mutant, the following primers could be used to amplify a cDNA fragment corresponding to this deletion mutant:

5′ Primer	5′-GCAGCA GCGGCCGC GTGCACGAGCTGCATCTCAGCGCCC-3′	(SEQ ID NO:185)
	NotI
3′ Primer	5′-GCAGCA GTCGAC CCCAGGGTGGACGGGCGCTCCAGGG-3′	(SEQ ID NO:186)
	SalI

[1125] For example, in the case of the R69to D544 Microsomal GPAT_hlog3 N-terminal deletion mutant, the following primers could be used to amplify a cDNA fragment corresponding to this deletion mutant:

5′ Primer	5′-GCAGCA GCGGCCGC CGTGTCTTATTGGTTGCG-3′	(SEQ ID NO:187)
	NotI
3′ Primer	5′-GCAGCA GTCGAC GTCATCTTTTTTGTCTGAGGTACTC-3′	(SEQ ID NO:188)
	SalI

[1126] For example, in the case of the MI to T279 Microsomal GPAT_hlog3 C-terminal deletion mutant, the following primers could be used to amplify a cDNA fragment corresponding to this deletion mutant:

5′ Primer	5′-GCAGCA GCGGCCGC ATGAGCCGGTGCGCCCAGGCGGCGG-3′	(SEQ ID NO:189)
	NotI
3′ Primer	5′-GCAGCA GTCGAC TGTGAAGAGCTGGCAGAAAGTAAGC-3′	(SEQ ID NO:156)
	SalI

[1127] Representative PCR amplification conditions are provided below, although the skilled artisan would appreciate that other conditions may be required for efficient amplification. A 100 ul PCR reaction mixture may be prepared using long of the template DNA (cDNA clone of Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, or Microsomal GPAT_hlog3), 200 uM 4dNTPs, 1 uM primers, 0.25U Taq DNA polymerase (PE), and standard Taq DNA polymerase buffer. Typical PCR cycling condition are as follows:

[1128] 20-25 cycles:45 sec, 93 degrees

[1129] 2 min, 50 degrees

[1130] 2 min, 72 degrees

[1131] 1 cycle: 10 min, 72 degrees

[1132] After the final extension step of PCR, 5U Klenow Fragment may be added and incubated for 15 min at 30 degrees.

[1133] Upon digestion of the fragment with the NotI and SalI restriction enzymes, the fragment could be cloned into an appropriate expression and/or cloning vector which has been similarly digested (e.g., pSport1, among others). . The skilled artisan would appreciate that other plasmids could be equally substituted, and may be desirable in certain circumstances. The digested fragment and vector are then ligated using a DNA ligase, and then used to transform competent E. coli cells using methods provided herein and/or otherwise known in the art.

[1134] The 5′ primer sequence for amplifying any additional N-terninal deletion mutants may be determined by reference to the following formula:

[1135] (S+(X*3)) to ((S+(X*3))+25), wherein ‘S’ is equal to the nucleotide position of the initiating start codon of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, or Microsomal GPAT_hlog3 gene (SEQ ID NO: 1, 3, 5, 7, and/or 202), and ‘X’ is equal to the most N-terminal amino acid of the intended N-terminal deletion mutant. The first term will provide the start 5′ nucleotide position of the 5′ primer, while the second term will provide the end 3′ nucleotide position of the 5′ primer corresponding to sense strand of SEQ ID NO: 1, 3, 5, 7, and/or 202. Once the corresponding nucleotide positions of the primer are determined, the final nucleotide sequence may be created by the addition of applicable restriction site sequences to the 5′ end of the sequence, for example. As referenced herein, the addition of other sequences to the 5′ primer may be desired in certain circumstances (e.g., kozac sequences, etc.).

[1136] The 3′ primer sequence for amplifying any additional N-terminal deletion mutants may be determined by reference to the following formula:

[1137] (S+(X*3)) to ((S+(X*3))-25), wherein ‘S’ is equal to the nucleotide position of the initiating start codon of the Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, or Microsomal GPAT_hlog3 gene (SEQ ID NO: 1, 3, 5, 7, and/or 202), and ‘X’ is equal to the most C-terminal amino acid of the intended N-terminal deletion mutant. The first term will provide the start 5′ nucleotide position of the 3′ primer, while the second term will provide the end 3′ nucleotide position of the 3′ primer corresponding to the anti-sense strand of SEQ ID NO: 1, 3, 5, 7, and/or 202. Once the corresponding nucleotide positions of the primer are determined, the final nucleotide sequence may be created by the addition of applicable restriction site sequences to the 5′ end of the sequence, for example. As referenced herein, the addition of other sequences to the 3′ primer may be desired in certain circumstances (e.g., stop codon sequences, etc.). The skilled artisan would appreciate that modifications of the above nucleotide positions may be necessary for optimizing PCR amplification.

[1138] The same general formulas provided above may be used in identifying the 5′ and 3′ primer sequences for amplifying any C-terminal deletion mutant of the present invention. Moreover, the same general formulas provided above may be used in identifying the 5′ and 3′ primer sequences for amplifying any combination of N-terminal and C-terminal deletion mutant of the present invention. The skilled artisan would appreciate that modifications of the above nucleotide positions may be necessary for optimizing PCR amplification.

Example 16

Regulation of Protein Expression via Controlled Aggregation in the Endoplasmic Reticulum

[1139] As described more particularly herein, proteins regulate diverse cellular processes in higher organisms, ranging from rapid metabolic changes to growth and differentiation. Increased production of specific proteins could be used to prevent certain diseases and/or disease states. Thus, the ability to modulate the expression of specific proteins in an organism would provide significant benefits.

[1140] Numerous methods have been developed to date for introducing foreign genes, either under the control of an inducible, constitutively active, or endogenous promoter, into organisms. Of particular interest are the inducible promoters (see, M. Gossen, et al., Proc. Natl. Acad. Sci. USA., 89:5547 (1992); Y. Wang, et al., Proc. Natl. Acad. Sci. USA, 91:8180 (1994), D. No., et al., Proc. Natl. Acad. Sci. USA, 93:3346 (1996); and V. M. Rivera, et al., Nature Med, 2:1028 (1996); in addition to additional examples disclosed elsewhere herein). In one example, the gene for erthropoietin (Epo) was transferred into mice and primates under the control of a small molecule inducer for expression (e.g., tetracycline or rapamycin) (see, D. Bohl, et al., Blood, 92:1512, (1998); K. G. Rendahl, et al., Nat. Biotech, 16:757, (1998); V. M. Rivera, et al., Proc. Natl. Acad. Sci. USA, 96:8657 (1999); and X.Ye et al., Science, 283:88 (1999). Although such systems enable efficient induction of the gene of interest in the organism upon addition of the inducing agent (i.e., tetracycline, rapamycin, etc,.), the levels of expression tend to peak at 24 hours and trail off to background levels after 4 to 14 days. Thus, controlled transient expression is virtually impossible using these systems, though such control would be desirable.

[1141] A new alternative method of controlling gene expression levels of a protein from a transgene (i.e., includes stable and transient transformants) has recently been elucidated (V. M. Rivera., et al., Science, 287:826-830, (2000)). This method does not control gene expression at the level of the mRNA like the aforementioned systems. Rather, the system controls the level of protein in an active secreted form. In the absence of the inducing agent, the protein aggregates in the ER and is not secreted. However, addition of the inducing agent results in dis-aggregation of the protein and the subsequent secretion from the ER. Such a system affords low basal secretion, rapid, high level secretion in the presence of the inducing agent, and rapid cessation of secretion upon removal of the inducing agent. In fact, protein secretion reached a maximum level within 30 minutes of induction, and a rapid cessation of secretion within 1 hour of removing the inducing agent. The method is also applicable for controlling the level of production for membrane proteins.

[1142] Detailed methods are presented in V. M. Rivera., et al., Science, 287:826-830, (2000)), briefly:

[1143] Fusion protein constructs are created using polynucleotide sequences of the present invention with one or more copies (preferably at least 2, 3, 4, or more) of a conditional aggregation domain (CAD) a domain that interacts with itself in a ligand-reversible manner (i.e., in the presence of an inducing agent) using molecular biology methods known in the art and discussed elsewhere herein. The CAD domain may be the mutant domain isolated from the human FKBP12 (Phe36 to Met) protein (as disclosed in V. M. Rivera., et al., Science, 287:826-830, (2000), or alternatively other proteins having domains with similar ligand-reversible, self-aggregation properties. As a principle of design the fusion protein vector would contain a furin cleavage sequence operably linked between the polynucleotides of the present invention and the CAD domains. Such a cleavage site would enable the proteolytic cleavage of the CAD domains from the polypeptide of the present invention subsequent to secretion from the ER and upon entry into the trans-Golgi (J. B. Denault, et al., FEBS Lett., 379:113, (1996)). Alternatively, the skilled artisan would recognize that any proteolytic cleavage sequence could be substituted for the furin sequence provided the substituted sequence is cleavable either endogenously (e.g., the furin sequence) or exogenously (e.g., post secretion, post purification, post production, etc.). The preferred sequence of each feature of the fusion protein construct, from the 5′ to 3′ direction with each feature being operably linked to the other, would be a promoter, signal sequence, “X” number of (CAD)x domains, the furin sequence (or other proteolytic sequence), and the coding sequence of the polypeptide of the present invention. The artisan would appreciate that the promotor and signal sequence, independent from the other, could be either the endogenous promotor or signal sequence of a polypeptide of the present invention, or alternatively, could be a heterologous signal sequence and promotor.

[1144] The specific methods described herein for controlling protein secretion levels through controlled ER aggregation are not meant to be limiting are would be generally applicable to any of the polynucleotides and polypeptides of the present invention, including variants, homologues, orthologs, and fragments therein.

Example 17

Alteration of Protein Glycosylation Sites to Enhance Characteristics of Polypeptides of the Invention

[1145] Many eukaryotic cell surface and proteins are post-translationally processed to incorporate N-linked and O-linked carbohydrates (Kornfeld and Kornfeld (1985) Annu. Rev. Biochem. 54:631-64; Rademacher et al., (1988) Annu. Rev. Biochem. 57:785-838). Protein glycosylation is thought to serve a variety of functions including: augmentation of protein folding, inhibition of protein aggregation, regulation of intracellular trafficking to organelles, increasing resistance to proteolysis, modulation of protein antigenicity, and mediation of intercellular adhesion (Fieldler and Simons (1995) Cell, 81:309-312; Helenius (1994) Mol. Biol. Of the Cell 5:253-265; Olden et al., (1978) Cell, 13:461-473; Caton et al., (1982) Cell, 37:417-427; Alexander and Elder (1984), Science, 226:1328-1330; and Flack et al., (1994), J. Biol. Chem., 269:14015-14020). In higher organisms, the nature and extent of glycosylation can markedly affect the circulating half-life and bio-availability of proteins by mechanisms involving receptor mediated uptake and clearance (Ashwell and Morrell, (1974), Adv. Enzymol., 41:99-128; Ashwell and Harford (1982), Ann. Rev. Biochem., 51:531-54). Receptor systems have been identified that are thought to play a major role in the clearance of serum proteins through recognition of various carbohydrate structures on the glycoproteins (Stockert (1995), Physiol. Rev., 75:591-609; Kery et al., (1992), Arch. Biochem. Biophys., 298:49-55). Thus, production strategies resulting in incomplete attachment of terminal sialic acid residues might provide a means of shortening the bioavailability and half-life of glycoproteins. Conversely, expression strategies resulting in saturation of terminal sialic acid attachment sites might lengthen protein bioavailability and half-life.

[1146] In the development of recombinant glycoproteins for use as pharmaceutical products, for example, it has been speculated that the pharmacodynamics of recombinant proteins can be modulated by the addition or deletion of glycosylation sites from a glycoproteins primary structure (Berman and Lasky (1985a) Trends in Biotechnol., 3:51-53). However, studies have reported that the deletion of N-linked glycosylation sites often impairs intracellular transport and results in the intracellular accumulation of glycosylation site variants (Machamer and Rose (1988), J. Biol Chem., 263:5955-5960; Gallagher et al., (1992), J. Virology., 66:7136-7145; Collier et al., (1993), Biochem., 32:7818-7823; Claffey et al., (1995) Biochemica et Biophysica Acta, 1246:1-9; Dube et al., (1988), J. Biol. Chem. 263:17516-17521). While glycosylation site variants of proteins can be expressed intracellularly, it has proved difficult to recover useful quantities from growth conditioned cell culture medium.

[1147] Moreover, it is unclear to what extent a glycosylation site in one species will be recognized by another species glycosylation machinery. Due to the importance of glycosylation in protein metabolism, particularly the secretion and/or expression of the protein, whether a glycosylation signal is recognized may profoundly determine a proteins ability to be expressed, either endogenously or recombinately, in another organism (i.e., expressing a human protein in E. coli, yeast, or viral organisms; or an E. coli, yeast, or viral protein in human, etc.). Thus, it may be desirable to add, delete, or modify a glycosylation site, and possibly add a glycosylation site of one species to a protein of another species to improve the proteins functional, bioprocess purification, and/or structural characteristics (e.g., a polypeptide of the present invention).

[1148] A number of methods may be employed to identify the location of glycosylation sites within a protein. One preferred method is to run the translated protein sequence through the PROSITE computer program (Swiss Institute of Bioinformatics). Once identified, the sites could be systematically deleted, or impaired, at the level of the DNA using mutagenesis methodology known in the art and available to the skilled artisan, Preferably using PCR-directed mutagenesis (See Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring, N.Y. (1982)). Similarly, glycosylation sites could be added, or modified at the level of the DNA using similar methods, preferably PCR methods (See, Maniatis, supra). The results of modifying the glycosylation sites for a particular protein (e.g., solubility, secretion potential, activity, aggregation, proteolytic resistance, etc.) could then be analyzed using methods know in the art.

Example 18

Method of Enhancing the Biological Activity/Functional Characteristics of Invention Through Molecular Evolution

[1149] Although many of the most biologically active proteins known are highly effective for their specified function in an organism, they often possess characteristics that make them undesirable for transgenic, therapeutic, and/or industrial applications. Among these traits, a short physiological half-life is the most prominent problem, and is present either at the level of the protein, or the level of the proteins mRNA. The ability to extend the half-life, for example, would be particularly important for a proteins use in gene therapy, transgenic animal production, the bioprocess production and purification of the protein, and use of the protein as a chemical modulator among others. Therefore, there is a need to identify novel variants of isolated proteins possessing characteristics which enhance their application as a therapeutic for treating diseases of animal origin, in addition to the proteins applicability to common industrial and pharmaceutical applications.

[1150] Thus, one aspect of the present invention relates to the ability to enhance specific characteristics of invention through directed molecular evolution. Such an enhancement may, in a non-limiting example, benefit the inventions utility as an essential component in a kit, the inventions physical attributes such as its solubility, structure, or codon optimization, the inventions specific biological activity, including any associated enzymatic activity, the proteins enzyme kinetics, the proteins Ki, Kcat, Km, Vmax, Kd, protein-protein activity, protein-DNA binding activity, antagonist/inhibitory activity (including direct or indirect interaction), agonist activity (including direct or indirect interaction), the proteins antigenicity (e.g., where it would be desirable to either increase or decrease the antigenic potential of the protein), the immunogenicity of the protein, the ability of the protein to form dimers, trimers, or multimers with either itself or other proteins, the antigenic efficacy of the invention, including its subsequent use a preventative treatment for disease or disease states, or as an effector for targeting diseased genes. Moreover, the ability to enhance specific characteristics of a protein may also be applicable to changing the characterized activity of an enzyme to an activity completely unrelated to its initially characterized activity. Other desirable enhancements of the invention would be specific to each individual protein, and would thus be well known in the art and contemplated by the present invention.

[1151] For example, an engineered acyltransferase may be constitutively active upon binding of its cognate ligand. Alternatively, an engineered acyltransferase may be constitutively active in the absence of ligand binding, or may have altered substrate specificity or enzyme kinetics. In yet another example, an engineered acyltransferase may be capable of being activated with less than all of the regulatory factors and/or conditions typically required for acyltransferase activation (e.g., ligand binding, phosphorylation, conformational changes, etc.). Such acyltransferases would be useful in screens to identify acyltransferase modulators, among other uses described herein.

[1152] Directed evolution is comprised of several steps. The first step is to establish a library of variants for the gene or protein of interest. The most important step is to then select for those variants that entail the activity you wish to identify. The design of the screen is essential since your screen should be selective enough to eliminate non-useful variants, but not so stringent as to eliminate all variants. The last step is then to repeat the above steps using the best variant from the previous screen. Each successive cycle, can then be tailored as necessary, such as increasing the stringency of the screen, for example.

[1153] Over the years, there have been a number of methods developed to introduce mutations into macromolecules. Some of these methods include, random mutagenesis, “error-prone” PCR, chemical mutagenesis, site-directed mutagenesis, and other methods well known in the art (for a comprehensive listing of current mutagenesis methods, see Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Press, Cold Spring, N.Y. (1982)). Typically, such methods have been used, for example, as tools for identifying the core functional region(s) of a protein or the function of specific domains of a protein (if a multi-domain protein). However, such methods have more recently been applied to the identification of macromolecule variants with specific or enhanced characteristics.

[1154] Random mutagenesis has been the most widely recognized method to date. Typically, this has been carried out either through the use of “error-prone” PCR (as described in Moore, J., et al, Nature Biotechnology 14:458, (1996), or through the application of randomized synthetic oligonucleotides corresponding to specific regions of interest (as described by Derbyshire, K. M. et al, Gene, 46:145-152, (1986), and Hill, D E, et al, Methods Enzymol., 55:559-568, (1987). Both approaches have limits to the level of mutagenesis that can be obtained. However, either approach enables the investigator to effectively control the rate of mutagenesis. This is particularly important considering the fact that mutations beneficial to the activity of the enzyme are fairly rare. In fact, using too high a level of mutagenesis may counter or inhibit the desired benefit of a useful mutation.

[1155] While both of the aforementioned methods are effective for creating randomized pools of macromolecule variants, a third method, termed “DNA Shuffling”, or “sexual PCR” (W P C, Stemmer, PNAS, 91:10747, (1994)) has recently been elucidated. DNA shuffling has also been referred to as “directed molecular evolution”, “exon-shuffling”, “directed enzyme evolution”, “in vitro evolution”, and “artificial evolution”. Such reference terms are known in the art and are encompassed by the invention. This new, preferred, method apparently overcomes the limitations of the previous methods in that it not only propagates positive traits, but simultaneously eliminates negative traits in the resulting progeny.

[1156] DNA shuffling accomplishes this task by combining the principal of in vitro recombination, along with the method of “error-prone” PCR. In effect, you begin with a randomly digested pool of small fragments of your gene, created by Dnase I digestion, and then introduce said random fragments into an “error-prone” PCR assembly reaction. During the PCR reaction, the randomly sized DNA fragments not only hybridize to their cognate strand, but also may hybridize to other DNA fragments corresponding to different regions of the polynucleotide of interest—regions not typically accessible via hybridization of the entire polynucleotide. Moreover, since the PCR assembly reaction utilizes “error-prone” PCR reaction conditions, random mutations are introduced during the DNA synthesis step of the PCR reaction for all of the fragments—further diversifying the potential hybridization sites during the annealing step of the reaction.

[1157] A variety of reaction conditions could be utilized to carry-out the DNA shuffling reaction. However, specific reaction conditions for DNA shuffling are provided, for example, in PNAS, 91:10747, (1994). Briefly:

[1158] Prepare the DNA substrate to be subjected to the DNA shuffling reaction. Preparation may be in the form of simply purifying the DNA from contaminating cellular material, chemicals, buffers, oligonucleotide primers, deoxynucleotides, RNAs, etc., and may entail the use of DNA purification kits as those provided by Qiagen, Inc., or by the Promega, Corp., for example.

[1159] Once the DNA substrate has been purified, it would be subjected to Dnase I digestion. About 2-4 ug of the DNA substrate(s) would be digested with 0.0015 units of Dnase I (Sigma) per ul in 100 ul of 50mM Tris-HCL, pH 7.4/1 mM MgCl2 for 10-20 min. at room temperature. The resulting fragments of 10-50 bp could then be purified by running them through a 2% low-melting point agarose gel by electrophoresis onto DE81 ion-exchange paper (Whatmann) or could be purified using Microcon concentrators (Amicon) of the appropriate molecular weight cutoff, or could use oligonucleotide purification columns (Qiagen), in addition to other methods known in the art. If using DE81 ion-exchange paper, the 10-50 bp fragments could be eluted from said paper using 1 M NaCl, followed by ethanol precipitation.

[1160] The resulting purified fragments would then be subjected to a PCR assembly reaction by re-suspension in a PCR mixture containing: 2 mM of each dNTP, 2.2 mM MgCl2, 50 mM KCl , 10 mM Tris.HCL, pH 9.0, and 0.1% Triton X-100, at a final fragment concentration of 10-30 ng/ul. No primers are added at this point. Taq DNA polymerase (Promega) would be used at 2.5 units per 100ul of reaction mixture. A PCR program of 94 C for 60 s; 94 C for 30 s, 50-55 C for 30 s, and 72 C for 30 s using 30-45 cycles, followed by 72 C for 5 min using an MJ Research (Cambridge, Mass.) PTC-150 thermocycler. After the assembly reaction is completed, a 1:40 dilution of the resulting primerless product would then be introduced into a PCR mixture (using the same buffer mixture used for the assembly reaction) containing 0.8 um of each primer and subjecting this mixture to 15 cycles of PCR (using 94 C for 30 s, 50 C for 30 s, and 72 C for 30 s). The referred primers would be primers corresponding to the nucleic acid sequences of the polynucleotide(s) utilized in the shuffling reaction. Said primers could consist of modified nucleic acid base pairs using methods known in the art and referred to else where herein, or could contain additional sequences (i.e., for adding restriction sites, mutating specific base-pairs, etc.).

[1161] The resulting shuffled, assembled, and amplified product can be purified using methods well known in the art (e.g., Qiagen PCR purification kits) and then subsequently cloned using appropriate restriction enzymes.

[1162] Although a number of variations of DNA shuffling have been published to date, such variations would be obvious to the skilled artisan and are encompassed by the invention. The DNA shuffling method can also be tailored to the desired level of mutagenesis using the methods described by Zhao, et al. (Nucl Acid Res., 25(6): 1307-1308, (1997).

[1163] As described above, once the randomized pool has been created, it can then be subjected to a specific screen to identify the variant possessing the desired characteristic(s). Once the variant has been identified, DNA corresponding to the variant could then be used as the DNA substrate for initiating another round of DNA shuffling. This cycle of shuffling, selecting the optimized variant of interest, and then re-shuffling, can be repeated until the ultimate variant is obtained. Examples of model screens applied to identify variants created using DNA shuffling technology may be found in the following publications: J. C., Moore, et al., J. Mol. Biol., 272:336-347, (1997), F. R., Cross, et al., Mol. Cell. Biol., 18:2923-2931, (1998), and A. Crameri., et al., Nat. Biotech., 15:436-438, (1997).

[1164] DNA shuffling has several advantages. First, it makes use of beneficial mutations. When combined with screening, DNA shuffling allows the discovery of the best mutational combinations and does not assume that the best combination contains all the mutations in a population. Secondly, recombination occurs simultaneously with point mutagenesis. An effect of forcing DNA polymerase to synthesize full-length genes from the small fragment DNA pool is a background mutagenesis rate. In combination with a stringent selection method, enzymatic activity has been evolved up to 16000 fold increase over the wild-type form of the enzyme. In essence, the background mutagenesis yielded the genetic variability on which recombination acted to enhance the activity.

[1165] A third feature of recombination is that it can be used to remove deleterious mutations. As discussed above, during the process of the randomization, for every one beneficial mutation, there may be at least one or more neutral or inhibitory mutations. Such mutations can be removed by including in the assembly reaction an excess of the wild-type random-size fragments, in addition to the random-size fragments of the selected mutant from the previous selection. During the next selection, some of the most active variants of the polynucleotide/polypeptide/enzyme, should have lost the inhibitory mutations.

[1166] Finally, recombination enables parallel processing. This represents a significant advantage since there are likely multiple characteristics that would make a protein more desirable (e.g. solubility, activity, etc.). Since it is increasingly difficult to screen for more than one desirable trait at a time, other methods of molecular evolution tend to be inhibitory. However, using recombination, it would be possible to combine the randomized fragments of the best representative variants for the various traits, and then select for multiple properties at once.

[1167] DNA shuffling can also be applied to the polynucleotides and polypeptides of the present invention to decrease their immunogenicity in a specified host. For example, a particular variant of the present invention may be created and isolated using DNA shuffling technology. Such a variant may have all of the desired characteristics, though may be highly immunogenic in a host due to its novel intrinsic structure. Specifically, the desired characteristic may cause the polypeptide to have a non-native structure which could no longer be recognized as a “self” molecule, but rather as a “foreign”, and thus activate a host immune response directed against the novel variant. Such a limitation can be overcome, for example, by including a copy of the gene sequence for a xenobiotic ortholog of the native protein in with the gene sequence of the novel variant gene in one or more cycles of DNA shuffling. The molar ratio of the ortholog and novel variant DNAs could be varied accordingly. Ideally, the resulting hybrid variant identified would contain at least some of the coding sequence which enabled the xenobiotic protein to evade the host immune system, and additionally, the coding sequence of the original novel variant that provided the desired characteristics.

[1168] Likewise, the invention encompasses the application of DNA shuffling technology to the evolution of polynucleotides and polypeptides of the invention, wherein one or more cycles of DNA shuffling include, in addition to the gene template DNA, oligonucleotides coding for known allelic sequences, optimized codon sequences, known variant sequences, known polynucleotide polymorphism sequences, known ortholog sequences, known homologue sequences, additional homologous sequences, additional non-homologous sequences, sequences from another species, and any number and combination of the above.

[1169] In addition to the described methods above, there, are a number of related methods that may also be applicable, or desirable in certain cases. Representative among these are the methods discussed in PCT applications WO 98/31700, and WO 98/32845, which are hereby incorporated by reference. Furthermore, related methods can also be applied to the polynucleotide sequences of the present invention in order to evolve invention for creating ideal variants for use in gene therapy, protein engineering, evolution of whole cells containing the variant, or in the evolution of entire enzyme pathways containing polynucleotides of the invention as described in PCT applications WO 98/13485, WO 98/13487, WO 98/27230, WO 98/31837, and Crameri, A., et al., Nat. Biotech., 15:436-438, (1997), respectively.

[1170] Additional methods of applying “DNA Shuffling” technology to the polynucleotides and polypeptides of the present invention, including their proposed applications, may be found in US Patent No. 5,605,793; PCT Application No. WO 95/22625; PCT Application No. WO 97/20078; PCT Application No. WO 97/35966; and PCT Application No. WO 98/42832; PCT Application No. WO 00/09727 specifically provides methods for applying DNA shuffling to the identification of herbicide selective crops which could be applied to the polynucleotides and polypeptides of the present invention; additionally, PCT Application No. WO 00/12680 provides methods and compositions for generating, modifying, adapting, and optimizing polynucleotide sequences that confer detectable phenotypic properties on plant species; each of the above are hereby incorporated in their entirety herein for all purposes.

Example 19

Method of Determining Alterations in a Gene Corresponding to a Polynucleotide

[1171] RNA isolated from entire families or individual patients presenting with a phenotype of interest (such as a disease) is be isolated. cDNA is then generated from these RNA samples using protocols known in the art. (See, Sambrook.) The cDNA is then used as a template for PCR, employing primers surrounding regions of interest in SEQ ID NO: 1, 3, 5, 7, and/or 202. Suggested PCR conditions consist of 35 cycles at 95 degrees C. for 30 seconds; 60-120 seconds at 52-58 degrees C.; and 60-120 seconds at 70 degrees C., using buffer solutions described in Sidransky et al., Science 252:706 (1991).

[1172] PCR products are then sequenced using primers labeled at their 5′ end with T4 polynucleotide kinase, employing SequiTherm Polymerase. (Epicentre Technologies). The intron-exon borders of selected exons is also determined and genorimc PCR products analyzed to confirm the results. PCR products harboring suspected mutations is then cloned and sequenced to validate the results of the direct sequencing.

[1173] PCR products are cloned into T-tailed vectors as described in Holton et al., Nucleic Acids Research, 19:1156 (1991) and sequenced with T7 polymerase (United States Biochemical). Affected individuals are identified by mutations not present in unaffected individuals.

[1174] Genomic rearrangements are also observed as a method of determining alterations in a gene corresponding to a polynucleotide. Genomic clones isolated according to Example 9 are nick-translated with digoxigenindeoxy-uridine 5′-triphosphate (Boehringer Manheim), and FISH performed as described in Johnson et al., Methods Cell Biol. 35:73-99 (1991). Hybridization with the labeled probe is carried out using a vast excess of human cot-1 DNA for specific hybridization to the corresponding genomic locus.

[1175] Chromosomes are counterstained with 4,6-diamino-2-phenylidole and propidium iodide, producing a combination of C- and R-bands. Aligned images for precise mapping are obtained using a triple-band filter set (Chroma Technology, Brattleboro, Vt.) in combination with a cooled charge-coupled device camera (Photometrics, Tucson, AZ) and variable excitation wavelength filters. (Johnson et al., Genet. Anal. Tech. Appl., 8:75 (1991).) Image collection, analysis and chromosomal fractional length measurements are performed using the ISee Graphical Program System. (Inovision Corporation, Durham, N.C.) Chromosome alterations of the genomic region hybridized by the probe are identified as insertions, deletions, and translocations. These alterations are used as a diagnostic marker for an associated disease.

Example 20

Method of Detecting Abnormal Levels of a Polypeptide in a Biological Sample

[1176] A polypeptide of the present invention can be detected in a biological sample, and if an increased or decreased level of the polypeptide is detected, this polypeptide is a marker for a particular phenotype. Methods of detection are numerous, and thus, it is understood that one skilled in the art can modify the following assay to fit their particular needs.

[1177] For example, antibody-sandwich ELISAs are used to detect polypeptides in a sample, preferably a biological sample. Wells of a microtiter plate are coated with specific antibodies, at a final concentration of 0.2 to 10 ug/ml. The antibodies are either monoclonal or polyclonal and are produced by the method described elsewhere herein. The wells are blocked so that non-specific binding of the polypeptide to the well is reduced.

[1178] The coated wells are then incubated for >2 hours at RT with a sample containing the polypeptide. Preferably, serial dilutions of the sample should be used to validate results. The plates are then washed three times with deionized or distilled water to remove unbounded polypeptide.

[1179] Next, 50 ul of specific antibody-alkaline phosphatase conjugate, at a concentration of 25-400 ng, is added and incubated for 2 hours at room temperature. The plates are again washed three times with deionized or distilled water to remove unbounded conjugate.

[1180] Add 75 ul of 4-methylumbelliferyl phosphate (MUP) or p-nitrophenyl phosphate (NPP) substrate solution to each well and incubate 1 hour at room temperature. Measure the reaction by a microtiter plate reader. Prepare a standard curve, using serial dilutions of a control sample, and plot polypeptide concentration on the X-axis (log scale) and fluorescence or absorbance of the Y-axis (linear scale). Interpolate the concentration of the polypeptide in the sample using the standard curve.

Example 21

Formulation

[1181] The invention also provides methods of treatment and/or prevention diseases, disorders, and/or conditions (such as, for example, any one or more of the diseases or disorders disclosed herein) by administration to a subject of an effective amount of a Therapeutic. By therapeutic is meant a polynucleotides or polypeptides of the invention (including fragments and variants), agonists or antagonists thereof, and/or antibodies thereto, in combination with a pharmaceutically acceptable carrier type (e.g., a sterile carrier).

[1182] The Therapeutic will be formulated and dosed in a fashion consistent with good medical practice, taking into account the clinical condition of the individual patient (especially the side effects of treatment with the Therapeutic alone), the site of delivery, the method of administration, the scheduling of administration, and other factors known to practitioners. The “effective amount” for purposes herein is thus determined by such considerations.

[1183] As a general proposition, the total pharmaceutically effective amount of the Therapeutic administered parenterally per dose will be in the range of about 1 ug/kg/day to 10 mg/kg/day of patient body weight, although, as noted above, this will be subject to therapeutic discretion. More preferably, this dose is at least 0.01 mg/kg/day, and most preferably for humans between about 0.01 and 1 mg/kg/day for the hormone. If given continuously, the Therapeutic is typically administered at a dose rate of about 1 ug/kg/hour to about 50 ug/kg/hour, either by 1-4 injections per day or by continuous subcutaneous infusions, for example, using a mini-pump. An intravenous bag solution may also be employed. The length of treatment needed to observe changes and the interval following treatment for responses to occur appears to vary depending on the desired effect.

[1184] Therapeutics can be administered orally, rectally, parenterally, intracisternally, intravaginally, intraperitoneally, topically (as by powders, ointments, gels, drops or transdermal patch), bucally, or as an oral or nasal spray. “Pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any. The term “parenteral” as used herein refers to modes of administration which include intravenous, intramuscular, intraperitoneal, intrasternal, subcutaneous and intraarticular injection and infusion.

[1185] In yet an additional embodiment, the Therapeutics of the invention are delivered orally using the drug delivery technology described in U.S. Pat. No. 6,258,789, which is hereby incorporated by reference herein.

[1186] Therapeutics of the invention are also suitably administered by sustained-release systems. Suitable examples of sustained-release Therapeutics are administered orally, rectally, parenterally, intracisternally, intravaginally, intraperitoneally, topically (as by powders, ointments, gels, drops or transdermal patch), bucally, or as an oral or nasal spray. “Pharmaceutically acceptable carrier” refers to a non-toxic solid, semisolid or liquid filler, diluent, encapsulating material or formulation auxiliary of any type. The term “parenteral” as used herein refers to modes of administration which include intravenous, intramuscular, intraperitoneal, intrasternal, subcutaneous and intraarticular injection and infusion.

[1187] Therapeutics of the invention may also be suitably administered by sustained-release systems. Suitable examples of sustained-release Therapeutics include suitable polymeric materials (such as, for example, semi-permeable polymer matrices in the form of shaped articles, e.g., films, or microcapsules), suitable hydrophobic materials (for example as an emulsion in an acceptable oil) or ion exchange resins, and sparingly soluble derivatives (such as, for example, a sparingly soluble salt).

[1188] Sustained-release matrices include polylactides (U.S. Pat. No. 3,773,919, EP 58,481), copolymers of L-glutamic acid and gamma-ethyl-L-glutamate (Sidman et al., Biopolymers 22:547-556 (1983)), poly (2- hydroxyethyl methacrylate) (Langer et al., J. Biomed. Mater. Res. 15:167-277 (1981), and Langer, Chem. Tech. 12:98-105 (1982)), ethylene vinyl acetate (Langer et al., Id.) or poly-D- (−)-3-hydroxybutyric acid (EP 133,988).

[1189] Sustained-release Therapeutics also include liposomally entrapped Therapeutics of the invention (see, generally, Langer, Science 249:1527-1533 (1990); Treat et al., in Liposomes in the Therapy of Infectious Disease and Cancer, Lopez-Berestein and Fidler (eds.), Liss, New York, pp. 317 -327 and 353-365 (1989)). Liposomes containing the Therapeutic are prepared by methods known per se: DE 3,218,121; Epstein et al., Proc. Natl. Acad. Sci. (USA) 82:3688-3692 (1985); Hwang et al., Proc. Natl. Acad. Sci.(USA) 77:4030-4034 (1980); EP 52,322; EP 36,676; EP 88,046; EP 143,949; EP 142,641; Japanese Pat. Appl. 83-118008; U.S. Pat. Nos. 4,485,045 and 4,544,545; and EP 102,324. Ordinarily, the liposomes are of the small (about 200-800 Angstroms) unilamellar type in which the lipid content is greater than about 30 mol. percent cholesterol, the selected proportion being adjusted for the optimal Therapeutic.

[1190] In yet an additional embodiment, the Therapeutics of the invention are delivered by way of a pump (see Langer, supra; Sefton, CRC Crit. Ref. Biomed. Eng. 14:201 (1987); Buchwald et al., Surgery 88:507 (1980); Saudek et al., N. Engl. J. Med. 321:574 (1989)).

[1191] Other controlled release systems are discussed in the review by Langer (Science 249:1527-1533 (1990)).

[1192] For parenteral administration, in one embodiment, the Therapeutic is formulated generally by mixing it at the desired degree of purity, in a unit dosage injectable form (solution, suspension, or emulsion), with a pharmaceutically acceptable carrier, i.e., one that is non-toxic to recipients at the dosages and concentrations employed and is compatible with other ingredients of the formulation. For example, the formulation preferably does not include oxidizing agents and other compounds that are known to be deleterious to the Therapeutic.

[1193] Generally, the formulations are prepared by contacting the Therapeutic uniformly and intimately with liquid carriers or finely divided solid carriers or both. Then, if necessary, the product is shaped into the desired formulation. Preferably the carrier is a parenteral carrier, more preferably a solution that is isotonic with the blood of the recipient. Examples of such carrier vehicles include water, saline, Ringer's solution, and dextrose solution. Non-aqueous vehicles such as fixed oils and ethyl oleate are also useful herein, as well as liposomes.

[1194] The carrier suitably contains minor amounts of additives such as substances that enhance isotonicity and chemical stability. Such materials are non-toxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, succinate, acetic acid, and other organic acids or their salts; antioxidants such as ascorbic acid; low molecular weight (less than about ten residues) polypeptides, e.g., polyarginine or tripeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids, such as glycine, glutamic acid, aspartic acid, or arginine; monosaccharides, disaccharides, and other carbohydrates including cellulose or its derivatives, glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; counterions such as sodium; and/or nonionic surfactants such as polysorbates, poloxamers, or PEG.

[1195] The Therapeutic will typically be formulated in such vehicles at a concentration of about 0.1 mg/ml to 100 mg/ml, preferably 1-10 mg/ml, at a pH of about 3 to 8. It will be understood that the use of certain of the foregoing excipients, carriers, or stabilizers will result in the formation of polypeptide salts.

[1196] Any pharmaceutical used for therapeutic administration can be sterile. Sterility is readily accomplished by filtration through sterile filtration membranes (e.g., 0.2 micron membranes). Therapeutics generally are placed into a container having a sterile access port, for example, an intravenous solution bag or vial having a stopper pierceable by a hypodermic injection needle.

[1197] Therapeutics ordinarily will be stored in unit or multi-dose containers, for example, sealed ampoules or vials, as an aqueous solution or as a lyophilized formulation for reconstitution. As an example of a lyophilized formulation, 10-ml vials are filled with 5 ml of sterile-filtered 1% (w/v) aqueous Therapeutic solution, and the resulting mixture is lyophilized. The infusion solution is prepared by reconstituting the lyophilized Therapeutic using bacteriostatic Water-for-Injection.

[1198] The invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the Therapeutics of the invention. Associated with such container(s) can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration. In addition, the Therapeutics may be employed in conjunction with other therapeutic compounds.

[1199] The Therapeutics of the invention may be administered alone or in combination with adjuvants. Adjuvants that may be administered with the Therapeutics of the invention include, but are not limited to, alum, alum plus deoxycholate (ImmunoAg), MTP-PE (Biocine Corp.), QS21 (Genentech, Inc.), BCG, and MPL. In a specific embodiment, Therapeutics of the invention are administered in combination with alum. In another specific embodiment, Therapeutics of the invention are administered in combination with QS-21. Further adjuvants that may be administered with the Therapeutics of the invention include, but are not limited to, Monophosphoryl lipid immunomodulator, AdjuVax lOOa, QS-21, QS-18, CRL1005, Aluminum salts, MF-59, and Virosomal adjuvant technology. Vaccines that may be administered with the Therapeutics of the invention include, but are not limited to, vaccines directed toward protection against MMR (measles, mumps, rubella), polio, varicella, tetanus/diptheria, hepatitis A, hepatitis B, haemophilus influenzae B, whooping cough, pneumonia, influenza, Lyme's Disease, rotavirus, cholera, yellow fever, Japanese encephalitis, poliomyelitis, rabies, typhoid fever, and pertussis. Combinations may be administered either concomitantly, e.g., as an admixture, separately but simultaneously or concurrently; or sequentially. This includes presentations in which the combined agents are administered together as a therapeutic mixture, and also procedures in which the combined agents are administered separately but simultaneously, e.g., as through separate intravenous lines into the same individual. Administration “in combination” further includes the separate administration of one of the compounds or agents given first, followed by the second.

[1200] The Therapeutics of the invention may be administered alone or in combination with other therapeutic agents. Therapeutic agents that may be administered in combination with the Therapeutics of the invention, include but not limited to, other members of the TNF family, chemotherapeutic agents, antibiotics, steroidal and non-steroidal anti-inflammatories, conventional immunotherapeutic agents, cytokines and/or growth factors. Combinations may be administered either concomitantly, e.g., as an admixture, separately but simultaneously or concurrently; or sequentially. This includes presentations in which the combined agents are administered together as a therapeutic mixture, and also procedures in which the combined agents are administered separately but simultaneously, e.g., as through separate intravenous lines into the same individual. Administration “in combination” further includes the separate administration of one of the compounds or agents given first, followed by the second.

[1201] In one embodiment, the Therapeutics of the invention are administered in combination with members of the TNF family. TNF, TNF-related or TNF-like molecules that may be administered with the Therapeutics of the invention include, but are not limited to, soluble forms of TNF-alpha, lymphotoxin-alpha (LT-alpha, also known as TNF-beta), LT-beta (found in complex heterotrimer LT-alpha2-beta), OPGL, FasL, CD27L, CD30L, CD40L, 4-1BBL, DcR3, OX40L, TNF-gamma (International Publication No. WO 96/14328), AIM-I (International Publication No. WO 97/33899), endokine-alpha (International Publication No. WO 98/07880), TR6 (International Publication No. WO 98/30694), OPG, and neutrokine-alpha (International Publication No. WO 98/18921, OX40, and nerve growth factor (NGF), and soluble forms of Fas, CD30, CD27, CD40 and 4-IBB, TR2 (International Publication No. WO 96/34095), DR3 (International Publication No. WO 97/33904), DR4 (International Publication No. WO 98/32856), TR5 (International Publication No. WO 98/30693), TR6 (International Publication No. WO 98/30694), TR7 (International Publication No. WO 98/41629), TRANK, TR9 (International Publication No. WO 98/56892),TR1O (International Publication No. WO 98/54202), 312C2 (International Publication No. WO 98/06842), and TR12, and soluble forms CD 154, CD70, and CD153.

[1202] In certain embodiments, Therapeutics of the invention are administered in combination with antiretroviral agents, nucleoside reverse transcriptase inhibitors, non-nucleoside reverse transcriptase inhibitors, and/or protease inhibitors. Nucleoside reverse transcriptase inhibitors that may be administered in combination with the Therapeutics of the invention, include, but are not limited to, RETROVIR (zidovudine/AZT), VIDEX (didanosine/ddI), HIVID (zalcitabine/ddC), ZERIT (stavudine/d4T), EPIVIR (lamivudine/3TC), and COMBIVIR (zidovudine/lamivudine). Non-nucleoside reverse transcriptase inhibitors that may be administered in combination with the Therapeutics of the invention, include, but are not limited to, VIRAMUNE (nevirapine), RESCRIPTOR (delavirdine), and SUSTIVA (efavirenz). Protease inhibitors that may be administered in combination with the Therapeutics of the invention, include, but are not limited to, CRIXIVAN (indinavir), NORVIR (ritonavir), INVIRASE (saquinavir), and VIRACEPT (nelfinavir). In a specific embodiment, antiretroviral agents, nucleoside reverse transcriptase inhibitors, non-nucleoside reverse transcriptase inhibitors, and/or protease inhibitors may be used in any combination with Therapeutics of the invention to treat AIDS and/or to prevent or treat HIV infection.

[1203] In other embodiments, Therapeutics of the invention may be administered in combination with anti-opportunistic infection agents. Anti-opportunistic agents that may be administered in combination with the Therapeutics of the invention, include, but are not limited to, TRIMETHOPRIM-SULFAMETHOXAZOLE, DAPSONE, PENTAMIDINE, ATOVAQUONE, ISONIAZID, RIFAMPIN, PYRAZINAMIDE, ETHAMBUTOL, RIFABUTIN, CLARITHROMYCIN, AZITHROMYCIN, GANCICLOVIR, FOSCARNET, CIDOFOVIR, FLUCONAZOLE, ITRACONAZOLE, KETOCONAZOLE, ACYCLOVIR, FAMCICOLVIR, PYRIMETHAMINE, LEUCOVORIN, NEUPOGEN (filgrastim/G-CSF), and LEUKINE (sargramostim/GM-CSF). In a specific embodiment, Therapeutics of the invention are used in any combination with TRIMETHOPRIM-SULFAMETHOXAZOLE, DAPSONE, PENTAMIDINE, and/or ATOVAQUONE to prophylactically treat or prevent an opportunistic Pneumocystis carinii pneumonia infection. In another specific embodiment, Therapeutics of the invention are used in any combination with ISONIAZID, RIFAMPIN, PYRAZINAMIDE, and/or ETHAMBUTOL to prophylactically treat or prevent an opportunistic Mycobacterium avium complex infection. In another specific embodiment, Therapeutics of the invention are used in any combination with RIFABUTIN, CLARITHROMYCIN, and/or AZITHROMYCIN to prophylactically treat or prevent an opportunistic Mycobacterium tuberculosis infection. In another specific embodiment, Therapeutics of the invention are used in any combination with GANCICLOVIR, FOSCARNET, and/or CIDOFOVIR to prophylactically treat or prevent an opportunistic cytomegalovirus infection. In another specific embodiment, Therapeutics of the invention are used in any combination with FLUCONAZOLE, ITRACONAZOLE, and/or KETOCONAZOLE to prophylactically treat or prevent an opportunistic fungal infection. In another specific embodiment, Therapeutics of the invention are used in any combination with ACYCLOVIR and/or FAMCICOLVIR to prophylactically treat or prevent an opportunistic herpes simplex virus type I and/or type II infection. In another specific embodiment, Therapeutics of the invention are used in any combination with PYRIMETHAMINE and/or LEUCOVORIN to prophylactically treat or prevent an opportunistic Toxoplasma gondii infection. In another specific embodiment, Therapeutics of the invention are used in any combination with LEUCOVORIN and/or NEUPOGEN to prophylactically treat or prevent an opportunistic bacterial infection.

[1204] In a further embodiment, the Therapeutics of the invention are administered in combination with an antiviral agent. Antiviral agents that may be administered with the Therapeutics of the invention include, but are not limited to, acyclovir, ribavirin, amantadine, and remantidine.

[1205] In a further embodiment, the Therapeutics of the invention are administered in combination with an antibiotic agent. Antibiotic agents that may be administered with the Therapeutics of the invention include, but are not limited to, amoxicillin, beta-lactamases, aminoglycosides, beta-lactam (glycopeptide), beta-lactamases, Clindamycin, chloramphenicol, cephalosporins, ciprofloxacin, ciprofloxacin, erythromycin, fluoroquinolones, macrolides, metronidazole, penicillins, quinolones, rifampin, streptomycin, sulfonamide, tetracyclines, trimethoprim, trimethoprim-sulfamthoxazole, and vancomycin.

[1206] Conventional nonspecific immunosuppressive agents, that may be administered in combination with the Therapeutics of the invention include, but are not limited to, steroids, cyclosporine, cyclosporine analogs, cyclophosphamide methylprednisone, prednisone, azathioprine, FK-506, 15-deoxyspergualin, and other immunosuppressive agents that act by suppressing the function of responding T cells.

[1207] In specific embodiments, Therapeutics of the invention are administered in combination with immunosuppressants. Immunosuppressants preparations that may be administered with the Therapeutics of the invention include, but are not limited to, ORTHOCLONE (OKT3), SANDIMMUNE/NEORAL/SANGDYA (cyclosporin), PROGRAF (tacrolimus), CELLCEPT (mycophenolate), Azathioprine, glucorticosteroids, and RAPAMUNE (sirolimus). In a specific embodiment, immunosuppressants may be used to prevent rejection of organ or bone marrow transplantation.

[1208] In an additional embodiment, Therapeutics of the invention are administered alone or in combination with one or more intravenous immune globulin preparations. Intravenous immune globulin preparations that may be administered with the Therapeutics of the invention include, but not limited to, GAMMAR, IVEEGAM, SANDOGLOBULIN, GAMMAGARD S/D, and GAMIMUNE. In a specific embodiment, Therapeutics of the invention are administered in combination with intravenous immune globulin preparations in transplantation therapy (e.g., bone marrow transplant).

[1209] In an additional embodiment, the Therapeutics of the invention are administered alone or in combination with an anti-inflammatory, agent. Anti-inflammatory agents that may be administered with the Therapeutics of the invention include, but are not limited to, glucocorticoids and the nonsteroidal anti-inflammatories, aminoarylcarboxylic acid derivatives, arylacetic acid derivatives, arylbutyric acid derivatives, arylcarboxylic acids, arylpropionic acid derivatives, pyrazoles, pyrazolones, salicylic acid derivatives, thiazinecarboxamides, e-acetamidocaproic acid, S-adenosylmethionine, 3-amino-4-hydroxybutyric acid, amixetrine, bendazac, benzydamine, bucolome, difenpiramide, ditazol, emorfazone, guaiazulene, nabumetone, nimesulide, orgotein, oxaceprol, paranyline, perisoxal, pifoxime, proquazone, proxazole, and tenidap.

[1210] In another embodiment, compositions of the invention are administered in combination with a chemotherapeutic agent. Chemotherapeutic agents that may be administered with the Therapeutics of the invention include, but are not limited to, antibiotic derivatives (e.g., doxorubicin, bleomycin, daunorubicin, and dactinomycin); antiestrogens (e.g., tamoxifen); antimetabolites (e.g., fluorouracil, 5-FU, methotrexate, floxuridine, interferon alpha-2b, glutamic acid, plicamycin, mercaptopurine, and 6-thioguanine); cytotoxic agents (e.g., carmustine, BCNU, lomustine, CCNU, cytosine arabinoside, cyclophosphamide, estramustine, hydroxyurea, procarbazine, mitomycin, busulfan, cis-platin, and vincristine sulfate); hormones (e.g., medroxyprogesterone, estramustine phosphate sodium, ethinyl estradiol, estradiol, megestrol acetate, methyltestosterone, diethylstilbestrol diphosphate, chlorotrianisene, and testolactone); nitrogen mustard derivatives (e.g., mephalen, chorambucil, mechlorethamine (nitrogen mustard) and thiotepa); steroids and combinations (e.g., bethamethasone sodium phosphate); and others (e.g., dicarbazine, asparaginase, mitotane, vincristine sulfate, vinblastine sulfate, and etoposide).

[1211] In a specific embodiment, Therapeutics of the invention are administered in combination with CHOP (cyclophosphamide, doxorubicin, vincristine, and prednisone) or any combination of the components of CHOP. In another embodiment, Therapeutics of the invention are administered in combination with Rituximab. In a further embodiment, Therapeutics of the invention are administered with Rituxmab and CHOP, or Rituxmab and any combination of the components of CHOP.

[1212] In an additional embodiment, the Therapeutics of the invention are administered in combination with cytokines. Cytokines that may be administered with the Therapeutics of the invention include, but are not limited to, IL2, IL3, IL4, IL5, IL6, IL7, IL10, IL12, IL13, IL1S, anti-CD40, CD40L, IFN-gamma and TNF-alpha. In another embodiment, Therapeutics of the invention may be administered with any interleukin, including, but not limited to, IL-1alpha, IL-1beta, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, IL-10, IL-11, IL-12, IL-13, IL-14, IL-15, IL-16, IL-17, IL-18, IL-19, IL-20, and IL-21.

[1213] In an additional embodiment, the Therapeutics of the invention are administered in combination with angiogenic proteins. Angiogenic proteins that may be administered with the Therapeutics of the invention include, but are not limited to, Glioma Derived Growth Factor (GDGF), as disclosed in European Patent Number EP-399816; Platelet Derived Growth Factor-A (PDGF-A), as disclosed in European Patent Number EP-682110; Platelet Derived Growth Factor-B (PDGF-B), as disclosed in European Patent Number EP-282317; Placental Growth Factor (PlGF), as disclosed in International Publication Number WO 92/06194; Placental Growth Factor-2 (PlGF-2), as disclosed in Hauser et al., Growth Factors, 4:259-268 (1993); Vascular Endothelial Growth Factor (VEGF), as disclosed in International Publication Number WO 90/13649; Vascular Endothelial Growth Factor-A (VEGF-A), as disclosed in European Patent Number EP-506477; Vascular Endothelial Growth Factor-2 (VEGF-2), as disclosed in International Publication Number WO 96/39515; Vascular Endothelial Growth Factor B (VEGF-3); Vascular Endothelial Growth Factor B-186 (VEGF-B186), as disclosed in International Publication Number WO 96/26736; Vascular Endothelial Growth Factor-D (VEGF-D), as disclosed in International Publication Number WO 98/02543; Vascular Endothelial Growth Factor-D (VEGF-D), as disclosed in International Publication Number WO 98/07832; and Vascular Endothelial Growth Factor-E (VEGF-E), as disclosed in German Patent Number DE19639601. The above mentioned references are incorporated herein by reference herein.

[1214] In an additional embodiment, the Therapeutics of the invention are administered in combination with hematopoietic growth factors. Hematopoietic growth factors that may be administered with the Therapeutics of the invention include, but are not limited to, LEUKINE (SARGRAMOSTIM) and NEUPOGEN (FILGRASTIM).

[1215] In an additional embodiment, the Therapeutics of the invention are administered in combination with Fibroblast Growth Factors. Fibroblast Growth Factors that may be administered with the Therapeutics of the invention include, but are not limited to, FGF-1, FGF-2, FGF-3, FGF-4, FGF-5, FGF-6, FGF-7, FGF-8, FGF-9, FGF-I0, FGF-1 1, FGF-12, FGF-13, FGF-14, and FGF-15.

[1216] In an additional embodiment, the Therapeutics of the invention are administered in combination with other immune factors. Immune factors that may be administered with the Therapeutics of the invention include, but are not limited to, Ly9, CD2, CD48, CD58, 2B4, CD84, CDw15O, CTLA4, CTLA4Ig, Bs11, Bs12, Bs13, BLYS, TRAIL, APRIL, B7, B7 antagonists, B7 agonists, and Ret16.

[1217] In a specific embodiment, formulations of the present invention may further comprise antagonists of P-glycoprotein (also referred to as the multiresistance protein, or PGP), including antagonists of its encoding polynucleotides (e.g., antisense oligonucleotides, ribozymes, zinc-finger proteins, etc.). P-glycoprotein is well known for decreasing the efficacy of various drug administrations due to its ability to export intracellular levels of absorbed drug to the cell exterior. While this activity has been particularly pronounced in cancer cells in response to the administration of chemotherapy regimens, a variety of other cell types and the administration of other drug classes have been noted (e.g., T-cells and anti-HIV drugs). In fact, certain mutations in the PGP gene significantly reduces PGP function, making it less able to force drugs out of cells. People who have two versions of the mutated gene—one inherited from each parent—have more than four times less PGP than those with two normal versions of the gene. People may also have one normal gene and one mutated one. Certain ethnic populations have increased incidence of such PGP mutations. Among individuals from Ghana, Kenya, the Sudan, as well as African Americans, frequency of the normal gene ranged from 73% to 84%. In contrast, the frequency was 34% to 59% among British whites, Portuguese, Southwest Asian, Chinese, Filipino and Saudi populations. As a result, certain ethnic populations may require increased administration of PGP antagonist in the formulation of the present invention to arrive at the an efficacious dose of the therapeutic (e.g., those from African descent). Conversely, certain ethnic populations, particularly those having increased frequency of the mutated PGP (e.g., of Caucasian descent, or non-African descent) may require less pharmaceutical compositions in the formulation due to an effective increase in efficacy of such compositions as a result of the increased effective absorption (e.g., less PGP activity) of said composition.

[1218] Moreover, in another specific embodiment, formulations of the present invention may further comprise antagonists of OATP2 (also referred to as the multiresistance protein, or MRP2), including antagonists of its encoding polynucleotides (e.g., antisense oligonucleotides, ribozymes, zinc-finger proteins, etc.). The invention also further comprises any additional antagonists known to inhibit proteins thought to be attributable to a multidrug resistant phenotype in proliferating cells.

[1219] Preferred antagonists that formulations of the present may comprise include the potent P-glycoprotein inhibitor elacridar, and/or LY-335979. Other P-glycoprotein inhibitors known in the art are also encompassed by the present invention.

[1220] In additional embodiments, the Therapeutics of the invention are administered in combination with other therapeutic or prophylactic regimens, such as, for example, radiation therapy.

Example 22

Method of Treating Decreased Levels of the Polypeptide

[1221] The present invention relates to a method for treating an individual in need of an increased level of a polypeptide of the invention in the body comprising administering to such an individual a composition comprising a therapeutically effective amount of an agonist of the invention (including polypeptides of the invention). Moreover, it will be appreciated that conditions caused by a decrease in the standard or normal expression level of a secreted protein in an individual can be treated by administering the polypeptide of the present invention, preferably in the secreted form. Thus, the invention also provides a method of treatment of an individual in need of an increased level of the polypeptide comprising administering to such an individual a Therapeutic comprising an amount of the polypeptide to increase the activity level of the polypeptide in such an individual.

[1222] For example, a patient with decreased levels of a polypeptide receives a daily dose 0.1-100 ug/kg of the polypeptide for six consecutive days. Preferably, the polypeptide is in the secreted form. The exact details of the dosing scheme, based on administration and formulation, are provided herein.

Example 23

Method of Treating Increased Levels of the Polypeptide

[1223] The present invention also relates to a method of treating an individual in need of a decreased level of a polypeptide of the invention in the body comprising administering to such an individual a composition comprising a therapeutically effective amount of an antagonist of the invention (including polypeptides and antibodies of the invention).

[1224] In one example, antisense technology is used to inhibit production of a polypeptide of the present invention. This technology is one example of a method of decreasing levels of a polypeptide, preferably a secreted form, due to a variety of etiologies, such as cancer. For example, a patient diagnosed with abnormally increased levels of a polypeptide is administered intravenously antisense polynucleotides at 0.5, 1.0, 1.5, 2.0 and 3.0 mg/kg day for 21 days. This treatment is repeated after a 7-day rest period if the treatment was well tolerated. The formulation of the antisense polynucleotide is provided herein.

Example 24

Method of Treatment using Gene Therapy ex vivo

[1225] One method of gene therapy transplants fibroblasts, which are capable of expressing a polypeptide, onto a patient. Generally, fibroblasts are obtained from a subject by skin biopsy. The resulting tissue is placed in tissue-culture medium and separated into small pieces. Small chunks of the tissue are placed on a wet surface of a tissue culture flask, approximately ten pieces are placed in each flask. The flask is turned upside down, closed tight and left at room temperature over night. After 24 hours at room temperature, the flask is inverted and the chunks of tissue remain fixed to the bottom of the flask and fresh media (e.g., Ham's F12 media, with 10% FBS, penicillin and streptomycin) is added. The flasks are then incubated at 37 degree C for approximately one week.

[1226] At this time, fresh media is added and subsequently changed every several days. After an additional two weeks ;in culture, a monolayer of fibroblasts emerge. The monolayer is trypsinized and scaled into larger flasks. pMV-7 (Kirschmeier, P. T. et al., DNA, 7:219-25 (1988)), flanked by the long terminal repeats of the Moloney murine sarcoma virus, is digested with EcoR1 and HindIII and subsequently treated with calf intestinal phosphatase. The linear vector is fractionated on agarose gel and purified, using glass beads.

[1227] The cDNA encoding a polypeptide of the present invention can be amplified using PCR primers which correspond to the 5′ and 3′ end sequences respectively as set forth in Example 9 using primers and having appropriate restriction sites and initiation/stop codons, if necessary. Preferably, the 5′ primer contains an EcoR1 site and the 3′ primer includes a HindIII site. Equal quantities of the Moloney murine sarcoma virus linear backbone and the amplified EcoR1 and HindIII fragment are added together, in the presence of T4 DNA ligase. The resulting mixture is maintained under conditions appropriate for ligation of the two fragments. The ligation mixture is then used to transform bacteria HB 101, which are then plated onto agar containing kanamycin for the purpose of confirming that the vector has the gene of interest properly inserted.

[1228] The amphotropic pA317 or GP+aml2 packaging cells are grown in tissue culture to confluent density in Dulbecco's Modified Eagles Medium (DMEM) with 10% calf serum (CS), penicillin and streptomycin. The MSV vector containing the gene is then added to the media and the packaging cells transduced with the vector. The packaging cells now produce infectious viral particles containing the gene (the packaging cells are now referred to as producer cells).

[1229] Fresh media is added to the transduced producer cells, and subsequently, the media is harvested from a 10 cm plate of confluent producer cells. The spent media, containing the infectious viral particles, is filtered through a millipore filter to remove detached producer cells and this media is then used to infect fibroblast cells. Media is removed from a sub-confluent plate of fibroblasts and quickly replaced with the media from the producer cells. This media is removed and replaced with fresh media. If the titer of virus is high, then virtually all fibroblasts will be infected and no selection is required. If the titer is very low, then it is necessary to use a retroviral vector that has a selectable marker, such as neo or his. Once the fibroblasts have been efficiently infected, the fibroblasts are analyzed to determine whether protein is produced.

[1230] The engineered fibroblasts are then transplanted onto the host, either alone or after having been grown to confluence on cytodex 3 microcarrier beads.

Example 25

Gene Therapy using Endogenous Genes Corresponding to Polynucleotides of the Invention

[1231] Another method of gene therapy according to the present invention involves operably associating the endogenous polynucleotide sequence of the invention with a promoter via homologous recombination as described, for example, in U.S. Pat. NO: 5,641,670, issued Jun. 24, 1997; International Publication NO: WO 96/29411, published Sep. 26, 1996; International Publication NO: WO 94/12650, published August 4, 1994; Koller et al., Proc. Natl. Acad. Sci. USA, 86:8932-8935 (1989); and Zijlstra et al., Nature, 342:435-438 (1989). This method involves the activation of a gene which is present in the target cells, but which is not expressed in the cells, or is expressed at a lower level than desired.

[1232] Polynucleotide constructs are made which contain a promoter and targeting sequences, which are homologous to the 5′ non-coding sequence of endogenous polynucleotide sequence, flanking the promoter. The targeting sequence will be sufficiently near the 5′ end of the polynucleotide sequence so the promoter will be operably linked to the endogenous sequence upon homologous recombination. The promoter and the targeting sequences can be amplified using PCR. Preferably, the amplified promoter contains distinct restriction enzyme sites on the 5′ and 3′ ends. Preferably, the 3′ end of the first targeting sequence contains the same restriction enzyme site as the 5′ end of the amplified promoter and the 5′ end of the second targeting sequence contains the same restriction site as the 3′ end of the amplified promoter.

[1233] The amplified promoter and the amplified targeting sequences are digested with the appropriate restriction enzymes and subsequently treated with calf intestinal phosphatase. The digested promoter and digested targeting sequences are added together in the presence of T4 DNA ligase. The resulting mixture is maintained under conditions appropriate for ligation of the two fragments. The construct is size fractionated on an agarose gel then purified by phenol extraction and ethanol precipitation.

[1234] In this Example, the polynucleotide constructs are administered as naked polynucleotides via electroporation. However, the polynucleotide constructs may also be administered with transfection-facilitating agents, such as liposomes, viral sequences, viral particles, precipitating agents, etc. Such methods of delivery are known in the art.

[1235] Once the cells are transfected, homologous recombination will take place which results in the promoter being operably linked to the endogenous polynucleotide sequence. This results in the expression of polynucleotide corresponding to the polynucleotide in the cell. Expression may be detected by immunological staining, or any other method known in the art.

[1236] Fibroblasts are obtained from a subject by skin biopsy. The resulting tissue is placed in DMEM +10% fetal calf serum. Exponentially growing or early stationary phase fibroblasts are trypsinized and rinsed from the plastic surface with nutrient medium. An aliquot of the cell suspension is removed for counting, and the remaining cells are subjected to centrifugation. The supernatant is aspirated and the pellet is resuspended in 5 ml of electroporation buffer (20 mM HEPES pH 7.3, 137 mM NaCl, 5 mM KCl, 0.7 mM Na2 HPO4, 6 mM dextrose). The cells are recentrifuged, the supernatant aspirated, and the cells resuspended in electroporation buffer containing 1 mg/ml acetylated bovine serum albumin. The final cell suspension contains approximately 3×106 cells/ml. Electroporation should be performed immediately following resuspension.

[1237] Plasmid DNA is prepared according to standard techniques. For example, to construct a plasmid for targeting to the locus corresponding to the polynucleotide of the invention, plasmid pUC18 (MBI Fermentas, Amherst, N.Y.) is digested with Hindlll. The CMV promoter is amplified by PCR with an XbaI site on the 5′ end and a BamHI site on the 3′ end. Two non-coding sequences are amplified via PCR: one non-coding sequence (fragment 1) is amplified with a HindIII site at the 5′ end and an Xba site at the 3′ end; the other non-coding sequence (fragment 2) is amplified with a BamHI site at the 5′ end and a Hindlll site at the 3′ end. The CMV promoter and the fragments (1 and 2) are digested with the appropriate enzymes (CMV promoter—XbaI and BamHI; fragment 1—XbaI; fragment 2—BamHI) and ligated together. The resulting ligation product is digested with HindIII, and ligated with the HindIII-digested pUC18 plasmid.

[1238] Plasmid DNA is added to a sterile cuvette with a 0.4 cm electrode gap (Bio-Rad). The final DNA concentration is generally at least 120 μg/ml. 0.5 ml of the cell suspension (containing approximately 1.5.×106 cells) is then added to the cuvette, and the cell suspension and DNA solutions are gently mixed. Electroporation is performed with a Gene-Pulser apparatus (Bio-Rad). Capacitance and voltage are set at 960 μF and 250-300 V, respectively. As voltage increases, cell survival decreases, but the percentage of surviving cells that stably incorporate the introduced DNA into their genome increases dramatically. Given these parameters, a pulse time of approximately 14-20 mSec should be observed.

[1239] Electroporated cells are maintained at room temperature for approximately 5 min, and the contents of the cuvette are then gently removed with a sterile transfer pipette. The cells are added directly to 10 ml of prewarmed nutrient media (DMEM with 15% calf serum) in a 10 cm dish and incubated at 37 degree C. The following day, the media is aspirated and replaced with 10 ml of fresh media and incubated for a further 16-24 hours.

[1240] The engineered fibroblasts are then injected into the host, either alone or after having been grown to confluence on cytodex 3 microcarrier beads. The fibroblasts now produce the protein product. The fibroblasts can then be introduced into a patient as described above.

Example 26

Method of Treatment using Gene Therapy In vivo

[1241] Another aspect of the present invention is using in vivo gene therapy methods to treat disorders, diseases and conditions. The gene therapy method relates to the introduction of naked nucleic acid (DNA, RNA, and antisense DNA or RNA) sequences into an animal to increase or decrease the expression of the polypeptide. The polynucleotide of the present invention may be operatively linked to a promoter or any other genetic elements necessary for the expression of the polypeptide by the target tissue. Such gene therapy and delivery techniques and methods are known in the art, see, for example, WO 90/11092, WO 98/11779; U.S. Pat. NO. 5693622, 5705151, 5580859; Tabata et al., Cardiovasc. Res. 35(3):470-479 (1997); Chao et al., Pharmacol. Res. 35(6):517-522 (1997); Wolff, Neuromuscul. Disord. 7(5):314-318 (1997); Schwartz et al., Gene Ther. 3(5):405-411 (1996); Tsurumi et al., Circulation 94(12):3281-3290 (1996) (incorporated herein by reference).

[1242] The polynucleotide constructs may be delivered by any method that delivers injectable materials to the cells of an animal, such as, injection into the interstitial space of tissues (heart, muscle, skin, lung, liver, intestine and the like). The polynucleotide constructs can be delivered in a pharmaceutically acceptable liquid or aqueous carrier.

[1243] The term “naked” polynucleotide, DNA or RNA, refers to sequences that are free from any delivery vehicle that acts to assist, promote, or facilitate entry into the cell, including viral sequences, viral particles, liposome formulations, lipofectin or precipitating agents and the like. However, the polynucleotides of the present invention may also be delivered in liposome formulations (such as those taught in Felgner P. L. et al. (1995) Ann. NY Acad. Sci. 772:126-139 and Abdallah B. et al. (1995) Biol. Cell 85(1):1-7) which can be prepared by methods well known to those skilled in the art.

[1244] The polynucleotide vector constructs used in the gene therapy method are preferably constructs that will not integrate into the host genome nor will they contain sequences that allow for replication. Any strong promoter known to those skilled in the art can be used for driving the expression of DNA. Unlike other gene therapies techniques, one major advantage of introducing naked nucleic acid sequences into target cells is the transitory nature of the polynucleotide synthesis in the cells. Studies have shown that non-replicating DNA sequences can be introduced into cells to provide production of the desired polypeptide for periods of up to six months.

[1245] The polynucleotide construct can be delivered to the interstitial space of tissues within the an animal, including of muscle, skin, brain, lung, liver, spleen, bone marrow, thymus, heart, lymph, blood, bone, cartilage, pancreas, kidney, gall bladder, stomach, intestine, testis, ovary, uterus, rectum, nervous system, eye, gland, and connective tissue. Interstitial space of the tissues comprises the intercellular fluid, mucopolysaccharide matrix among the reticular fibers of organ tissues, elastic fibers in the walls of vessels or chambers, collagen fibers of fibrous tissues, or that same matrix within connective tissue ensheathing muscle cells or in the lacunae of bone. It is similarly the space occupied by the plasma of the circulation and the lymph fluid of the lymphatic channels. Delivery to the interstitial space of muscle tissue is preferred for the reasons discussed below. They may be conveniently delivered by injection into the tissues comprising these cells. They are preferably delivered to and expressed in persistent, non-dividing cells which are differentiated, although delivery and expression may be achieved in non-differentiated or less completely differentiated cells, such as, for example, stem cells of blood or skin fibroblasts. In vivo muscle cells are particularly competent in their ability to take up and express polynucleotides.

[1246] For the naked polynucleotide injection, an effective dosage amount of DNA or RNA will be in the range of from about 0.05 g/kg body weight to about 50 mg/kg body weight. Preferably the dosage will be from about 0.005 mg/kg to about 20 mg/kg and more preferably from about 0.05 mg/kg to about 5 mg/kg. Of course, as the artisan of ordinary skill will appreciate, this dosage will vary according to the tissue site of injection. The appropriate and effective dosage of nucleic acid sequence can readily be determined by those of ordinary skill in the art and may depend on the condition being treated and the route of administration. The preferred route of administration is by the parenteral route of injection into the interstitial space of tissues. However, other parenteral routes may also be used, such as, inhalation of an aerosol formulation particularly for delivery to lungs or bronchial tissues, throat or mucous membranes of the nose. In addition, naked polynucleotide constructs can be delivered to arteries during angioplasty by the catheter used in the procedure.

[1247] The dose response effects of injected polynucleotide in muscle in vivo is determined as follows. Suitable template DNA for production of mRNA coding for polypeptide of the present invention is prepared in accordance with a standard recombinant DNA methodology. The template DNA, which may be either circular or linear, is either used as naked DNA or complexed with liposomes. The quadriceps muscles of mice are then injected with various amounts of the template DNA.

[1248] Five to six week old female and male Balb/C mice are anesthetized by intraperitoneal injection with 0.3 ml of 2.5% Avertin. A 1.5 cm incision is made on the anterior thigh, and the quadriceps muscle is directly visualized. The template DNA is injected in 0.1 ml of carrier in a 1 cc syringe through a 27 gauge needle over one minute, approximately 0.5 cm from the distal insertion site of the muscle into the knee and about 0.2 cm deep. A suture is placed over the injection site for future localization, and the skin is closed with stainless steel clips.

[1249] After an appropriate incubation time (e.g., 7 days) muscle extracts are prepared by excising the entire quadriceps. Every fifth 15 um cross-section of the individual quadriceps muscles is histochemically stained for protein expression. A time course for protein expression may be done in a similar fashion except that quadriceps from different mice are harvested at different times. Persistence of DNA in muscle following injection may be determined by Southern blot analysis after preparing total cellular DNA and HIRT supernatants from injected and control mice. The results of the above experimentation in mice can be use to extrapolate proper dosages and other treatment parameters in humans and other animals using naked DNA.

Example 27

Transgenic Animals

[1250] The polypeptides of the invention can also be expressed in transgenic animals. Animals of any species, including, but not limited to, nmce, rats, rabbits, hamsters, guinea pigs, pigs, micro-pigs, goats, sheep, cows and non-human primates, e.g., baboons, monkeys, and chimpanzees may be used to generate transgenic animals. In a specific embodiment, techniques described herein or otherwise known in the art, are used to express polypeptides of the invention in humans, as part of a gene therapy protocol.

[1251] Any technique known in the art may be used to introduce the transgene (i.e., polynucleotides of the invention) into animals to produce the founder lines of transgenic animals. Such techniques include, but are not limited to, pronuclear ricroinjection (Paterson et al., Appl. Microbiol. Biotechnol. 40:691-698 (1994); Carver et al., Biotechnology (NY) 11:1263-1270 (1993); Wright et al., Biotechnology (NY) 9:830-834 (1991); and Hoppe et al., U.S. Pat. No. 4,873,191 (1989)); retrovirus mediated gene transfer into germ lines (Van der Putten et al., Proc. Natl. Acad. Sci., USA 82:6148-6152 (1985)), blastocysts or embryos; gene targeting in embryonic stem cells (Thompson et al., Cell 56:313-321 (1989)); electroporation of cells or embryos (Lo, 1983, Mol Cell. Biol. 3:1803-1814 (1983)); introduction of the polynucleotides of the invention using a gene gun (see, e.g., Ulmer et al., Science 259:1745 (1993); introducing nucleic acid constructs into embryonic pleuripotent stem cells and transferring the stem cells back into the blastocyst; and sperm-mediated gene transfer (Lavitrano et al., Cell 57:717-723 (1989); etc. For a review of such techniques, see Gordon, “Transgenic Animals,” Intl. Rev. Cytol. 115:171-229 (1989), which is incorporated by reference herein in its entirety.

[1252] Any technique known in the art may be used to produce transgenic clones containing polynucleotides of the invention, for example, nuclear transfer into enucleated oocytes of nuclei from cultured embryonic, fetal, or adult cells induced to quiescence (Campell et al., Nature 380:64-66 (1996); Wilmut et al., Nature 385:810-813 (1997)).

[1253] The present invention provides for transgenic animals that carry the transgene in all their cells, as well as animals which carry the transgene in some, but not all their cells, i.e., mosaic animals or chimeric. The transgene may be integrated as a single transgene or as multiple copies such as in concatamers, e.g., head-to-head tandems or head-to-tail tandems. The transgene may also be selectively introduced into and activated in a particular cell type by following, for example, the teaching of Lasko et al. (Lasko et al., Proc. Natl. Acad. Sci. USA 89:6232-6236 (1992)). The regulatory sequences required for such a cell-type specific activation will depend upon the particular cell type of interest, and will be apparent to those of skill in the art. When it is desired that the polynucleotide transgene be integrated into the chromosomal site of the endogenous gene, gene targeting is preferred. Briefly, when such a technique is to be utilized, vectors containing some nucleotide sequences homologous to the endogenous gene are designed for the purpose of integrating, via homologous recombination with chromosomal sequences, into and disrupting the function of the nucleotide sequence of the endogenous gene. The transgene may also be selectively introduced into a particular cell type, thus inactivating the endogenous gene in only that cell type, by following, for example, the teaching of Gu et al. (Gu et al., Science 265:103-106 (1994)). The regulatory sequences required for such a cell-type specific inactivation will depend upon the particular cell type of interest, and will be apparent to those of skill in the art.

[1254] Once transgenic animals have been generated, the expression of the recombinant gene may be assayed utilizing standard techniques. Initial screening may be accomplished by Southern blot analysis or PCR techniques to analyze animal tissues to verify that integration of the transgene has taken place. The level of mRNA expression of the transgene in the tissues of the transgenic animals may also be assessed using techniques which include, but are not limited to, Northern blot analysis of tissue samples obtained from the animal, in situ hybridization analysis, and reverse transcriptase-PCR(RT-PCR). Samples of transgenic gene-expressing tissue may also be evaluated immunocytochemically or immunohistochemically using antibodies specific for the transgene product.

[1255] Once the founder animals are produced, they may be bred, inbred, outbred, or crossbred to produce colonies of the particular animal. Examples of such breeding strategies include, but are not limited to: outbreeding of founder animals with more than one integration site in order to establish separate lines; inbreeding of separate lines in order to produce compound transgenics that express the transgene at higher levels because of the effects of additive expression of each transgene; crossing of heterozygous transgenic animals to produce animals homozygous for a given integration site in order to both augment expression and eliminate the need for screening of animals by DNA analysis; crossing of separate homozygous lines to produce compound heterozygous or homozygous lines; and breeding to place the transgene on a distinct background that is appropriate for an experimental model of interest.

[1256] Transgenic animals of the invention have uses which include, but are not limited to, animal model systems useful in elaborating the biological function of polypeptides of the present invention, studying diseases, disorders, and/or conditions associated with aberrant expression, and in screening for compounds effective in ameliorating such diseases, disorders, and/or conditions.

Example 28

Knock-out Animals

[1257] Endogenous gene expression can also be reduced by inactivating or “knocking out” the gene and/or its promoter using targeted homologous recombination. (E.g., see Smithies et al., Nature 317:230-234 (1985); Thomas & Capecchi, Cell 51:503-512t. (1987); Thompson et al., Cell 5:313-321 (1989); each of which is incorporated by reference herein in its entirety). For example, a mutant, non-functional polynucleotide of the invention (or a completely unrelated DNA sequence) flanked by DNA homologous to the endogenous polynucleotide sequence (either the coding regions or regulatory regions of the gene) can be used, with or without a selectable marker and/or a negative selectable marker, to transfect cells that express polypeptides of the invention in vivo. In another embodiment, techniques known in the art are used to generate knockouts in cells that contain, but do not express the gene of interest. Insertion of the DNA construct, via targeted homologous recombination, results in inactivation of the targeted gene. Such approaches are particularly suited in research and agricultural fields where modifications to embryonic stem cells can be used to generate animal offspring with an inactive targeted gene (e.g., see Thomas & Capecchi 1987 and Thompson 1989, supra). However this approach can be routinely adapted for use in humans provided the recombinant DNA constructs are directly administered or targeted to the required site in vivo using appropriate viral vectors that will be apparent to those of skill in the art.

[1258] In further embodiments of the invention, cells that are genetically engineered to express the polypeptides of the invention, or alternatively, that are genetically engineered not to express the polypeptides of the invention (e.g., knockouts) are administered to a patient in vivo. Such cells may be obtained from the patient (i.e., animal, including human) or an MHC compatible donor and can include, but are not limited to fibroblasts, bone marrow cells, blood cells (e.g., lymphocytes), adipocytes, muscle cells, endothelial cells etc. The cells are genetically engineered in vitro using recombinant DNA techniques to introduce the coding sequence of polypeptides of the invention into the cells, or alternatively, to disrupt the coding sequence and/or endogenous regulatory sequence associated with the polypeptides of the invention, e.g., by transduction (using viral vectors, and preferably vectors that integrate the transgene into the cell genome) or transfection procedures, including, but not limited to, the use of plasmids, cosmids, YACs, naked DNA, electroporation, liposomes, etc. The coding sequence of the polypeptides of the invention can be placed under the control of a strong constitutive or inducible promoter or promoter/enhancer to achieve expression, and preferably secretion, of the polypeptides of the invention. The engineered cells which express and preferably secrete the polypeptides of the invention can be introduced into the patient systemically, e.g., in the circulation, or intraperitoneally.

[1259] Alternatively, the cells can be incorporated into a matrix and implanted in the body, e.g., genetically engineered fibroblasts can be implanted as part of a skin graft; genetically engineered endothelial cells can be implanted as part of a lymphatic or vascular graft. (See, for example, Anderson et al. U.S. Pat. No. 5,399,349; and Mulligan & Wilson, U.S. Pat. No. 5,460,959 each of which is incorporated by reference herein in its entirety).

[1260] When the cells to be administered are non-autologous or non-MHC compatible cells, they can be administered using well known techniques which prevent the development of a host immune response against the introduced cells. For example, the cells may be introduced in an encapsulated form which, while allowing for an exchange of components with the immediate extracellular environment, does not allow the introduced cells to be recognized by the host immune system.

[1261] Transgenic and “knock-out” animals of the invention have uses which include, but are not limited to, animal model systems useful in elaborating the biological function of polypeptides of the present invention, studying diseases, disorders, and/or conditions associated with aberrant expression, and in screening for compounds effective in ameliorating such diseases, disorders, and/or conditions.

Example 29

Method of Isolating Antibody Fragments Directed Against Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 from a Library of scFvs

[1262] Naturally occurring V-genes isolated from human PBLs are constructed into a library of antibody fragments which contain reactivities against Mitochondrial GPAT, Microsomal GPAT_hlog1, Microsomal GPAT_hlog2, Microsomal GPAT_hlog3, and/or Microsomal GPAT_hlog3_v1 to which the donor may or may not have been exposed (see e.g., U.S. Pat. No. 5,885,793 incorporated herein by reference in its entirety).

[1263] Rescue of the Library. A library of scFvs is constructed from the RNA of human PBLs as described in PCT publication WO 92/01047. To rescue phage displaying antibody fragments, approximately 109 E. coli harboring the phagemid are used to inoculate 50 ml of 2xTY containing 1% glucose and 100 μg/ml of ampicillin (2xTY-AMP-GLU) and grown to an O.D. of 0.8 with shaking. Five ml of this culture is used to inoculate 50 ml of 2xTY-AMP-GLU, 2×108 TU of delta gene 3 helper (M13 delta gene III, see PCT publication WO 92/01047) are added and the culture incubated at 37° C. for 45 minutes without shaking and then at 37° C. for 45 minutes with shaking. The culture is centrifuged at 4000 r.p.m. for 10 min. and the pellet resuspended in 2 liters of 2xTY containing 100 μg/nl ampicillin and 50 ug/ml kanamycin and grown overnight. Phage are prepared as described in PCT publication WO 92/01047.

[1264] M13 delta gene III is prepared as follows: M13 delta gene III helper phage does not encode gene III protein, hence the phage(mid) displaying antibody fragments have a greater avidity of binding to antigen. Infectious M13 delta gene III particles are made by growing the helper phage in cells harboring a pUC19 derivative supplying the wild type gene III protein during phage morphogenesis. The culture is incubated for 1 hour at 37° C. without shaking and then for a further hour at 37° C. with shaking. Cells are spun down (IEC-Centra 8,400 r.p.m. for 10 min), resuspended in 300 ml 2xTY broth containing 100 μg ampicillin/ml and 25 μg kanamycin/ml (2xTY-AMP-KAN) and grown overnight, shaking at 37° C. Phage particles are purified and concentrated from the culture medium by two PEG-precipitations (Sambrook et al., 1990), resuspended in 2 ml PBS and passed through a 0.45 μm filter (Minisart NML; Sartorius) to give a final concentration of approximately 1013 transducing units/ml (ampicillin-resistant clones).

[1265] Panning of the Library. Immunotubes (Nunc) are coated overnight in PBS with 4 ml of either 100 μg/ml or 10 μg/ml of a polypeptide of the present invention. Tubes are blocked with 2% Marvel-PBS for 2 hours at 37° C. and then washed 3 times in PBS. Approximately 1013 TU of phage is applied to the tube and incubated for 30 minutes at room temperature tumbling on an over and under turntable and then left to stand for another 1.5 hours. Tubes are washed 10 times with PBS 0.1% Tween-20 and 10 times with PBS. Phage are eluted by adding 1 ml of 100 mM triethylamine and rotating 15 minutes on an under and over turntable after which the solution is immediately neutralized with 0.5 ml of 1.0 M Tris-HCl, pH 7.4. Phage are then used to infect 10 ml of mid-log E. coli TG1 by incubating eluted phage with bacteria for 30 minutes at 37° C. The E. coli are then plated on TYE plates containing 1% glucose and 100 μg/ml ampicillin. The resulting bacterial library is then rescued with delta gene 3 helper phage as described above to prepare phage for a subsequent round of selection. This process is then repeated for a total of 4 rounds of affinity purification with tube-washing increased to 20 times with PBS, 0.1% Tween-20 and 20 times with PBS for rounds 3 and 4.

[1266] Characterization of Binders. Eluted phage from the 3rd and 4th rounds of selection are used to infect E. coli HB 2151 and soluble scFv is produced (Marks, et al., 1991) from single colonies for assay. ELISAs are performed with microtitre plates coated with either 10 pg/ml of the polypeptide of the present invention in 50 mM bicarbonate pH 9.6. Clones positive in ELISA are further characterized by PCR fingerprinting (see, e.g., PCT publication WO 92/01047) and then by sequencing. These ELISA positive clones may also be further characterized by techniques known in the art, such as, for example, epitope mapping, binding affinity, receptor signal transduction, ability to block or competitively inhibit antibody/antigen binding, and competitive agonistic or antagonistic activity.

[1267] Moreover, in another preferred method, the antibodies directed against the polypeptides of the present invention may be produced in plants. Specific methods are disclosed in U.S. Pat. Nos. 5,959,177, and 6,080,560, which are hereby incorporated in their entirety herein. The methods not only describe methods of expressing antibodies, but also the means of assembling foreign multimeric proteins in plants (i.e., antibodies, etc,), and the subsequent secretion of such antibodies from the plant.

Example 30

Assays Detecting Stimulation or Inhibition of B Cell Proliferation and Differentiation

[1268] Generation of functional humoral immune responses requires both soluble and cognate signaling between B-lineage cells and their microenvironment. Signals may impart a positive stimulus that allows a B-lineage cell to continue its programmed development, or a negative stimulus that instructs the cell to arrest its current developmental pathway. To date, numerous stimulatory and inhibitory signals have been found to influence B cell responsiveness including IL-2, IL-4, IL-5, IL-6, IL-7, IL10, IL-13, IL-14 and IL-15. Interestingly, these signals are by themselves weak effectors but can, in combination with various co-stimulatory proteins, induce activation, proliferation, differentiation, homing, tolerance and death among B cell populations.

[1269] One of the best studied classes of B-cell co-stimulatory proteins is the TNF-superfamily. Within this family CD40, CD27, and CD30 along with their respective ligands CD154, CD70, and CD153 have been found to regulate a variety of immune responses. Assays which allow for the detection and/or observation of the proliferation and differentiation of these B-cell populations and their precursors are valuable tools in determining the effects various proteins may have on these B-cell populations in terms of proliferation and differentiation. Listed below are two assays designed to allow for the detection of the differentiation, proliferation, or inhibition of B-cell populations and their precursors.

[1270] In Vitro Assay—Purified polypeptides of the invention, or truncated forms thereof, is assessed for its ability to induce activation, proliferation, differentiation or inhibition and/or death in B-cell populations and their precursors. The activity of the polypeptides of the invention on purified human tonsillar B cells, measured qualitatively over the dose range from 0.1 to 10,000 ng/mL, is assessed in a standard B-lymphocyte co-stimulation assay in which purified tonsillar B cells are cultured in the presence of either formalin-fixed Staphylococcus aureus Cowan I (SAC) or immobilized anti-human IgM antibody as the prining agent. Second signals such as IL-2 and IL-15 synergize with SAC and IgM crosslinking to elicit B cell proliferation as measured by tritiated-thymidine incorporation. Novel synergizing agents can be readily identified using this assay. The assay involves isolating human tonsillar B cells by magnetic bead (MACS) depletion of CD3-positive cells. The resulting cell population is greater than 95% B cells as assessed by expression of CD45R(B220).

[1271] Various dilutions of each sample are placed into individual wells of a 96-well plate to which are added 105 B-cells suspended in culture medium (RPMI 1640 containing 10% FBS, 5×10-5 M 2 ME, 100 U/ml penicillin, 10 ug/ml streptomycin, and 10-5 dilution of SAC) in a total volume of 150 ul. Proliferation or inhibition is quantitated by a 20h pulse (1 uCi/well) with 3H-thymidine (6.7 Ci/mM) beginning 72 h post factor addition. The positive and negative controls are IL2 and medium respectively.

[1272] In Vivo Assay—BALB/c mice are injected (i.p.) twice per day with buffer only, or 2 mg/Kg of a polypeptide of the invention, or truncated forms thereof. Mice receive this treatment for 4 consecutive days, at which time they are sacrificed and various tissues and serum collected for analyses. Comparison of H&E sections from normal spleens and spleens treated with polypeptides of the invention identify the results of the activity of the polypeptides on spleen cells, such as the diffusion of peri-arterial lymphatic sheaths, and/or significant increases in the nucleated cellularity of the red pulp regions, which may indicate the activation of the differentiation and proliferation of B-cell populations. hflunohistochermcal studies using a B cell marker, anti-CD45R(B220), are used to determine whether any physiological changes to splenic cells, such as splenic disorganization, are due to increased B-cell representation within loosely defined B-cell zones that infiltrate established T-cell regions.

[1273] Flow cytometric analyses of the spleens from mice treated with polypeptide is used to indicate whether the polypeptide specifically increases the proportion of ThB+, CD45R(B220)dull B cells over that which is observed in control mice.

[1274] Likewise, a predicted consequence of increased mature B-cell representation in vivo is a relative increase in serum Ig titers. Accordingly, serum IgM and IgA levels are compared between buffer and polypeptide-treated mice.

[1275] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 31

T Cell Proliferation Assay

[1276] A CD3-induced proliferation assay is performed on PBMCs and is measured by the uptake of 3H-thymidine. The assay is performed as follows. Ninety-six well plates are coated with 100 (1/well of mAb to CD3 (HIT3a, Pharmingen) or isotype-matched control mAb (B33.1) overnight at 4 degrees C. (1 (g/ml in 0.05 M bicarbonate buffer, pH 9.5), then washed three times with PBS. PBMC are isolated by F/H gradient centrifugation from human peripheral blood and added to quadruplicate wells (5×104/well) of mAb coated plates in RPMI containing 10% FCS and P/S in the presence of varying concentrations of polypeptides of the invention (total volume 200 ul). Relevant protein buffer and medium alone are controls. After 48 hr. culture at 37 degrees C, plates are spun for 2 min. at 1000 rpm and 100 (1 of supernatant is removed and stored −20 degrees C for measurement of IL-2 (or other cytokines) if effect on proliferation is observed. Wells are supplemented with 100 ul of medium containing 0.5 uCi of 3H-thymidine and cultured at 37 degrees C. for 18-24 hr. Wells are harvested and incorporation of 3H-thymidine used as a measure of proliferation. Anti-CD3 alone is the positive control for proliferation. IL-2 (100 U/ml) is also used as a control which enhances proliferation. Control antibody which does not induce proliferation of T cells is used as the negative controls for the effects of polypeptides of the invention.

[1277] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 32

Effect of Polypeptides of the Invention on the Expression of MHC Class II, Costimulatory and Adhesion Molecules and Cell Differentiation of Monocytes and Monocyte-Derived Human Dendritic Cells

[1278] Dendritic cells are generated by the expansion of proliferating precursors found in the peripheral blood: adherent PBMC or elutriated monocytic fractions are cultured for 7-10 days with GM-CSF (50 ng/ml) and IL-4 (20 ng/ml). These dendritic cells have the characteristic phenotype of immature cells (expression of CD1, CD80, CD86, CD40 and MHC class II antigens). Treatment with activating factors, such as TNF-, causes a rapid change in surface phenotype (increased expression of MHC class I and II, costimulatory and adhesion molecules, downregulation of FC(RII, upregulation of CD83). These changes correlate with increased antigen-presenting capacity and with functional maturation of the dendritic cells.

[1279] FACS analysis of surface antigens is performed as follows. Cells are treated 1-3 days with increasing concentrations of polypeptides of the invention or LPS (positive control), washed with PBS containing 1% BSA and 0.02 mM sodium azide, and then incubated with 1:20 dilution of appropriate FITC- or PE-labeled monoclonal antibodies for 30 minutes at 4 degrees C. After an additional wash, the labeled cells are analyzed by flow cytometry on a FACScan (Becton Dickinson).

[1280] Effect on the production of cytokines. Cytokines generated by dendritic cells, in particular IL-12, are important in the initiation of T-cell dependent immune responses. IL-12 strongly influences the development of Th1 helper T-cell immune response, and induces cytotoxic T and NK cell function. An ELISA is used to measure the IL-12 release as follows. Dendritic cells (106/ml) are treated with increasing concentrations of polypeptides of the invention for 24 hours. LPS (100 ng/ml) is added to the cell culture as positive control. Supernatants from the cell cultures are then collected and analyzed for IL-12 content using commercial ELISA kit(e.g., R & D Systems (Minneapolis, Minn.)). The standard protocols provided with the kits are used.

[1281] Effect on the expression of MHC Class II, costimulatory and adhesion molecules. Three major families of cell surface antigens can be identified on monocytes: adhesion molecules, molecules involved in antigen presentation, and Fc receptor. Modulation of the expression of MHC class II antigens and other costimulatory molecules, such as B7 and ICAM-1, may result in changes in the antigen presenting capacity of monocytes and ability to induce T cell activation. Increase expression of Fc receptors may correlate with improved monocyte cytotoxic activity, cytokine release and phagocytosis.

[1282] FACS analysis is used to examine the surface antigens as follows. Monocytes are treated 1-5 days with increasing concentrations of polypeptides of the invention or LPS (positive control), washed with PBS containing 1% BSA and 0.02 mM sodium azide, and then incubated with 1:20 dilution of appropriate FITC- or PE-labeled monoclonal antibodies for 30 minutes at 4 degrees C after an additional wash, the labeled cells are analyzed by flow cytometry on a FACScan (Becton Dickinson).

[1283] Monocyte activation and/or increased survival. Assays for molecules that activate (or alternatively, inactivate) monocytes and/or increase monocyte survival (or alternatively, decrease monocyte survival) are known in the art and may routinely be applied to determine whether a molecule of the invention functions as an inhibitor or activator of monocytes. Polypeptides, agonists, or antagonists of the invention can be screened using the three assays described below. For each of these assays, Peripheral blood mononuclear cells (PBMC) are purified from single donor leukopacks (American Red Cross, Baltimore, Md.) by centrifugation through a Histopaque gradient (Sigma). Monocytes are isolated from PBMC by counterflow centrifugal elutriation.

[1284] Monocyte Survival Assay. Human peripheral blood monocytes progressively lose viability when cultured in absence of serum or other stimuli. Their death results from internally regulated process (apoptosis). Addition to the culture of activating factors, such as TNF-alpha dramatically improves cell survival and prevents DNA fragmentation. Propidium iodide (PI) staining is used to measure apoptosis as follows. Monocytes are cultured for 48 hours in polypropylene tubes in serum-free medium (positive control), in the presence of 100 ng/ml TNF-alpha (negative control), and in the presence of varying concentrations of the compound to be tested. Cells are suspended at a concentration of 2×106/ml in PBS containing PI at a final concentration of 5 (g/ml, and then incubated at room temperature for 5 minutes before FACScan analysis. PI uptake has been demonstrated to correlate with DNA fragmentation in this experimental paradigm.

[1285] Effect on cytokine release. An important function of monocytes/macrophages is their regulatory activity on other cellular populations of the immune system through the release of cytokines after stimulation. An ELISA to measure cytokine release is performed as follows. Human monocytes are incubated at a density of 5×105 cells/ml with increasing concentrations of the a polypeptide of the invention and under the same conditions, but in the absence of the polypeptide. For IL-12 production, the cells are primed overnight with IFN (100 U/ml) in presence of a polypeptide of the invention. LPS (10 ng/ml) is then added. Conditioned media are collected after 24 h and kept frozen until use. Measurement of TNF-alpha, IL-10, MCP-1 and IL-8 is then performed using a commercially available ELISA kit(e.g., R & D Systems (Minneapolis, Minn.)) and applying the standard protocols provided with the kit.

[1286] Oxidative burst. Purified monocytes are plated in 96-w plate at 2-1×105 cell/well. Increasing concentrations of polypeptides of the invention are added to the wells in a total volume of 0.2 ml culture medium (RPMI 1640+10% FCS, glutamine and antibiotics). After 3 days incubation, the plates are centrifuged and the medium is removed from the wells. To the macrophage monolayers, 0.2 ml per well of phenol red solution (140 mM NaCl, 10 mM potassium phosphate buffer pH 7.0, 5.5 mM dextrose, 0.56 mM phenol red and 19 U/ml of HRPO) is added, together with the stimulant (200 nM PMA). The plates are incubated at 37(C for 2 hours and the reaction is stopped by adding 20 μl IN NaOH per well. The absorbance is read at 610 nm. To calculate the amount of H202 produced by the macrophages, a standard curve of a H202 solution of known molarity is performed for each experiment.

[1287] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 33

Biological Effects of Polypeptides of the Invention

Astrocyte and Neuronal Assays

[1288] Recombinant polypeptides of the invention, expressed in Escherichia coli and purified as described above, can be tested for activity in promoting the survival, neurite outgrowth, or phenotypic differentiation of cortical neuronal cells and for inducing the proliferation of glial fibrillary acidic protein inmiunopositive cells, astrocytes. The selection of cortical cells for the bioassay is based on the prevalent expression of FGF-1 and FGF-2 in cortical structures and on the previously reported enhancement of cortical neuronal survival resulting from FGF-2 treatment. A thymidine incorporation assay, for example, can be used to elucidate a polypeptide of the invention's activity on these cells.

[1289] Moreover, previous reports describing the biological effects of FGF-2 (basic FGF) on cortical or hippocampal neurons in vitro have demonstrated increases in both neuron survival and neurite outgrowth (Walicke et al., “Fibroblast growth factor promotes survival of dissociated hippocampal neurons and enhances neurite extension.” Proc. Natl. Acad. Sci. USA 83:3012-3016. (1986), assay herein incorporated by reference in its entirety). However, reports from experiments done on PC-12 cells suggest that these two responses are not necessarily synonymous and may depend on not only which FGF is being tested but also on which receptor(s) are expressed on the target cells. Using the primary cortical neuronal culture paradigm, the ability of a polypeptide of the invention to induce neurite outgrowth can be compared to the response achieved with FGF-2 using, for example, a thymidine incorporation assay.

Fibroblast and Endothelial Cell Assays

[1290] Human lung fibroblasts are obtained from Clonetics (San Diego, Calif.) and maintained in growth media from Clonetics. Dermal microvascular endothelial cells are obtained from Cell Applications (San Diego, Calif.). For proliferation assays, the human lung fibroblasts and dermal microvascular endothelial cells can be cultured at 5,000 cells/well in a 96-well plate for one day in growth medium. The cells are then incubated for one day in 0.1% BSA basal medium. After replacing the medium with fresh 0.1% BSA medium, the cells are incubated with the test proteins for 3 days. Alamar Blue (Alamar Biosciences, Sacramento, Calif.) is added to each well to a final concentration of 10%. The cells are incubated for 4 hr. Cell viability is measured by reading in a CytoFluor fluorescence reader. For the PGE2 assays, the human lung fibroblasts are cultured at 5,000 cells/well in a 96-well plate for one day. After a medium change to 0.1% BSA basal medium, the cells are incubated with FGF-2 or polypeptides of the invention with or without IL-1(for 24 hours. The supernatants are collected and assayed for PGE2 by EIA kit (Cayman, Ann Arbor, Mich.). For the IL-6 assays, the human lung fibroblasts are cultured at 5,000 cells/well in a 96-well plate for one day. After a medium change to 0.1% BSA basal medium, the cells are incubated with FGF-2 or with or without polypeptides of the invention IL-1(for 24 hours. The supernatants are collected and assayed for IL-6 by ELISA kit (Endogen, Cambridge, Mass.).

[1291] Human lung fibroblasts are cultured with FGF-2 or polypeptides of the invention for 3 days in basal medium before the addition of Alamar Blue to assess effects on growth of the fibroblasts. FGF-2 should show a stimulation at 10-2500 ng/ml which can be used to compare stimulation with polypeptides of the invention.

Parkinson Models

[1292] The loss of motor function in Parkinson's disease is attributed to a deficiency of striatal dopamine resulting from the degeneration of the nigrostriatal dopaminergic projection neurons. An animal model for Parkinson's that has been extensively characterized involves the systemic administration of 1-methyl-4 phenyl 1,2,3,6-tetrahydropyridine (MPTP). In the CNS, MPTP is taken-up by astrocytes and catabolized by monoamine oxidase B to 1-methyl-4-phenyl pyridine (MPP+) and released. Subsequently, MPP+ is actively accumulated in dopaminergic neurons by the high-affinity reuptake transporter for dopamine. MPP+ is then concentrated in mitochondria by the electrochemical gradient and selectively inhibits nicotidamide adenine disphosphate: ubiquinone oxidoreductionase (complex 1), thereby interfering with electron transport and eventually generating oxygen radicals.

[1293] It has been demonstrated in tissue culture paradigms that FGF-2 (basic FGF) has trophic activity towards nigral dopaminergic neurons (Ferrari et al., Dev. Biol. 1989). Recently, Dr. Unsicker's group has demonstrated that administering FGF-2 in gel foam implants in the striatum results in the near complete protection of nigral dopaminergic neurons from the toxicity associated with MPTP exposure (Otto and Unsicker, J. Neuroscience, 1990).

[1294] Based on the data with FGF-2, polypeptides of the invention can be evaluated to determine whether it has an action similar to that of FGF-2 in enhancing dopaminergic neuronal survival in vitro and it can also be tested in vivo for protection of dopaminergic neurons in the striatum from the damage associated with MPTP treatment. The potential effect of a polypeptide of the invention is first examined in vitro in a dopaminergic neuronal cell culture paradigm. The cultures are prepared by dissecting the midbrain floor plate from gestation day 14 Wistar rat embryos. The tissue is dissociated with trypsin and seeded at a density of 200,000 cells/cm2 on polyorthinine-laminin coated glass coverslips. The cells are maintained in Dulbecco's Modified Eagle's medium and F12 medium containing hormonal supplements (N1). The cultures are fixed with paraformaldehyde after 8 days in vitro and are processed for tyrosine hydroxylase, a specific mnarker for dopaminergic neurons, immunohistochemical staining. Dissociated cell cultures are prepared from embryonic rats. The culture medium is changed every third day and the factors are also added at that time.

[1295] Since the dopaminergic neurons are isolated from animals at gestation day 14, a developmental time which is past the stage when the dopaminergic precursor cells are proliferating, an increase in the number of tyrosine hydroxylase immunopositive neurons would represent an increase in the number of dopaminergic neurons surviving in vitro. Therefore, if a polypeptide of the invention acts to prolong the survival of dopaminergic neurons, it would suggest that the polypeptide may be involved in Parkinson's Disease.

[1296] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 34

The Effect of Polypeptides of the Invention on the Growth of Vascular Endothelial Cells

[1297] On day 1, human umbilical vein endothelial cells (HUVEC) are seeded at 2-5×104 cells/35 mm dish density in M199 medium containing 4% fetal bovine serum (FBS), 16 units/ml heparin, and 50 units/ml endothelial cell growth supplements (ECGS, Biotechnique, Inc.). On day 2, the medium is replaced with M199 containing 10% FBS, 8 units/ml heparin. A polypeptide having the amino acid sequence of SEQ ID NO: 2, and positive controls, such as VEGF and basic FGF (bFGF) are added, at varying concentrations. On days 4 and 6, the medium is replaced. On day 8, cell number is determined with a Coulter Counter.

[1298] An increase in the number of HUVEC cells indicates that the polypeptide of the invention may proliferate vascular endothelial cells.

[1299] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 35

Stimulatory Effect of Polypeptides of the Invention on the Proliferation of Vascular Enodthelial Cells

[1300] For evaluation of mitogenic activity of growth factors, the calorimetric MTS (3-(4,5-dimethylthiazol-2-yl)-5-(3 -carboxymethoxyphenyl)-2-(4-sulfophenyl)2H-tetrazolium) assay with the electron coupling reagent PMS (phenazine methosulfate) was performed (CellTiter 96 AQ, Promega). Cells are seeded in a 96-well plate (5,000 cells/well) in 0.1 mL, serum-supplemented medium and are allowed to attach overnight. After serum-starvation for 12 hours in 0.5% FBS, conditions (bFGF, VEGF165 or a polypeptide of the invention in 0.5% FBS) with or without Heparin (8 U/ml) are added to wells for 48 hours. 20 mg of MTS/PMS mixture (1:0.05) are added per well and allowed to incubate for 1 hour at 37° C. before measuring the absorbance at 490 nm in an ELISA plate reader. Background absorbance from control wells (some media, no cells) is subtracted, and seven wells are performed in parallel for each condition. See, Leak et al. In Vitro Cell. Dev. Biol. 30A:512-518 (1994).

[1301] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 36

Inhibition of PDGF-Induced Vascular Smooth Muscle Cell Proliferation Stimulatory Effect

[1302] HAoSMC proliferation can be measured, for example, by BrdUrd incorporation. Briefly, subconfluent, quiescent cells grown on the 4-chamber slides are transfected with CRP or FITC-labeled AT2-3LP. Then, the cells are pulsed with 10% calf serum and 6 mg/mil BrdUrd. After 24 h, immunocytochemistry is performed by using BrdUrd Staining Kit (Zymed Laboratories). In brief, the cells are incubated with the biotinylated mouse anti-BrdUrd antibody at 4 degrees C for 2 h after being exposed to denaturing solution and then incubated with the streptavidin-peroxidase and diaminobenzidine. After counterstaining with hematoxylin, the cells are mounted for microscopic examination, and the BrdUrd-positive cells are counted. The BrdUrd index is calculated as a percent of the BrdUrd-positive cells to the total cell number. In addition, the simultaneous detection of the BrdUrd staining (nucleus) and the FITC uptake (cytoplasm) is performed for individual cells by the concormtant use of bright field illumination and dark field-UV fluorescent illumination. See, Hayashida et al., J. Biol. Chem. 6:271(36):21985-21992 (1996).

[1303] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 37

Stimulation of Endothelial Migration

[1304] This example will be used to explore the possibility that a polypeptide of the invention may stimulate lymphatic endothelial cell migration.

[1305] Endothelial cell migration assays are performed using a 48 well microchemotaxis chamber (Neuroprobe Inc., Cabin John, MD; Falk, W., et al., J. Immunological Methods 1980;33:239-247). Polyvinylpyrrolidone-free polycarbonate filters with a pore size of 8 um (Nucleopore Corp. Cambridge, MA) are coated with 0.1% gelatin for at least 6 hours at room temperature and dried under sterile air. Test substances are diluted to appropriate concentrations in M199 supplemented with 0.25% bovine serum albumin (BSA), and 25 ul of the final dilution is placed in the lower chamber of the modified Boyden apparatus. Subconfluent, early passage (2-6) HUVEC or BMEC cultures are washed and trypsinized for the minimum time required to achieve cell detachment. After placing the filter between lower and upper chamber, 2.5×105 cells suspended in 50 ul M199 containing 1% FBS are seeded in the upper compartment. The apparatus is then incubated for 5 hours at 37° C. in a humidified chamber with 5% CO2 to allow cell migration. After the incubation period, the filter is removed and the upper side of the filter with the non-migrated cells is scraped with a rubber policeman. The filters are fixed with methanol and stained with a Giemsa solution (Diff-Quick, Baxter, McGraw Park, Ill.). Migration is quantified by counting cells of three random high-power fields (40×) in each well, and all groups are performed in quadruplicate.

[1306] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 38

Stimulation of Nitric Oxide Production by Endothelial Cells

[1307] Nitric oxide released by the vascular endothelium is believed to be a mediator of vascular endothelium relaxation. Thus, activity of a polypeptide of the invention can be assayed by determining nitric oxide production by endothelial cells in response to the polypeptide.

[1308] Nitric oxide is measured in 96-well plates of confluent microvascular endothelial cells after 24 hours starvation and a subsequent 4 hr exposure to various levels of a positive control (such as VEGF-1) and the polypeptide of the invention. Nitric oxide in the medium is determined by use of the Griess reagent to measure total nitrite after reduction of nitric oxide-derived nitrate by nitrate reductase. The effect of the polypeptide of the invention on nitric oxide release is examined on HUVEC.

[1309] Briefly, NO release from cultured HUVEC monolayer is measured with a NO-specific polarographic electrode connected to a NO meter (Iso-NO, World Precision Instruments Inc.) (1049). Calibration of the NO elements is performed according to the following equation:

2KNO2+2KI+2H2SO462NO+I2+2H2O+2K2SO4

[1310] The standard calibration curve is obtained by adding graded concentrations of KNO2 (0, 5, 10, 25, 50, 100, 250, and 500 nmol/L) into the calibration solution containing KI and H2S04. The specificity of the Iso-NO electrode to NO is previously determined by measurement of NO from authentic NO gas (1050). The culture medium is removed and HUVECs are washed twice with Dulbecco's phosphate buffered saline. The cells are then bathed in 5 ml of filtered Krebs-Henseleit solution in 6-well plates, and the cell plates are kept on a slide warmer (Lab Line Instruments Inc.) To maintain the temperature at 37° C. The NO sensor probe is inserted vertically into the wells, keeping the tip of the electrode 2 mm under the surface of the solution, before addition of the different conditions. S-nitroso acetyl penicillamin (SNAP) is used as a positive control. The amount of released NO is expressed as picomoles per 1×106 endothelial cells. All values reported are means of four to six measurements in each group (number of cell culture wells). See, Leak et al. Biochem. and Biophys. Res. Comm. 217:96-105 (1995).

[1311] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 39

Effect of Polypepides of the Invention on Cord Formation in Anglogenesis

[1312] Another step in angiogenesis is cord formation, marked by differentiation of endothelial cells. This bioassay measures the ability of microvascular endothelial cells to form capillary-like structures (hollow structures) when cultured in vitro.

[1313] CADMEC (microvascular endothelial cells) are purchased from Cell Applications, Inc. as proliferating (passage 2) cells and are cultured in Cell Applications' CADMEC Growth Medium and used at passage 5. For the in vitro angiogenesis assay, the wells of a 48-well cell culture plate are coated with Cell Applications' Attachment Factor Medium (200 ml/well) for 30 min. at 37° C. CADMEC are seeded onto the coated wells at 7,500 cells/well and cultured overnight in Growth Medium. The Growth Medium is then replaced with 300 mg Cell Applications' Chord Formation Medium containing control buffer or a polypeptide of the invention (0.1 to 100 ng/ml) and the cells are cultured for an additional 48 hr. The numbers and lengths of the capillary-like chords are quantitated through use of the Boeckeler VIA-170 video image analyzer. All assays are done in triplicate.

[1314] Commercial (R&D) VEGF (50 ng/ml) is used as a positive control. b-esteradiol (1 ng/ml) is used as a negative control. The appropriate buffer (without protein) is also utilized as a control.

[1315] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 40

Angiogenic Effect on Chick Chorioallantoic Membrane

[1316] Chick chorioallantoic membrane (CAM) is a well-established system to examine angiogenesis. Blood vessel formation on CAM is easily visible and quantifiable. The ability of polypeptides of the invention to stimulate angiogenesis in CAM can be examined.

[1317] Fertilized eggs of the White Leghorn chick (Gallus gallus) and the Japanese qual (Coturnix coturnix) are incubated at 37.8° C. and 80% humidity. Differentiated CAM of 16-day-old chick and 13-day-old qual embryos is studied with the following methods.

[1318] On Day 4 of development, a window is made into the egg shell of chick eggs. The embryos are checked for normal development and the eggs sealed with cellotape. They are further incubated until Day 13. Thermanox coverslips (Nunc, Naperville, Ill.) are cut into disks of about 5 mm in diameter. Sterile and salt-free growth factors are dissolved in distilled water and about 3.3 mg/5 ml are pipetted on the disks. After air-drying, the inverted disks are applied on CAM. After 3 days, the specimens are fixed in 3% glutaraldehyde and 2% formaldehyde and rinsed in 0.12 M sodium cacodylate buffer. They are photographed with a stereo microscope [Wild M8] and embedded for semi- and ultrathin sectioning as described above. Controls are performed with carrier disks alone.

[1319] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 41

Angiogenesis Assay Using a Matrigel Implant in Mouse

[1320] In vivo angiogenesis assay of a polypeptide of the invention measures the ability of an existing capillary network to form new vessels in an implanted capsule of murine extracellular matrix material (Matrigel). The protein is mixed with the liquid Matrigel at 4 degree C and the mixture is then injected subcutaneously in mice where it solidifies. After 7 days, the solid “plug” of Matrigel is removed and examined for the presence of new blood vessels. Matrigel is purchased from Becton Dickinson Labware/Collaborative Biomedical Products.

[1321] When thawed at 4 degree C the Matrigel material is a liquid. The Matrigel is mixed with a polypeptide of the invention at 150 ng/ml at 4 degrees C and drawn into cold 3 ml syringes. Female C57B1/6 mice approximately 8 weeks old are injected with the mixture of Matrigel and experimental protein at 2 sites at the midventral aspect of the abdomen (0.5 ml/site). After 7 days, the mice are sacrificed by cervical dislocation, the Matrigel plugs are removed and cleaned (i.e., all clinging membranes and fibrous tissue is removed). Replicate whole plugs are fixed in neutral buffered 10% formaldehyde, embedded in paraffin and used to produce sections for histological examination after staining with Masson's Trichrome. Cross sections from 3 different regions of each plug are processed. Selected sections are stained for the presence of vWF. The positive control for this assay is bovine basic FGF (150 ng/ml). Matrigel alone is used to determine basal levels of angiogenesis.

[1322] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 42

Rescue of Ischemia in Rabbit Lower Limb Model

[1323] To study the in vivo effects of polynucleotides and polypeptides of the invention on ischemia, a rabbit hindlimb ischemia model is created by surgical removal of one femoral arteries as described previously (Takeshita et al., Am J. Pathol 147:1649-1660 (1995)). The excision of the femoral artery results in retrograde propagation of thrombus and occlusion of the external iliac artery. Consequently, blood flow to the ischemic limb is dependent upon collateral vessels originating from the internal iliac artery (Takeshitaet al. Am J. Pathol 147:1649-1660 (1995)). An interval of 10 days is allowed for post-operative recovery of rabbits and development of endogenous collateral vessels. At 10 day post-operatively (day 0), after performing a baseline angiogram, the internal iliac artery of the ischemic limb is transfected with 500 mg naked expression plasmid containing a polynucleotide of the invention by arterial gene transfer technology using a hydrogel-coated balloon catheter as described (Riessen et al. Hum Gene Ther. 4:749-758 (1993); Leclerc et al. J. Clin. Invest. 90: 936-944 (1992)). When a polypeptide of the invention is used in the treatment, a single bolus of 500 mg polypeptide of the invention or control is delivered into the internal iliac artery of the ischemic limb over a period of 1 min. through an infusion catheter. On day 30, various parameters are measured in these rabbits: (a) BP ratio—The blood pressure ratio of systolic pressure of the ischemic limb to that of normal limb; (b) Blood Flow and Flow Reserve—Resting FL: the blood flow during undilated condition and Max FL: the blood flow during fully dilated condition (also an indirect measure of the blood vessel amount) and Flow Reserve is reflected by the ratio of max FL: resting FL; (c) Angiographic Score—This is measured by the angiogram of collateral vessels. A score is determined by the percentage of circles in an overlaying grid that with crossing opacified arteries divided by the total number m the rabbit thigh; (d) Capillary density—The number of collateral capillaries determined in light microscopic sections taken from hindlimbs.

[1324] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 43

Effect of Polypeptides of the Invention on Vasodilation

[1325] Since dilation of vascular endothelium is important in reducing blood pressure, the ability of polypeptides of the invention to affect the blood pressure in spontaneously hypertensive rats (SHR) is examined. Increasing doses (0, 10, 30, 100, 300, and 900 mg/kg) of the polypeptides of the invention are administered to 13-14 week old spontaneously hypertensive rats (SHR). Data are expressed as the mean +/− SEM. Statistical analysis are performed with a paired t-test and statistical significance is defined as p<0.05 vs. the response to buffer alone.

[1326] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 44

Rat Ischemia Skin Flap Model

[1327] The evaluation parameters include skin blood flow, skin temperature, and factor VIII immunohistochemistry or endothelial alkaline phosphatase reaction. Expression of polypeptides of the invention, during the skin ischemia, is studied using in situ hybridization.

[1328] The study in this model is divided into three parts as follows:

[1329] a) Ischemic skin

[1330] b) Ischemic skin wounds

[1331] c) Normal wounds

[1332] The experimental protocol includes:

[1333] a) Raising a 3×4 cm, single pedicle full-thickness random skin flap (myocutaneous flap over the lower back of the animal).

[1334] b) An excisional wounding (4-6 mm in diameter) in the ischemic skin (skin-flap).

[1335] c) Topical treatment with a polypeptide of the invention of the excisional wounds (day 0, 1, 2, 3, 4 post-wounding) at the following various dosage ranges: 1 mg to 100 mg.

[1336] d) Harvesting the wound tissues at day 3, 5, 7, 10, 14 and 21 post-wounding for histological, immunohistochemical, and in situ studies.

[1337] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 45

Peripheral Arterial Disease Model

[1338] Angiogenic therapy using a polypeptide of the invention is a novel therapeutic strategy to obtain restoration of blood flow around the ischemia in case of peripheral arterial diseases. The experimental protocol includes:

[1339] a) One side of the femoral artery is ligated to create ischemic muscle of the hindlimb, the other side of hindlimb serves as a control.

[1340] b) a polypeptide of the invention, in a dosage range of 20 mg-500 mg, is delivered intravenously and/or intramuscularly 3 times (perhaps more) per week for 2-3 weeks.

[1341] c) The ischemic muscle tissue is collected after ligation of the femoral artery at 1, 2, and 3 weeks for the analysis of expression of a polypeptide of the invention and histology. Biopsy is also performed on the other side of normal muscle of the contralateral hindlimb.

[1342] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 46

Ischemia Myocardial Disease Model

[1343] A polypeptide of the invention is evaluated as a potent mitogen capable of stimulating the development of collateral vessels, and restructuring new vessels after coronary artery occlusion. Alteration of expression of the polypeptide is investigated in situ. The experimental protocol includes:

[1344] a) The heart is exposed through a left-side thoracotomy in the rat. Immediately, the left coronary artery is occluded with a thin suture (6-0) and the thorax is closed.

[1345] b) a polypeptide of the invention, in a dosage range of 20 mg-500 mg, is delivered intravenously and/or intramuscularly 3 times (perhaps more) per week for 2-4 weeks.

[1346] c) Thirty days after the surgery, the heart is removed and cross-sectioned for morphometric and in situ analyzes.

[1347] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 47

Rat Corneal Wound Healing Model

[1348] This animal model shows the effect of a polypeptide of the invention on neovascularization. The experimental protocol includes:

[1349] a) Making a 1-1.5 mm long incision from the center of cornea into the stromal layer.

[1350] b) Inserting a spatula below the lip of the incision facing the outer corner of the eye.

[1351] c) Making a pocket (its base is 1-1.5 mm form the edge of the eye).

[1352] d) Positioning a pellet, containing 50ng-5ug of a polypeptide of the invention, within the pocket.

[1353] e) Treatment with a polypeptide of the invention can also be applied topically to the corneal wounds in a dosage range of 20mg-500mg (daily treatment for five days).

[1354] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

Example 48

Suppression of TNF Alpha-induced Adhesion Molecule Expression by a Polypeptide of the Invention

[1355] The recruitment of lymphocytes to areas of inflammation and angiogenesis involves specific receptor-ligand interactions between cell surface adhesion molecules (CAMs) on lymphocytes and the vascular endothelium. The adhesion process, in both normal and pathological settings, follows a multi-step cascade that involves intercellular adhesion molecule-1 (ICAM-1), vascular cell adhesion molecule-1 (VCAM-1), and endothelial leukocyte adhesion molecule-I (E-selectin) expression on endothelial cells (EC). The expression of these molecules and others on the vascular endothelium determines the efficiency with which leukocytes may adhere to the local vasculature and extravasate into the local tissue during the development of an inflammatory response. The local concentration of cytokines and growth factor participate in the modulation of the expression of these CAMs.

[1356] Tumor necrosis factor alpha (TNF-a), a potent proinflammatory cytokine, is a stimulator of all three CAMs on endothelial cells and may be involved in a wide variety of inflammatory responses, often resulting in a pathological outcome.

[1357] The potential of a polypeptide of the invention to mediate a suppression of TNF-a induced CAM expression can be examined. A modified ELISA assay which uses ECs as a solid phase absorbent is employed to measure the amount of CAM expression on TNF-a treated ECs when co-stimulated with a member of the FGF family of proteins.

[1358] To perform the experiment, human umbilical vein endothelial cell (HUVEC) cultures are obtained from pooled cord harvests and maintained in growth medium (EGM-2; Clonetics, San Diego, Calif.) supplemented with 10% FCS and 1% penicillin/streptomycin in a 37 degree C humidified incubator containing 5% C02. HUVECs are seeded in 96-well plates at concentrations of 1×104 cells/well in EGM medium at 37 degree C for 18-24 hrs or until confluent. The monolayers are subsequently washed 3 times with a serum-free solution of RPMI-1640 supplemented with 100 U/ml penicillin and 100 mg/ml streptomycin, and treated with a given cytokine and/or growth factor(s) for 24 h at 37 degree C. Following incubation, the cells are then evaluated for CAM expression.

[1359] Human Umbilical Vein Endothelial cells (HUVECs) are grown in a standard 96 well plate to confluence. Growth medium is removed from the cells and replaced with 90 ul of 199 Medium (10% FBS). Samples for testing and positive or negative controls are added to the plate in triplicate (in 10 ul volumes). Plates are incubated at 37 degree C for either 5 h (selectin and integrin expression) or 24 h (integrin expression only). Plates are aspirated to remove medium and 100 μl of 0.1% paraformaldehyde-PBS(with Ca++ and Mg++) is added to each well. Plates are held at 4oC for 30 min.

[1360] Fixative is then removed from the wells and wells are washed 1X with PBS(+Ca,Mg)+0.5% BSA and drained. Do not allow the wells to dry. Add 10 μl of diluted primary antibody to the test and control wells. Anti-ICAM-1-Biotin, Anti-VCAM-1-Biotin and Anti-E-selectin-Biotin are used at a concentration of 10 μg/ml (1:10 dilution of 0.1 mg/ml stock antibody). Cells are incubated at 37oC for 30 min. in a humidified environment. Wells are washed X3 with PBS(+Ca,Mg)+0.5% BSA.

[1361] Then add 20 μl of diluted ExtrAvidin-Alkaline Phosphatase (1:5,000 dilution) to each well and incubated at 37oC for 30 min. Wells are washed X3 with PBS(+Ca,Mg)+0.5% BSA. 1 tablet of p-Nitrophenol Phosphate pNPP is dissolved in 5 ml of glycine buffer (pH 10.4). 100 μl of pNPP substrate in glycine buffer is added to each test well. Standard wells in triplicate are prepared from the working dilution of the ExtrAvidin-Alkaline Phosphatase in glycine buffer: 1:5,000 (100)>10-0.5>10-1>10-1.5. 5 μl of each dilution is added to triplicate wells and the resulting AP content in each well is 5.50 ng, 1.74 ng, 0.55 ng, 0.18 ng. 100 μl of pNNP reagent must then be added to each of the standard wells. The plate must be incubated at 37oC for 4h. A volume of 50 μl of 3M NaOH is added to all wells. The results are quantified on a plate reader at 405 nm. The background subtraction option is used on blank wells filled with glycine buffer only. The template is set up to indicate the concentration of AP-conjugate in each standard well [5.50 ng; 1.74 ng; 0.55 ng; 0.18 ng]. Results are indicated as amount of bound AP-conjugate in each sample.

[1362] One skilled in the art could easily modify the exemplified studies to test the activity of polynucleotides of the invention (e.g., gene therapy), agonists, and/or antagonists of polynucleotides or polypeptides of the invention.

[1363] It will be clear that the invention may be practiced otherwise than as particularly described in the foregoing description and examples. Numerous modifications and variations of the present invention are possible in light of the above teachings and, therefore, are within the scope of the appended claims.

[1364] The entire disclosure of each document cited (including patents, patent applications, journal articles, abstracts, laboratory manuals, books, or other disclosures) in the Background of the Invention, Detailed Description, and Examples is hereby incorporated herein by reference. Further, the hard copy of the sequence listing submitted herewith and the corresponding computer readable form are both incorporated herein by reference in their entireties.

TABLE IV
	ATOM		Residue
ATOM	Type	Residue	Position	X Coord	Y Coord	Z Coord
1	N	LEU	43	30.285	49.116	64.675
3	CA	LEU	43	30.648	48.125	65.694
4	CB	LEU	43	29.832	48.414	66.957
5	CG	LEU	43	30.443	47.849	68.244
6	CD1	LEU	43	29.829	48.519	69.469
7	CD2	LEU	43	30.341	46.330	68.365
8	C	LEU	43	30.342	46.732	65.157
9	O	LEU	43	29.207	46.248	65.270
10	N	LYS	44	31.334	46.135	64.519
12	CA	LYS	44	31.179	44.780	63.986
13	CB	LYS	44	32.328	44.493	63.031
14	CG	LYS	44	32.358	45.517	61.904
15	CD	LYS	44	33.502	45.241	60.939
16	CE	LYS	44	34.851	45.269	61.645
17	NZ	LYS	44	35.937	44.969	60.699
18	C	LYS	44	31.172	43.764	65.120
19	O	LYS	44	32.017	43.807	66.024
20	N	TRP	45	30.192	42.883	65.085
22	CA	TRP	45	30.050	41.890	66.150
23	CB	TRP	45	28.578	41.562	66.349
24	CG	TRP	45	27.922	42.447	67.385
25	CD1	TRP	45	27.431	43.723	67.210
26	NE1	TRP	45	26.944	44.163	68.398
28	CE2	TRP	45	27.090	43.228	69.359
29	CZ2	TRP	45	26.759	43.206	70.706
30	CH2	TRP	45	27.041	42.073	71.466
31	CZ3	TRP	45	27.654	40.969	70.880
32	CE3	TRP	45	27.987	40.986	69.533
33	CD2	TRP	45	27.708	42.112	68.774
34	C	TRP	45	30.844	40.622	65.887
35	O	TRP	45	30.513	39.819	65.007
36	N	GLY	46	31.732	40.341	66.827
38	CA	GLY	46	32.579	39.143	66.759
39	C	GLY	46	31.982	37.942	67.495
40	O	GLY	46	32.721	37.037	67.901
41	N	ARG	47	30.669	37.799	67.403
43	CA	ARG	47	29.965	36.772	68.175
44	CB	ARG	47	28.517	37.206	68.369
45	CG	ARG	47	27.798	36.247	69.308
46	CD	ARG	47	26.347	36.639	69.540
47	NE	ARG	47	25.714	35.672	70.449
48	CZ	ARG	47	25.322	35.982	71.686
49	NH1	ARG	47	25.432	37.237	72.126
50	NH2	ARG	47	24.762	35.050	72.460
51	C	ARG	47	30.017	35.400	67.503
52	O	ARG	47	29.948	34.377	68.197
53	N	ALA	48	30.438	35.368	66.248
55	CA	ALA	48	30.614	34.079	65.576
56	CB	ALA	48	30.674	34.292	64.071
57	C	ALA	48	31.878	33.363	66.056
58	O	ALA	48	31.845	32.133	66.177
59	N	LEU	49	32.789	34.115	66.662
61	CA	LEU	49	34.002	33.533	67.251
62	CB	LEU	49	35.069	34.617	67.355
63	CG	LEU	49	35.471	35.172	65.995
64	CD1	LEU	49	36.383	36.383	66.156
65	CD2	LEU	49	36.135	34.107	65.129
66	C	LEU	49	33.750	32.966	68.650
67	O	LEU	49	34.620	32.297	69.218
68	N	VAL	50	32.559	33.205	69.177
70	CA	VAL	50	32.177	32.703	70.497
71	CB	VAL	50	31.381	33.814	71.183
72	CG1	VAL	50	31.047	33.479	72.633
73	CG2	VAL	50	32.144	35.134	71.123
74	C	VAL	50	31.337	31.426	70.365
75	O	VAL	50	31.055	30.742	71.359
76	N	SER	51	31.010	31.063	69.135
78	CA	SER	51	30.178	29.879	68.913
79	CB	SER	51	29.466	30.023	67.581
80	OG	SER	51	28.734	28.823	67.400
81	C	SER	51	30.977	28.579	68.907
82	O	SER	51	31.492	28.141	67.873
83	N	HIS	52	31.012	27.936	70.061
85	CA	HIS	52	31.654	26.625	70.171
86	CB	HIS	52	32.114	26.460	71.617
87	CG	HIS	52	32.800	25.147	71.938
88	ND1	HIS	52	33.545	24.397	71.104
90	CE1	HIS	52	33.986	23.305	71.761
91	NE2	HIS	52	33.507	23.365	73.024
92	CD2	HIS	52	32.774	24.494	73.148
93	C	HIS	52	30.656	25.530	69.806
94	O	HIS	52	30.986	24.565	69.108
95	N	ILE	53	29.422	25.737	70.224
97	CA	ILE	53	28.338	24.811	69.898
98	CB	ILE	53	27.383	24.836	71.098
99	CG2	ILE	53	26.209	23.873	70.957
100	CG1	ILE	53	28.156	24.505	72.369
101	CD1	ILE	53	27.234	24.434	73.580
102	C	ILE	53	27.663	25.280	68.609
103	O	ILE	53	27.455	26.486	68.439
104	N	PRO	54	27.280	24.355	67.738
105	CA	PRO	54	26.569	24.724	66.502
106	CB	PRO	54	26.447	23.446	65.730
107	CG	PRO	54	26.998	22.296	66.560
108	CD	PRO	54	27.511	22.912	67.850
109	C	PRO	54	25.187	25.358	66.729
110	O	PRO	54	24.774	26.197	65.919
111	N	ARG	55	24.606	25.175	67.907
113	CA	ARG	55	23.362	25.875	68.240
114	CB	ARG	55	22.654	25.137	69.369
115	CG	ARG	55	21.450	25.927	69.868
116	CD	ARG	55	20.473	25.039	70.622
117	NE	ARG	55	19.884	24.063	69.695
118	CZ	ARG	55	19.185	23.000	70.092
119	NH1	ARG	55	19.013	22.763	71.395
120	NH2	ARG	55	18.674	22.164	69.187
121	C	ARG	55	23.614	27.335	68.622
122	O	ARG	55	22.782	28.188	68.295
123	N	TYR	56	24.854	27.657	68.957
125	CA	TYR	56	25.224	29.053	69.197
126	CB	TYR	56	26.480	29.139	70.058
127	CG	TYR	56	26.331	28.739	71.522
128	CD1	TYR	56	27.467	28.429	72.259
129	CE1	TYR	56	27.352	28.073	73.596
130	CZ	TYR	56	26.099	28.035	74.193
131	OH	TYR	56	25.982	27.659	75.513
132	CE2	TYR	56	24.963	28.358	73.464
133	CD2	TYR	56	25.080	28.718	72.129
134	C	TYR	56	25.504	29.752	67.872
135	O	TYR	56	25.356	30.975	67.784
136	N	SER	57	25.694	28.969	66.820
138	CA	SER	57	25.859	29.532	65.480
139	CB	SER	57	26.393	28.464	64.528
140	OG	SER	57	27.535	27.852	65.110
141	C	SER	57	24.490	29.965	64.992
142	O	SER	57	24.289	31.146	64.684
143	N	LYS	58	23.521	29.103	65.257
145	CA	LYS	58	22.127	29.373	64.901
146	CB	LYS	58	21.309	28.149	65.287
147	CG	LYS	58	21.789	26.910	64.544
148	CD	LYS	58	21.219	25.645	65.172
149	CE	LYS	58	19.700	25.705	65.275
150	NZ	LYS	58	19.175	24.508	65.956
151	C	LYS	58	21.589	30.580	65.654
152	O	LYS	58	21.218	31.573	65.012
153	N	ILE	59	21.817	30.608	66.958
155	CA	ILE	59	21.321	31.710	67.789
156	CB	ILE	59	21.509	31.310	69.248
157	CG2	ILE	59	21.168	32.461	70.187
158	CG1	ILE	59	20.653	30.094	69.577
159	CD1	ILE	59	20.848	29.655	71.024
160	C	ILE	59	22.023	33.039	67.509
161	O	ILE	59	21.321	34.042	67.319
162	N	ALA	60	23.303	33.004	67.172
164	CA	ALA	60	24.011	34.250	66.865
165	CB	ALA	60	25.511	33.983	66.826
166	C	ALA	60	23.567	34.831	65.527
167	O	ALA	60	23.222	36.018	65.481
168	N	VAL	61	23.266	33.962	64.574
170	CA	VAL	61	22.823	34.419	63.255
171	CB	VAL	61	22.986	33.260	62.279
172	CG1	VAL	61	22.430	33.608	60.910
173	CG2	VAL	61	24.445	32.841	62.157
174	C	VAL	61	21.369	34.893	63.276
175	O	VAL	61	21.084	35.973	62.740
176	N	GLU	62	20.572	34.301	64.152
178	CA	GLU	62	19.180	34.733	64.312
179	CB	GLU	62	18.426	33.671	65.098
180	CG	GLU	62	18.319	32.379	64.300
181	CD	GLU	62	17.738	31.270	65.169
182	OE1	GLU	62	18.520	30.544	65.772
183	OE2	GLU	62	16.521	31.160	65.213
184	C	GLU	62	19.095	36.069	65.038
185	O	GLU	62	18.341	36.949	64.605
186	N	GLN	63	20.046	36.316	65.921
188	CA	GLN	63	20.109	37.607	66.604
189	CB	GLN	63	20.892	37.428	67.893
190	CG	GLN	63	20.152	36.501	68.848
191	CD	GLN	63	21.076	36.162	70.007
192	OE1	GLN	63	20.660	35.602	71.028
193	NE2	GLN	63	22.341	36.484	69.811
196	C	GLN	63	20.754	38.690	65.741
197	O	GLN	63	20.395	39.862	65.896
198	N	CYS	64	21.474	38.299	64.702
200	CA	CYS	64	21.974	39.281	63.736
201	CB	CYS	64	23.100	38.671	62.908
202	SG	CYS	64	24.635	38.323	63.797
203	C	CYS	64	20.851	39.735	62.812
204	O	CYS	64	20.797	40.920	62.453
205	N	GLN	65	19.852	38.882	62.647
207	CA	GLN	65	18.644	39.265	61.915
208	CB	GLN	65	17.827	38.005	61.668
209	CG	GLN	65	18.675	36.903	61.057
210	CD	GLN	65	17.922	35.578	61.100
211	OE1	GLN	65	18.505	34.503	60.913
212	NE2	GLN	65	16.665	35.663	61.498
215	C	GLN	65	17.797	40.216	62.752
216	O	GLN	65	17.414	41.288	62.268
217	N	LYS	66	17.739	39.949	64.049
219	CA	LYS	66	16.911	40.751	64.965
220	CB	LYS	66	16.741	39.950	66.249
221	CG	LYS	66	16.099	38.598	65.973
222	CD	LYS	66	16.199	37.681	67.185
223	CE	LYS	66	15.709	36.276	66.854
224	NZ	LYS	66	15.941	35.361	67.982
225	C	LYS	66	17.529	42.105	65.316
226	O	LYS	66	16.801	43.049	65.643
227	N	MET	67	18.840	42.220	65.178
229	CA	MET	67	19.520	43.505	65.370
230	CB	MET	67	20.863	43.255	66.047
231	CG	MET	67	20.685	42.676	67.447
232	SD	MET	67	19.789	43.724	68.617
233	CE	MET	67	20.914	45.139	68.654
234	C	MET	67	19.750	44.247	64.055
235	O	MET	67	20.447	45.268	64.050
236	N	THR	68	19.195	43.713	62.971
238	CA	THR	68	19.370	44.206	61.590
239	CB	THR	68	18.494	45.432	61.329
240	OG1	THR	68	18.920	46.525	62.131
241	CG2	THR	68	17.028	45.148	61.636
242	C	THR	68	20.830	44.480	61.235
243	O	THR	68	21.180	45.522	60.669
244	N	SER	69	21.660	43.496	61.536
246	CA	SER	69	23.075	43.529	61.173
247	CB	SER	69	23.929	43.300	62.414
248	OG	SER	69	23.632	42.004	62.914
249	C	SER	69	23.321	42.427	60.156
250	O	SER	69	24.421	42.269	59.616
251	N	GLY	70	22.291	41.619	59.979
253	CA	GLY	70	22.282	40.573	58.960
254	C	GLY	70	20.865	40.413	58.422
255	O	GLY	70	20.062	39.654	58.979
256	N	LEU	71	20.570	41.175	57.379
258	CA	LEU	71	19.255	41.129	56.716
259	CB	LEU	71	19.290	42.049	55.502
260	CG	LEU	71	19.631	43.483	55.892
261	CD1	LEU	71	19.871	44.343	54.656
262	CD2	LEU	71	18.546	44.093	56.776
263	C	LEU	71	18.981	39.704	56.269
264	O	LEU	71	19.816	39.163	55.542
265	N	LYS	72	17.735	39.271	56.403
267	CA	LYS	72	17.375	37.836	56.473
268	CB	LYS	72	15.873	37.793	56.736
269	CG	LYS	72	15.381	36.402	57.119
270	CD	LYS	72	13.891	36.430	57.437
271	CE	LYS	72	13.393	35.074	57.921
272	NZ	LYS	72	13.600	34.039	56.897
273	C	LYS	72	17.711	36.936	55.269
274	O	LYS	72	18.026	35.760	55.492
275	N	THR	73	17.903	37.491	54.082
277	CA	THR	73	18.284	36.651	52.936
278	CB	THR	73	18.028	37.426	51.650
279	OG1	THR	73	16.641	37.729	51.598
280	CG2	THR	73	18.379	36.600	50.417
281	C	THR	73	19.760	36.256	53.035
282	O	THR	73	20.111	35.094	52.785
283	N	GLY	74	20.524	37.130	53.670
285	CA	GLY	74	21.915	36.863	54.056
286	C	GLY	74	22.020	35.604	54.917
287	O	GLY	74	22.607	34.626	54.449
288	N	PRO	75	21.492	35.610	56.137
289	CA	PRO	75	21.474	34.402	56.980
290	CB	PRO	75	20.752	34.800	58.226
291	CG	PRO	75	20.446	36.281	58.186
292	CD	PRO	75	20.950	36.769	56.849
293	C	PRO	75	20.814	33.153	56.382
294	O	PRO	75	21.316	32.057	56.662
295	N	LEU	76	19.891	33.277	55.439
297	CA	LEU	76	19.376	32.067	54.774
298	CB	LEU	76	18.152	32.429	53.940
299	CG	LEU	76	16.991	32.902	54.806
300	CD1	LEU	76	15.840	33.402	53.941
301	CD2	LEU	76	16.523	31.803	55.754
302	C	LEU	76	20.448	31.456	53.868
303	O	LEU	76	20.756	30.262	53.992
304	N	ALA	77	21.214	32.334	53.241
306	CA	ALA	77	22.377	31.943	52.437
307	CB	ALA	77	22.641	33.034	51.405
308	C	ALA	77	23.649	31.700	53.263
309	O	ALA	77	24.706	31.434	52.683
310	N	VAL	78	23.553	31.821	54.579
312	CA	VAL	78	24.644	31.471	55.495
313	CB	VAL	78	24.735	32.560	56.562
314	CG1	VAL	78	25.420	32.091	57.841
315	CG2	VAL	78	25.397	33.817	56.013
316	C	VAL	78	24.371	30.112	56.135
317	O	VAL	78	25.296	29.319	56.356
318	N	TYR	79	23.095	29.776	56.243
320	CA	TYR	79	22.713	28.450	56.729
321	CB	TYR	79	21.280	28.493	57.249
322	CG	TYR	79	21.080	29.193	58.592
323	CD1	TYR	79	19.962	29.994	58.795
324	CE1	TYR	79	19.766	30.619	60.020
325	CZ	TYR	79	20.689	30.439	61.041
326	OH	TYR	79	20.487	31.042	62.264
327	CE2	TYR	79	21.808	29.642	60.842
328	CD2	TYR	79	22.003	29.018	59.617
329	C	TYR	79	22.804	27.422	55.609
330	O	TYR	79	23.226	26.288	55.854
331	N	SER	80	22.619	27.876	54.382
333	CA	SER	80	22.733	26.981	53.216
334	CB	SER	80	22.106	27.657	51.996
335	OG	SER	80	22.770	28.893	51.764
336	C	SER	80	24.142	26.450	52.846
337	O	SER	80	24.147	25.399	52.196
338	N	PRO	81	25.267	27.152	53.017
339	CA	PRO	81	26.557	26.453	53.009
340	CB	PRO	81	27.543	27.507	52.612
341	CG	PRO	81	26.921	28.863	52.896
342	CD	PRO	81	25.482	28.579	53.277
343	C	PRO	81	27.000	25.857	54.359
344	O	PRO	81	27.956	25.065	54.338
345	N	LEU	82	26.305	26.124	55.463
347	CA	LEU	82	26.797	25.688	56.779
348	CB	LEU	82	26.028	26.410	57.889
349	CG	LEU	82	26.804	26.558	59.198
350	CD1	LEU	82	26.075	27.507	60.145
351	CD2	LEU	82	27.083	25.229	59.892
352	C	LEU	82	26.771	24.150	56.807
353	O	LEU	82	27.865	23.596	56.683
354	N	PRO	83	25.652	23.440	56.917
355	CA	PRO	83	25.546	22.263	56.054
356	CB	PRO	83	24.290	21.574	56.497
357	CG	PRO	83	23.480	22.542	57.343
358	CD	PRO	83	24.320	23.804	57.431
359	C	PRO	83	25.437	22.764	54.611
360	O	PRO	83	24.687	23.714	54.372
361	N	PRO	84	26.064	22.110	53.646
362	CA	PRO	84	26.673	20.783	53.784
363	CB	PRO	84	26.416	20.149	52.453
364	CG	PRO	84	26.131	21.255	51.443
365	CD	PRO	84	26.043	22.538	52.250
366	C	PRO	84	28.182	20.720	54.088
367	O	PRO	84	28.753	19.642	53.880
368	N	ARG	85	28.825	21.787	54.544
370	CA	ARG	85	30.270	21.719	54.866
371	CB	ARG	85	30.723	23.054	55.461
372	CG	ARG	85	32.213	23.063	55.804
373	CD	ARG	85	33.096	22.939	54.566
374	NE	ARG	85	32.933	24.105	53.681
375	CZ	ARG	85	33.766	24.373	52.672
376	NH1	ARG	85	33.548	25.436	51.893
377	NH2	ARG	85	34.804	23.568	52.430
378	C	ARG	85	30.685	20.539	55.783
379	O	ARG	85	31.538	19.769	55.321
380	N	PRO	86	30.044	20.258	56.923
381	CA	PRO	86	30.427	19.056	57.685
382	CB	PRO	86	29.652	19.123	58.967
383	CG	PRO	86	28.708	20.308	58.932
384	CD	PRO	86	28.966	20.992	57.607
385	C	PRO	86	30.135	17.722	56.989
386	O	PRO	86	30.908	16.777	57.177
387	N	LYS	87	29.249	17.722	56.006
389	CA	LYS	87	28.900	16.487	55.312
390	CB	LYS	87	27.540	16.609	54.617
391	CG	LYS	87	26.325	16.559	55.552
392	CD	LYS	87	26.009	17.881	56.250
393	CE	LYS	87	24.752	17.773	57.103
394	NZ	LYS	87	23.580	17.473	56.265
395	C	LYS	87	29.969	16.179	54.274
396	O	LYS	87	30.411	15.029	54.201
397	N	PHE	88	30.600	17.222	53.757
399	CA	PHE	88	31.701	17.033	52.804
400	CB	PHE	88	32.033	18.357	52.123
401	CG	PHE	88	30.919	18.992	51.299
402	CD1	PHE	88	29.966	18.206	50.663
403	CE1	PHE	88	28.960	18.805	49.918
404	CZ	PHE	88	28.915	20.188	49.799
405	CE2	PHE	88	29.873	20.973	50.426
406	CD2	PHE	88	30.876	20.374	51.175
407	C	PHE	88	32.956	16.554	53.521
408	O	PHE	88	33.618	15.625	53.041
409	N	CYS	89	33.107	16.971	54.768
411	CA	CYS	89	34.255	16.538	55.567
412	CB	CYS	89	34.350	17.457	56.776
413	SG	CYS	89	35.707	17.114	57.917
414	C	CYS	89	34.108	15.090	56.035
415	O	CYS	89	35.087	14.330	56.008
416	N	LEU	90	32.870	14.655	56.208
418	CA	LEU	90	32.615	13.261	56.579
419	CB	LEU	90	31.274	13.191	57.298
420	CG	LEU	90	31.312	13.977	58.604
421	CD1	LEU	90	29.923	14.088	59.221
422	CD2	LEU	90	32.302	13.365	59.592
423	C	LEU	90	32.606	12.332	55.365
424	O	LEU	90	33.047	11.184	55.485
425	N	LEU	91	32.360	12.886	54.186
427	CA	LEU	91	32.432	12.104	52.942
428	CB	LEU	91	31.526	12.744	51.895
429	CG	LEU	91	30.055	12.635	52.280
430	CD1	LEU	91	29.179	13.437	51.324
431	CD2	LEU	91	29.605	11.180	52.342
432	C	LEU	91	33.857	12.022	52.393
433	O	LEU	91	34.133	11.224	51.490
434	N	GLY	92	34.752	12.808	52.968
436	CA	GLY	92	36.178	12.694	52.660
437	C	GLY	92	36.898	11.921	53.763
438	O	GLY	92	38.093	11.624	53.640
439	N	ALA	93	36.153	11.612	54.818
441	CA	ALA	93	36.646	10.870	55.987
442	CB	ALA	93	36.974	9.436	55.581
443	C	ALA	93	37.863	11.537	56.610
444	O	ALA	93	38.922	10.918	56.772
445	N	LEU	94	37.711	12.809	56.931
447	CA	LEU	94	38.823	13.544	57.528
448	CB	LEU	94	38.669	15.021	57.196
449	CG	LEU	94	38.730	15.219	55.683
450	CD1	LEU	94	38.388	16.649	55.287
451	CD2	LEU	94	40.093	14.817	55.127
452	C	LEU	94	38.866	13.293	59.028
453	O	LEU	94	37.863	13.453	59.734
454	N	LEU	95	40.064	13.004	59.511
456	CA	LEU	95	40.255	12.569	60.904
457	CB	LEU	95	41.563	11.794	60.993
458	CG	LEU	95	41.489	10.499	60.190
459	CD1	LEU	95	42.841	9.795	60.158
460	CD2	LEU	95	40.411	9.570	60.742
461	C	LEU	95	40.251	13.696	61.940
462	O	LEU	95	40.282	13.415	63.143
463	N	ALA	96	40.175	14.940	61.497
465	CA	ALA	96	39.934	16.042	62.437
466	CB	ALA	96	41.095	17.023	62.327
467	C	ALA	96	38.624	16.775	62.126
468	O	ALA	96	38.650	18.013	62.054
469	N	PRO	97	37.485	16.093	62.205
470	CA	PRO	97	36.334	16.531	61.410
471	CB	PRO	97	35.338	15.413	61.481
472	CG	PRO	97	35.871	14.318	62.391
473	CD	PRO	97	37.242	14.788	62.844
474	C	PRO	97	35.749	17.827	61.947
475	O	PRO	97	36.016	18.903	61.395
476	N	ILE	98	35.279	17.748	63.181
478	CA	ILE	98	34.607	18.878	63.821
479	CB	ILE	98	33.809	18.317	64.995
480	CG2	ILE	98	32.981	19.403	65.674
481	CG1	ILE	98	32.900	17.190	64.520
482	CD1	ILE	98	32.102	16.595	65.675
483	C	ILE	98	35.583	19.948	64.312
484	O	ILE	98	35.192	21.115	64.389
485	N	ARG	99	36.868	19.637	64.356
487	CA	ARG	99	37.829	20.629	64.832
488	CB	ARG	99	39.081	19.902	65.304
489	CG	ARG	99	38.729	18.937	66.430
490	CD	ARG	99	39.967	18.298	67.048
491	NE	ARG	99	40.690	17.452	66.087
492	CZ	ARG	99	41.196	16.264	66.427
493	NH1	ARG	99	40.996	15.785	67.656
494	NH2	ARG	99	41.869	15.539	65.532
495	C	ARG	99	38.165	21.619	63.723
496	O	ARG	99	38.009	22.832	63.919
497	N	VAL	100	38.297	21.099	62.513
499	CA	VAL	100	38.595	21.964	61.371
500	CB	VAL	100	39.245	21.103	60.295
501	CG1	VAL	100	39.573	21.923	59.057
502	CG2	VAL	100	40.508	20.439	60.829
503	C	VAL	100	37.315	22.606	60.843
504	O	VAL	100	37.313	23.793	60.484
505	N	LEU	101	36.211	21.919	61.083
507	CA	LEU	101	34.884	22.423	60.713
508	CB	LEU	101	33.879	21.311	60.984
509	CG	LEU	101	33.383	20.597	59.732
510	CD1	LEU	101	34.369	20.639	58.571
511	CD2	LEU	101	32.986	19.167	60.075
512	C	LEU	101	34.503	23.628	61.556
513	O	LEU	101	34.263	24.707	61.002
514	N	LEU	102	34.725	23.515	62.855
516	CA	LEU	102	34.366	24.579	63.789
517	CB	LEU	102	34.568	24.020	65.198
518	CG	LEU	102	33.799	24.746	66.301
519	CD1	LEU	102	33.650	23.831	67.508
520	CD2	LEU	102	34.434	26.072	66.710
521	C	LEU	102	35.256	25.792	63.563
522	O	LEU	102	34.722	26.879	63.314
523	N	ALA	103	36.538	25.549	63.344
525	CA	ALA	103	37.481	26.651	63.140
526	CB	ALA	103	38.887	26.071	63.046
527	C	ALA	103	37.178	27.456	61.879
528	O	ALA	103	36.919	28.665	61.978
529	N	PHE	104	36.949	26.771	60.771
531	CA	PHE	104	36.747	27.494	59.514
532	CB	PHE	104	37.114	26.586	58.348
533	CG	PHE	104	38.617	26.371	58.198
534	CD1	PHE	104	39.104	25.173	57.695
535	CE1	PHE	104	40.473	24.981	57.560
536	CZ	PHE	104	41.355	25.990	57.923
537	CE2	PHE	104	40.869	27.194	58.416
538	CD2	PHE	104	39.500	27.385	58.550
539	C	PHE	104	35.333	28.034	59.340
540	O	PHE	104	35.194	29.150	58.826
541	N	ILE	105	34.346	27.422	59.973
543	CA	ILE	105	32.982	27.946	59.855
544	CB	ILE	105	31.988	26.833	60.181
545	CG2	ILE	105	30.585	27.388	60.400
546	CG1	ILE	105	31.971	25.781	59.075
547	CD1	ILE	105	31.508	26.378	57.749
548	C	ILE	105	32.774	29.144	60.775
549	O	ILE	105	32.261	30.172	60.315
550	N	VAL	106	33.454	29.136	61.908
552	CA	VAL	106	33.350	30.250	62.850
553	CB	VAL	106	33.870	29.743	64.192
554	CG1	VAL	106	34.462	30.832	65.071
555	CG2	VAL	106	32.795	28.951	64.926
556	C	VAL	106	34.128	31.474	62.372
557	O	VAL	106	33.578	32.585	62.388
558	N	LEU	107	35.222	31.237	61.666
560	CA	LEU	107	36.001	32.358	61.146
561	CB	LEU	107	37.420	31.872	60.882
562	CG	LEU	107	38.334	33.014	60.455
563	CD1	LEU	107	38.363	34.117	61.510
564	CD2	LEU	107	39.743	32.505	60.173
565	C	LEU	107	35.397	32.917	59.859
566	O	LEU	107	35.240	34.140	59.751
567	N	PHE	108	34.820	32.050	59.041
569	CA	PHE	108	34.264	32.504	57.765
570	CB	PHE	108	34.176	31.321	56.807
571	CG	PHE	108	33.662	31.680	55.415
572	CD1	PHE	108	34.426	32.486	54.581
573	CE1	PHE	108	33.960	32.817	53.315
574	CZ	PHE	108	32.729	32.343	52.883
575	CE2	PHE	108	31.962	31.539	53.718
576	CD2	PHE	108	32.428	31.208	54.984
577	C	PHE	108	32.886	33.130	57.926
578	O	PHE	108	32.541	34.022	57.146
579	N	LEU	109	32.178	32.797	58.993
581	CA	LEU	109	30.904	33.468	59.238
582	CB	LEU	109	29.939	32.533	59.953
583	CG	LEU	109	29.560	31.355	59.062
584	CD1	LEU	109	28.564	30.444	59.770
585	CD2	LEU	109	28.991	31.830	57.728
586	C	LEU	109	31.115	34.746	60.036
587	O	LEU	109	30.375	35.715	59.829
588	N	LEU	110	32.251	34.850	60.707
590	CA	LEU	110	32.579	36.107	61.374
591	CB	LEU	110	33.723	35.870	62.355
592	CG	LEU	110	33.895	37.045	63.311
593	CD1	LEU	110	34.846	38.122	62.793
594	CD2	LEU	110	32.540	37.617	63.701
595	C	LEU	110	32.969	37.119	60.308
596	O	LEU	110	32.453	38.249	60.312
597	N	TRP	111	33.648	36.627	59.284
599	CA	TRP	111	33.929	37.445	58.110
600	CB	TRP	111	34.773	36.646	57.129
601	CG	TRP	111	36.238	36.517	57.512
602	CD1	TRP	111	37.026	35.400	57.344
603	NE1	TRP	111	38.273	35.679	57.800
605	CE2	TRP	111	38.354	36.939	58.264
606	CZ2	TRP	111	39.390	37.672	58.820
607	CH2	TRP	111	39.174	38.987	59.213
608	CZ3	TRP	111	37.923	39.572	59.053
609	CE3	TRP	111	36.877	38.844	58.498
610	CD2	TRP	111	37.085	37.529	58.106
611	C	TRP	111	32.630	37.926	57.478
612	O	TRP	111	32.510	39.140	57.265
613	N	PRO	112	31.712	37.003	57.186
614	CA	PRO	112	30.958	38.130	56.546
615	CB	PRO	112	30.501	37.634	55.192
616	CG	PRO	112	30.494	36.148	55.364
617	CD	PRO	112	30.456	36.291	56.850
618	C	PRO	112	29.834	38.838	57.377
619	O	PRO	112	29.187	39.718	56.798
620	N	PHE	113	29.761	38.682	58.701
622	CA	PHE	113	28.875	39.543	59.494
623	CB	PHE	113	28.620	38.932	60.870
624	CG	PHE	113	27.983	37.548	60.868
625	CD1	PHE	113	26.937	37.252	60.004
626	CE1	PHE	113	26.379	35.981	60.001
627	CZ	PHE	113	26.857	35.009	60.871
628	CE2	PHE	113	27.881	35.315	61.757
629	CD2	PHE	113	28.437	36.587	61.762
630	C	PHE	113	29.577	40.882	59.681
631	O	PHE	113	28.977	41.936	59.421
632	N	ALA	114	30.896	40.805	59.755
634	CA	ALA	114	31.717	42.010	59.841
635	CB	ALA	114	33.129	41.597	60.238
636	C	ALA	114	31.756	42.750	58.506
637	O	ALA	114	31.569	43.972	58.499
638	N	TRP	115	31.665	42.003	57.415
640	CA	TRP	115	31.651	42.602	56.076
641	CB	TRP	115	32.046	41.518	55.072
642	CG	TRP	115	32.498	42.017	53.711
643	CD1	TRP	115	33.803	42.203	53.310
644	NE1	TRP	115	33.801	42.677	52.038
646	CE2	TRP	115	32.545	42.810	51.572
647	CZ2	TRP	115	32.033	43.305	50.382
648	CH2	TRP	115	30.659	43.319	50.175
649	CZ3	TRP	115	29.795	42.853	51.160
650	CE3	TRP	115	30.300	42.378	52.365
651	CD2	TRP	115	31.670	42.369	52.579
652	C	TRP	115	30.269	43.157	55.714
653	O	TRP	115	30.177	44.077	54.896
654	N	LEU	116	29.228	42.721	56.406
656	CA	LEU	116	27.897	43.280	56.151
657	CB	LEU	116	26.852	42.245	56.571
658	CG	LEU	116	25.477	42.463	55.932
659	CD1	LEU	116	24.604	43.486	56.652
660	CD2	LEU	116	25.587	42.763	54.441
661	C	LEU	116	27.722	44.573	56.943
662	O	LEU	116	27.066	45.512	56.472
663	N	GLN	117	28.427	44.680	58.056
665	CA	GLN	117	28.352	45.912	58.839
666	CB	GLN	117	28.664	45.580	60.289
667	CG	GLN	117	27.680	44.548	60.828
668	CD	GLN	117	27.953	44.338	62.308
669	OE1	GLN	117	28.566	43.342	62.717
670	NE2	GLN	117	27.510	45.304	63.092
673	C	GLN	117	29.325	46.961	58.310
674	O	GLN	117	29.032	48.162	58.353
675	N	VAL	118	30.446	46.504	57.778
677	CA	VAL	118	31.380	47.386	57.068
678	CB	VAL	118	32.638	47.614	57.909
679	CG1	VAL	118	33.668	48.445	57.149
680	CG2	VAL	118	32.309	48.291	59.236
681	C	VAL	118	31.746	46.756	55.726
682	O	VAL	118	32.657	45.922	55.633
683	N	ALA	119	31.004	47.149	54.704
685	CA	ALA	119	31.227	46.619	53.355
686	CB	ALA	119	30.041	46.999	52.475
687	C	ALA	119	32.519	47.137	52.734
688	O	ALA	119	32.712	48.344	52.540
689	N	GLY	120	33.398	46.201	52.424
691	CA	GLY	120	34.664	46.531	51.763
692	C	GLY	120	34.473	46.655	50.255
693	O	GLY	120	34.213	45.663	49.563
694	N	LEU	121	34.568	47.883	49.773
696	CA	LEU	121	34.408	48.169	48.341
697	CB	LEU	121	34.365	49.686	48.165
698	CG	LEU	121	34.167	50.096	46.708
699	CD1	LEU	121	32.839	49.575	46.167
700	CD2	LEU	121	34.246	51.610	46.555
701	C	LEU	121	35.557	47.595	47.513
702	O	LEU	121	36.703	48.056	47.596
703	N	SER	122	35.229	46.596	46.709
705	CA	SER	122	36.205	46.007	45.788
706	CB	SER	122	35.684	44.661	45.302
707	OG	SER	122	36.610	44.174	44.338
708	C	SER	122	36.431	46.916	44.588
709	O	SER	122	35.595	47.007	43.683
710	N	GLU	123	37.568	47.586	44.599
712	CA	GLU	123	37.915	48.500	43.511
713	CB	GLU	123	38.813	49.604	44.049
714	CG	GLU	123	38.075	50.426	45.099
715	CD	GLU	123	38.959	51.576	45.565
716	OE1	GLU	123	38.412	52.596	45.959
717	OE2	GLU	123	40.169	51.431	45.456
718	C	GLU	123	38.587	47.761	42.364
719	O	GLU	123	38.693	46.525	42.368
720	N	GLU	124	39.046	48.529	41.390
722	CA	GLU	124	39.613	47.910	40.191
723	CB	GLU	124	39.698	48.866	38.984
724	CG	GLU	124	40.442	50.195	39.149
725	CD	GLU	124	39.500	51.294	39.632
726	OE1	GLU	124	38.702	51.749	38.828
727	OE2	GLU	124	39.401	51.419	40.847
728	C	GLU	124	40.938	47.217	40.500
729	O	GLU	124	40.955	45.990	40.407
730	N	GLN	125	41.878	47.882	41.156
732	CA	GLN	125	43.153	47.213	41.472
733	CB	GLN	125	44.329	48.150	41.206
734	CG	GLN	125	44.355	48.706	39.784
735	CD	GLN	125	44.349	47.600	38.729
736	OE1	GLN	125	43.338	47.422	38.040
737	NE2	GLN	125	45.478	46.934	38.563
740	C	GLN	125	43.195	46.759	42.932
741	O	GLN	125	43.870	47.371	43.767
742	N	LEU	126	42.481	45.685	43.219
744	CA	LEU	126	42.415	45.152	44.584
745	CB	LEU	126	41.046	44.496	44.727
746	CG	LEU	126	40.690	44.174	46.170
747	CD1	LEU	126	40.729	45.433	47.030
748	CD2	LEU	126	39.314	43.526	46.236
749	C	LEU	126	43.549	44.150	44.851
750	O	LEU	126	43.722	43.178	44.107
751	N	GLN	127	44.342	44.452	45.871
753	CA	GLN	127	45.497	43.626	46.277
754	CB	GLN	127	46.715	44.557	46.326
755	CG	GLN	127	48.043	43.887	46.694
756	CD	GLN	127	48.433	42.790	45.701
757	OE1	GLN	127	47.930	41.661	45.784
758	NE2	GLN	127	49.370	43.112	44.826
761	C	GLN	127	45.230	42.965	47.640
762	O	GLN	127	44.630	43.594	48.520
763	N	GLU	128	45.718	41.741	47.812
765	CA	GLU	128	45.404	40.916	48.999
766	CB	GLU	128	46.111	39.553	48.933
767	CG	GLU	128	47.582	39.536	49.350
768	CD	GLU	128	48.525	39.779	48.181
769	OE1	GLU	128	49.294	40.727	48.257
770	OE2	GLU	128	48.601	38.900	47.331
771	C	GLU	128	45.696	41.581	50.347
772	O	GLU	128	46.783	42.112	50.606
773	N	PRO	129	44.653	41.631	51.157
774	CA	PRO	129	44.780	41.985	52.568
775	CB	PRO	129	43.382	42.276	53.011
776	CG	PRO	129	42.422	41.806	51.929
777	CD	PRO	129	43.287	41.250	50.813
778	C	PRO	129	45.393	40.845	53.379
779	O	PRO	129	44.836	39.743	53.496
780	N	ILE	130	46.610	41.104	53.823
782	CA	ILE	130	47.334	40.191	54.710
783	CB	ILE	130	48.548	39.636	53.973
784	CG2	ILE	130	48.127	38.689	52.857
785	CG1	ILE	130	49.419	40.759	53.423
786	CD1	ILE	130	50.617	40.206	52.660
787	C	ILE	130	47.789	40.919	55.973
788	O	ILE	130	48.540	40.370	56.789
789	N	THR	131	47.308	42.142	56.135
791	CA	THR	131	47.789	43.025	57.213
792	CB	THR	131	47.633	44.481	56.771
793	OG1	THR	131	46.269	44.741	56.455
794	CG2	THR	131	48.459	44.769	55.522
795	C	THR	131	47.064	42.775	58.536
796	O	THR	131	46.101	43.466	58.893
797	N	GLY	132	47.556	41.788	59.267
799	CA	GLY	132	46.914	41.368	60.520
800	C	GLY	132	45.882	40.299	60.186
801	O	GLY	132	46.051	39.114	60.499
802	N	TRP	133	44.796	40.746	59.581
804	CA	TRP	133	43.826	39.827	58.996
805	CB	TRP	133	42.515	40.574	58.773
806	CG	TRP	133	41.985	41.290	60.003
807	CD1	TRP	133	41.688	42.631	60.096
808	NE1	TRP	133	41.243	42.886	61.352
810	CE2	TRP	133	41.228	41.772	62.103
811	CZ2	TRP	133	40.865	41.523	63.417
812	CH2	TRP	133	40.958	40.236	63.931
813	CZ3	TRP	133	41.411	39.191	63.131
814	CE3	TRP	133	41.777	39.429	61.811
815	CD2	TRP	133	41.687	40.710	61.293
816	C	TRP	133	44.382	39.340	57.663
817	O	TRP	133	44.520	40.115	56.707
818	N	ARG	134	44.813	38.092	57.653
820	CA	ARG	134	45.366	37.504	56.435
821	CB	ARG	134	46.689	36.830	56.776
822	CG	ARG	134	47.395	36.298	55.534
823	CD	ARG	134	48.776	35.761	55.885
824	NE	ARG	134	49.586	36.813	56.521
825	CZ	ARG	134	50.713	37.294	55.993
826	NH1	ARG	134	51.152	36.832	54.820
827	NH2	ARG	134	51.392	38.251	56.629
828	C	ARG	134	44.387	36.503	55.841
829	O	ARG	134	44.488	35.289	56.063
830	N	LYS	135	43.565	36.995	54.931
832	CA	LYS	135	42.555	36.124	54.329
833	CB	LYS	135	41.333	36.935	53.929
834	CG	LYS	135	41.695	38.152	53.094
835	CD	LYS	135	40.462	39.018	52.883
836	CE	LYS	135	39.878	39.489	54.213
837	NZ	LYS	135	40.847	40.297	54.977
838	C	LYS	135	43.102	35.311	53.161
839	O	LYS	135	42.438	34.362	52.726
840	N	THR	136	44.371	35.510	52.837
842	CA	THR	136	45.044	34.657	51.855
843	CB	THR	136	46.456	35.186	51.624
844	OG1	THR	136	46.358	36.493	51.072
845	CG2	THR	136	47.225	34.314	50.638
846	C	THR	136	45.120	33.222	52.364
847	O	THR	136	44.531	32.326	51.746
848	N	VAL	137	45.508	33.073	53.622
850	CA	VAL	137	45.620	31.728	54.186
851	CB	VAL	137	46.687	31.713	55.276
852	CG1	VAL	137	48.055	32.041	54.689
853	CG2	VAL	137	46.353	32.661	56.422
854	C	VAL	137	44.282	31.212	54.717
855	O	VAL	137	44.130	29.996	54.877
856	N	CYS	138	43.275	32.069	54.768
858	CA	CYS	138	41.944	31.616	55.165
859	CB	CYS	138	41.171	32.786	55.760
860	SG	CYS	138	39.479	32.406	56.268
861	C	CYS	138	41.193	31.060	53.960
862	O	CYS	138	40.569	29.998	54.076
863	N	HIS	139	41.476	31.602	52.785
865	CA	HIS	139	40.859	31.092	51.558
866	CB	HIS	139	41.025	32.154	50.472
867	CG	HIS	139	40.333	31.872	49.149
868	ND1	HIS	139	39.282	31.060	48.933
870	CE1	HIS	139	38.959	31.082	47.623
871	NE2	HIS	139	39.819	31.922	47.004
872	CD2	HIS	139	40.669	32.417	47.933
873	C	HIS	139	41.534	29.784	51.155
874	O	HIS	139	40.828	28.793	50.907
875	N	ASN	140	42.830	29.710	51.423
877	CA	ASN	140	43.581	28.467	51.213
878	CB	ASN	140	45.066	28.742	51.438
879	CG	ASN	140	45.629	29.678	50.373
880	OD1	ASN	140	45.095	29.773	49.264
881	ND2	ASN	140	46.772	30.265	50.683
884	C	ASN	140	43.147	27.379	52.192
885	O	ASN	140	42.841	26.262	51.766
886	N	GLY	141	42.927	27.759	53.439
888	CA	GLY	141	42.511	26.809	54.474
889	C	GLY	141	41.124	26.218	54.242
890	O	GLY	141	41.001	25.001	54.042
891	N	VAL	142	40.127	27.079	54.106
893	CA	VAL	142	38.737	26.610	54.015
894	CB	VAL	142	37.805	27.819	54.054
895	CG1	VAL	142	36.345	27.394	53.926
896	CG2	VAL	142	38.002	28.638	55.324
897	C	VAL	142	38.465	25.822	52.738
898	O	VAL	142	37.875	24.738	52.809
899	N	LEU	143	39.088	26.212	51.639
901	CA	LEU	143	38.819	25.505	50.384
902	CB	LEU	143	38.820	26.486	49.215
903	CG	LEU	143	37.484	27.222	49.038
904	CD1	LEU	143	36.313	26.252	49.156
905	CD2	LEU	143	37.283	28.388	50.003
906	C	LEU	143	39.796	24.348	50.165
907	O	LEU	143	39.465	23.378	49.471
908	N	GLY	144	40.843	24.327	50.973
910	CA	GLY	144	41.769	23.195	51.028
911	C	GLY	144	41.117	22.022	51.748
912	O	GLY	144	41.282	20.872	51.325
913	N	LEU	145	40.201	22.345	52.650
915	CA	LEU	145	39.397	21.346	53.367
916	CB	LEU	145	38.636	22.120	54.445
917	CG	LEU	145	37.691	21.264	55.280
918	CD1	LEU	145	38.457	20.210	56.071
919	CD2	LEU	145	36.870	22.141	56.218
920	C	LEU	145	38.400	20.604	52.459
921	O	LEU	145	37.982	19.489	52.796
922	N	SER	146	38.117	21.136	51.279
924	CA	SER	146	37.242	20.419	50.348
925	CB	SER	146	36.233	21.384	49.739
926	OG	SER	146	36.937	22.288	48.900
927	C	SER	146	38.024	19.727	49.226
928	O	SER	146	37.405	19.078	48.376
929	N	ARG	147	39.340	19.868	49.199
931	CA	ARG	147	40.133	19.211	48.149
932	CB	ARG	147	41.373	20.040	47.830
933	CG	ARG	147	41.073	21.092	46.775
934	CD	ARG	147	42.323	21.840	46.325
935	NE	ARG	147	42.845	22.725	47.378
936	CZ	ARG	147	44.116	22.705	47.785
937	NH1	ARG	147	44.935	21.741	47.361
938	NH2	ARG	147	44.536	23.581	48.700
939	C	ARG	147	40.584	17.809	48.530
940	O	ARG	147	41.267	17.606	49.541
941	N	LEU	148	40.242	16.851	47.686
943	CA	LEU	148	40.802	15.510	47.860
944	CB	LEU	148	39.866	14.484	47.239
945	CG	LEU	148	40.186	13.086	47.750
946	CD1	LEU	148	40.298	13.085	49.271
947	CD2	LEU	148	39.130	12.090	47.292
948	C	LEU	148	42.186	15.481	47.211
949	O	LEU	148	42.321	15.326	45.991
950	N	LEU	149	43.201	15.451	48.062
952	CA	LEU	149	44.585	15.684	47.625
953	CB	LEU	149	45.435	15.897	48.875
954	CG	LEU	149	46.877	16.272	48.541
955	CD1	LEU	149	46.934	17.560	47.728
956	CD2	LEU	149	47.708	16.412	49.812
957	C	LEU	149	45.187	14.560	46.779
958	O	LEU	149	45.858	14.868	45.790
959	N	PHE	150	44.725	13.332	46.952
961	CA	PHE	150	45.247	12.245	46.106
962	CB	PHE	150	45.268	10.917	46.866
963	CG	PHE	150	43.932	10.336	47.330
964	CD1	PHE	150	43.463	10.606	48.609
965	CE1	PHE	150	42.258	10.064	49.036
966	CZ	PHE	150	41.527	9.242	48.187
967	CE2	PHE	150	42.005	8.958	46.915
968	CD2	PHE	150	43.210	9.500	46.489
969	C	PHE	150	44.498	12.121	44.772
970	O	PHE	150	44.812	11.244	43.960
971	N	PHE	151	43.503	12.971	44.571
973	CA	PHE	151	42.827	13.091	43.279
974	CB	PHE	151	41.343	12.802	43.434
975	CG	PHE	151	41.003	11.315	43.431
976	CD1	PHE	151	39.988	10.831	44.244
977	CE1	PHE	151	39.673	9.479	44.235
978	CZ	PHE	151	40.373	8.609	43.410
979	CE2	PHE	151	41.387	9.093	42.593
980	CD2	PHE	151	41.701	10.446	42.603
981	C	PHE	151	43.062	14.478	42.683
982	O	PHE	151	42.320	14.918	41.793
983	N	LEU	152	43.978	15.209	43.297
985	CA	LEU	152	44.461	16.465	42.728
986	CB	LEU	152	45.080	17.291	43.856
987	CG	LEU	152	45.647	18.628	43.388
988	CD1	LEU	152	44.551	19.534	42.845
989	CD2	LEU	152	46.378	19.330	44.526
990	C	LEU	152	45.517	16.107	41.692
991	O	LEU	152	46.459	15.374	42.007
992	N	LEU	153	45.316	16.506	40.450
994	CA	LEU	153	46.308	16.159	39.433
995	CB	LEU	153	45.673	15.205	38.430
996	CG	LEU	153	46.729	14.504	37.581
997	CD1	LEU	153	47.666	13.674	38.450
998	CD2	LEU	153	46.076	13.620	36.533
999	C	LEU	153	46.853	17.398	38.730
1000	O	LEU	153	46.120	18.157	38.087
1001	N	GLY	154	48.160	17.555	38.830
1003	CA	GLY	154	48.851	18.673	38.195
1004	C	GLY	154	49.167	18.417	36.723
1005	O	GLY	154	48.957	17.319	36.189
1006	N	PHE	155	49.814	19.411	36.148
1008	CA	PHE	155	50.077	19.511	34.710
1009	CB	PHE	155	49.724	20.940	34.310
1010	CG	PHE	155	50.137	22.038	35.305
1011	CD1	PHE	155	51.454	22.178	35.726
1012	CE1	PHE	155	51.793	23.162	36.644
1013	CZ	PHE	155	50.823	24.028	37.125
1014	CE2	PHE	155	49.517	23.920	36.677
1015	CD2	PHE	155	49.177	22.931	35.765
1016	C	PHE	155	51.510	19.277	34.257
1017	O	PHE	155	51.809	19.641	33.111
1018	N	LEU	156	52.363	18.731	35.113
1020	CA	LEU	156	53.813	18.731	34.866
1021	CB	LEU	156	54.165	18.057	33.538
1022	CG	LEU	156	55.654	18.144	33.218
1023	CD1	LEU	156	56.485	17.385	34.247
1024	CD2	LEU	156	55.940	17.629	31.811
1025	C	LEU	156	54.283	20.182	34.897
1026	O	LEU	156	54.229	20.925	33.906
1027	N	ARG	157	54.875	20.523	36.027
1029	CA	ARG	157	55.198	21.913	36.382
1030	CB	ARG	157	55.389	21.956	37.888
1031	CG	ARG	157	56.234	20.786	38.364
1032	CD	ARG	157	56.087	20.608	39.871
1033	NE	ARG	157	56.546	19.274	40.286
1034	CZ	ARG	157	55.737	18.211	40.329
1035	NH1	ARG	157	56.192	17.045	40.793
1036	NH2	ARG	157	54.453	18.334	39.984
1037	C	ARG	157	56.387	22.576	35.684
1038	O	ARG	157	56.684	23.737	35.990
1039	N	ILE	158	56.912	21.981	34.627
1041	CA	ILE	158	57.971	22.662	33.883
1042	CB	ILE	158	58.795	21.645	33.092
1043	CG2	ILE	158	57.945	20.884	32.079
1044	CG1	ILE	158	59.979	22.314	32.401
1045	CD1	ILE	158	60.916	22.966	33.415
1046	C	ILE	158	57.361	23.734	32.973
1047	O	ILE	158	58.001	24.771	32.757
1048	N	ARG	159	56.053	23.654	32.757
1050	CA	ARG	159	55.380	24.703	31.997
1051	CB	ARG	159	54.058	24.165	31.461
1052	CG	ARG	159	53.379	25.133	30.489
1053	CD	ARG	159	54.157	25.310	29.183
1054	NE	ARG	159	54.870	26.599	29.126
1055	CZ	ARG	159	56.192	26.699	28.969
1056	NH1	ARG	159	56.780	27.895	29.022
1057	NH2	ARG	159	56.935	25.598	28.835
1058	C	ARG	159	55.125	25.940	32.860
1059	O	ARG	159	55.219	27.065	32.356
1060	N	VAL	160	55.054	25.772	34.171
1062	CA	VAL	160	54.892	26.962	35.007
1063	CB	VAL	160	53.937	26.718	36.165
1064	CG1	VAL	160	52.527	26.492	35.641
1065	CG2	VAL	160	54.386	25.586	37.079
1066	C	VAL	160	56.236	27.487	35.493
1067	O	VAL	160	56.333	28.672	35.826
1068	N	ARG	161	57.288	26.702	35.324
1070	CA	ARG	161	58.626	27.232	35.574
1071	CB	ARG	161	59.593	26.082	35.807
1072	CG	ARG	161	60.973	26.631	36.129
1073	CD	ARG	161	61.952	25.532	36.517
1074	NE	ARG	161	63.204	26.123	37.015
1075	CZ	ARG	161	63.479	26.257	38.315
1076	NH1	ARG	161	64.590	26.888	38.699
1077	NH2	ARG	161	62.607	25.828	39.231
1078	C	ARG	161	59.068	28.058	34.372
1079	O	ARG	161	59.567	29.179	34.541
1080	N	GLY	162	58.619	27.633	33.200
1082	CA	GLY	162	58.791	28.418	31.975
1083	C	GLY	162	57.985	29.711	32.059
1084	O	GLY	162	58.527	30.796	31.819
1085	N	GLN	163	56.773	29.603	32.580
1087	CA	GLN	163	55.905	30.765	32.805
1088	CB	GLN	163	54.577	30.219	33.317
1089	CG	GLN	163	53.561	31.315	33.592
1090	CD	GLN	163	52.210	30.696	33.940
1091	OE1	GLN	163	51.338	31.352	34.519
1092	NE2	GLN	163	52.036	29.448	33.542
1095	C	GLN	163	56.467	31.766	33.822
1096	O	GLN	163	56.433	32.972	33.552
1097	N	ARG	164	57.191	31.286	34.822
1099	CA	ARG	164	57.783	32.184	35.819
1100	CB	ARG	164	58.081	31.382	37.077
1101	CG	ARG	164	58.580	32.289	38.195
1102	CD	ARG	164	59.704	31.614	38.969
1103	NE	ARG	164	60.829	31.325	38.064
1104	CZ	ARG	164	61.446	30.145	38.002
1105	NH1	ARG	164	61.066	29.153	38.806
1106	NH2	ARG	164	62.446	29.958	37.140
1107	C	ARG	164	59.078	32.815	35.311
1108	O	ARG	164	59.372	33.973	35.633
1109	N	ALA	165	59.722	32.154	34.364
1111	CA	ALA	165	60.882	32.754	33.702
1112	CB	ALA	165	61.700	31.647	33.050
1113	C	ALA	165	60.436	33.769	32.648
1114	O	ALA	165	61.106	34.791	32.447
1115	N	SER	166	59.204	33.620	32.186
1117	CA	SER	166	58.608	34.605	31.283
1118	CB	SER	166	57.394	33.988	30.597
1119	OG	SER	166	57.822	32.827	29.898
1120	C	SER	166	58.177	35.840	32.066
1121	O	SER	166	58.509	36.949	31.627
1122	N	ARG	167	57.869	35.627	33.339
1124	CA	ARG	167	57.507	36.698	34.282
1125	CB	ARG	167	56.976	36.066	35.559
1126	CG	ARG	167	55.582	35.473	35.439
1127	CD	ARG	167	55.199	34.893	36.795
1128	NE	ARG	167	53.790	34.491	36.860
1129	CZ	ARG	167	53.410	33.230	37.056
1130	NH1	ARG	167	54.316	32.254	37.005
1131	NH2	ARG	167	52.115	32.934	37.182
1132	C	ARG	167	58.667	37.599	34.711
1133	O	ARG	167	58.440	38.588	35.415
1134	N	LEU	168	59.875	37.340	34.239
1136	CA	LEU	168	60.987	38.238	34.551
1137	CB	LEU	168	62.295	37.497	34.296
1138	CG	LEU	168	62.412	36.251	35.171
1139	CD1	LEU	168	63.645	35.435	34.797
1140	CD2	LEU	168	62.433	36.608	36.655
1141	C	LEU	168	60.929	39.519	33.710
1142	O	LEU	168	61.580	40.511	34.058
1143	N	GLN	169	60.127	39.518	32.655
1145	CA	GLN	169	59.870	40.754	31.907
1146	CB	GLN	169	60.913	40.915	30.804
1147	CG	GLN	169	60.627	42.123	29.910
1148	CD	GLN	169	60.097	41.659	28.554
1149	OE1	GLN	169	58.928	41.870	28.200
1150	NE2	GLN	169	60.965	40.974	27.832
1153	C	GLN	169	58.468	40.748	31.309
1154	O	GLN	169	57.700	41.699	31.489
1155	N	ALA	170	58.111	39.612	30.741
1157	CA	ALA	170	56.864	39.478	30.001
1158	CB	ALA	170	56.982	38.230	29.134
1159	C	ALA	170	55.678	39.331	30.937
1160	O	ALA	170	55.772	38.640	31.959
1161	N	PRO	171	54.656	40.126	30.671
1162	CA	PRO	171	53.310	39.811	31.140
1163	CB	PRO	171	52.456	40.950	30.680
1164	CG	PRO	171	53.274	41.846	29.764
1165	CD	PRO	171	54.665	41.241	29.722
1166	C	PRO	171	52.838	38.486	30.546
1167	O	PRO	171	52.886	38.264	29.327
1168	N	VAL	172	52.425	37.596	31.426
1170	CA	VAL	172	51.977	36.272	30.989
1171	CB	VAL	172	52.606	35.231	31.911
1172	CG1	VAL	172	52.236	33.817	31.475
1173	CG2	VAL	172	54.122	35.387	31.960
1174	C	VAL	172	50.457	36.141	31.036
1175	O	VAL	172	49.844	36.326	32.090
1176	N	LEU	173	49.856	35.843	29.899
1178	CA	LEU	173	48.429	35.511	29.860
1179	CB	LEU	173	47.874	35.592	28.435
1180	CG	LEU	173	47.430	36.992	28.008
1181	CD1	LEU	173	46.563	37.619	29.091
1182	CD2	LEU	173	48.589	37.915	27.642
1183	C	LEU	173	48.226	34.095	30.382
1184	O	LEU	173	48.848	33.137	29.901
1185	N	VAL	174	47.349	33.991	31.362
1187	CA	VAL	174	47.041	32.708	31.998
1188	CB	VAL	174	47.335	32.846	33.489
1189	CG1	VAL	174	47.078	31.541	34.229
1190	CG2	VAL	174	48.764	33.317	33.734
1191	C	VAL	174	45.569	32.361	31.780
1192	O	VAL	174	44.679	32.868	32.472
1193	N	ALA	175	45.314	31.482	30.829
1195	CA	ALA	175	43.927	31.157	30.480
1196	CB	ALA	175	43.805	31.127	28.962
1197	C	ALA	175	43.438	29.828	31.053
1198	O	ALA	175	43.251	28.870	30.299
1199	N	ALA	176	43.226	29.773	32.357
1201	CA	ALA	176	42.670	28.563	32.983
1202	CB	ALA	176	43.469	28.289	34.251
1203	C	ALA	176	41.179	28.719	33.326
1204	O	ALA	176	40.846	29.381	34.314
1205	N	PRO	177	40.330	28.019	32.578
1206	CA	PRO	177	38.865	28.220	32.567
1207	CB	PRO	177	38.312	27.137	31.700
1208	CG	PRO	177	39.461	26.486	30.955
1209	CD	PRO	177	40.730	27.115	31.501
1210	C	PRO	177	38.164	28.272	33.923
1211	O	PRO	177	38.633	27.724	34.931
1212	N	HIS	178	37.005	28.915	33.896
1214	CA	HIS	178	36.262	29.251	35.112
1215	CB	HIS	178	35.526	30.566	34.868
1216	CG	HIS	178	35.015	31.273	36.111
1217	ND1	HIS	178	35.338	31.011	37.392
1219	CE1	HIS	178	34.689	31.871	38.203
1220	NE2	HIS	178	33.945	32.687	37.422
1221	CD2	HIS	178	34.134	32.330	36.132
1222	C	HIS	178	35.265	28.159	35.459
1223	O	HIS	178	34.049	28.318	35.277
1224	N	SER	179	35.772	27.091	36.045
1226	CA	SER	179	34.894	25.984	36.397
1227	CB	SER	179	35.727	24.726	36.661
1228	OG	SER	179	36.611	24.915	37.761
1229	C	SER	179	34.043	26.354	37.607
1230	O	SER	179	32.813	26.241	37.543
1231	N	THR	180	34.666	27.043	38.549
1233	CA	THR	180	34.018	27.414	39.809
1234	CB	THR	180	34.286	26.307	40.823
1235	OG1	THR	180	35.674	26.005	40.742
1236	CG2	THR	180	33.522	25.027	40.527
1237	C	THR	180	34.610	28.698	40.375
1238	O	THR	180	35.707	29.117	39.986
1239	N	PHE	181	34.047	29.110	41.499
1241	CA	PHE	181	34.586	30.250	42.268
1242	CB	PHE	181	33.479	30.772	43.176
1243	CG	PHE	181	32.189	31.127	42.444
1244	CD1	PHE	181	32.181	32.130	41.484
1245	CE1	PHE	181	31.004	32.453	40.822
1246	CZ	PHE	181	29.835	31.768	41.118
1247	CE2	PHE	181	29.843	30.762	42.075
1248	CD2	PHE	181	31.018	30.439	42.737
1249	C	PHE	181	35.792	29.827	43.121
1250	O	PHE	181	36.581	30.658	43.583
1251	N	PHE	182	36.022	28.524	43.111
1253	CA	PHE	182	37.123	27.831	43.779
1254	CB	PHE	182	36.579	26.407	43.880
1255	CG	PHE	182	37.406	25.331	44.563
1256	CD1	PHE	182	38.307	24.567	43.832
1257	CE1	PHE	182	39.038	23.569	44.461
1258	CZ	PHE	182	38.855	23.328	45.816
1259	CE2	PHE	182	37.944	24.080	46.542
1260	CD2	PHE	182	37.215	25.079	45.914
1261	C	PHE	182	38.430	27.844	42.964
1262	O	PHE	182	39.494	27.504	43.497
1263	N	ASP	183	38.385	28.402	41.762
1265	CA	ASP	183	39.531	28.338	40.830
1266	CB	ASP	183	39.173	29.078	39.545
1267	CG	ASP	183	38.132	28.315	38.730
1268	OD1	ASP	183	37.832	27.177	39.071
1269	OD2	ASP	183	37.549	28.923	37.846
1270	C	ASP	183	40.912	28.853	41.299
1271	O	ASP	183	41.882	28.196	40.912
1272	N	PRO	184	41.084	29.923	42.077
1273	CA	PRO	184	42.466	30.339	42.379
1274	CB	PRO	184	42.339	31.707	42.972
1275	CG	PRO	184	40.878	32.040	43.202
1276	CD	PRO	184	40.101	30.871	42.631
1277	C	PRO	184	43.248	29.447	43.358
1278	O	PRO	184	44.484	29.470	43.325
1279	N	ILE	185	42.585	28.570	44.095
1281	CA	ILE	185	43.292	27.844	45.161
1282	CB	ILE	185	42.540	28.049	46.481
1283	CG2	ILE	185	42.838	29.433	47.045
1284	CG1	ILE	185	41.031	27.857	46.361
1285	CD1	ILE	185	40.622	26.394	46.262
1286	C	ILE	185	43.582	26.363	44.870
1287	O	ILE	185	43.536	25.542	45.792
1288	N	VAL	186	44.022	26.052	43.660
1290	CA	VAL	186	44.215	24.638	43.287
1291	CB	VAL	186	44.030	24.484	41.778
1292	CG1	VAL	186	43.889	23.012	41.385
1293	CG2	VAL	186	42.797	25.249	41.316
1294	C	VAL	186	45.581	24.083	43.727
1295	O	VAL	186	45.669	23.434	44.775
1296	N	LEU	187	46.624	24.309	42.941
1298	CA	LEU	187	47.919	23.665	43.224
1299	CB	LEU	187	48.739	23.518	41.949
1300	CG	LEU	187	48.256	22.356	41.089
1301	CD1	LEU	187	49.119	22.223	39.840
1302	CD2	LEU	187	48.282	21.050	41.875
1303	C	LEU	187	48.761	24.382	44.271
1304	O	LEU	187	48.856	25.616	44.307
1305	N	LEU	188	49.475	23.562	45.024
1307	CA	LEU	188	50.336	24.041	46.115
1308	CB	LEU	188	50.610	22.969	47.194
1309	CG	LEU	188	49.438	22.266	47.896
1310	CD1	LEU	188	48.352	23.228	48.354
1311	CD2	LEU	188	48.840	21.113	47.091
1312	C	LEU	188	51.696	24.580	45.615
1313	O	LEU	188	51.911	25.787	45.751
1314	N	PRO	189	52.609	23.761	45.084
1315	CA	PRO	189	54.038	24.116	45.153
1316	CB	PRO	189	54.719	22.817	45.418
1317	CG	PRO	189	53.810	21.699	44.948
1318	CD	PRO	189	52.473	22.356	44.654
1319	C	PRO	189	54.642	24.703	43.875
1320	O	PRO	189	55.761	24.311	43.513
1321	N	CYS	190	53.933	25.575	43.179
1323	CA	CYS	190	54.447	26.111	41.923
1324	CB	CYS	190	53.262	26.536	41.072
1325	SG	CYS	190	52.098	25.221	40.646
1326	C	CYS	190	55.391	27.273	42.219
1327	O	CYS	190	54.978	28.420	42.453
1328	N	ASP	191	56.667	26.953	42.071
1330	CA	ASP	191	57.779	27.794	42.539
1331	CB	ASP	191	57.931	29.049	41.689
1332	CG	ASP	191	59.179	29.802	42.145
1333	OD1	ASP	191	60.253	29.381	41.748
1334	OD2	ASP	191	59.050	30.702	42.966
1335	C	ASP	191	57.529	28.173	43.993
1336	O	ASP	191	56.914	29.214	44.280
1337	N	LEU	192	57.866	27.241	44.877
1339	CA	LEU	192	57.590	27.404	46.311
1340	CB	LEU	192	58.259	28.690	46.832
1341	CG	LEU	192	59.758	28.579	47.121
1342	CD1	LEU	192	60.615	28.835	45.882
1343	CD2	LEU	192	60.134	29.597	48.190
1344	C	LEU	192	56.059	27.399	46.472
1345	O	LEU	192	55.379	27.067	45.498
1346	N	PRO	193	55.495	27.650	47.646
1347	CA	PRO	193	54.050	27.944	47.689
1348	CB	PRO	193	53.717	27.951	49.153
1349	CG	PRO	193	54.993	27.888	49.978
1350	CD	PRO	193	56.124	27.758	48.975
1351	C	PRO	193	53.639	29.291	47.052
1352	O	PRO	193	52.438	29.513	46.841
1353	N	LYS	194	54.607	30.068	46.583
1355	CA	LYS	194	54.405	31.479	46.264
1356	CB	LYS	194	55.757	32.172	46.273
1357	CG	LYS	194	56.366	32.180	47.666
1358	CD	LYS	194	57.610	33.056	47.704
1359	CE	LYS	194	58.224	33.111	49.097
1360	NZ	LYS	194	59.449	33.928	49.084
1361	C	LYS	194	53.751	31.769	44.928
1362	O	LYS	194	52.637	31.301	44.655
1363	N	VAL	195	54.560	32.385	44.076
1365	CA	VAL	195	54.140	33.203	42.920
1366	CB	VAL	195	55.446	33.814	42.396
1367	CG1	VAL	195	56.485	32.746	42.077
1368	CG2	VAL	195	55.264	34.751	41.209
1369	C	VAL	195	53.362	32.521	41.779
1370	O	VAL	195	52.759	33.223	40.956
1371	N	VAL	196	53.281	31.202	41.745
1373	CA	VAL	196	52.486	30.574	40.689
1374	CB	VAL	196	53.385	29.634	39.890
1375	CG1	VAL	196	52.808	29.351	38.510
1376	CG2	VAL	196	54.799	30.186	39.745
1377	C	VAL	196	51.289	29.831	41.302
1378	O	VAL	196	50.494	29.196	40.599
1379	N	SER	197	51.151	29.948	42.611
1381	CA	SER	197	50.093	29.235	43.332
1382	CB	SER	197	50.743	28.341	44.356
1383	OG	SER	197	51.287	27.296	43.586
1384	C	SER	197	49.101	30.129	44.043
1385	O	SER	197	48.815	31.257	43.629
1386	N	ARG	198	48.566	29.575	45.117
1388	CA	ARG	198	47.503	30.235	45.879
1389	CB	ARG	198	46.552	29.148	46.349
1390	CG	ARG	198	46.786	27.832	45.618
1391	CD	ARG	198	46.893	26.679	46.610
1392	NE	ARG	198	48.091	26.860	47.443
1393	CZ	ARG	198	48.099	26.745	48.771
1394	NH1	ARG	198	49.233	26.934	49.446
1395	NH2	ARG	198	46.977	26.434	49.421
1396	C	ARG	198	48.021	30.941	47.127
1397	O	ARG	198	47.271	31.660	47.801
1398	N	ALA	199	49.285	30.740	47.456
1400	CA	ALA	199	49.759	31.291	48.723
1401	CB	ALA	199	50.777	30.345	49.344
1402	C	ALA	199	50.356	32.682	48.571
1403	O	ALA	199	50.257	33.486	49.506
1404	N	GLU	200	50.924	32.989	47.413
1406	CA	GLU	200	51.499	34.331	47.222
1407	CB	GLU	200	52.924	34.392	47.780
1408	CG	GLU	200	52.999	34.674	49.280
1409	CD	GLU	200	52.282	35.984	49.616
1410	OE1	GLU	200	52.086	36.772	48.694
1411	OE2	GLU	200	52.056	36.231	50.790
1412	C	GLU	200	51.572	34.805	45.775
1413	O	GLU	200	51.816	34.024	44.857
1414	N	ASN	201	51.550	36.121	45.631
1416	CA	ASN	201	51.844	36.762	44.345
1417	CB	ASN	201	50.924	37.972	44.144
1418	CG	ASN	201	51.511	39.291	44.659
1419	OD1	ASN	201	52.408	39.885	44.039
1420	ND2	ASN	201	50.905	39.800	45.711
1423	C	ASN	201	53.319	37.184	44.315
1424	O	ASN	201	53.826	37.706	43.312
1425	N	LEU	202	53.988	36.990	45.437
1427	CA	LEU	202	55.392	37.389	45.557
1428	CB	LEU	202	55.744	37.569	47.031
1429	CG	LEU	202	54.714	38.331	47.855
1430	CD1	LEU	202	55.094	38.272	49.330
1431	CD2	LEU	202	54.560	39.778	47.411
1432	C	LEU	202	56.336	36.307	45.059
1433	O	LEU	202	56.275	35.162	45.519
1434	N	SER	203	57.252	36.690	44.192
1436	CA	SER	203	58.418	35.842	43.959
1437	CB	SER	203	58.875	35.903	42.508
1438	OG	SER	203	59.571	37.124	42.324
1439	C	SER	203	59.509	36.376	44.872
1440	O	SER	203	59.420	37.524	45.326
1441	N	VAL	204	60.540	35.579	45.095
1443	CA	VAL	204	61.627	35.983	46.003
1444	CB	VAL	204	62.721	34.914	45.979
1445	CG1	VAL	204	63.814	35.211	47.002
1446	CG2	VAL	204	62.125	33.534	46.236
1447	C	VAL	204	62.178	37.403	45.724
1448	O	VAL	204	62.074	38.225	46.641
1449	N	PRO	205	62.663	37.754	44.533
1450	CA	PRO	205	63.113	39.138	44.326
1451	CB	PRO	205	64.097	39.035	43.201
1452	CG	PRO	205	63.876	37.717	42.478
1453	CD	PRO	205	62.877	36.945	43.322
1454	C	PRO	205	62.038	40.181	43.948
1455	O	PRO	205	62.407	41.357	43.860
1456	N	VAL	206	60.769	39.825	43.768
1458	CA	VAL	206	59.833	40.814	43.182
1459	CB	VAL	206	60.232	41.043	41.713
1460	CG1	VAL	206	60.269	39.760	40.889
1461	CG2	VAL	206	59.378	42.098	41.013
1462	C	VAL	206	58.338	40.454	43.295
1463	O	VAL	206	57.894	39.340	42.986
1464	N	ILE	207	57.585	41.428	43.782
1466	CA	ILE	207	56.112	41.377	43.865
1467	CB	ILE	207	55.732	42.509	44.825
1468	CG2	ILE	207	54.246	42.507	45.178
1469	CG1	ILE	207	56.570	42.424	46.096
1470	CD1	ILE	207	56.237	43.553	47.065
1471	C	ILE	207	55.477	41.662	42.494
1472	O	ILE	207	56.018	42.472	41.732
1473	N	GLY	208	54.377	41.002	42.166
1475	CA	GLY	208	53.661	41.367	40.940
1476	C	GLY	208	52.978	40.203	40.228
1477	O	GLY	208	52.842	40.235	38.998
1478	N	ALA	209	52.574	39.187	40.964
1480	CA	ALA	209	51.874	38.066	40.328
1481	CB	ALA	209	52.565	36.752	40.647
1482	C	ALA	209	50.405	37.977	40.722
1483	O	ALA	209	49.862	38.861	41.395
1484	N	LEU	210	49.782	36.917	40.227
1486	CA	LEU	210	48.362	36.591	40.456
1487	CB	LEU	210	48.137	36.079	41.881
1488	CG	LEU	210	48.378	34.576	42.053
1489	CD1	LEU	210	47.767	33.791	40.896
1490	CD2	LEU	210	49.850	34.216	42.215
1491	C	LEU	210	47.441	37.780	40.213
1492	O	LEU	210	46.941	38.389	41.168
1493	N	LEU	211	47.201	38.087	38.950
1495	CA	LEU	211	46.314	39.201	38.611
1496	CB	LEU	211	47.147	40.340	38.033
1497	CG	LEU	211	48.008	41.011	39.101
1498	CD1	LEU	211	48.930	42.056	38.489
1499	CD2	LEU	211	47.143	41.636	40.192
1500	C	LEU	211	45.237	38.752	37.629
1501	O	LEU	211	45.415	38.779	36.406
1502	N	ARG	212	44.126	38.296	38.176
1504	CA	ARG	212	43.032	37.835	37.316
1505	CB	ARG	212	42.410	36.583	37.927
1506	CG	ARG	212	41.589	36.877	39.174
1507	CD	ARG	212	41.190	35.598	39.898
1508	NE	ARG	212	40.541	34.620	39.012
1509	CZ	ARG	212	40.976	33.362	38.915
1510	NH1	ARG	212	40.266	32.459	38.237
1511	NH2	ARG	212	42.053	32.979	39.603
1512	C	ARG	212	41.966	38.908	37.130
1513	O	ARG	212	41.742	39.740	38.015
1514	N	PHE	213	41.338	38.888	35.967
1516	CA	PHE	213	40.173	39.734	35.686
1517	CB	PHE	213	39.997	39.867	34.177
1518	CG	PHE	213	40.920	40.836	33.453
1519	CD1	PHE	213	41.188	42.084	33.995
1520	CE1	PHE	213	42.009	42.973	33.316
1521	CZ	PHE	213	42.560	42.615	32.093
1522	CE2	PHE	213	42.289	41.366	31.550
1523	CD2	PHE	213	41.468	40.478	32.231
1524	C	PHE	213	38.905	39.068	36.203
1525	O	PHE	213	38.050	38.698	35.391
1526	N	ASN	214	38.729	39.041	37.514
1528	CA	ASN	214	37.661	38.232	38.107
1529	CB	ASN	214	37.832	38.243	39.625
1530	CG	ASN	214	36.800	39.135	40.304
1531	OD1	ASN	214	36.765	40.357	40.111
1532	ND2	ASN	214	35.934	38.487	41.059
1535	C	ASN	214	36.281	38.739	37.693
1536	O	ASN	214	36.091	39.939	37.461
1537	N	GLN	215	35.381	37.805	37.437
1539	CA	GLN	215	33.994	38.159	37.110
1540	CB	GLN	215	33.304	36.898	36.595
1541	CG	GLN	215	31.904	37.193	36.076
1542	CD	GLN	215	31.994	38.238	34.970
1543	OE1	GLN	215	31.505	39.362	35.128
1544	NE2	GLN	215	32.635	37.868	33.874
1547	C	GLN	215	33.313	38.667	38.377
1548	O	GLN	215	32.921	37.866	39.235
1549	N	ALA	216	33.159	39.974	38.491
1551	CA	ALA	216	32.863	40.526	39.808
1552	CB	ALA	216	33.981	41.483	40.179
1553	C	ALA	216	31.564	41.281	40.005
1554	O	ALA	216	30.637	40.769	40.644
1555	N	ILE	217	31.558	42.513	39.530
1557	CA	ILE	217	30.682	43.543	40.110
1558	CB	ILE	217	31.020	44.884	39.491
1559	CG2	ILE	217	32.533	45.102	39.479
1560	CG1	ILE	217	30.472	44.978	38.081
1561	CD1	ILE	217	30.672	46.388	37.555
1562	C	ILE	217	29.177	43.344	40.041
1563	O	ILE	217	28.633	42.644	39.181
1564	N	LEU	218	28.584	43.801	41.131
1566	CA	LEU	218	27.152	44.091	41.269
1567	CB	LEU	218	26.727	45.077	40.189
1568	CG	LEU	218	27.301	46.462	40.469
1569	CD1	LEU	218	26.934	47.449	39.368
1570	CD2	LEU	218	26.835	46.977	41.827
1571	C	LEU	218	26.188	42.911	41.308
1572	O	LEU	218	26.385	41.878	40.654
1573	N	VAL	219	25.010	43.300	41.777
1575	CA	VAL	219	23.824	42.462	42.057
1576	CB	VAL	219	22.815	42.688	40.922
1577	CG1	VAL	219	21.387	42.357	41.358
1578	CG2	VAL	219	22.849	44.140	40.454
1579	C	VAL	219	24.134	40.972	42.257
1580	O	VAL	219	24.610	40.582	43.326
1581	N	SER	220	23.901	40.161	41.238
1583	CA	SER	220	23.974	38.703	41.411
1584	CB	SER	220	22.928	38.036	40.529
1585	OG	SER	220	23.353	38.175	39.185
1586	C	SER	220	25.332	38.088	41.083
1587	O	SER	220	25.437	36.856	41.059
1588	N	ARG	221	26.340	38.891	40.792
1590	CA	ARG	221	27.646	38.311	40.466
1591	CB	ARG	221	28.396	39.236	39.520
1592	CG	ARG	221	27.684	39.486	38.189
1593	CD	ARG	221	27.764	38.332	37.188
1594	NE	ARG	221	26.788	37.259	37.454
1595	CZ	ARG	221	25.735	37.009	36.672
1596	NH1	ARG	221	25.529	37.737	35.571
1597	NH2	ARG	221	24.898	36.015	36.980
1598	C	ARG	221	28.468	38.010	41.721
1599	O	ARG	221	27.946	37.983	42.841
1600	N	HIS	222	29.762	37.818	41.524
1602	CA	HIS	222	30.634	37.300	42.587
1603	CB	HIS	222	31.873	36.774	41.871
1604	CG	HIS	222	32.776	35.819	42.622
1605	ND1	HIS	222	33.815	35.151	42.089
1607	CE1	HIS	222	34.391	34.386	43.039
1608	NE2	HIS	222	33.706	34.579	44.188
1609	CD2	HIS	222	32.708	35.458	43.946
1610	C	HIS	222	31.030	38.377	43.603
1611	O	HIS	222	31.274	38.085	44.781
1612	N	ASP	223	30.948	39.633	43.204
1614	CA	ASP	223	31.274	40.732	44.121
1615	CB	ASP	223	32.693	41.233	43.851
1616	CG	ASP	223	33.738	40.128	43.978
1617	OD1	ASP	223	34.289	39.981	45.057
1618	OD2	ASP	223	34.043	39.542	42.949
1619	C	ASP	223	30.321	41.912	43.941
1620	O	ASP	223	30.561	42.759	43.072
1621	N	PRO	224	29.420	42.113	44.887
1622	CA	PRO	224	29.277	41.266	46.072
1623	CB	PRO	224	28.776	42.225	47.108
1624	CG	PRO	224	28.161	43.425	46.393
1625	CD	PRO	224	28.485	43.237	44.919
1626	C	PRO	224	28.256	40.141	45.903
1627	O	PRO	224	27.058	40.411	45.752
1628	N	ALA	225	28.706	38.912	46.093
1630	CA	ALA	225	27.806	37.756	46.144
1631	CB	ALA	225	28.598	36.512	45.783
1632	C	ALA	225	27.235	37.577	47.545
1633	O	ALA	225	27.699	36.713	48.307
1634	N	SER	226	26.231	38.394	47.843
1636	CA	SER	226	25.554	38.473	49.154
1637	CB	SER	226	24.395	37.477	49.179
1638	OG	SER	226	24.895	36.171	48.915
1639	C	SER	226	26.492	38.221	50.331
1640	O	SER	226	26.308	37.241	51.061
1641	N	ARG	227	27.483	39.099	50.470
1643	CA	ARG	227	28.626	39.082	51.435
1644	CB	ARG	227	28.124	39.533	52.813
1645	CG	ARG	227	27.331	38.481	53.586
1646	CD	ARG	227	26.743	39.062	54.862
1647	NE	ARG	227	26.153	38.022	55.717
1648	CZ	ARG	227	24.924	38.103	56.230
1649	NH1	ARG	227	24.534	37.223	57.152
1650	NH2	ARG	227	24.145	39.146	55.938
1651	C	ARG	227	29.504	37.809	51.579
1652	O	ARG	227	30.708	37.968	51.826
1653	N	ARG	228	29.025	36.639	51.186
1655	CA	ARG	228	29.719	35.375	51.443
1656	CB	ARG	228	28.755	34.249	51.083
1657	CG	ARG	228	29.399	32.875	51.227
1658	CD	ARG	228	28.500	31.785	50.664
1659	NE	ARG	228	29.227	30.508	50.601
1660	CZ	ARG	228	29.235	29.729	49.518
1661	NH1	ARG	228	28.533	30.079	48.437
1662	NH2	ARG	228	29.922	28.584	49.525
1663	C	ARG	228	30.997	35.233	50.630
1664	O	ARG	228	32.098	35.309	51.193
1665	N	ARG	229	30.871	35.287	49.315
1667	CA	ARG	229	32.051	35.049	48.482
1668	CB	ARG	229	31.614	34.487	47.141
1669	CG	ARG	229	30.897	33.156	47.325
1670	CD	ARG	229	30.718	32.424	46.000
1671	NE	ARG	229	29.977	33.235	45.022
1672	CZ	ARG	229	28.727	32.960	44.642
1673	NH1	ARG	229	28.071	31.939	45.197
1674	NH2	ARG	229	28.123	33.721	43.726
1675	C	ARG	229	32.920	36.289	48.294
1676	O	ARG	229	34.112	36.148	47.991
1677	N	VAL	230	32.445	37.424	48.781
1679	CA	VAL	230	33.207	38.655	48.605
1680	CB	VAL	230	32.293	39.843	48.825
1681	CG1	VAL	230	32.667	40.970	47.871
1682	CG2	VAL	230	30.848	39.432	48.633
1683	C	VAL	230	34.312	38.743	49.637
1684	O	VAL	230	35.441	39.089	49.278
1685	N	VAL	231	34.076	38.171	50.809
1687	CA	VAL	231	35.082	38.274	51.865
1688	CB	VAL	231	34.395	38.190	53.225
1689	CG1	VAL	231	33.823	36.802	53.496
1690	CG2	VAL	231	35.352	38.606	54.336
1691	C	VAL	231	36.197	37.233	51.710
1692	O	VAL	231	37.305	37.454	52.212
1693	N	GLU	232	36.001	36.252	50.841
1695	CA	GLU	232	37.101	35.333	50.532
1696	CB	GLU	232	36.578	33.903	50.364
1697	CG	GLU	232	35.717	33.731	49.116
1698	CD	GLU	232	35.194	32.302	49.010
1699	OE1	GLU	232	35.829	31.419	49.571
1700	OE2	GLU	232	34.090	32.145	48.506
1701	C	GLU	232	37.835	35.787	49.268
1702	O	GLU	232	38.875	35.222	48.913
1703	N	GLU	233	37.341	36.845	48.643
1705	CA	GLU	233	37.942	37.318	47.405
1706	CB	GLU	233	36.993	37.010	46.258
1707	CG	GLU	233	37.735	36.995	44.928
1708	CD	GLU	233	36.742	36.785	43.801
1709	OE1	GLU	233	35.625	37.253	43.938
1710	OE2	GLU	233	37.116	36.181	42.802
1711	C	GLU	233	38.261	38.815	47.460
1712	O	GLU	233	38.427	39.448	46.409
1713	N	VAL	234	38.625	39.298	48.641
1715	CA	VAL	234	39.061	40.704	48.790
1716	CB	VAL	234	38.885	41.142	50.245
1717	CG1	VAL	234	38.959	42.659	50.390
1718	CG2	VAL	234	37.557	40.671	50.809
1719	C	VAL	234	40.534	40.874	48.373
1720	O	VAL	234	41.119	41.957	48.486
1721	N	ARG	235	41.116	39.808	47.853
1723	CA	ARG	235	42.512	39.807	47.460
1724	CB	ARG	235	43.044	38.409	47.730
1725	CG	ARG	235	42.690	37.927	49.128
1726	CD	ARG	235	43.427	36.636	49.455
1727	NE	ARG	235	43.074	35.525	48.555
1728	CZ	ARG	235	43.964	34.920	47.762
1729	NH1	ARG	235	43.640	33.784	47.144
1730	NH2	ARG	235	45.225	35.357	47.720
1731	C	ARG	235	42.718	40.086	45.977
1732	O	ARG	235	43.858	40.331	45.564
1733	N	ARG	236	41.656	40.010	45.190
1735	CA	ARG	236	41.820	40.049	43.727
1736	CB	ARG	236	41.452	38.675	43.172
1737	CG	ARG	236	42.399	37.626	43.748
1738	CD	ARG	236	42.111	36.211	43.267
1739	NE	ARG	236	43.092	35.277	43.844
1740	CZ	ARG	236	44.194	34.869	43.208
1741	NH1	ARG	236	44.389	35.198	41.928
1742	NH2	ARG	236	45.047	34.043	43.819
1743	C	ARG	236	41.010	41.155	43.055
1744	O	ARG	236	39.913	41.515	43.498
1745	N	ARG	237	41.577	41.673	41.978
1747	CA	ARG	237	40.999	42.818	41.267
1748	CB	ARG	237	42.052	43.371	40.317
1749	CG	ARG	237	42.570	42.388	39.286
1750	CD	ARG	237	43.539	43.116	38.366
1751	NE	ARG	237	44.087	42.230	37.336
1752	CZ	ARG	237	44.616	42.699	36.205
1753	NH1	ARG	237	45.262	41.874	35.381
1754	NH2	ARG	237	44.619	44.012	35.970
1755	C	ARG	237	39.682	42.519	40.542
1756	O	ARG	237	39.489	41.449	39.947
1757	N	ALA	238	38.792	43.499	40.619
1759	CA	ALA	238	37.411	43.357	40.134
1760	CB	ALA	238	36.506	44.187	41.036
1761	C	ALA	238	37.195	43.793	38.688
1762	O	ALA	238	37.594	44.889	38.275
1763	N	THR	239	36.516	42.940	37.938
1765	CA	THR	239	36.131	43.288	36.562
1766	CB	THR	239	36.649	42.189	35.640
1767	OG1	THR	239	37.971	41.888	36.053
1768	CG2	THR	239	36.676	42.570	34.162
1769	C	THR	239	34.613	43.424	36.423
1770	O	THR	239	33.833	42.753	37.116
1771	N	SER	240	34.210	44.368	35.588
1773	CA	SER	240	32.793	44.519	35.243
1774	CB	SER	240	32.555	45.878	34.592
1775	OG	SER	240	33.044	46.897	35.455
1776	C	SER	240	32.382	43.432	34.256
1777	O	SER	240	33.172	43.026	33.394
1778	N	GLY	241	31.169	42.940	34.419
1780	CA	GLY	241	30.648	41.940	33.488
1781	C	GLY	241	30.149	42.602	32.211
1782	O	GLY	241	29.323	43.520	32.257
1783	N	GLY	242	30.576	42.061	31.080
1785	CA	GLY	242	30.167	42.570	29.757
1786	C	GLY	242	28.659	42.476	29.514
1787	O	GLY	242	28.041	43.411	28.994
1788	N	LYS	243	28.073	41.387	29.984
1790	CA	LYS	243	26.624	41.148	29.899
1791	CB	LYS	243	26.476	39.651	30.171
1792	CG	LYS	243	25.068	39.206	30.547
1793	CD	LYS	243	25.098	37.776	31.074
1794	CE	LYS	243	23.749	37.337	31.629
1795	NZ	LYS	243	23.842	35.988	32.213
1796	C	LYS	243	25.812	41.933	30.942
1797	O	LYS	243	24.623	42.214	30.735
1798	N	TRP	244	26.505	42.473	31.926
1800	CA	TRP	244	25.842	43.016	33.109
1801	CB	TRP	244	26.805	42.743	34.254
1802	CG	TRP	244	26.161	42.475	35.596
1803	CD1	TRP	244	26.623	42.922	36.811
1804	NE1	TRP	244	25.798	42.461	37.783
1806	CE2	TRP	244	24.787	41.740	37.261
1807	CZ2	TRP	244	23.700	41.097	37.825
1808	CH2	TRP	244	22.802	40.410	37.017
1809	CZ3	TRP	244	22.990	40.367	35.641
1810	CE3	TRP	244	24.073	41.015	35.063
1811	CD2	TRP	244	24.969	41.709	35.864
1812	C	TRP	244	25.412	44.506	33.143
1813	O	TRP	244	24.432	44.746	33.861
1814	N	PRO	245	25.962	45.475	32.404
1815	CA	PRO	245	25.584	46.862	32.724
1816	CB	PRO	245	26.584	47.718	32.008
1817	CG	PRO	245	27.454	46.865	31.109
1818	CD	PRO	245	27.019	45.440	31.376
1819	C	PRO	245	24.159	47.244	32.309
1820	O	PRO	245	23.485	47.981	33.043
1821	N	GLN	246	23.615	46.522	31.343
1823	CA	GLN	246	22.298	46.848	30.794
1824	CB	GLN	246	22.305	46.431	29.323
1825	CG	GLN	246	22.839	45.017	29.105
1826	CD	GLN	246	21.707	43.992	29.114
1827	OE1	GLN	246	20.618	44.254	28.596
1828	NE2	GLN	246	21.996	42.817	29.646
1831	C	GLN	246	21.119	46.242	31.565
1832	O	GLN	246	19.965	46.523	31.227
1833	N	VAL	247	21.395	45.572	32.675
1835	CA	VAL	247	20.332	44.889	33.416
1836	CB	VAL	247	20.993	43.721	34.148
1837	CG1	VAL	247	19.998	42.912	34.976
1838	CG2	VAL	247	21.705	42.810	33.157
1839	C	VAL	247	19.599	45.786	34.424
1840	O	VAL	247	18.441	45.506	34.761
1841	N	LEU	248	20.181	46.912	34.798
1843	CA	LEU	248	19.549	47.673	35.884
1844	CB	LEU	248	20.604	48.026	36.924
1845	CG	LEU	248	19.945	48.496	38.217
1846	CD1	LEU	248	19.007	47.424	38.769
1847	CD2	LEU	248	20.988	48.878	39.259
1848	C	LEU	248	18.819	48.934	35.428
1849	O	LEU	248	19.455	49.934	35.065
1850	N	PHE	249	17.495	48.860	35.540
1852	CA	PHE	249	16.530	49.969	35.336
1853	CB	PHE	249	16.377	50.723	36.652
1854	CG	PHE	249	15.590	49.966	37.715
1855	CD1	PHE	249	14.469	49.230	37.352
1856	CE1	PHE	249	13.744	48.546	38.319
1857	CZ	PHE	249	14.136	48.605	39.650
1858	CE2	PHE	249	15.251	49.349	40.014
1859	CD2	PHE	249	15.976	50.033	39.047
1860	C	PHE	249	16.903	50.968	34.254
1861	O	PHE	249	17.699	51.878	34.529
1862	N	PHE	250	16.193	50.885	33.132
1864	CA	PHE	250	16.441	51.694	31.914
1865	CB	PHE	250	15.523	52.914	31.930
1866	CG	PHE	250	15.593	53.761	30.660
1867	CD1	PHE	250	15.633	53.150	29.413
1868	CE1	PHE	250	15.701	53.923	28.261
1869	CZ	PHE	250	15.729	55.308	28.356
1870	CE2	PHE	250	15.687	55.920	29.602
1871	CD2	PHE	250	15.618	55.146	30.754
1872	C	PHE	250	17.896	52.132	31.833
1873	O	PHE	250	18.220	53.286	32.145
1874	N	PRO	251	18.714	51.272	31.250
1875	CA	PRO	251	19.947	50.835	31.917
1876	CB	PRO	251	20.624	50.001	30.880
1877	CG	PRO	251	19.580	49.558	29.866
1878	CD	PRO	251	18.293	50.238	30.301
1879	C	PRO	251	20.841	51.941	32.475
1880	O	PRO	251	21.864	52.301	31.879
1881	N	GLU	252	20.591	52.256	33.738
1883	CA	GLU	252	21.341	53.280	34.470
1884	CB	GLU	252	20.423	53.832	35.555
1885	CG	GLU	252	19.209	54.524	34.945
1886	CD	GLU	252	18.103	54.653	35.988
1887	OE1	GLU	252	18.415	54.493	37.162
1888	OE2	GLU	252	16.965	54.881	35.602
1889	C	GLU	252	22.583	52.667	35.099
1890	O	GLU	252	23.619	53.336	35.229
1891	N	GLY	253	22.556	51.346	35.187
1893	CA	GLY	253	23.725	50.578	35.625
1894	C	GLY	253	24.823	50.573	34.560
1895	O	GLY	253	26.015	50.518	34.897
1896	N	THR	254	24.442	50.867	33.325
1898	CA	THR	254	25.384	50.827	32.211
1899	CB	THR	254	24.607	50.965	30.909
1900	OG1	THR	254	23.652	49.920	30.857
1901	CG2	THR	254	25.510	50.827	29.691
1902	C	THR	254	26.427	51.929	32.291
1903	O	THR	254	27.616	51.606	32.193
1904	N	CYS	255	26.049	53.082	32.818
1906	CA	CYS	255	26.990	54.203	32.860
1907	CB	CYS	255	26.196	55.482	33.091
1908	SG	CYS	255	24.934	55.835	31.847
1909	C	CYS	255	28.027	54.035	33.965
1910	O	CYS	255	29.220	54.253	33.715
1911	N	SER	256	27.638	53.328	35.013
1913	CA	SER	256	28.542	53.131	36.142
1914	CB	SER	256	27.707	52.733	37.352
1915	OG	SER	256	26.725	53.742	37.551
1916	C	SER	256	29.548	52.032	35.831
1917	O	SER	256	30.755	52.239	36.010
1918	N	ASN	257	29.097	51.047	35.073
1920	CA	ASN	257	29.970	49.923	34.739
1921	CB	ASN	257	29.104	48.689	34.522
1922	CG	ASN	257	28.357	48.346	35.813
1923	OD1	ASN	257	28.768	48.731	36.914
1924	ND2	ASN	257	27.267	47.616	35.665
1927	C	ASN	257	30.844	50.210	33.519
1928	O	ASN	257	31.974	49.707	33.455
1929	N	LYS	258	30.452	51.189	32.715
1931	CA	LYS	258	31.330	51.640	31.631
1932	CB	LYS	258	30.564	52.481	30.619
1933	CG	LYS	258	29.565	51.677	29.797
1934	CD	LYS	258	28.888	52.498	28.693
1935	CE	LYS	258	27.911	53.570	29.190
1936	NZ	LYS	258	28.556	54.846	29.554
1937	C	LYS	258	32.447	52.502	32.188
1938	O	LYS	258	33.607	52.300	31.814
1939	N	LYS	259	32.150	53.236	33.249
1941	CA	LYS	259	33.179	54.055	33.889
1942	CB	LYS	259	32.497	55.063	34.806
1943	CG	LYS	259	33.016	56.472	34.548
1944	CD	LYS	259	32.688	56.912	33.124
1945	CE	LYS	259	31.182	56.919	32.880
1946	NZ	LYS	259	30.875	57.219	31.473
1947	C	LYS	259	34.129	53.183	34.701
1948	O	LYS	259	35.347	53.399	34.651
1949	N	ALA	260	33.616	52.060	35.176
1951	CA	ALA	260	34.459	51.078	35.856
1952	CB	ALA	260	33.566	50.020	36.493
1953	C	ALA	260	35.434	50.418	34.885
1954	O	ALA	260	36.634	50.392	35.181
1955	N	LEU	261	35.005	50.177	33.656
1957	CA	LEU	261	35.920	49.612	32.655
1958	CB	LEU	261	35.103	48.970	31.541
1959	CG	LEU	261	34.331	47.765	32.055
1960	CD1	LEU	261	33.441	47.180	30.964
1961	CD2	LEU	261	35.286	46.707	32.600
1962	C	LEU	261	36.861	50.652	32.049
1963	O	LEU	261	37.988	50.299	31.685
1964	N	LEU	262	36.518	51.924	32.160
1966	CA	LEU	262	37.404	52.986	31.671
1967	CB	LEU	262	36.580	54.234	31.378
1968	CG	LEU	262	35.661	54.036	30.179
1969	CD1	LEU	262	34.731	55.231	30.002
1970	CD2	LEU	262	36.463	53.778	28.909
1971	C	LEU	262	38.496	53.338	32.675
1972	O	LEU	262	39.500	53.952	32.298
1973	N	LYS	263	38.327	52.924	33.920
1975	CA	LYS	263	39.393	53.095	34.908
1976	CB	LYS	263	38.756	53.565	36.205
1977	CG	LYS	263	37.970	54.852	35.988
1978	CD	LYS	263	37.241	55.274	37.257
1979	CE	LYS	263	36.292	54.181	37.735
1980	NZ	LYS	263	35.569	54.603	38.944
1981	C	LYS	263	40.137	51.779	35.125
1982	O	LYS	263	41.328	51.767	35.470
1983	N	PHE	264	39.484	50.688	34.762
1985	CA	PHE	264	40.110	49.370	34.868
1986	CB	PHE	264	39.021	48.322	35.047
1987	CG	PHE	264	39.534	46.969	35.517
1988	CD1	PHE	264	38.952	45.799	35.050
1989	CE1	PHE	264	39.422	44.570	35.491
1990	CZ	PHE	264	40.471	44.506	36.396
1991	CE2	PHE	264	41.059	45.673	36.858
1992	CD2	PHE	264	40.592	46.903	36.415
1993	C	PHE	264	40.937	49.046	33.628
1994	O	PHE	264	41.857	48.225	33.699
1995	N	LYS	265	40.719	49.774	32.549
1997	CA	LYS	265	41.615	49.648	31.394
1998	CB	LYS	265	40.996	50.299	30.163
1999	CG	LYS	265	41.045	49.323	28.995
2000	CD	LYS	265	40.197	48.091	29.295
2001	CE	LYS	265	40.407	46.992	28.260
2002	NZ	LYS	265	41.792	46.500	28.308
2003	C	LYS	265	43.028	50.191	31.682
2004	O	LYS	265	43.962	49.394	31.533
2005	N	PRO	266	43.225	51.416	32.178
2006	CA	PRO	266	44.559	51.775	32.691
2007	CB	PRO	266	44.490	53.234	33.019
2008	CG	PRO	266	43.064	53.725	32.845
2009	CD	PRO	266	42.276	52.530	32.345
2010	C	PRO	266	45.002	50.967	33.923
2011	O	PRO	266	46.211	50.781	34.107
2012	N	GLY	267	44.065	50.383	34.656
2014	CA	GLY	267	44.399	49.406	35.698
2015	C	GLY	267	45.154	48.208	35.117
2016	O	GLY	267	46.288	47.932	35.530
2017	N	ALA	268	44.622	47.640	34.044
2019	CA	ALA	268	45.273	46.532	33.326
2020	CB	ALA	268	44.236	45.881	32.420
2021	C	ALA	268	46.480	46.955	32.478
2022	O	ALA	268	47.323	46.112	32.144
2023	N	PHE	269	46.690	48.258	32.354
2025	CA	PHE	269	47.870	48.811	31.672
2026	CB	PHE	269	47.571	50.202	31.123
2027	CG	PHE	269	46.922	50.240	29.737
2028	CD1	PHE	269	46.254	49.133	29.226
2029	CE1	PHE	269	45.677	49.187	27.964
2030	CZ	PHE	269	45.773	50.346	27.206
2031	CE2	PHE	269	46.448	51.450	27.710
2032	CD2	PHE	269	47.024	51.396	28.973
2033	C	PHE	269	49.101	48.852	32.582
2034	O	PHE	269	50.197	49.209	32.127
2035	N	ILE	270	48.970	48.284	33.777
2037	CA	ILE	270	50.121	48.016	34.647
2038	CB	ILE	270	49.605	47.715	36.057
2039	CG2	ILE	270	48.846	46.393	36.104
2040	CG1	ILE	270	50.737	47.699	37.079
2041	CD1	ILE	270	51.426	49.057	37.161
2042	C	ILE	270	50.972	46.847	34.110
2043	O	ILE	270	52.144	46.740	34.489
2044	N	ALA	271	50.500	46.205	33.044
2046	CA	ALA	271	51.256	45.193	32.292
2047	CB	ALA	271	50.276	44.448	31.396
2048	C	ALA	271	52.405	45.744	31.433
2049	O	ALA	271	53.015	44.986	30.669
2050	N	GLY	272	52.625	47.050	31.478
2052	CA	GLY	272	53.840	47.634	30.913
2053	C	GLY	272	55.037	47.176	31.744
2054	O	GLY	272	56.024	46.667	31.199
2055	N	VAL	273	54.923	47.304	33.058
2057	CA	VAL	273	55.982	46.809	33.941
2058	CB	VAL	273	55.889	47.505	35.305
2059	CG1	VAL	273	55.896	49.019	35.137
2060	CG2	VAL	273	54.678	47.070	36.117
2061	C	VAL	273	55.849	45.287	34.055
2062	O	VAL	273	54.743	44.753	33.920
2063	N	PRO	274	56.967	44.616	34.300
2064	CA	PRO	274	57.092	43.158	34.118
2065	CB	PRO	274	58.484	42.826	34.562
2066	CG	PRO	274	59.256	44.108	34.812
2067	CD	PRO	274	58.273	45.235	34.560
2068	C	PRO	274	56.080	42.283	34.862
2069	O	PRO	274	55.223	42.772	35.615
2070	N	VAL	275	56.358	40.986	34.775
2072	CA	VAL	275	55.583	39.820	35.299
2073	CB	VAL	275	55.850	39.593	36.809
2074	CG1	VAL	275	55.855	40.818	37.721
2075	CG2	VAL	275	54.989	38.489	37.411
2076	C	VAL	275	54.086	39.715	34.936
2077	O	VAL	275	53.743	38.816	34.153
2078	N	GLN	276	53.262	40.652	35.391
2080	CA	GLN	276	51.780	40.672	35.267
2081	CB	GLN	276	51.416	41.860	34.390
2082	CG	GLN	276	52.192	43.116	34.766
2083	CD	GLN	276	51.818	43.649	36.143
2084	OE1	GLN	276	50.638	43.832	36.463
2085	NE2	GLN	276	52.845	43.929	36.925
2088	C	GLN	276	51.130	39.431	34.645
2089	O	GLN	276	50.979	39.376	33.418
2090	N	PRO	277	50.901	38.399	35.441
2091	CA	PRO	277	50.156	37.226	34.983
2092	CB	PRO	277	50.533	36.142	35.934
2093	CG	PRO	277	51.198	36.787	37.136
2094	CD	PRO	277	51.266	38.277	36.846
2095	C	PRO	277	48.658	37.490	35.030
2096	O	PRO	277	48.021	37.358	36.085
2097	N	VAL	278	48.119	37.753	33.854
2099	CA	VAL	278	46.734	38.189	33.688
2100	CB	VAL	278	46.754	39.298	32.642
2101	CG1	VAL	278	45.362	39.857	32.379
2102	CG2	VAL	278	47.707	40.410	33.062
2103	C	VAL	278	45.820	37.056	33.232
2104	O	VAL	278	46.042	36.427	32.189
2105	N	LEU	279	44.793	36.802	34.023
2107	CA	LEU	279	43.793	35.789	33.654
2108	CB	LEU	279	43.364	34.963	34.872
2109	CG	LEU	279	44.444	34.050	35.460
2110	CD1	LEU	279	45.266	34.729	36.557
2111	CD2	LEU	279	43.799	32.797	36.041
2112	C	LEU	279	42.548	36.451	33.068
2113	O	LEU	279	41.839	37.163	33.786
2114	N	ILE	280	42.290	36.236	31.789
2116	CA	ILE	280	41.061	36.773	31.176
2117	CB	ILE	280	41.423	37.615	29.951
2118	CG2	ILE	280	41.880	36.737	28.790
2119	CG1	ILE	280	40.251	38.504	29.537
2120	CD1	ILE	280	40.630	39.506	28.457
2121	C	ILE	280	40.116	35.601	30.879
2122	O	ILE	280	40.593	34.504	30.571
2123	N	ARG	281	38.811	35.837	30.908
2125	CA	ARG	281	37.824	34.755	31.081
2126	CB	ARG	281	36.609	35.376	31.741
2127	CG	ARG	281	37.085	36.388	32.777
2128	CD	ARG	281	36.308	36.346	34.091
2129	NE	ARG	281	36.495	35.080	34.829
2130	CZ	ARG	281	37.526	34.794	35.635
2131	NH1	ARG	281	38.607	35.579	35.673
2132	NH2	ARG	281	37.534	33.642	36.306
2133	C	ARG	281	37.418	33.896	29.865
2134	O	ARG	281	36.326	34.011	29.294
2135	N	TYR	282	38.349	33.006	29.561
2137	CA	TYR	282	38.275	31.730	28.814
2138	CB	TYR	282	38.825	30.713	29.823
2139	CG	TYR	282	39.255	31.303	31.182
2140	CD1	TYR	282	38.346	31.441	32.228
2141	CE1	TYR	282	38.752	31.974	33.439
2142	CZ	TYR	282	40.071	32.358	33.618
2143	OH	TYR	282	40.519	32.747	34.856
2144	CE2	TYR	282	40.988	32.215	32.589
2145	CD2	TYR	282	40.583	31.673	31.371
2146	C	TYR	282	36.919	31.218	28.300
2147	O	TYR	282	35.878	31.368	28.944
2148	N	PRO	283	36.954	30.631	27.109
2149	CA	PRO	283	35.751	30.135	26.407
2150	CB	PRO	283	36.171	30.052	24.974
2151	CG	PRO	283	37.686	30.137	24.904
2152	CD	PRO	283	38.162	30.449	26.310
2153	C	PRO	283	35.307	28.745	26.852
2154	O	PRO	283	36.144	27.854	27.049
2155	N	ASN	284	34.003	28.523	26.891
2157	CA	ASN	284	33.504	27.176	27.214
2158	CB	ASN	284	33.098	27.123	28.682
2159	CG	ASN	284	34.336	26.970	29.568
2160	OD1	ASN	284	34.744	27.891	30.290
2161	ND2	ASN	284	34.891	25.770	29.533
2164	C	ASN	284	32.361	26.675	26.317
2165	O	ASN	284	31.556	27.446	25.782
2166	N	SER	285	32.378	25.360	26.132
2168	CA	SER	285	31.369	24.577	25.382
2169	CB	SER	285	29.999	24.706	26.025
2170	OG	SER	285	30.067	24.054	27.284
2171	C	SER	285	31.264	24.850	23.884
2172	O	SER	285	32.031	25.614	23.288
2173	N	LEU	286	30.305	24.136	23.310
2175	CA	LEU	286	30.075	24.034	21.856
2176	CB	LEU	286	28.735	23.344	21.620
2177	CG	LEU	286	28.739	21.907	22.129
2178	CD1	LEU	286	27.349	21.289	22.030
2179	CD2	LEU	286	29.759	21.058	21.377
2180	C	LEU	286	30.070	25.362	21.108
2181	O	LEU	286	29.481	26.352	21.551
2182	N	PHE	287	30.435	25.233	19.841
2184	CA	PHE	287	30.675	26.368	18.935
2185	CB	PHE	287	31.562	25.864	17.797
2186	CG	PHE	287	32.715	24.954	18.214
2187	CD1	PHE	287	33.823	25.481	18.865
2188	CE1	PHE	287	34.868	24.647	19.244
2189	CZ	PHE	287	34.808	23.287	18.969
2190	CE2	PHE	287	33.705	22.760	18.309
2191	CD2	PHE	287	32.661	23.594	17.929
2192	C	PHE	287	29.403	26.933	18.296
2193	O	PHE	287	29.466	27.894	17.517
2194	N	LEU	288	28.265	26.344	18.619
2196	CA	LEU	288	27.006	26.729	17.971
2197	CB	LEU	288	25.950	25.656	18.237
2198	CG	LEU	288	24.671	25.896	17.441
2199	CD1	LEU	288	24.951	25.935	15.941
2200	CD2	LEU	288	23.638	24.822	17.762
2201	C	LEU	288	26.532	28.137	18.380
2202	O	LEU	288	26.391	28.964	17.468
2203	N	PRO	289	26.330	28.465	19.655
2204	CA	PRO	289	26.007	29.856	19.991
2205	CB	PRO	289	25.313	29.769	21.314
2206	CG	PRO	289	25.637	28.422	21.942
2207	CD	PRO	289	26.400	27.648	20.879
2208	C	PRO	289	27.240	30.754	20.123
2209	O	PRO	289	27.484	31.260	21.227
2210	N	VAL	290	27.964	30.972	19.027
2212	CA	VAL	290	29.155	31.843	18.977
2213	CB	VAL	290	28.746	33.261	19.422
2214	CG1	VAL	290	29.856	34.301	19.284
2215	CG2	VAL	290	27.538	33.746	18.622
2216	C	VAL	290	30.316	31.224	19.787
2217	O	VAL	290	30.107	30.320	20.601
2218	N	TYR	291	31.535	31.558	19.393
2220	CA	TYR	291	32.748	31.040	20.057
2221	CB	TYR	291	33.726	30.517	19.005
2222	CG	TYR	291	33.249	30.523	17.550
2223	CD1	TYR	291	33.510	31.624	16.738
2224	CE1	TYR	291	33.079	31.629	15.417
2225	CZ	TYR	291	32.404	30.527	14.909
2226	OH	TYR	291	31.965	30.537	13.603
2227	CE2	TYR	291	32.164	29.417	15.708
2228	CD2	TYR	291	32.594	29.412	17.028
2229	C	TYR	291	33.451	32.120	20.879
2230	O	TYR	291	32.879	33.188	21.125
2231	N	HIS	292	34.687	31.814	21.274
2233	CA	HIS	292	35.633	32.697	22.014
2234	CB	HIS	292	36.230	33.756	21.067
2235	CG	HIS	292	35.309	34.711	20.330
2236	ND1	HIS	292	35.068	34.710	18.998
2238	CE1	HIS	292	34.200	35.709	18.710
2239	NE2	HIS	292	33.909	36.347	19.865
2240	CD2	HIS	292	34.595	35.755	20.866
2241	C	HIS	292	35.100	33.282	23.348
2242	O	HIS	292	33.903	33.528	23.477
2243	N	PRO	293	36.000	33.633	24.264
2244	CA	PRO	293	35.757	33.603	25.729
2245	CB	PRO	293	36.874	34.410	26.298
2246	CG	PRO	293	38.013	34.380	25.299
2247	CD	PRO	293	37.441	33.728	24.055
2248	C	PRO	293	34.388	34.010	26.274
2249	O	PRO	293	33.674	34.846	25.702
2250	N	SER	294	34.147	33.541	27.486
2252	CA	SER	294	32.782	33.436	28.035
2253	CB	SER	294	32.744	32.439	29.197
2254	OG	SER	294	33.802	32.690	30.108
2255	C	SER	294	31.989	34.745	28.247
2256	O	SER	294	31.186	35.003	27.340
2257	N	PRO	295	32.176	35.613	29.243
2258	CA	PRO	295	33.243	35.651	30.258
2259	CB	PRO	295	33.457	37.113	30.484
2260	CG	PRO	295	32.174	37.840	30.117
2261	CD	PRO	295	31.341	36.820	29.359
2262	C	PRO	295	32.905	35.027	31.627
2263	O	PRO	295	33.613	35.329	32.595
2264	N	GLU	296	31.782	34.348	31.782
2266	CA	GLU	296	31.449	33.804	33.103
2267	CB	GLU	296	29.974	34.045	33.363
2268	CG	GLU	296	29.699	35.544	33.299
2269	CD	GLU	296	28.303	35.849	33.812
2270	OE1	GLU	296	27.442	36.110	32.986
2271	OE2	GLU	296	28.091	35.618	34.993
2272	C	GLU	296	31.828	32.329	33.237
2273	O	GLU	296	32.793	31.882	32.608
2274	N	GLU	297	31.152	31.626	34.135
2276	CA	GLU	297	31.449	30.204	34.402
2277	CB	GLU	297	30.437	29.663	35.402
2278	CG	GLU	297	31.106	29.032	36.621
2279	CD	GLU	297	31.528	30.105	37.617
2280	OE1	GLU	297	32.270	29.771	38.532
2281	OE2	GLU	297	30.982	31.198	37.535
2282	C	GLU	297	31.411	29.330	33.148
2283	O	GLU	297	30.892	29.737	32.100
2284	N	SER	298	31.852	28.092	33.323
2286	CA	SER	298	32.042	27.112	32.236
2287	CB	SER	298	32.970	26.017	32.749
2288	OG	SER	298	34.247	26.601	32.928
2289	C	SER	298	30.787	26.449	31.647
2290	O	SER	298	30.780	25.233	31.417
2291	N	ARG	299	29.780	27.246	31.331
2293	CA	ARG	299	28.640	26.770	30.548
2294	CB	ARG	299	27.428	27.633	30.847
2295	CG	ARG	299	27.693	28.587	31.999
2296	CD	ARG	299	26.580	29.619	32.084
2297	NE	ARG	299	26.840	30.617	33.126
2298	CZ	ARG	299	26.523	31.896	32.949
2299	NH1	ARG	299	26.028	32.294	31.777
2300	NH2	ARG	299	26.723	32.777	33.929
2301	C	ARG	299	29.021	26.959	29.083
2302	O	ARG	299	30.065	26.473	28.635
2303	N	ASP	300	28.165	27.646	28.346
2305	CA	ASP	300	28.555	28.135	27.014
2306	CB	ASP	300	27.767	27.368	25.951
2307	CG	ASP	300	26.276	27.321	26.282
2308	OD1	ASP	300	25.614	28.313	26.030
2309	OD2	ASP	300	25.841	26.324	26.838
2310	C	ASP	300	28.401	29.652	26.770
2311	O	ASP	300	27.936	29.980	25.673
2312	N	PRO	301	28.729	30.572	27.679
2313	CA	PRO	301	28.849	31.951	27.222
2314	CB	PRO	301	28.954	32.784	28.458
2315	CG	PRO	301	29.207	31.868	29.640
2316	CD	PRO	301	29.195	30.463	29.068
2317	C	PRO	301	30.089	32.044	26.338
2318	O	PRO	301	31.116	31.406	26.616
2319	N	THR	302	29.953	32.772	25.245
2321	CA	THR	302	31.015	32.872	24.238
2322	CB	THR	302	30.925	31.655	23.320
2323	OG1	THR	302	29.545	31.320	23.201
2324	CG2	THR	302	31.672	30.424	23.842
2325	C	THR	302	30.863	34.135	23.378
2326	O	THR	302	30.164	34.075	22.360
2327	N	LEU	303	31.492	35.236	23.778
2329	CA	LEU	303	31.405	36.491	23.014
2330	CB	LEU	303	29.966	37.018	23.130
2331	CG	LEU	303	29.408	37.096	24.561
2332	CD1	LEU	303	29.859	38.348	25.316
2333	CD2	LEU	303	27.884	37.067	24.522
2334	C	LEU	303	32.386	37.590	23.452
2335	O	LEU	303	32.299	38.708	22.930
2336	N	TYR	304	33.301	37.309	24.363
2338	CA	TYR	304	33.957	38.423	25.068
2339	CB	TYR	304	33.835	38.102	26.551
2340	CG	TYR	304	34.088	39.267	27.505
2341	CD1	TYR	304	33.226	40.355	27.507
2342	CE1	TYR	304	33.427	41.401	28.392
2343	CZ	TYR	304	34.496	41.367	29.277
2344	OH	TYR	304	34.599	42.326	30.263
2345	CE2	TYR	304	35.383	40.295	29.263
2346	CD2	TYR	304	35.180	39.244	28.370
2347	C	TYR	304	35.433	38.731	24.766
2348	O	TYR	304	35.764	39.770	24.174
2349	N	ALA	305	36.314	37.882	25.264
2351	CA	ALA	305	37.715	38.297	25.455
2352	CB	ALA	305	38.243	37.612	26.705
2353	C	ALA	305	38.677	38.060	24.294
2354	O	ALA	305	39.414	37.069	24.272
2355	N	ASN	306	38.764	39.060	23.432
2357	CA	ASN	306	39.783	39.098	22.373
2358	CB	ASN	306	39.069	39.525	21.090
2359	CG	ASN	306	40.057	39.994	20.026
2360	OD1	ASN	306	40.827	39.196	19.481
2361	ND2	ASN	306	40.066	41.295	19.775
2364	C	ASN	306	40.861	40.128	22.684
2365	O	ASN	306	42.062	39.880	22.499
2366	N	ASN	307	40.443	41.129	23.440
2368	CA	ASN	307	41.150	42.418	23.493
2369	CB	ASN	307	40.136	43.455	23.965
2370	CG	ASN	307	38.843	43.328	23.153
2371	OD1	ASN	307	38.859	43.121	21.930
2372	ND2	ASN	307	37.731	43.429	23.861
2375	C	ASN	307	42.393	42.483	24.381
2376	O	ASN	307	43.187	43.421	24.229
2377	N	VAL	308	42.709	41.398	25.069
2379	CA	VAL	308	43.866	41.418	25.963
2380	CB	VAL	308	43.679	40.353	27.038
2381	CG1	VAL	308	43.743	38.936	26.473
2382	CG2	VAL	308	44.676	40.525	28.175
2383	C	VAL	308	45.170	41.203	25.187
2384	O	VAL	308	46.208	41.742	25.588
2385	N	GLN	309	45.038	40.758	23.945
2387	CA	GLN	309	46.206	40.563	23.094
2388	CB	GLN	309	45.783	39.660	21.943
2389	CG	GLN	309	45.086	38.408	22.461
2390	CD	GLN	309	44.602	37.540	21.301
2391	OE1	GLN	309	45.321	36.649	20.838
2392	NE2	GLN	309	43.388	37.810	20.855
2395	C	GLN	309	46.666	41.906	22.542
2396	O	GLN	309	47.860	42.230	22.606
2397	N	ARG	310	45.693	42.784	22.358
2399	CA	ARG	310	45.984	44.091	21.789
2400	CB	ARG	310	44.689	44.712	21.290
2401	CG	ARG	310	43.934	43.771	20.360
2402	CD	ARG	310	42.674	44.441	19.824
2403	NE	ARG	310	41.832	44.928	20.928
2404	CZ	ARG	310	41.504	46.213	21.090
2405	NH1	ARG	310	41.948	47.129	20.228
2406	NH2	ARG	310	40.747	46.583	22.125
2407	C	ARG	310	46.585	44.984	22.855
2408	O	ARG	310	47.692	45.491	22.641
2409	N	VAL	311	46.075	44.863	24.071
2411	CA	VAL	311	46.559	45.731	25.145
2412	CB	VAL	311	45.472	45.886	26.205
2413	CG1	VAL	311	44.204	46.446	25.572
2414	CG2	VAL	311	45.171	44.583	26.932
2415	C	VAL	311	47.883	45.270	25.760
2416	O	VAL	311	48.602	46.120	26.297
2417	N	MET	312	48.327	44.053	25.476
2419	CA	MET	312	49.679	43.665	25.899
2420	CB	MET	312	49.798	42.148	25.909
2421	CG	MET	312	48.973	41.547	27.034
2422	SD	MET	312	49.442	42.101	28.686
2423	CE	MET	312	48.160	41.250	29.630
2424	C	MET	312	50.720	44.246	24.951
2425	O	MET	312	51.710	44.840	25.405
2426	N	ALA	313	50.332	44.358	23.691
2428	CA	ALA	313	51.213	44.971	22.697
2429	CB	ALA	313	50.781	44.504	21.313
2430	C	ALA	313	51.156	46.496	22.771
2431	O	ALA	313	52.188	47.151	22.589
2432	N	GLN	314	50.051	47.023	23.273
2434	CA	GLN	314	49.909	48.471	23.471
2435	CB	GLN	314	48.423	48.808	23.423
2436	CG	GLN	314	47.859	48.521	22.036
2437	CD	GLN	314	46.335	48.612	22.033
2438	OE1	GLN	314	45.649	47.911	22.789
2439	NE2	GLN	314	45.820	49.427	21.130
2442	C	GLN	314	50.517	48.950	24.792
2443	O	GLN	314	50.738	50.153	24.968
2444	N	ALA	315	50.833	48.016	25.676
2446	CA	ALA	315	51.592	48.334	26.888
2447	CB	ALA	315	51.090	47.454	28.027
2448	C	ALA	315	53.087	48.097	26.671
2449	O	ALA	315	53.905	48.462	27.525
2450	N	LEU	316	53.409	47.533	25.514
2452	CA	LEU	316	54.783	47.234	25.087
2453	CB	LEU	316	55.582	48.526	24.948
2454	CG	LEU	316	55.029	49.398	23.825
2455	CD1	LEU	316	55.719	50.756	23.796
2456	CD2	LEU	316	55.153	48.701	22.473
2457	C	LEU	316	55.476	46.258	26.030
2458	O	LEU	316	56.598	46.498	26.492
2459	N	GLY	317	54.812	45.139	26.258
2461	CA	GLY	317	55.393	44.051	27.047
2462	C	GLY	317	55.193	42.757	26.275
2463	O	GLY	317	54.161	42.596	25.612
2464	N	ILE	318	56.161	41.856	26.348
2466	CA	ILE	318	56.083	40.599	25.579
2467	CB	ILE	318	57.413	39.859	25.721
2468	CG2	ILE	318	57.343	38.457	25.120
2469	CG1	ILE	318	58.541	40.650	25.067
2470	CD1	ILE	318	58.325	40.800	23.565
2471	C	ILE	318	54.922	39.723	26.055
2472	O	ILE	318	54.897	39.273	27.204
2473	N	PRO	319	53.952	39.527	25.176
2474	CA	PRO	319	52.710	38.845	25.541
2475	CB	PRO	319	51.721	39.297	24.512
2476	CG	PRO	319	52.469	39.964	23.366
2477	CD	PRO	319	53.925	40.025	23.799
2478	C	PRO	319	52.844	37.326	25.498
2479	O	PRO	319	52.627	36.707	24.449
2480	N	ALA	320	53.181	36.732	26.629
2482	CA	ALA	320	53.190	35.268	26.707
2483	CB	ALA	320	53.947	34.835	27.957
2484	C	ALA	320	51.738	34.820	26.785
2485	O	ALA	320	50.924	35.550	27.354
2486	N	THR	321	51.375	33.728	26.139
2488	CA	THR	321	49.964	33.317	26.200
2489	CB	THR	321	49.267	33.755	24.916
2490	OG1	THR	321	49.479	35.152	24.752
2491	CG2	THR	321	47.764	33.503	24.977
2492	C	THR	321	49.808	31.813	26.403
2493	O	THR	321	50.046	31.018	25.485
2494	N	GLU	322	49.412	31.442	27.612
2496	CA	GLU	322	49.255	30.027	27.956
2497	CB	GLU	322	50.040	29.737	29.224
2498	CG	GLU	322	51.492	30.135	29.033
2499	CD	GLU	322	52.355	29.532	30.127
2500	OE1	GLU	322	52.067	28.411	30.527
2501	OE2	GLU	322	53.383	30.123	30.422
2502	C	GLU	322	47.806	29.614	28.170
2503	O	GLU	322	47.147	30.062	29.119
2504	N	CYS	323	47.382	28.645	27.380
2506	CA	CYS	323	46.020	28.113	27.504
2507	CB	CYS	323	45.490	27.777	26.115
2508	SG	CYS	323	46.706	27.108	24.958
2509	C	CYS	323	46.003	26.912	28.446
2510	O	CYS	323	46.466	25.810	28.133
2511	N	GLU	324	45.461	27.157	29.622
2513	CA	GLU	324	45.501	26.186	30.712
2514	CB	GLU	324	46.016	26.907	31.951
2515	CG	GLU	324	47.371	27.559	31.685
2516	CD	GLU	324	47.958	28.101	32.983
2517	OE1	GLU	324	47.173	28.400	33.869
2518	OE2	GLU	324	49.174	28.233	33.054
2519	C	GLU	324	44.109	25.605	30.942
2520	O	GLU	324	43.273	25.646	30.033
2521	N	PHE	325	43.902	24.975	32.088
2523	CA	PHE	325	42.582	24.397	32.372
2524	CB	PHE	325	42.420	23.119	31.553
2525	CG	PHE	325	40.999	22.590	31.575
2526	CD1	PHE	325	40.652	21.517	32.387
2527	CE1	PHE	325	39.335	21.066	32.412
2528	CZ	PHE	325	38.379	21.685	31.620
2529	CE2	PHE	325	38.729	22.736	30.792
2530	CD2	PHE	325	40.040	23.184	30.766
2531	C	PHE	325	42.350	24.060	33.843
2532	O	PHE	325	42.947	23.104	34.353
2533	N	VAL	326	41.422	24.759	34.481
2535	CA	VAL	326	40.988	24.356	35.827
2536	CB	VAL	326	40.491	25.563	36.618
2537	CG1	VAL	326	40.057	25.139	38.017
2538	CG2	VAL	326	41.553	26.648	36.713
2539	C	VAL	326	39.858	23.334	35.712
2540	O	VAL	326	38.714	23.669	35.382
2541	N	GLY	327	40.181	22.093	36.027
2543	CA	GLY	327	39.209	21.006	35.910
2544	C	GLY	327	38.656	20.628	37.274
2545	O	GLY	327	39.013	19.588	37.843
2546	N	SER	328	37.773	21.471	37.776
2548	CA	SER	328	37.169	21.224	39.082
2549	CB	SER	328	38.028	21.905	40.140
2550	OG	SER	328	37.640	21.391	41.405
2551	C	SER	328	35.737	21.751	39.125
2552	O	SER	328	35.369	22.524	40.018
2553	N	LEU	329	34.944	21.325	38.154
2555	CA	LEU	329	33.515	21.693	38.090
2556	CB	LEU	329	32.836	21.095	36.845
2557	CG	LEU	329	32.872	21.950	35.576
2558	CD1	LEU	329	32.297	23.337	35.833
2559	CD2	LEU	329	34.252	22.032	34.928
2560	C	LEU	329	32.722	21.278	39.347
2561	O	LEU	329	32.273	22.182	40.062
2562	N	PRO	330	32.632	19.994	39.703
2563	CA	PRO	330	31.674	19.585	40.741
2564	CB	PRO	330	31.424	18.129	40.501
2565	CG	PRO	330	32.435	17.608	39.496
2566	CD	PRO	330	33.271	18.807	39.102
2567	C	PRO	330	32.089	19.831	42.199
2568	O	PRO	330	31.539	19.163	43.082
2569	N	VAL	331	33.056	20.695	42.473
2571	CA	VAL	331	33.340	21.000	43.874
2572	CB	VAL	331	34.826	21.318	44.076
2573	CG1	VAL	331	35.689	20.098	43.794
2574	CG2	VAL	331	35.315	22.503	43.251
2575	C	VAL	331	32.453	22.154	44.349
2576	O	VAL	331	31.976	22.120	45.488
2577	N	ILE	332	32.102	23.058	43.442
2579	CA	ILE	332	31.208	24.186	43.757
2580	CB	ILE	332	31.976	25.424	44.258
2581	CG2	ILE	332	31.006	26.544	44.635
2582	CG1	ILE	332	32.877	25.149	45.458
2583	CD1	ILE	332	33.520	26.432	45.968
2584	C	ILE	332	30.448	24.565	42.488
2585	O	ILE	332	30.766	25.569	41.835
2586	N	VAL	333	29.505	23.721	42.107
2588	CA	VAL	333	28.672	23.998	40.930
2589	CB	VAL	333	27.868	22.753	40.563
2590	CG1	VAL	333	26.914	23.027	39.403
2591	CG2	VAL	333	28.785	21.586	40.226
2592	C	VAL	333	27.716	25.148	41.220
2593	O	VAL	333	26.751	25.010	41.983
2594	N	VAL	334	28.044	26.295	40.656
2596	CA	VAL	334	27.205	27.482	40.799
2597	CB	VAL	334	27.993	28.647	40.218
2598	CG1	VAL	334	29.032	28.147	39.231
2599	CG2	VAL	334	27.119	29.759	39.641
2600	C	VAL	334	25.854	27.306	40.115
2601	O	VAL	334	25.753	26.871	38.959
2602	N	GLY	335	24.821	27.530	40.910
2604	CA	GLY	335	23.452	27.472	40.411
2605	C	GLY	335	22.424	27.411	41.535
2606	O	GLY	335	22.004	28.440	42.074
2607	N	ARG	336	22.081	26.185	41.902
2609	CA	ARG	336	21.029	25.842	42.885
2610	CB	ARG	336	21.648	25.623	44.280
2611	CG	ARG	336	22.738	26.609	44.716
2612	CD	ARG	336	22.193	27.858	45.388
2613	NE	ARG	336	21.423	27.478	46.587
2614	CZ	ARG	336	20.519	28.284	47.159
2615	NH1	ARG	336	19.739	27.812	48.138
2616	NH2	ARG	336	20.305	29.512	46.668
2617	C	ARG	336	19.781	26.746	42.916
2618	O	ARG	336	19.371	27.242	43.971
2619	N	LEU	337	19.175	26.922	41.751
2621	CA	LEU	337	17.827	27.502	41.645
2622	CB	LEU	337	17.817	29.040	41.645
2623	CG	LEU	337	18.339	29.741	40.390
2624	CD1	LEU	337	17.590	31.049	40.170
2625	CD2	LEU	337	19.841	29.998	40.424
2626	C	LEU	337	17.132	26.922	40.411
2627	O	LEU	337	17.767	26.225	39.607
2628	N	LYS	338	15.842	27.185	40.268
2630	CA	LYS	338	15.076	26.571	39.172
2631	CB	LYS	338	13.614	26.503	39.590
2632	CG	LYS	338	13.468	25.752	40.907
2633	CD	LYS	338	12.006	25.624	41.316
2634	CE	LYS	338	11.221	24.825	40.283
2635	NZ	LYS	338	9.810	24.693	40.679
2636	C	LYS	338	15.184	27.328	37.849
2637	O	LYS	338	15.037	26.723	36.781
2638	N	VAL	339	15.491	28.613	37.907
2640	CA	VAL	339	15.725	29.367	36.670
2641	CB	VAL	339	15.574	30.859	36.946
2642	CG1	VAL	339	15.808	31.678	35.680
2643	CG2	VAL	339	14.206	31.171	37.541
2644	C	VAL	339	17.136	29.070	36.182
2645	O	VAL	339	18.114	29.518	36.793
2646	N	ALA	340	17.223	28.249	35.149
2648	CA	ALA	340	18.519	27.795	34.641
2649	CB	ALA	340	18.287	26.659	33.654
2650	C	ALA	340	19.332	28.890	33.962
2651	O	ALA	340	18.835	29.627	33.102
2652	N	LEU	341	20.557	29.031	34.435
2654	CA	LEU	341	21.563	29.847	33.760
2655	CB	LEU	341	21.908	31.037	34.647
2656	CG	LEU	341	22.861	32.003	33.955
2657	CD1	LEU	341	22.312	32.439	32.601
2658	CD2	LEU	341	23.141	33.213	34.840
2659	C	LEU	341	22.769	28.942	33.543
2660	O	LEU	341	23.356	28.870	32.459
2661	N	GLU	342	23.044	28.181	34.587
2663	CA	GLU	342	23.988	27.060	34.560
2664	CB	GLU	342	24.978	27.247	35.708
2665	CG	GLU	342	26.321	27.632	35.109
2666	CD	GLU	342	27.369	27.935	36.161
2667	OE1	GLU	342	28.321	27.166	36.216
2668	OE2	GLU	342	27.407	29.089	36.560
2669	C	GLU	342	23.161	25.783	34.694
2670	O	GLU	342	21.929	25.915	34.757
2671	N	PRO	343	23.750	24.599	34.545
2672	CA	PRO	343	22.989	23.330	34.646
2673	CB	PRO	343	23.942	22.265	34.209
2674	CG	PRO	343	25.308	22.871	33.946
2675	CD	PRO	343	25.155	24.362	34.180
2676	C	PRO	343	22.431	22.977	36.033
2677	O	PRO	343	22.637	21.856	36.512
2678	N	GLN	344	21.489	23.784	36.490
2680	CA	GLN	344	20.836	23.618	37.789
2681	CB	GLN	344	20.445	25.015	38.230
2682	CG	GLN	344	21.612	25.961	38.001
2683	CD	GLN	344	21.084	27.356	37.706
2684	OE1	GLN	344	21.795	28.204	37.155
2685	NE2	GLN	344	19.804	27.533	37.959
2688	C	GLN	344	19.578	22.779	37.631
2689	O	GLN	344	19.110	22.127	38.567
2690	N	LEU	345	19.100	22.739	36.399
2692	CA	LEU	345	18.006	21.838	36.030
2693	CB	LEU	345	17.130	22.505	34.972
2694	CG	LEU	345	16.351	23.691	35.533
2695	CD1	LEU	345	15.513	24.354	34.444
2696	CD2	LEU	345	15.458	23.257	36.692
2697	C	LEU	345	18.536	20.507	35.491
2698	O	LEU	345	17.746	19.628	35.130
2699	N	TRP	346	19.852	20.373	35.411
2701	CA	TRP	346	20.451	19.124	34.941
2702	CB	TRP	346	21.485	19.460	33.871
2703	CG	TRP	346	22.287	18.280	33.351
2704	CD1	TRP	346	21.792	17.102	32.836
2705	NE1	TRP	346	22.839	16.310	32.492
2707	CE2	TRP	346	24.013	16.914	32.746
2708	CZ2	TRP	346	25.332	16.521	32.569
2709	CH2	TRP	346	26.363	17.381	32.931
2710	CZ3	TRP	346	26.077	18.632	33.470
2711	CE3	TRP	346	24.759	19.031	33.650
2712	CD2	TRP	346	23.728	18.179	33.291
2713	C	TRP	346	21.119	18.395	36.100
2714	O	TRP	346	21.096	17.160	36.176
2715	N	GLU	347	21.686	19.161	37.014
2717	CA	GLU	347	22.334	18.557	38.176
2718	CB	GLU	347	23.663	19.256	38.434
2719	CG	GLU	347	24.677	18.946	37.340
2720	CD	GLU	347	24.954	17.444	37.290
2721	OE1	GLU	347	25.324	16.972	36.225
2722	OE2	GLU	347	24.790	16.795	38.316
2723	C	GLU	347	21.475	18.630	39.425
2724	O	GLU	347	21.212	19.709	39.965
2725	N	LEU	348	21.060	17.460	39.877
2727	CA	LEU	348	20.327	17.353	41.141
2728	CB	LEU	348	19.188	16.356	40.934
2729	CG	LEU	348	18.164	16.396	42.064
2730	CD1	LEU	348	17.591	17.800	42.229
2731	CD2	LEU	348	17.048	15.390	41.813
2732	C	LEU	348	21.267	16.880	42.259
2733	O	LEU	348	20.924	16.947	43.445
2734	N	GLY	349	22.468	16.474	41.873
2736	CA	GLY	349	23.463	15.983	42.838
2737	C	GLY	349	24.241	17.116	43.507
2738	O	GLY	349	24.430	18.190	42.925
2739	N	LYS	350	24.667	16.857	44.734
2741	CA	LYS	350	25.435	17.832	45.522
2742	CB	LYS	350	25.357	17.469	47.000
2743	CG	LYS	350	23.955	17.734	47.529
2744	CD	LYS	350	23.579	19.201	47.330
2745	CE	LYS	350	22.155	19.485	47.800
2746	NZ	LYS	350	21.809	20.905	47.617
2747	C	LYS	350	26.891	17.928	45.071
2748	O	LYS	350	27.366	17.149	44.237
2749	N	VAL	351	27.577	18.915	45.624
2751	CA	VAL	351	28.941	19.248	45.182
2752	CB	VAL	351	28.999	20.770	45.057
2753	CG1	VAL	351	28.042	21.208	43.960
2754	CG2	VAL	351	28.630	21.487	46.355
2755	C	VAL	351	30.041	18.694	46.101
2756	O	VAL	351	30.258	19.175	47.217
2757	N	LEU	352	30.752	17.696	45.600
2759	CA	LEU	352	31.816	17.042	46.379
2760	CB	LEU	352	31.210	16.151	47.475
2761	CG	LEU	352	30.081	15.229	47.010
2762	CD1	LEU	352	30.368	13.782	47.391
2763	CD2	LEU	352	28.736	15.660	47.586
2764	C	LEU	352	32.782	16.241	45.497
2765	O	LEU	352	32.702	15.010	45.421
2766	N	ARG	353	33.725	16.933	44.875
2768	CA	ARG	353	34.676	16.246	43.983
2769	CB	ARG	353	34.271	16.499	42.538
2770	CG	ARG	353	33.320	15.419	42.038
2771	CD	ARG	353	34.033	14.077	41.969
2112	NE	ARG	353	33.146	13.018	41.475
2773	CZ	ARG	353	32.948	11.880	42.142
2774	NH1	ARG	353	33.548	11.687	43.318
2775	NH2	ARG	353	32.136	10.946	41.643
2776	C	ARG	353	36.151	16.614	44.165
2777	O	ARG	353	36.603	17.109	45.203
2778	N	LYS	354	36.889	16.297	43.115
2780	CA	LYS	354	38.347	16.444	43.062
2781	CB	LYS	354	38.858	15.119	42.523
2782	CG	LYS	354	38.080	14.733	41.269
2783	CD	LYS	354	38.035	13.223	41.077
2784	CE	LYS	354	37.310	12.537	42.228
2785	NZ	LYS	354	37.135	11.102	41.954
2786	C	LYS	354	38.768	17.610	42.168
2787	O	LYS	354	37.924	18.422	41.766
2788	N	ALA	355	40.061	17.716	41.900
2790	CA	ALA	355	40.551	18.854	41.110
2791	CB	ALA	355	40.902	19.992	42.062
2792	C	ALA	355	41.760	18.540	40.228
2793	O	ALA	355	42.784	18.019	40.685
2794	N	GLY	356	41.640	18.905	38.965
2796	CA	GLY	356	42.772	18.820	38.036
2797	C	GLY	356	43.180	20.213	37.558
2798	O	GLY	356	42.364	21.142	37.553
2799	N	LEU	357	44.451	20.374	37.238
2801	CA	LEU	357	44.930	21.662	36.723
2802	CB	LEU	357	45.556	22.450	37.872
2803	CG	LEU	357	45.917	23.877	37.464
2804	CD1	LEU	357	44.728	24.596	36.839
2805	CD2	LEU	357	46.452	24.675	38.648
2806	C	LEU	357	45.937	21.452	35.594
2807	O	LEU	357	47.016	20.888	35.802
2808	N	SER	358	45.550	21.887	34.405
2810	CA	SER	358	46.391	21.798	33.201
2811	CB	SER	358	45.487	21.326	32.065
2812	OG	SER	358	46.252	21.176	30.878
2813	C	SER	358	47.025	23.146	32.833
2814	O	SER	358	46.503	24.205	33.200
2815	N	ALA	359	48.163	23.094	32.156
2817	CA	ALA	359	48.827	24.294	31.624
2818	CB	ALA	359	49.917	24.743	32.593
2819	C	ALA	359	49.448	23.986	30.262
2820	O	ALA	359	50.573	23.478	30.187
2821	N	GLY	360	48.736	24.313	29.198
2823	CA	GLY	360	49.185	23.925	27.861
2824	C	GLY	360	49.845	25.041	27.057
2825	O	GLY	360	49.171	25.880	26.448
2826	N	TYR	361	51.169	25.048	27.110
2828	CA	TYR	361	52.032	25.826	26.195
2829	CB	TYR	361	51.791	25.329	24.772
2830	CG	TYR	361	52.095	23.852	24.555
2831	CD1	TYR	361	53.374	23.364	24.794
2832	CE1	TYR	361	53.649	22.018	24.601
2833	CZ	TYR	361	52.646	21.165	24.165
2834	OH	TYR	361	52.913	19.825	24.008
2835	CE2	TYR	361	51.369	21.650	23.915
2836	CD2	TYR	361	51.094	22.997	24.109
2837	C	TYR	361	51.867	27.348	26.198
2838	O	TYR	361	50.811	27.912	26.500
2839	N	VAL	362	52.938	27.995	25.766
2841	CA	VAL	362	52.959	29.451	25.532
2842	CB	VAL	362	54.338	30.000	25.887
2843	CG1	VAL	362	54.561	30.110	27.385
2844	CG2	VAL	362	55.447	29.188	25.225
2845	C	VAL	362	52.701	29.791	24.063
2846	O	VAL	362	52.889	30.942	23.647
2847	N	ASP	363	52.204	28.822	23.312
2849	CA	ASP	363	52.287	28.869	21.846
2850	CB	ASP	363	52.657	27.475	21.339
2851	CG	ASP	363	54.058	27.086	21.811
2852	OD1	ASP	363	54.170	26.587	22.925
2853	OD2	ASP	363	55.001	27.383	21.092
2854	C	ASP	363	51.014	29.347	21.155
2855	O	ASP	363	50.411	28.608	20.366
2856	N	ALA	364	50.621	30.576	21.441
2858	CA	ALA	364	49.531	31.199	20.682
2859	CB	ALA	364	48.979	32.379	21.473
2860	C	ALA	364	50.073	31.682	19.338
2861	O	ALA	364	50.881	32.618	19.279
2862	N	GLY	365	49.594	31.071	18.266
2864	CA	GLY	365	50.111	31.368	16.921
2865	C	GLY	365	49.446	32.569	16.246
2866	O	GLY	365	48.809	32.427	15.193
2867	N	ALA	366	49.787	33.754	16.729
2869	CA	ALA	366	49.213	34.990	16.189
2870	CB	ALA	366	49.529	36.129	17.152
2871	C	ALA	366	49.799	35.308	14.823
2872	O	ALA	366	49.054	35.581	13.873
2873	N	GLU	367	51.076	35.005	14.676
2875	CA	GLU	367	51.766	35.178	13.389
2876	CB	GLU	367	53.284	34.984	13.526
2877	CG	GLU	367	54.028	36.164	14.165
2878	CD	GLU	367	53.893	36.204	15.689
2879	OE1	GLU	367	53.550	35.169	16.251
2880	OE2	GLU	367	53.972	37.291	16.239
2881	C	GLU	367	51.181	34.272	12.289
2882	O	GLU	367	50.691	34.847	11.310
2883	N	PRO	368	51.116	32.945	12.435
2884	CA	PRO	368	50.460	32.148	11.388
2885	CB	PRO	368	50.603	30.718	11.810
2886	CG	PRO	368	51.331	30.650	13.139
2887	CD	PRO	368	51.648	32.086	13.510
2888	C	PRO	368	48.987	32.507	11.162
2889	O	PRO	368	48.614	32.701	10.000
2890	N	GLY	369	48.242	32.819	12.213
2892	CA	GLY	369	46.837	33.230	12.065
2893	C	GLY	369	46.677	34.452	11.159
2894	O	GLY	369	46.056	34.357	10.089
2895	N	ARG	370	47.445	35.488	11.457
2897	CA	ARG	370	47.369	36.756	10.722
2898	CB	ARG	370	48.101	37.794	11.568
2899	CG	ARG	370	47.971	39.204	11.007
2900	CD	ARG	370	46.513	39.652	10.987
2901	NE	ARG	370	46.384	41.040	10.518
2902	CZ	ARG	370	46.336	42.091	11.341
2903	NH1	ARG	370	46.171	43.319	10.845
2904	NH2	ARG	370	46.415	41.912	12.662
2905	C	ARG	370	48.017	36.693	9.334
2906	O	ARG	370	47.657	37.478	8.451
2907	N	SER	371	48.858	35.701	9.102
2909	CA	SER	371	49.481	35.548	7.785
2910	CB	SER	371	50.911	35.051	7.962
2911	OG	SER	371	50.858	33.745	8.522
2912	C	SER	371	48.720	34.579	6.880
2913	O	SER	371	49.098	34.415	5.714
2914	N	ARG	372	47.717	33.898	7.412
2916	CA	ARG	372	46.917	33.002	6.576
2917	CB	ARG	372	46.766	31.656	7.275
2918	CG	ARG	372	48.097	30.943	7.467
2919	CD	ARG	372	47.881	29.617	8.185
2920	NE	ARG	372	47.128	29.831	9.432
2921	CZ	ARG	372	47.331	29.120	10.543
2922	NH1	ARG	372	46.639	29.401	11.649
2923	NH2	ARG	372	48.250	28.152	10.558
2924	C	ARG	372	45.527	33.566	6.319
2925	O	ARG	372	44.863	33.176	5.350
2926	N	MET	373	45.069	34.433	7.204
2928	CA	MET	373	43.730	34.995	7.030
2929	CB	MET	373	43.063	35.132	8.388
2930	CG	MET	373	42.804	33.732	8.924
2931	SD	MET	373	41.896	32.674	7.771
2932	CE	MET	373	42.976	31.222	7.797
2933	C	MET	373	43.741	36.312	6.275
2934	O	MET	373	44.663	37.124	6.390
2935	N	ILE	374	42.682	36.506	5.508
2937	CA	ILE	374	42.547	37.716	4.698
2938	CB	ILE	374	41.817	37.360	3.404
2939	CG2	ILE	374	42.699	36.478	2.527
2940	CG1	ILE	374	40.485	36.667	3.679
2941	CD1	ILE	374	39.757	36.318	2.387
2942	C	ILE	374	41.809	38.814	5.459
2943	O	ILE	374	41.817	39.979	5.045
2944	N	SER	375	41.196	38.449	6.573
2946	CA	SER	375	40.589	39.461	7.432
2947	CB	SER	375	39.068	39.339	7.420
2948	OG	SER	375	38.696	38.316	8.333
2949	C	SER	375	41.087	39.307	8.859
2950	O	SER	375	41.291	38.192	9.360
2951	N	GLN	376	41.032	40.422	9.566
2953	CA	GLN	376	41.412	40.451	10.978
2954	CB	GLN	376	41.679	41.904	11.344
2955	CG	GLN	376	42.197	42.072	12.766
2956	CD	GLN	376	42.345	43.560	13.055
2957	OE1	GLN	376	41.434	44.347	12.774
2958	NE2	GLN	376	43.511	43.938	13.549
2961	C	GLN	376	40.301	39.876	11.860
2962	O	GLN	376	40.585	39.357	12.944
2963	N	GLU	377	39.106	39.750	11.301
2965	CA	GLU	377	38.014	39.088	12.016
2966	CB	GLU	377	36.703	39.393	11.303
2967	CG	GLU	377	35.501	38.895	12.098
2968	CD	GLU	377	34.219	39.259	11.358
2969	OE1	GLU	377	33.170	38.760	11.737
2970	OE2	GLU	377	34.321	40.034	10.416
2971	C	GLU	377	38.249	37.580	12.056
2972	O	GLU	377	38.191	36.992	13.143
2973	N	GLU	378	38.724	37.017	10.951
2975	CA	GLU	378	39.119	35.609	10.933
2976	CB	GLU	378	39.519	35.267	9.507
2977	CG	GLU	378	38.340	35.208	8.551
2978	CD	GLU	378	38.885	35.116	7.133
2979	OE1	GLU	378	38.146	34.687	6.260
2980	OE2	GLU	378	39.950	35.687	6.914
2981	C	GLU	378	40.320	35.363	11.835
2982	O	GLU	378	40.253	34.487	12.705
2983	N	PHE	379	41.268	36.285	11.801
2985	CA	PHE	379	42.442	36.210	12.676
2986	CB	PHE	379	43.313	37.433	12.402
2987	CG	PHE	379	44.368	37.728	13.465
2988	CD1	PHE	379	45.274	36.751	13.856
2989	CE1	PHE	379	46.226	37.034	14.827
2990	CZ	PHE	379	46.271	38.294	15.409
2991	CE2	PHE	379	45.364	39.271	15.021
2992	CD2	PHE	379	44.413	38.988	14.050
2993	C	PHE	379	42.058	36.169	14.154
2994	O	PHE	379	42.413	35.197	14.832
2995	N	ALA	380	41.161	37.046	14.574
2997	CA	ALA	380	40.772	37.102	15.984
2998	CB	ALA	380	39.900	38.334	16.199
2999	C	ALA	380	40.007	35.859	16.416
3000	O	ALA	380	40.485	35.138	17.303
3001	N	ARG	381	39.037	35.453	15.612
3003	CA	ARG	381	38.201	34.312	15.990
3004	CB	ARG	381	37.035	34.204	15.018
3005	CG	ARG	381	36.117	35.414	15.108
3006	CD	ARG	381	34.975	35.290	14.112
3007	NE	ARG	381	35.499	35.176	12.743
3008	CZ	ARG	381	34.716	35.069	11.669
3009	NH1	ARG	381	35.254	35.072	10.448
3010	NH2	ARG	381	33.390	35.041	11.814
3011	C	ARG	381	38.967	32.996	15.977
3012	O	ARG	381	38.987	32.313	17.005
3013	N	GLN	382	39.794	32.788	14.969
3015	CA	GLN	382	40.485	31.504	14.824
3016	CB	GLN	382	40.863	31.359	13.362
3017	CG	GLN	382	39.624	31.480	12.484
3018	CD	GLN	382	40.055	31.552	11.028
3019	OE1	GLN	382	39.530	32.343	10.235
3020	NE2	GLN	382	41.041	30.737	10.702
3023	C	GLN	382	41.734	31.394	15.695
3024	O	GLN	382	42.075	30.286	16.131
3025	N	LEU	383	42.283	32.525	16.108
3027	CA	LEU	383	43.401	32.489	17.049
3028	CB	LEU	383	44.147	33.812	16.978
3029	CG	LEU	383	45.271	33.875	18.001
3030	CD1	LEU	383	46.268	32.745	17.783
3031	CD2	LEU	383	45.966	35.229	17.952
3032	C	LEU	383	42.875	32.279	18.461
3033	O	LEU	383	43.378	31.411	19.190
3034	N	GLN	384	41.686	32.808	18.698
3036	CA	GLN	384	41.049	32.647	20.001
3037	CB	GLN	384	39.935	33.672	20.115
3038	CG	GLN	384	39.730	34.083	21.559
3039	CD	GLN	384	40.740	35.159	21.927
3040	OE1	GLN	384	40.730	36.242	21.330
3041	NE2	GLN	384	41.631	34.835	22.846
3044	C	GLN	384	40.442	31.255	20.144
3045	O	GLN	384	40.443	30.704	21.251
3046	N	LEU	385	40.204	30.607	19.013
3048	CA	LEU	385	39.704	29.231	18.981
3049	CB	LEU	385	39.035	28.972	17.641
3050	CG	LEU	385	37.639	29.573	17.643
3051	CD1	LEU	385	36.980	29.448	16.275
3052	CD2	LEU	385	36.796	28.909	18.723
3053	C	LEU	385	40.782	28.185	19.228
3054	O	LEU	385	40.438	27.079	19.664
3055	N	SER	386	42.032	28.616	19.277
3057	CA	SER	386	43.114	27.712	19.666
3058	CB	SER	386	44.440	28.348	19.266
3059	OG	SER	386	44.358	28.686	17.885
3060	C	SER	386	43.070	27.494	21.178
3061	O	SER	386	43.305	26.372	21.651
3062	N	ASP	387	42.475	28.460	21.867
3064	CA	ASP	387	42.215	28.333	23.305
3065	CB	ASP	387	41.669	29.641	23.894
3066	CG	ASP	387	42.527	30.856	23.539
3067	OD1	ASP	387	43.741	30.711	23.493
3068	OD2	ASP	387	41.964	31.945	23.481
3069	C	ASP	387	41.257	27.159	23.575
3070	O	ASP	387	41.767	26.162	24.100
3071	N	PRO	388	40.002	27.136	23.111
3072	CA	PRO	388	39.148	25.981	23.419
3073	CB	PRO	388	37.756	26.380	23.041
3074	CG	PRO	388	37.807	27.683	22.270
3075	CD	PRO	388	39.252	28.139	22.337
3076	C	PRO	388	39.523	24.680	22.697
3077	O	PRO	388	39.111	23.620	23.174
3078	N	GLN	389	40.379	24.712	21.687
3080	CA	GLN	389	40.829	23.452	21.093
3081	CB	GLN	389	41.488	23.751	19.755
3082	CG	GLN	389	40.438	24.215	18.754
3083	CD	GLN	389	41.088	24.787	17.499
3084	OE1	GLN	389	42.222	25.282	17.528
3085	NE2	GLN	389	40.319	24.787	16.425
3088	C	GLN	389	41.798	22.740	22.031
3089	O	GLN	389	41.534	21.593	22.422
3090	N	THR	390	42.701	23.502	22.625
3092	CA	THR	390	43.640	22.912	23.589
3093	CB	THR	390	44.872	23.803	23.694
3094	OG1	THR	390	44.457	25.096	24.114
3095	CG2	THR	390	45.576	23.940	22.348
3096	C	THR	390	43.003	22.740	24.969
3097	O	THR	390	43.302	21.761	25.665
3098	N	VAL	391	41.968	23.519	25.235
3100	CA	VAL	391	41.209	23.386	26.480
3101	CB	VAL	391	40.428	24.682	26.693
3102	CG1	VAL	391	39.209	24.513	27.591
3103	CG2	VAL	391	41.336	25.797	27.203
3104	C	VAL	391	40.273	22.176	26.454
3105	O	VAL	391	40.177	21.481	27.472
3106	N	ALA	392	39.835	21.767	25.273
3108	CA	ALA	392	39.021	20.553	25.165
3109	CB	ALA	392	38.199	20.611	23.882
3110	C	ALA	392	39.909	19.316	25.151
3111	O	ALA	392	39.536	18.283	25.723
3112	N	GLY	393	41.142	19.498	24.705
3114	CA	GLY	393	42.157	18.446	24.807
3115	C	GLY	393	42.448	18.135	26.272
3116	O	GLY	393	42.257	16.994	26.716
3117	N	ALA	394	42.705	19.180	27.044
3119	CA	ALA	394	42.992	19.020	28.474
3120	CB	ALA	394	43.546	20.341	28.992
3121	C	ALA	394	41.768	18.623	29.305
3122	O	ALA	394	41.915	17.841	30.253
3123	N	PHE	395	40.577	18.960	28.836
3125	CA	PHE	395	39.345	18.539	29.511
3126	CB	PHE	395	38.188	19.327	28.906
3127	CG	PHE	395	36.849	19.216	29.633
3128	CD1	PHE	395	36.806	18.933	30.993
3129	CE1	PHE	395	35.586	18.857	31.651
3130	CZ	PHE	395	34.406	19.059	30.948
3131	CE2	PHE	395	34.447	19.335	29.588
3132	CD2	PHE	395	35.668	19.415	28.931
3133	C	PHE	395	39.108	17.050	29.297
3134	O	PHE	395	38.822	16.323	30.257
3135	N	GLY	396	39.414	16.579	28.100
3137	CA	GLY	396	39.339	15.149	27.795
3138	C	GLY	396	40.295	14.366	28.685
3139	O	GLY	396	39.840	13.536	29.487
3140	N	TYR	397	41.543	14.810	28.710
3142	CA	TYR	397	42.587	14.137	29.491
3143	CB	TYR	397	43.921	14.842	29.266
3144	CG	TYR	397	44.485	14.724	27.853
3145	CD1	TYR	397	45.178	15.791	27.295
3146	CE1	TYR	397	45.691	15.690	26.009
3147	CZ	TYR	397	45.516	14.518	25.287
3148	OH	TYR	397	46.052	14.405	24.023
3149	CE2	TYR	397	44.832	13.445	25.844
3150	CD2	TYR	397	44.319	13.548	27.130
3151	C	TYR	397	42.295	14.121	30.988
3152	O	TYR	397	42.257	13.027	31.563
3153	N	PHE	398	41.840	15.231	31.548
3155	CA	PHE	398	41.607	15.278	32.999
3156	CB	PHE	398	41.742	16.713	33.495
3157	CG	PHE	398	43.198	17.112	33.732
3158	CD1	PHE	398	43.753	16.944	34.994
3159	CE1	PHE	398	45.078	17.289	35.224
3160	CZ	PHE	398	45.853	17.800	34.191
3161	CE2	PHE	398	45.300	17.966	32.929
3162	CD2	PHE	398	43.974	17.624	32.699
3163	C	PHE	398	40.290	14.648	33.448
3164	O	PHE	398	40.235	14.129	34.575
3165	N	GLN	399	39.368	14.444	32.520
3167	CA	GLN	399	38.179	13.659	32.843
3168	CB	GLN	399	37.082	13.908	31.820
3169	CG	GLN	399	36.409	15.257	32.026
3170	CD	GLN	399	35.400	15.476	30.907
3171	OE1	GLN	399	34.216	15.743	31.144
3172	NE2	GLN	399	35.898	15.387	29.687
3175	C	GLN	399	38.521	12.178	32.864
3176	O	GLN	399	38.168	11.514	33.841
3177	N	GLN	400	39.442	11.756	32.013
3179	CA	GLN	400	39.879	10.355	32.043
3180	CB	GLN	400	40.692	10.070	30.786
3181	CG	GLN	400	39.908	10.326	29.505
3182	CD	GLN	400	38.730	9.363	29.392
3183	OE1	GLN	400	38.886	8.146	29.535
3184	NE2	GLN	400	37.572	9.920	29.083
3187	C	GLN	400	40.757	10.109	33.266
3188	O	GLN	400	40.502	9.174	34.042
3189	N	ASP	401	41.549	11.121	33.583
3191	CA	ASP	401	42.416	11.107	34.762
3192	CB	ASP	401	43.135	12.447	34.886
3193	CG	ASP	401	44.127	12.677	33.751
3194	OD1	ASP	401	44.621	11.698	33.222
3195	OD2	ASP	401	44.416	13.835	33.470
3196	C	ASP	401	41.640	10.882	36.049
3197	O	ASP	401	41.522	9.737	36.513
3198	N	THR	402	40.970	11.925	36.505
3200	CA	THR	402	40.385	11.888	37.847
3201	CB	THR	402	40.455	13.296	38.434
3202	OG1	THR	402	39.678	14.173	37.626
3203	CG2	THR	402	41.885	13.824	38.477
3204	C	THR	402	38.941	11.392	37.888
3205	O	THR	402	38.517	10.859	38.917
3206	N	LYS	403	38.234	11.449	36.773
3208	CA	LYS	403	36.819	11.062	36.780
3209	CB	LYS	403	36.022	12.164	36.093
3210	CG	LYS	403	36.231	13.499	36.800
3211	CD	LYS	403	35.484	14.631	36.105
3212	CE	LYS	403	35.716	15.957	36.821
3213	NZ	LYS	403	35.008	17.057	36.145
3214	C	LYS	403	36.573	9.715	36.099
3215	O	LYS	403	35.451	9.196	36.137
3216	N	GLY	404	37.608	9.158	35.492
3218	CA	GLY	404	37.506	7.830	34.882
3219	C	GLY	404	38.419	6.862	35.622
3220	O	GLY	404	38.332	5.641	35.438
3221	N	LEU	405	39.369	7.453	36.333
3223	CA	LEU	405	40.310	6.748	37.219
3224	CB	LEU	405	39.611	5.729	38.122
3225	CG	LEU	405	39.226	6.289	39.497
3226	CD1	LEU	405	38.128	7.352	39.433
3227	CD2	LEU	405	38.780	5.156	40.417
3228	C	LEU	405	41.411	6.072	36.409
3229	O	LEU	405	41.895	4.989	36.756
3230	N	VAL	406	41.844	6.762	35.365
3232	CA	VAL	406	42.959	6.287	34.537
3233	CB	VAL	406	42.556	6.425	33.068
3234	CG1	VAL	406	43.578	5.762	32.149
3235	CG2	VAL	406	41.176	5.820	32.817
3236	C	VAL	406	44.207	7.112	34.854
3237	O	VAL	406	45.326	6.726	34.499
3238	N	ASP	407	44.000	8.075	35.741
3240	CA	ASP	407	44.978	9.081	36.211
3241	CB	ASP	407	45.280	8.782	37.675
3242	CG	ASP	407	45.600	10.085	38.405
3243	OD1	ASP	407	44.947	11.075	38.095
3244	OD2	ASP	407	46.467	10.059	39.268
3245	C	ASP	407	46.284	9.193	35.416
3246	O	ASP	407	46.277	9.722	34.298
3247	N	PHE	408	47.349	8.563	35.892
3249	CA	PHE	408	48.679	8.779	35.293
3250	CB	PHE	408	49.751	8.333	36.282
3251	CG	PHE	408	49.924	9.261	37.483
3252	CD1	PHE	408	49.593	8.827	38.761
3253	CE1	PHE	408	49.757	9.678	39.846
3254	CZ	PHE	408	50.258	10.960	39.656
3255	CE2	PHE	408	50.597	11.390	38.380
3256	CD2	PHE	408	50.433	10.539	37.294
3257	C	PHE	408	48.910	8.071	33.954
3258	O	PHE	408	49.844	8.433	33.231
3259	N	ARG	409	47.970	7.244	33.529
3261	CA	ARG	409	48.080	6.565	32.239
3262	CB	ARG	409	47.320	5.251	32.342
3263	CG	ARG	409	47.914	4.406	33.460
3264	CD	ARG	409	47.084	3.159	33.735
3265	NE	ARG	409	47.685	2.369	34.822
3266	CZ	ARG	409	47.313	2.464	36.101
3267	NH1	ARG	409	47.932	1.730	37.029
3268	NH2	ARG	409	46.339	3.305	36.458
3269	C	ARG	409	47.532	7.416	31.092
3270	O	ARG	409	47.596	7.000	29.931
3271	N	ASP	410	47.007	8.594	31.403
3273	CA	ASP	410	46.602	9.535	30.352
3274	CB	ASP	410	45.354	10.288	30.769
3275	CG	ASP	410	44.159	9.356	30.855
3276	OD1	ASP	410	43.729	9.075	31.966
3277	OD2	ASP	410	43.579	9.105	29.808
3278	C	ASP	410	47.675	10.565	30.002
3279	O	ASP	410	47.343	11.560	29.344
3280	N	VAL	411	48.893	10.399	30.503
3282	CA	VAL	411	49.989	11.316	30.142
3283	CB	VAL	411	51.299	10.815	30.753
3284	CG1	VAL	411	51.339	11.017	32.261
3285	CG2	VAL	411	51.580	9.357	30.407
3286	C	VAL	411	50.131	11.428	28.622
3287	O	VAL	411	50.201	10.426	27.902
3288	N	ALA	412	50.102	12.656	28.138
3290	CA	ALA	412	50.118	12.867	26.693
3291	CB	ALA	412	48.818	13.552	26.291
3292	C	ALA	412	51.299	13.704	26.233
3293	O	ALA	412	52.020	14.316	27.029
3294	N	LEU	413	51.371	13.861	24.921
3296	CA	LEU	413	52.438	14.657	24.300
3297	CB	LEU	413	52.573	14.235	22.841
3298	CG	LEU	413	52.983	12.772	22.703
3299	CD1	LEU	413	52.943	12.328	21.244
3300	CD2	LEU	413	54.365	12.526	23.303
3301	C	LEU	413	52.154	16.158	24.364
3302	O	LEU	413	53.044	16.971	24.093
3303	N	ALA	414	50.946	16.515	24.774
3305	CA	ALA	414	50.601	17.919	24.976
3306	CB	ALA	414	49.140	18.115	24.591
3307	C	ALA	414	50.816	18.357	26.424
3308	O	ALA	414	51.018	19.552	26.673
3309	N	LEU	415	50.909	17.381	27.321
3311	CA	LEU	415	51.041	17.638	28.767
3312	CB	LEU	415	49.904	18.547	29.262
3313	CG	LEU	415	48.493	18.002	29.022
3314	CD1	LEU	415	47.931	17.349	30.283
3315	CD2	LEU	415	47.565	19.131	28.586
3316	C	LEU	415	51.074	16.327	29.551
3317	O	LEU	415	50.271	15.412	29.314
3318	N	ALA	416	52.026	16.229	30.460
3320	CA	ALA	416	52.091	15.051	31.328
3321	CB	ALA	416	53.547	14.724	31.633
3322	C	ALA	416	51.328	15.287	32.628
3323	O	ALA	416	51.456	16.336	33.265
3324	N	ALA	417	50.520	14.312	32.998
3326	CA	ALA	417	49.803	14.371	34.272
3327	CB	ALA	417	48.754	13.268	34.274
3328	C	ALA	417	50.779	14.156	35.425
3329	O	ALA	417	51.426	13.106	35.516
3330	N	LEU	418	50.863	15.133	36.312
3332	CA	LEU	418	51.824	15.041	37.418
3333	CB	LEU	418	53.203	15.432	36.891
3334	CG	LEU	418	54.297	15.242	37.936
3335	CD1	LEU	418	54.293	13.825	38.502
3336	CD2	LEU	418	55.664	15.580	37.355
3337	C	LEU	418	51.440	15.927	38.603
3338	O	LEU	418	51.618	17.151	38.577
3339	N	ASP	419	50.862	15.295	39.613
3341	CA	ASP	419	50.535	15.970	40.880
3342	CB	ASP	419	49.413	15.193	41.569
3343	CG	ASP	419	49.094	15.789	42.944
3344	OD1	ASP	419	48.821	16.984	42.965
3345	OD2	ASP	419	49.471	15.152	43.918
3346	C	ASP	419	51.739	16.016	41.816
3347	O	ASP	419	52.336	14.978	42.117
3348	N	GLY	420	52.017	17.193	42.352
3350	CA	GLY	420	53.109	17.334	43.320
3351	C	GLY	420	52.588	17.663	44.718
3352	O	GLY	420	52.534	18.831	45.118
3353	N	GLY	421	52.252	16.631	45.472
3355	CA	GLY	421	51.750	16.842	46.834
3356	C	GLY	421	52.874	16.842	47.869
3357	O	GLY	421	53.368	15.780	48.263
3358	N	ARG	422	53.284	18.032	48.282
3360	CA	ARG	422	54.295	18.150	49.345
3361	CB	ARG	422	54.772	19.595	49.478
3362	CG	ARG	422	55.690	20.043	48.345
3363	CD	ARG	422	56.262	21.422	48.670
3364	NE	ARG	422	57.227	21.889	47.661
3365	CZ	ARG	422	57.592	23.169	47.555
3366	NH1	ARG	422	57.069	24.079	48.378
3367	NH2	ARG	422	58.461	23.544	46.615
3368	C	ARG	422	53.729	17.703	50.690
3369	O	ARG	422	52.563	17.974	50.939
3370	OXT	ARG	422	54.486	17.125	51.459

[1365]

TABLE V
			Residue
	ATOM	Resi-	Posi-
ATOM	Type	due	tion	X Coord	Y Coord	Z Coord
1	N	PRO	27	21.535	30.577	67.331
2	CA	PRO	27	21.824	31.591	68.345
3	C	PRO	27	22.251	32.903	67.700
4	O	PRO	27	21.405	33.719	67.311
5	CB	PRO	27	22.912	31.003	69.192
6	CG	PRO	27	23.230	29.597	68.700
7	CD	PRO	27	22.318	29.352	67.508
8	N	MET	28	23.547	33.008	67.447
9	CA	MET	28	24.141	34.222	66.876
10	C	MET	28	23.524	34.569	65.529
11	O	MET	28	22.876	35.615	65.417
12	CB	MET	28	25.631	33.973	66.679
13	CG	MET	28	26.341	33.703	68.000
14	SD	MET	28	26.383	35.090	69.157
15	CE	MET	28	27.228	34.280	70.535
16	N	VAL	29	23.459	33.581	64.653
17	CA	VAL	29	22.919	33.764	63.296
18	C	VAL	29	21.516	34.426	63.252
19	O	VAL	29	21.456	35.569	62.774
20	CB	VAL	29	22.972	32.401	62.603
21	CG1	VAL	29	22.619	32.503	61.129
22	CG2	VAL	29	24.355	31.780	62.757
23	N	PRO	30	20.454	33.854	63.827
24	CA	PRO	30	19.157	34.552	63.786
25	C	PRO	30	19.043	35.775	64.712
26	O	PRO	30	18.286	36.696	64.382
27	CB	PRO	30	18.145	33.522	64.182
28	CG	PRO	30	18.860	32.288	64.706
29	CD	PRO	30	20.340	32.553	64.508
30	N	ARG	31	19.906	35.895	65.709
31	CA	ARG	31	19.864	37.051	66.611
32	C	ARG	31	20.447	38.285	65.930
33	O	ARG	31	19.847	39.367	65.983
34	CB	ARG	31	20.699	36.694	67.833
35	CG	ARG	31	20.729	37.795	68.881
36	CD	ARG	31	21.555	37.356	70.083
37	NE	ARG	31	21.018	36.104	70.643
38	CZ	ARG	31	21.769	35.032	70.902
39	NH1	ARG	31	21.199	33.910	71.346
40	NH2	ARG	31	23.082	35.062	70.664
41	N	GLN	32	21.403	38.039	65.053
42	CA	GLN	32	21.990	39.101	64.240
43	C	GLN	32	20.980	39.628	63.225
44	O	GLN	32	20.692	40.834	63.223
45	CB	GLN	32	23.177	38.491	63.506
46	CG	GLN	32	24.301	38.091	64.453
47	CD	GLN	32	25.196	37.073	63.754
48	OE1	GLN	32	26.030	36.408	64.384
49	NE2	GLN	32	24.897	36.852	62.486
50	N	ALA	33	20.223	38.715	62.636
51	CA	ALA	33	19.210	39.104	61.647
52	C	ALA	33	17.965	39.739	62.264
53	O	ALA	33	17.298	40.545	61.604
54	CB	ALA	33	18.781	37.858	60.888
55	N	SER	34	17.734	39.496	63.544
56	CA	SER	34	16.591	40.108	64.226
57	C	SER	34	16.950	41.441	64.882
58	O	SER	34	16.056	42.148	65.360
59	CB	SER	34	16.056	39.147	65.283
60	OG	SER	34	17.059	38.968	66.274
61	N	PHE	35	18.232	41.766	64.941
62	CA	PHE	35	18.631	43.085	65.436
63	C	PHE	35	19.074	44.002	64.303
64	O	PHE	35	19.417	45.160	64.578
65	CB	PHE	35	19.715	42.933	66.494
66	CG	PHE	35	19.153	42.473	67.835
67	CD1	PHE	35	18.152	43.217	68.447
68	CD2	PHE	35	19.631	41.321	68.445
69	CE1	PHE	35	17.627	42.808	69.666
70	CE2	PHE	35	19.105	40.911	69.663
71	CZ	PHE	35	18.103	41.654	70.274
72	N	PHE	36	19.319	43.388	63.151
73	CA	PHE	36	19.417	44.011	61.801
74	C	PHE	36	20.525	43.363	60.949
75	O	PHE	36	20.192	42.804	59.899
76	CB	PHE	36	19.508	45.545	61.750
77	CG	PHE	36	18.226	46.310	62.086
78	CD1	PHE	36	16.983	45.768	61.788
79	CD2	PHE	36	18.311	47.556	62.695
80	CE1	PHE	36	15.826	46.469	62.102
81	CE2	PHE	36	17.155	48.257	63.010
82	CZ	PHE	36	15.912	47.713	62.714
83	N	PRO	37	21.806	43.524	61.280
84	CA	PRO	37	22.852	42.930	60.441
85	C	PRO	37	23.154	41.487	60.838
86	O	PRO	37	23.287	41.181	62.026
87	CB	PRO	37	24.057	43.781	60.693
88	CG	PRO	37	23.845	44.543	61.992
89	CD	PRO	37	22.407	44.267	62.400
90	N	PRO	38	23.362	40.621	59.861
91	CA	PRO	38	22.990	40.862	58.469
92	C	PRO	38	21.496	40.633	58.267
93	O	PRO	38	20.899	39.817	58.981
94	CB	PRO	38	23.770	39.833	57.710
95	CG	PRO	38	24.226	38.755	58.681
96	CD	PRO	38	23.822	39.248	60.056
97	N	PRO	39	20.940	41.279	57.253
98	CA	PRO	39	19.554	41.027	56.854
99	C	PRO	39	19.338	39.542	56.599
100	O	PRO	39	20.195	38.878	55.999
101	CB	PRO	39	19.332	41.848	55.622
102	CG	PRO	39	20.600	42.626	55.305
103	CD	PRO	39	21.614	42.232	56.366
104	N	VAL	40	18.135	39.089	56.914
105	CA	VAL	40	17.801	37.653	56.980
106	C	VAL	40	18.092	36.720	55.767
107	O	VAL	40	18.431	35.566	56.068
108	CB	VAL	40	16.335	37.573	57.417
109	CG1	VAL	40	15.398	38.342	56.494
110	CG2	VAL	40	15.855	36.143	57.613
111	N	PRO	41	18.127	37.122	54.491
112	CA	PRO	41	18.599	36.159	53.482
113	C	PRO	41	20.062	35.724	53.659
114	O	PRO	41	20.332	34.529	53.484
115	CB	PRO	41	18.406	36.824	52.154
116	CG	PRO	41	17.914	38.244	52.366
117	CD	PRO	41	17.769	38.411	53.867
118	N	ASN	42	20.917	36.563	54.228
119	CA	ASN	42	22.300	36.131	54.471
120	C	ASN	42	22.384	35.051	55.561
121	O	ASN	42	22.879	33.974	55.211
122	CB	ASN	42	23.227	37.296	54.792
123	CG	ASN	42	24.647	36.743	54.894
124	OD1	ASN	42	24.998	35.781	54.200
125	ND2	ASN	42	25.460	37.376	55.720
126	N	PRO	43	21.860	35.225	56.776
127	CA	PRO	43	21.801	34.089	57.712
128	C	PRO	43	21.028	32.853	57.221
129	O	PRO	43	21.412	31.740	57.600
130	CB	PRO	43	21.170	34.628	58.958
131	CG	PRO	43	20.890	36.104	58.795
132	CD	PRO	43	21.317	36.447	57.387
133	N	PHE	44	20.086	32.989	56.297
134	CA	PHE	44	19.466	31.790	55.710
135	C	PHE	44	20.480	30.997	54.891
136	O	PHE	44	20.731	29.821	55.191
137	CB	PHE	44	18.321	32.187	54.786
138	CG	PHE	44	16.987	32.464	55.466
139	CD1	PHE	44	16.040	33.255	54.828
140	CD2	PHE	44	16.702	31.903	56.705
141	CE1	PHE	44	14.814	33.495	55.433
142	CE2	PHE	44	15.477	32.145	57.311
143	CZ	PHE	44	14.532	32.940	56.675
144	N	VAL	45	21.253	31.719	54.098
145	CA	VAL	45	22.280	31.103	53.260
146	C	VAL	45	23.477	30.615	54.077
147	O	VAL	45	23.947	29.495	53.839
148	CB	VAL	45	22.722	32.154	52.249
149	CG1	VAL	45	23.910	31.676	51.433
150	CG2	VAL	45	21.571	32.547	51.332
151	N	GLN	46	23.746	31.266	55.197
152	CA	GLN	46	24.817	30.811	56.086
153	C	GLN	46	24.432	29.590	56.917
154	O	GLN	46	25.318	28.809	57.270
155	CB	GLN	46	25.194	31.947	57.024
156	CG	GLN	46	25.785	33.119	56.257
157	CD	GLN	46	26.122	34.237	57.234
158	OE1	GLN	46	25.231	34.935	57.741
159	NE2	GLN	46	27.408	34.386	57.500
160	N	GLN	47	23.151	29.305	57.062
161	CA	GLN	47	22.766	28.074	57.752
162	C	GLN	47	22.673	26.895	56.785
163	O	GLN	47	22.792	25.740	57.212
164	CB	GLN	47	21.436	28.298	58.460
165	CG	GLN	47	21.604	29.265	59.627
166	CD	GLN	47	20.245	29.635	60.214
167	OE1	GLN	47	19.966	29.398	61.395
168	NE2	GLN	47	19.453	30.308	59.399
169	N	THR	48	22.618	27.189	55.495
170	CA	THR	48	22.586	26.116	54.501
171	C	THR	48	23.983	25.773	53.986
172	O	THR	48	24.237	24.606	53.665
173	CB	THR	48	21.667	26.501	53.342
174	OG1	THR	48	22.171	27.665	52.702
175	CG2	THR	48	20.252	26.800	53.824
176	N	GLN	49	24.908	26.720	54.008
177	CA	GLN	49	26.281	26.363	53.637
178	C	GLN	49	27.093	25.949	54.862
179	O	GLN	49	27.802	24.938	54.809
180	CB	GLN	49	26.976	27.505	52.889
181	CG	GLN	49	26.899	28.839	53.622
182	CD	GLN	49	28.074	29.730	53.254
183	OE1	GLN	49	28.035	30.948	53.471
184	NE2	GLN	49	29.133	29.100	52.774
185	N	ILE	50	26.850	26.600	55.985
186	CA	ILE	50	27.554	26.288	57.223
187	C	ILE	50	26.616	25.443	58.071
188	O	ILE	50	26.466	24.256	57.754
189	CB	ILE	50	27.919	27.614	57.898
190	CG1	ILE	50	28.681	28.503	56.923
191	CG2	ILE	50	28.736	27.440	59.174
192	CD1	ILE	50	28.928	29.882	57.516
193	N	GLY	51	25.782	26.124	58.849
194	CA	GLY	51	24.875	25.504	59.834
195	C	GLY	51	25.371	24.147	60.315
196	O	GLY	51	26.430	24.025	60.941
197	N	SER	52	24.574	23.138	60.016
198	CA	SER	52	24.997	21.746	60.187
199	C	SER	52	24.969	21.069	58.822
200	O	SER	52	25.189	19.858	58.703
201	CB	SER	52	24.044	21.024	61.128
202	OG	SER	52	22.792	20.914	60.465
203	N	ALA	53	24.802	21.887	57.797
204	CA	ALA	53	24.489	21.395	56.461
205	C	ALA	53	25.713	21.185	55.581
206	O	ALA	53	26.621	20.423	55.943
207	CB	ALA	53	23.532	22.376	55.798
208	N	ARG	54	25.780	21.956	54.507
209	CA	ARG	54	26.661	21.667	53.362
210	C	ARG	54	28.104	21.328	53.722
211	O	ARG	54	28.475	20.147	53.662
212	CB	ARG	54	26.638	22.878	52.445
213	CG	ARG	54	27.044	22.511	51.026
214	CD	ARG	54	26.869	23.704	50.091
215	NE	ARG	54	25.576	24.377	50.320
216	CZ	ARG	54	24.393	23.985	49.834
217	NH1	ARG	54	24.299	22.896	49.066
218	NH2	ARG	54	23.296	24.691	50.117
219	N	ARG	55	28.831	22.276	54.294
220	CA	ARG	55	30.258	22.049	54.554
221	C	ARG	55	30.517	21.100	55.722
222	O	ARG	55	31.483	20.328	55.657
223	CB	ARG	55	30.933	23.389	54.830
224	CG	ARG	55	30.726	24.366	53.677
225	CD	ARG	55	31.637	25.581	53.804
226	NE	ARG	55	33.046	25.158	53.744
227	CZ	ARG	55	33.833	25.364	52.684
228	NH1	ARG	55	33.391	26.088	51.653
229	NH2	ARG	55	35.087	24.906	52.687
230	N	VAL	56	29.530	20.930	56.586
231	CA	VAL	56	29.692	20.036	57.729
232	C	VAL	56	29.598	18.586	57.275
233	O	VAL	56	30.564	17.828	57.446
234	CB	VAL	56	28.590	20.343	58.735
235	CG1	VAL	56	28.653	19.405	59.936
236	CG2	VAL	56	28.660	21.798	59.182
237	N	GLN	57	28.641	18.349	56.392
238	CA	GLN	57	28.418	17.010	55.852
239	C	GLN	57	29.532	16.590	54.907
240	O	GLN	57	29.987	15.445	54.988
241	CB	GLN	57	27.129	17.042	55.045
242	CG	GLN	57	25.917	17.437	55.877
243	CD	GLN	57	24.818	17.880	54.917
244	OE1	GLN	57	23.703	18.233	55.321
245	NE2	GLN	57	25.201	17.984	53.656
246	N	ILE	58	30.130	17.543	54.212
247	CA	ILE	58	31.141	17.175	53.217
248	C	ILE	58	32.515	16.940	53.832
249	O	ILE	58	33.213	16.023	53.386
250	CB	ILE	58	31.190	18.256	52.149
251	CG1	ILE	58	29.829	18.345	51.477
252	CG2	ILE	58	32.271	17.962	51.114
253	CD1	ILE	58	29.419	16.992	50.912
254	N	VAL	59	32.753	17.504	55.005
255	CA	VAL	59	34.002	17.209	55.711
256	C	VAL	59	33.893	15.879	56.461
257	O	VAL	59	34.862	15.104	56.495
258	CB	VAL	59	34.292	18.369	56.655
259	CG1	VAL	59	35.453	18.073	57.594
260	CG2	VAL	59	34.567	19.635	55.852
261	N	LEU	60	32.662	15.492	56.761
262	CA	LEU	60	32.415	14.170	57.345
263	C	LEU	60	32.494	13.083	56.275
264	O	LEU	60	33.176	12.073	56.488
265	CB	LEU	60	31.024	14.159	57.967
266	CG	LEU	60	30.906	15.149	59.120
267	CD1	LEU	60	29.460	15.275	59.584
268	CD2	LEU	60	31.816	14.760	60.280
269	N	LEU	61	32.072	13.427	55.066
270	CA	LEU	61	32.146	12.512	53.914
271	C	LEU	61	33.530	12.476	53.263
272	O	LEU	61	33.776	11.658	52.370
273	CB	LEU	61	31.116	12.944	52.875
274	CG	LEU	61	29.693	12.735	53.379
275	CD1	LEU	61	28.674	13.321	52.409
276	CD2	LEU	61	29.416	11.257	53.632
277	N	GLY	62	34.433	13.309	53.755
278	CA	GLY	62	35.826	13.284	53.322
279	C	GLY	62	36.638	12.327	54.181
280	O	GLY	62	37.772	11.978	53.828
281	N	ILE	63	36.031	11.905	55.284
282	CA	ILE	63	36.638	10.980	56.251
283	C	ILE	63	37.924	11.601	56.787
284	O	ILE	63	39.036	11.081	56.631
285	CB	ILE	63	36.870	9.612	55.601
286	CG1	ILE	63	35.592	9.091	54.943
287	CG2	ILE	63	37.345	8.592	56.633
288	CD1	ILE	63	34.498	8.804	55.969
289	N	ILE	64	37.755	12.803	57.306
290	CA	ILE	64	38.871	13.524	57.905
291	C	ILE	64	38.925	13.153	59.379
292	O	ILE	64	37.879	13.051	60.027
293	CB	ILE	64	38.625	15.013	57.673
294	CG1	ILE	64	38.448	15.250	56.178
295	CG2	ILE	64	39.762	15.881	58.205
296	CD1	ILE	64	38.307	16.729	55.856
297	N	LEU	65	40.123	12.935	59.900
298	CA	LEU	65	40.260	12.494	61.295
299	C	LEU	65	40.068	13.622	62.308
300	O	LEU	65	39.793	13.350	63.482
301	CB	LEU	65	41.633	11.864	61.482
302	CG	LEU	65	41.766	10.582	60.667
303	CD1	LEU	65	43.179	10.018	60.768
304	CD2	LEU	65	40.740	9.542	61.108
305	N	LEU	66	40.141	14.865	61.858
306	CA	LEU	66	39.755	15.990	62.726
307	C	LEU	66	38.631	16.818	62.095
308	O	LEU	66	38.796	18.044	61.998
309	CB	LEU	66	40.962	16.903	62.921
310	CG	LEU	66	42.159	16.181	63.531
311	CD1	LEU	66	43.381	17.091	63.558
312	CD2	LEU	66	41.845	15.655	64.927
313	N	PRO	67	37.450	16.239	61.891
314	CA	PRO	67	36.522	16.831	60.925
315	C	PRO	67	35.936	18.125	61.466
316	O	PRO	67	36.361	19.210	61.049
317	CB	PRO	67	35.456	15.801	60.702
318	CG	PRO	67	35.677	14.633	61.649
319	CD	PRO	67	36.956	14.950	62.407
320	N	ILE	68	35.311	17.993	62.625
321	CA	ILE	68	34.626	19.106	63.281
322	C	ILE	68	35.584	20.060	64.001
323	O	ILE	68	35.213	21.213	64.232
324	CB	ILE	68	33.636	18.491	64.268
325	CG1	ILE	68	32.775	17.450	63.561
326	CG2	ILE	68	32.744	19.553	64.903
327	CD1	ILE	68	31.787	16.797	64.521
328	N	ARG	69	36.852	19.698	64.111
329	CA	ARG	69	37.809	20.587	64.770
330	C	ARG	69	38.145	21.757	63.854
331	O	ARG	69	37.789	22.904	64.160
332	CB	ARG	69	39.082	19.809	65.080
333	CG	ARG	69	40.140	20.719	65.696
334	CD	ARG	69	41.459	19.986	65.890
335	NE	ARG	69	41.302	18.867	66.829
336	CZ	ARG	69	42.338	18.287	67.438
337	NH1	ARG	69	42.132	17.298	68.310
338	NH2	ARG	69	43.579	18.711	67.193
339	N	VAL	70	38.524	21.425	62.629
340	CA	VAL	70	38.912	22.466	61.677
341	C	VAL	70	37.674	23.056	61.016
342	O	VAL	70	37.625	24.264	60.744
343	CB	VAL	70	39.820	21.840	60.627
344	CG1	VAL	70	40.392	22.907	59.699
345	CG2	VAL	70	40.950	21.059	61.288
346	N	LEU	71	36.605	22.279	61.053
347	CA	LEU	71	35.320	22.707	60.513
348	C	LEU	71	34.675	23.773	61.394
349	O	LEU	71	34.270	24.813	60.865
350	CB	LEU	71	34.452	21.460	60.492
351	CG	LEU	71	33.128	21.630	59.776
352	CD1	LEU	71	33.352	22.002	58.315
353	CD2	LEU	71	32.350	20.327	59.886
354	N	LEU	72	34.849	23.660	62.702
355	CA	LEU	72	34.290	24.651	63.623
356	C	LEU	72	35.048	25.967	63.517
357	O	LEU	72	34.417	27.009	63.298
358	CB	LEU	72	34.382	24.075	65.038
359	CG	LEU	72	33.842	24.989	66.136
360	CD1	LEU	72	33.070	24.185	67.176
361	CD2	LEU	72	34.951	25.800	66.806
362	N	VAL	73	36.358	25.874	63.360
363	CA	VAL	73	37.176	27.085	63.268
364	C	VAL	73	36.911	27.845	61.970
365	O	VAL	73	36.497	29.011	62.027
366	CB	VAL	73	38.643	26.678	63.340
367	CG1	VAL	73	39.558	27.892	63.214
368	CG2	VAL	73	38.935	25.926	64.633
369	N	ALA	74	36.841	27.117	60.867
370	CA	ALA	74	36.658	27.765	59.567
371	C	ALA	74	35.224	28.228	59.320
372	O	ALA	74	35.026	29.299	58.733
373	CB	ALA	74	37.073	26.779	58.482
374	N	LEU	75	34.263	27.587	59.962
375	CA	LEU	75	32.872	27.999	59.780
376	C	LEU	75	32.471	29.132	60.717
377	O	LEU	75	31.623	29.948	60.339
378	CB	LEU	75	31.959	26.801	59.977
379	CG	LEU	75	32.107	25.788	58.845
380	CD1	LEU	75	31.097	24.661	59.014
381	CD2	LEU	75	31.927	26.449	57.483
382	N	ILE	76	33.219	29.329	61.791
383	CA	ILE	76	32.989	30.514	62.621
384	C	ILE	76	33.668	31.727	61.994
385	O	ILE	76	33.089	32.824	62.000
386	CB	ILE	76	33.506	30.263	64.033
387	CG1	ILE	76	32.658	29.202	64.723
388	CG2	ILE	76	33.516	31.547	64.855
389	CD1	ILE	76	33.112	28.980	66.160
390	N	LEU	77	34.687	31.462	61.191
391	CA	LEU	77	35.292	32.529	60.393
392	C	LEU	77	34.364	32.929	59.249
393	O	LEU	77	34.143	34.129	59.063
394	CB	LEU	77	36.626	32.050	59.834
395	CG	LEU	77	37.647	31.826	60.943
396	CD1	LEU	77	38.917	31.188	60.395
397	CD2	LEU	77	37.964	33.130	61.669
398	N	LEU	78	33.600	31.974	58.741
399	CA	LEU	78	32.582	32.262	57.717
400	C	LEU	78	31.272	32.831	58.275
401	O	LEU	78	30.351	33.118	57.499
402	CB	LEU	78	32.269	30.990	56.942
403	CG	LEU	78	33.400	30.585	56.009
404	CD1	LEU	78	33.020	29.316	55.255
405	CD2	LEU	78	33.719	31.708	55.027
406	N	LEU	79	31.165	32.971	59.584
407	CA	LEU	79	30.032	33.697	60.149
408	C	LEU	79	30.443	35.135	60.433
409	O	LEU	79	29.820	36.073	59.913
410	CB	LEU	79	29.600	33.024	61.447
411	CG	LEU	79	28.991	31.650	61.196
412	CD1	LEU	79	28.792	30.893	62.504
413	CD2	LEU	79	27.678	31.765	60.429
414	N	ALA	80	31.628	35.276	61.006
415	CA	ALA	80	32.106	36.590	61.447
416	C	ALA	80	32.624	37.459	60.308
417	O	ALA	80	32.275	38.646	60.244
418	CB	ALA	80	33.220	36.376	62.466
419	N	TRP	81	33.255	36.847	59.322
420	CA	TRP	81	33.742	37.614	58.171
421	C	TRP	81	32.625	38.250	57.331
422	O	TRP	81	32.643	39.484	57.247
423	CB	TRP	81	34.697	36.771	57.329
424	CG	TRP	81	36.086	36.606	57.921
425	CD1	TRP	81	36.839	35.453	57.925
426	CD2	TRP	81	36.886	37.619	58.577
427	NE1	TRP	81	38.021	35.710	58.541
428	CE2	TRP	81	38.091	36.992	58.946
429	CE3	TRP	81	36.682	38.960	58.868
430	CZ2	TRP	81	39.073	37.718	59.603
431	CZ3	TRP	81	37.670	39.679	59.529
432	CH2	TRP	81	38.861	39.060	59.894
433	N	PRO	82	31.631	37.533	56.805
434	CA	PRO	82	30.544	38.239	56.105
435	C	PRO	82	29.651	39.114	57.002
436	O	PRO	82	29.077	40.080	56.489
437	CB	PRO	82	29.735	37.173	55.437
438	CG	PRO	82	30.272	35.812	55.837
439	CD	PRO	82	31.434	36.077	56.777
440	N	PHE	83	29.683	38.932	58.315
441	CA	PHE	83	28.956	39.839	59.209
442	C	PHE	83	29.688	41.179	59.331
443	O	PHE	83	29.061	42.241	59.216
444	CB	PHE	83	28.859	39.170	60.576
445	CG	PHE	83	28.230	40.027	61.668
446	CD1	PHE	83	26.969	40.579	61.486
447	CD2	PHE	83	28.923	40.251	62.851
448	CE1	PHE	83	26.404	41.359	62.486
449	CE2	PHE	83	28.356	41.031	63.851
450	CZ	PHE	83	27.096	41.585	63.668
451	N	ALA	84	31.010	41.122	59.280
452	CA	ALA	84	31.818	42.343	59.280
453	C	ALA	84	31.845	42.993	57.900
454	O	ALA	84	31.838	44.226	57.813
455	CB	ALA	84	33.238	41.990	59.707
456	N	ALA	85	31.585	42.202	56.870
457	CA	ALA	85	31.467	42.727	55.505
458	C	ALA	85	30.107	43.376	55.239
459	O	ALA	85	30.001	44.244	54.367
460	CB	ALA	85	31.677	41.579	54.529
461	N	ILE	86	29.146	43.111	56.111
462	CA	ILE	86	27.859	43.814	56.070
463	C	ILE	86	27.986	45.195	56.712
464	O	ILE	86	27.261	46.129	56.346
465	CB	ILE	86	26.831	42.961	56.818
466	CG1	ILE	86	26.439	41.745	55.992
467	CG2	ILE	86	25.583	43.755	57.191
468	CD1	ILE	86	25.704	42.170	54.727
469	N	SER	87	29.030	45.367	57.506
470	CA	SER	87	29.293	46.663	58.122
471	C	SER	87	30.275	47.466	57.272
472	O	SER	87	30.189	48.699	57.211
473	CB	SER	87	29.903	46.402	59.493
474	OG	SER	87	29.069	45.464	60.161
475	N	THR	88	31.157	46.761	56.581
476	CA	THR	88	32.160	47.398	55.712
477	C	THR	88	32.410	46.603	54.429
478	O	THR	88	33.285	45.729	54.383
479	CB	THR	88	33.483	47.529	56.471
480	OG1	THR	88	33.750	46.288	57.112
481	CG2	THR	88	33.447	48.605	57.551
482	N	VAL	89	31.693	46.960	53.378
483	CA	VAL	89	31.917	46.324	52.071
484	C	VAL	89	32.537	47.302	51.064
485	O	VAL	89	31.908	48.279	50.639
486	CB	VAL	89	30.589	45.760	51.567
487	CG1	VAL	89	29.438	46.748	51.728
488	CG2	VAL	89	30.694	45.251	50.134
489	N	CYS	90	33.797	47.062	50.738
490	CA	CYS	90	34.508	47.925	49.780
491	C	CYS	90	35.149	47.120	48.650
492	O	CYS	90	35.781	46.086	48.892
493	CB	CYS	90	35.593	48.695	50.526
494	SG	CYS	90	35.020	49.780	51.854
495	N	CYS	91	34.995	47.607	47.428
496	CA	CYS	91	35.606	46.937	46.263
497	C	CYS	91	36.326	47.906	45.309
498	O	CYS	91	35.745	48.308	44.295
499	CB	CYS	91	34.499	46.221	45.492
500	SG	CYS	91	33.643	44.885	46.361
501	N	PRO	92	37.561	48.275	45.625
502	CA	PRO	92	38.357	49.146	44.744
503	C	PRO	92	38.830	48.440	43.472
504	O	PRO	92	39.115	47.234	43.485
505	CB	PRO	92	39.528	49.574	45.572
506	CG	PRO	92	39.543	48.773	46.863
507	CD	PRO	92	38.309	47.886	46.822
508	N	GLU	93	39.046	49.240	42.435
509	CA	GLU	93	39.442	48.740	41.103
510	C	GLU	93	40.637	47.795	41.155
511	O	GLU	93	40.454	46.605	40.899
512	CB	GLU	93	39.740	49.917	40.183
513	CG	GLU	93	38.456	50.605	39.730
514	CD	GLU	93	37.675	49.717	38.758
515	OE1	GLU	93	38.297	49.254	37.814
516	OE2	GLU	93	36.454	49.776	38.823
517	N	LYS	94	41.802	48.243	41.586
518	CA	LYS	94	42.870	47.255	41.785
519	C	LYS	94	43.085	46.985	43.275
520	O	LYS	94	43.983	47.532	43.925
521	CB	LYS	94	44.159	47.664	41.080
522	CG	LYS	94	45.185	46.537	41.189
523	CD	LYS	94	46.332	46.686	40.196
524	CE	LYS	94	45.839	46.535	38.760
525	NZ	LYS	94	46.966	46.537	37.813
526	N	LEU	95	42.163	46.200	43.805
527	CA	LEU	95	42.197	45.748	45.198
528	C	LEU	95	43.299	44.704	45.414
529	O	LEU	95	43.446	43.768	44.622
530	CB	LEU	95	40.807	45.170	45.449
531	CG	LEU	95	40.573	44.605	46.841
532	CD1	LEU	95	40.961	45.591	47.937
533	CD2	LEU	95	39.110	44.202	46.976
534	N	THR	96	44.129	44.952	46.416
535	CA	THR	96	45.242	44.049	46.754
536	C	THR	96	44.977	43.283	48.049
537	O	THR	96	44.186	43.723	48.889
538	CB	THR	96	46.514	44.868	46.927
539	OG1	THR	96	46.348	45.704	48.064
540	CG2	THR	96	46.794	45.743	45.710
541	N	HIS	97	45.751	42.227	48.247
542	CA	HIS	97	45.590	41.323	49.396
543	C	HIS	97	45.762	41.976	50.770
544	O	HIS	97	46.785	42.595	51.092
545	CB	HIS	97	46.579	40.167	49.243
546	CG	HIS	97	48.024	40.551	48.985
547	ND1	HIS	97	48.955	40.829	49.916
548	CD2	HIS	97	48.639	40.666	47.759
549	CE1	HIS	97	50.120	41.126	49.309
550	NE2	HIS	97	49.922	41.028	47.975
551	N	PRO	98	44.726	41.825	51.579
552	CA	PRO	98	44.814	42.116	53.008
553	C	PRO	98	45.556	41.021	53.770
554	O	PRO	98	45.112	39.864	53.836
555	CB	PRO	98	43.391	42.177	53.466
556	CG	PRO	98	42.514	41.553	52.391
557	CD	PRO	98	43.439	41.232	51.231
558	N	ILE	99	46.751	41.367	54.214
559	CA	ILE	99	47.488	40.509	55.141
560	C	ILE	99	47.830	41.277	56.411
561	O	ILE	99	48.280	40.698	57.407
562	CB	ILE	99	48.754	39.984	54.476
563	CG1	ILE	99	49.572	41.108	53.851
564	CG2	ILE	99	48.409	38.924	53.441
565	CD1	ILE	99	50.840	40.568	53.201
566	N	THR	100	47.611	42.581	56.358
567	CA	THR	100	47.894	43.446	57.508
568	C	THR	100	46.833	43.265	58.586
569	O	THR	100	45.653	43.588	58.398
570	CB	THR	100	47.963	44.901	57.049
571	OG1	THR	100	46.725	45.265	56.449
572	CG2	THR	100	49.064	45.103	56.014
573	N	GLY	101	47.254	42.662	59.684
574	CA	GLY	101	46.335	42.356	60.785
575	C	GLY	101	45.747	40.961	60.594
576	O	GLY	101	45.961	40.059	61.411
577	N	TRP	102	44.924	40.834	59.567
578	CA	TRP	102	44.378	39.533	59.189
579	C	TRP	102	44.816	39.150	57.784
580	O	TRP	102	44.689	39.925	56.827
581	CB	TRP	102	42.860	39.568	59.296
582	CG	TRP	102	42.387	39.746	60.724
583	CD1	TRP	102	41.738	40.839	61.255
584	CD2	TRP	102	42.536	38.793	61.800
585	NE1	TRP	102	41.506	40.602	62.571
586	CE2	TRP	102	41.973	39.393	62.939
587	CE3	TRP	102	43.100	37.529	61.881
588	CZ2	TRP	102	41.988	38.719	64.151
589	CZ3	TRP	102	43.109	36.859	63.099
590	CH2	TRP	102	42.555	37.452	64.229
591	N	ARG	103	45.382	37.961	57.697
592	CA	ARG	103	45.838	37.413	56.419
593	C	ARG	103	44.741	36.575	55.784
594	O	ARG	103	44.706	35.347	55.958
595	CB	ARG	103	47.045	36.530	56.693
596	CG	ARG	103	48.162	37.331	57.344
597	CD	ARG	103	48.935	36.473	58.337
598	NE	ARG	103	48.008	35.913	59.336
599	CZ	ARG	103	47.640	36.542	60.456
600	NH1	ARG	103	48.204	37.705	60.791
601	NH2	ARG	103	46.758	35.971	61.279
602	N	ARG	104	44.014	37.193	54.869
603	CA	ARG	104	42.889	36.503	54.228
604	C	ARG	104	43.339	35.495	53.173
605	O	ARG	104	42.628	34.509	52.942
606	CB	ARG	104	41.942	37.534	53.628
607	CG	ARG	104	41.211	38.280	54.739
608	CD	ARG	104	40.191	39.271	54.192
609	NE	ARG	104	39.369	39.817	55.286
610	CZ	ARG	104	39.201	41.120	55.518
611	NH1	ARG	104	39.821	42.022	54.756
612	NH2	ARG	104	38.424	41.522	56.526
613	N	LYS	105	44.606	35.564	52.795
614	CA	LYS	105	45.175	34.569	51.888
615	C	LYS	105	45.304	33.210	52.581
616	O	LYS	105	44.742	32.215	52.096
617	CB	LYS	105	46.566	35.042	51.473
618	CG	LYS	105	46.563	36.504	51.054
619	CD	LYS	105	47.777	36.864	50.204
620	CE	LYS	105	49.098	36.594	50.911
621	NZ	LYS	105	50.218	37.139	50.126
622	N	ILE	106	45.753	33.247	53.827
623	CA	ILE	106	46.000	32.014	54.577
624	C	ILE	106	44.710	31.481	55.186
625	O	ILE	106	44.488	30.262	55.196
626	CB	ILE	106	47.009	32.327	55.675
627	CG1	ILE	106	48.277	32.922	55.072
628	CG2	ILE	106	47.342	31.075	56.479
629	CD1	ILE	106	49.314	33.227	56.147
630	N	THR	107	43.759	32.385	55.362
631	CA	THR	107	42.436	31.999	55.854
632	C	THR	107	41.651	31.292	54.752
633	O	THR	107	41.014	30.261	55.007
634	CB	THR	107	41.696	33.266	56.273
635	OG1	THR	107	42.470	33.931	57.263
636	CG2	THR	107	40.325	32.957	56.864
637	N	GLN	108	41.952	31.663	53.517
638	CA	GLN	108	41.311	31.037	52.370
639	C	GLN	108	41.850	29.637	52.129
640	O	GLN	108	41.056	28.697	51.980
641	CB	GLN	108	41.615	31.874	51.138
642	CG	GLN	108	40.739	31.453	49.970
643	CD	GLN	108	39.363	32.092	50.116
644	OE1	GLN	108	39.149	33.202	49.620
645	NE2	GLN	108	38.430	31.373	50.716
646	N	THR	109	43.146	29.471	52.346
647	CA	THR	109	43.775	28.155	52.143
648	C	THR	109	43.553	27.186	53.300
649	O	THR	109	43.690	25.973	53.105
650	CB	THR	109	45.268	28.287	51.852
651	OG1	THR	109	45.853	29.238	52.737
652	CG2	THR	109	45.500	28.756	50.423
653	N	ALA	110	43.067	27.680	54.425
654	CA	ALA	110	42.671	26.783	55.511
655	C	ALA	110	41.203	26.369	55.392
656	O	ALA	110	40.809	25.327	55.932
657	CB	ALA	110	42.898	27.500	56.837
658	N	LEU	111	40.462	27.063	54.543
659	CA	LEU	111	39.025	26.811	54.407
660	C	LEU	111	38.735	25.574	53.556
661	O	LEU	111	38.354	24.529	54.098
662	CB	LEU	111	38.398	28.050	53.772
663	CG	LEU	111	36.880	27.950	53.680
664	CD1	LEU	111	36.261	27.782	55.061
665	CD2	LEU	111	36.298	29.167	52.971
666	N	LYS	112	39.131	25.617	52.292
667	CA	LYS	112	38.785	24.543	51.342
668	C	LYS	112	39.791	23.377	51.344
669	O	LYS	112	39.635	22.405	50.591
670	CB	LYS	112	38.643	25.189	49.967
671	CG	LYS	112	38.256	24.231	48.849
672	CD	LYS	112	38.313	24.934	47.502
673	CE	LYS	112	38.218	23.940	46.353
674	NZ	LYS	112	39.414	23.090	46.288
675	N	PHE	113	40.667	23.354	52.337
676	CA	PHE	113	41.654	22.275	52.440
677	C	PHE	113	40.974	20.974	52.885
678	O	PHE	113	41.349	19.901	52.399
679	CB	PHE	113	42.700	22.707	53.467
680	CG	PHE	113	43.983	21.876	53.496
681	CD1	PHE	113	45.126	22.355	52.868
682	CD2	PHE	113	44.022	20.662	54.171
683	CE1	PHE	113	46.298	21.611	52.894
684	CE2	PHE	113	45.193	19.916	54.195
685	CZ	PHE	113	46.330	20.389	53.554
686	N	LEU	114	39.803	21.119	53.490
687	CA	LEU	114	38.989	19.989	53.956
688	C	LEU	114	38.120	19.318	52.877
689	O	LEU	114	37.246	18.525	53.243
690	CB	LEU	114	38.051	20.524	55.034
691	CG	LEU	114	38.794	21.174	56.196
692	CD1	LEU	114	37.821	21.899	57.120
693	CD2	LEU	114	39.623	20.153	56.970
694	N	GLY	115	38.284	19.647	51.604
695	CA	GLY	115	37.403	19.049	50.588
696	C	GLY	115	38.127	18.504	49.354
697	O	GLY	115	37.503	17.854	48.502
698	N	ARG	116	39.416	18.781	49.254
699	CA	ARG	116	40.184	18.372	48.070
700	C	ARG	116	40.577	16.898	48.091
701	O	ARG	116	40.981	16.365	49.132
702	CB	ARG	116	41.455	19.204	48.033
703	CG	ARG	116	41.123	20.678	48.190
704	CD	ARG	116	42.349	21.553	47.985
705	NE	ARG	116	43.396	21.298	48.986
706	CZ	ARG	116	44.650	20.993	48.649
707	NH1	ARG	116	44.947	20.704	47.381
708	NH2	ARG	116	45.576	20.838	49.594
709	N	ALA	117	40.507	16.260	46.936
710	CA	ALA	117	40.986	14.879	46.828
711	C	ALA	117	42.460	14.870	46.442
712	O	ALA	117	42.806	14.574	45.291
713	CB	ALA	117	40.171	14.133	45.777
714	N	MET	118	43.310	14.929	47.457
715	CA	MET	118	44.764	15.062	47.255
716	C	MET	118	45.465	13.779	46.806
717	O	MET	118	46.618	13.828	46.372
718	CB	MET	118	45.380	15.497	48.577
719	CG	MET	118	44.806	16.821	49.065
720	SD	MET	118	45.452	17.380	50.658
721	CE	MET	118	47.209	17.453	50.237
722	N	PHE	119	44.760	12.661	46.839
723	CA	PHE	119	45.316	11.404	46.336
724	C	PHE	119	44.936	11.164	44.876
725	O	PHE	119	45.347	10.163	44.278
726	CB	PHE	119	44.770	10.266	47.190
727	CG	PHE	119	45.125	10.381	48.669
728	CD1	PHE	119	46.455	10.321	49.065
729	CD2	PHE	119	44.123	10.549	49.617
730	CE1	PHE	119	46.784	10.428	50.410
731	CE2	PHE	119	44.453	10.656	50.962
732	CZ	PHE	119	45.783	10.595	51.358
733	N	PHE	120	44.107	12.042	44.335
734	CA	PHE	120	43.648	11.893	42.955
735	C	PHE	120	44.025	13.107	42.119
736	O	PHE	120	44.051	13.050	40.883
737	CB	PHE	120	42.136	11.739	42.980
738	CG	PHE	120	41.643	10.492	43.702
739	CD1	PHE	120	41.874	9.238	43.152
740	CD2	PHE	120	40.964	10.609	44.908
741	CE1	PHE	120	41.429	8.100	43.811
742	CE2	PHE	120	40.520	9.472	45.567
743	CZ	PHE	120	40.754	8.217	45.019
744	N	SER	121	44.247	14.213	42.802
745	CA	SER	121	44.711	15.425	42.134
746	C	SER	121	46.227	15.375	41.974
747	O	SER	121	46.965	15.428	42.962
748	CB	SER	121	44.307	16.616	42.994
749	OG	SER	121	42.888	16.619	43.114
750	N	MET	122	46.673	15.269	40.733
751	CA	MET	122	48.110	15.197	40.442
752	C	MET	122	48.790	16.556	40.574
753	O	MET	122	48.719	17.206	41.623
754	CB	MET	122	48.324	14.641	39.039
755	CG	MET	122	48.563	13.133	39.037
756	SD	MET	122	47.215	12.070	39.601
757	CE	MET	122	46.048	12.408	38.268
758	N	GLY	123	49.593	16.894	39.582
759	CA	GLY	123	50.297	18.178	39.598
760	C	GLY	123	51.181	18.364	38.368
761	O	GLY	123	52.412	18.230	38.434
762	N	PHE	124	50.534	18.690	37.263
763	CA	PHE	124	51.226	18.985	36.000
764	C	PHE	124	51.979	20.306	36.114
765	O	PHE	124	51.361	21.376	36.130
766	CB	PHE	124	50.138	19.101	34.937
767	CG	PHE	124	50.557	19.467	33.513
768	CD1	PHE	124	50.819	18.461	32.593
769	CD2	PHE	124	50.629	20.797	33.120
770	CE1	PHE	124	51.163	18.783	31.288
771	CE2	PHE	124	50.975	21.119	31.815
772	CZ	PHE	124	51.240	20.113	30.898
773	N	ILE	125	53.297	20.236	36.188
774	CA	ILE	125	54.055	21.472	36.375
775	C	ILE	125	54.748	21.967	35.120
776	O	ILE	125	54.466	23.110	34.770
777	CB	ILE	125	55.082	21.303	37.486
778	CG1	ILE	125	54.386	21.174	38.831
779	CG2	ILE	125	56.038	22.491	37.517
780	CD1	ILE	125	53.607	22.439	39.180
781	N	VAL	126	55.296	21.067	34.314
782	CA	VAL	126	56.242	21.388	33.209
783	C	VAL	126	56.303	22.838	32.667
784	O	VAL	126	57.259	23.547	33.011
785	CB	VAL	126	56.017	20.381	32.083
786	CG1	VAL	126	56.841	19.120	32.312
787	CG2	VAL	126	54.545	20.026	31.913
788	N	ALA	127	55.257	23.337	32.015
789	CA	ALA	127	55.301	24.681	31.403
790	C	ALA	127	55.253	25.855	32.396
791	O	ALA	127	55.727	26.948	32.056
792	CB	ALA	127	54.141	24.804	30.421
793	N	VAL	128	54.965	25.569	33.656
794	CA	VAL	128	54.988	26.573	34.723
795	C	VAL	128	56.412	27.000	35.058
796	O	VAL	128	56.608	28.181	35.345
797	CB	VAL	128	54.357	25.972	35.981
798	CG1	VAL	128	54.541	26.858	37.209
799	CG2	VAL	128	52.885	25.647	35.779
800	N	LYS	129	57.404	26.176	34.748
801	CA	LYS	129	58.787	26.582	35.018
802	C	LYS	129	59.338	27.486	33.915
803	O	LYS	129	60.084	28.428	34.214
804	CB	LYS	129	59.645	25.339	35.195
805	CG	LYS	129	59.183	24.569	36.426
806	CD	LYS	129	60.094	23.389	36.736
807	CE	LYS	129	59.661	22.688	38.018
808	NZ	LYS	129	59.640	23.631	39.149
809	N	GLY	130	58.720	27.405	32.747
810	CA	GLY	130	59.027	28.337	31.659
811	C	GLY	130	58.385	29.677	31.995
812	O	GLY	130	59.051	30.720	31.990
813	N	LYS	131	57.190	29.577	32.555
814	CA	LYS	131	56.417	30.729	33.028
815	C	LYS	131	56.923	31.319	34.365
816	O	LYS	131	56.447	32.381	34.776
817	CB	LYS	131	54.976	30.238	33.134
818	CG	LYS	131	53.976	31.318	33.532
819	CD	LYS	131	52.565	30.749	33.602
820	CE	LYS	131	52.498	29.549	34.540
821	NZ	LYS	131	52.897	29.917	35.907
822	N	ILE	132	57.942	30.724	34.968
823	CA	ILE	132	58.600	31.337	36.126
824	C	ILE	132	59.639	32.346	35.652
825	O	ILE	132	59.772	33.434	36.228
826	CB	ILE	132	59.307	30.253	36.942
827	CG1	ILE	132	58.319	29.288	37.580
828	CG2	ILE	132	60.207	30.864	38.010
829	CD1	ILE	132	59.027	28.246	38.437
830	N	ALA	133	60.241	32.054	34.510
831	CA	ALA	133	61.239	32.962	33.941
832	C	ALA	133	60.577	33.973	33.014
833	O	ALA	133	61.045	35.114	32.886
834	CB	ALA	133	62.259	32.139	33.163
835	N	SER	134	59.409	33.599	32.519
836	CA	SER	134	58.602	34.475	31.659
837	C	SER	134	58.385	35.902	32.190
838	O	SER	134	58.991	36.789	31.573
839	CB	SER	134	57.267	33.807	31.367
840	OG	SER	134	56.465	34.769	30.705
841	N	PRO	135	57.790	36.146	33.363
842	CA	PRO	135	57.398	37.522	33.723
843	C	PRO	135	58.552	38.444	34.135
844	O	PRO	135	58.325	39.650	34.290
845	CB	PRO	135	56.421	37.389	34.848
846	CG	PRO	135	56.418	35.954	35.336
847	CD	PRO	135	57.330	35.198	34.389
848	N	LEU	136	59.775	37.930	34.148
849	CA	LEU	136	60.953	38.743	34.442
850	C	LEU	136	61.308	39.633	33.250
851	O	LEU	136	61.993	40.650	33.414
852	CB	LEU	136	62.122	37.794	34.697
853	CG	LEU	136	61.879	36.875	35.889
854	CD1	LEU	136	62.889	35.733	35.915
855	CD2	LEU	136	61.919	37.657	37.195
856	N	GLU	137	60.877	39.248	32.058
857	CA	GLU	137	61.062	40.117	30.888
858	C	GLU	137	59.782	40.229	30.058
859	O	GLU	137	59.635	41.163	29.260
860	CB	GLU	137	62.194	39.597	29.993
861	CG	GLU	137	63.599	40.052	30.410
862	CD	GLU	137	64.192	39.200	31.531
863	OE1	GLU	137	63.733	38.074	31.684
864	OE2	GLU	137	65.167	39.634	32.129
865	N	ALA	138	58.881	39.279	30.241
866	CA	ALA	138	57.647	39.231	29.448
867	C	ALA	138	56.428	38.787	30.261
868	O	ALA	138	56.324	37.628	30.682
869	CB	ALA	138	57.884	38.249	28.308
870	N	PRO	139	55.526	39.728	30.488
871	CA	PRO	139	54.309	39.476	31.276
872	C	PRO	139	53.388	38.416	30.654
873	O	PRO	139	53.305	38.251	29.430
874	CB	PRO	139	53.643	40.809	31.394
875	CG	PRO	139	54.440	41.847	30.621
876	CD	PRO	139	55.633	41.117	30.037
877	N	VAL	140	52.678	37.722	31.529
878	CA	VAL	140	51.918	36.522	31.137
879	C	VAL	140	50.398	36.726	31.047
880	O	VAL	140	49.755	37.227	31.977
881	CB	VAL	140	52.223	35.451	32.188
882	CG1	VAL	140	51.623	34.095	31.831
883	CG2	VAL	140	53.726	35.305	32.398
884	N	PHE	141	49.841	36.288	29.928
885	CA	PHE	141	48.382	36.192	29.748
886	C	PHE	141	47.953	34.747	29.955
887	O	PHE	141	48.704	33.835	29.595
888	CB	PHE	141	47.993	36.569	28.325
889	CG	PHE	141	47.904	38.055	28.027
890	CD1	PHE	141	47.718	38.960	29.061
891	CD2	PHE	141	47.986	38.502	26.716
892	CE1	PHE	141	47.620	40.316	28.787
893	CE2	PHE	141	47.886	39.858	26.441
894	CZ	PHE	141	47.702	40.764	27.477
895	N	VAL	142	46.798	34.526	30.558
896	CA	VAL	142	46.325	33.140	30.724
897	C	VAL	142	44.817	33.000	30.468
898	O	VAL	142	44.006	33.394	31.314
899	CB	VAL	142	46.638	32.667	32.143
900	CG1	VAL	142	46.157	31.241	32.331
901	CG2	VAL	142	48.118	32.747	32.507
902	N	ALA	143	44.458	32.373	29.357
903	CA	ALA	143	43.032	32.220	28.986
904	C	ALA	143	42.484	30.819	29.291
905	O	ALA	143	43.144	29.829	28.955
906	CB	ALA	143	42.887	32.507	27.498
907	N	ALA	144	41.272	30.743	29.832
908	CA	ALA	144	40.735	29.447	30.283
909	C	ALA	144	39.214	29.336	30.520
910	O	ALA	144	38.499	30.336	30.646
911	CB	ALA	144	41.444	29.160	31.596
912	N	PRO	145	38.711	28.123	30.342
913	CA	PRO	145	37.466	27.650	30.987
914	C	PRO	145	37.338	27.902	32.494
915	O	PRO	145	38.325	28.187	33.177
916	CB	PRO	145	37.349	26.206	30.640
917	CG	PRO	145	38.442	25.855	29.649
918	CD	PRO	145	39.364	27.057	29.595
919	N	HIS	146	36.146	27.624	33.007
920	CA	HIS	146	35.678	28.244	34.259
921	C	HIS	146	34.502	27.420	34.854
922	O	HIS	146	33.351	27.670	34.484
923	CB	HIS	146	35.174	29.583	33.700
924	CG	HIS	146	35.262	30.903	34.457
925	ND1	HIS	146	35.809	31.146	35.657
926	CD2	HIS	146	34.780	32.111	34.011
927	CE1	HIS	146	35.677	32.449	35.968
928	NE2	HIS	146	35.042	33.053	34.944
929	N	SER	147	34.770	26.477	35.750
930	CA	SER	147	33.698	25.588	36.279
931	C	SER	147	32.821	26.076	37.456
932	O	SER	147	31.700	26.509	37.166
933	CB	SER	147	34.239	24.180	36.547
934	OG	SER	147	35.409	24.230	37.341
935	N	THR	148	33.196	25.836	38.712
936	CA	THR	148	32.277	26.033	39.850
937	C	THR	148	32.788	26.979	40.950
938	O	THR	148	33.829	27.626	40.817
939	CB	THR	148	32.015	24.677	40.478
940	OG1	THR	148	33.252	24.148	40.938
941	CG2	THR	148	31.400	23.715	39.472
942	N	PHE	149	32.110	26.937	42.094
943	CA	PHE	149	32.310	27.960	43.156
944	C	PHE	149	33.619	27.879	43.916
945	O	PHE	149	34.054	28.893	44.474
946	CB	PHE	149	31.204	27.886	44.205
947	CG	PHE	149	29.881	28.580	43.899
948	CD1	PHE	149	29.567	29.763	44.555
949	CD2	PHE	149	28.967	28.009	43.023
950	CE1	PHE	149	28.359	30.399	44.301
951	CE2	PHE	149	27.761	28.646	42.765
952	CZ	PHE	149	27.459	29.843	43.401
953	N	PHE	150	34.272	26.734	43.882
954	CA	PHE	150	35.527	26.559	44.598
955	C	PHE	150	36.370	25.549	43.860
956	O	PHE	150	36.073	24.355	43.871
957	CB	PHE	150	35.280	26.082	46.025
958	CG	PHE	150	34.972	27.179	47.039
959	CD1	PHE	150	35.998	27.988	47.509
960	CD2	PHE	150	33.675	27.368	47.495
961	CE1	PHE	150	35.727	28.985	48.436
962	CE2	PHE	150	33.404	28.366	48.421
963	CZ	PHE	150	34.430	29.175	48.893
964	N	ASP	151	37.338	26.047	43.120
965	CA	ASP	151	38.248	25.164	42.404
966	C	ASP	151	39.669	25.233	42.912
967	O	ASP	151	40.544	24.526	42.397
968	CB	ASP	151	38.276	25.606	40.961
969	CG	ASP	151	37.150	24.963	40.179
970	OD1	ASP	151	37.458	24.493	39.094
971	OD2	ASP	151	35.991	25.058	40.571
972	N	GLY	152	39.906	26.058	43.911
973	CA	GLY	152	41.291	26.330	44.206
974	C	GLY	152	41.666	26.783	45.596
975	O	GLY	152	41.563	27.955	45.977
976	N	ILE	153	41.901	25.751	46.377
977	CA	ILE	153	42.866	25.772	47.472
978	C	ILE	153	43.854	24.683	47.033
979	O	ILE	153	44.950	24.497	47.576
980	CB	ILE	153	42.189	25.550	48.835
981	CG1	ILE	153	41.803	26.869	49.516
982	CG2	ILE	153	43.064	24.759	49.801
983	CD1	ILE	153	40.702	27.690	48.848
984	N	ALA	154	43.568	24.255	45.808
985	CA	ALA	154	44.257	23.182	45.091
986	C	ALA	154	45.634	23.568	44.581
987	O	ALA	154	46.473	22.693	44.325
988	CB	ALA	154	43.400	22.865	43.882
989	N	CYS	155	45.939	24.853	44.650
990	CA	CYS	155	47.276	25.311	44.312
991	C	CYS	155	48.286	25.011	45.423
992	O	CYS	155	49.482	25.127	45.153
993	CB	CYS	155	47.250	26.802	44.003
994	SG	CYS	155	48.750	27.417	43.207
995	N	VAL	156	47.874	24.427	46.543
996	CA	VAL	156	48.843	23.985	47.559
997	C	VAL	156	49.671	22.774	47.097
998	O	VAL	156	50.861	22.701	47.430
999	CB	VAL	156	48.081	23.643	48.840
1000	CG1	VAL	156	48.974	22.978	49.883
1001	CG2	VAL	156	47.415	24.881	49.430
1002	N	VAL	157	49.168	22.029	46.120
1003	CA	VAL	157	49.945	20.912	45.554
1004	C	VAL	157	50.919	21.400	44.469
1005	O	VAL	157	51.915	20.739	44.150
1006	CB	VAL	157	48.959	19.901	44.970
1007	CG1	VAL	157	49.665	18.707	44.342
1008	CG2	VAL	157	47.988	19.422	46.039
1009	N	ALA	158	50.696	22.615	43.998
1010	CA	ALA	158	51.613	23.220	43.038
1011	C	ALA	158	52.574	24.166	43.746
1012	O	ALA	158	53.700	24.342	43.275
1013	CB	ALA	158	50.803	23.995	42.011
1014	N	GLY	159	52.215	24.538	44.966
1015	CA	GLY	159	52.965	25.487	45.795
1016	C	GLY	159	54.395	25.060	46.068
1017	O	GLY	159	55.320	25.865	45.900
1018	N	LEU	160	54.569	23.786	46.387
1019	CA	LEU	160	55.904	23.229	46.652
1020	C	LEU	160	56.899	23.540	45.507
1021	O	LEU	160	57.880	24.232	45.804
1022	CB	LEU	160	55.745	21.733	46.966
1023	CG	LEU	160	56.941	21.101	47.684
1024	CD1	LEU	160	58.081	20.703	46.750
1025	CD2	LEU	160	57.430	21.969	48.839
1026	N	PRO	161	56.718	23.088	44.266
1027	CA	PRO	161	57.631	23.550	43.206
1028	C	PRO	161	57.369	24.965	42.647
1029	O	PRO	161	58.253	25.505	41.970
1030	CB	PRO	161	57.461	22.547	42.106
1031	CG	PRO	161	56.213	21.720	42.370
1032	CD	PRO	161	55.716	22.143	43.740
1033	N	SER	162	56.221	25.564	42.927
1034	CA	SER	162	55.878	26.866	42.344
1035	C	SER	162	54.769	27.606	43.100
1036	O	SER	162	53.612	27.171	43.174
1037	CB	SER	162	55.449	26.653	40.895
1038	OG	SER	162	54.358	25.741	40.878
1039	N	MET	163	55.071	28.868	43.344
1040	CA	MET	163	54.184	29.802	44.057
1041	C	MET	163	53.070	30.427	43.204
1042	O	MET	163	52.285	31.210	43.754
1043	CB	MET	163	55.073	30.946	44.517
1044	CG	MET	163	55.893	31.442	43.330
1045	SD	MET	163	56.086	33.228	43.197
1046	CE	MET	163	54.350	33.667	42.981
1047	N	VAL	164	52.863	29.907	42.001
1048	CA	VAL	164	52.159	30.593	40.899
1049	C	VAL	164	50.840	31.299	41.232
1050	O	VAL	164	50.710	32.483	40.896
1051	CB	VAL	164	51.968	29.562	39.787
1052	CG1	VAL	164	51.710	28.161	40.333
1053	CG2	VAL	164	50.921	29.980	38.758
1054	N	SER	165	49.933	30.649	41.943
1055	CA	SER	165	48.678	31.302	42.302
1056	C	SER	165	48.475	31.350	43.811
1057	O	SER	165	47.786	32.259	44.279
1058	CB	SER	165	47.528	30.537	41.658
1059	OG	SER	165	47.726	30.549	40.252
1060	N	ARG	166	49.297	30.597	44.528
1061	CA	ARG	166	49.099	30.271	45.956
1062	C	ARG	166	48.541	31.381	46.831
1063	O	ARG	166	47.352	31.723	46.808
1064	CB	ARG	166	50.459	29.901	46.536
1065	CG	ARG	166	50.758	28.419	46.397
1066	CD	ARG	166	49.742	27.606	47.191
1067	NE	ARG	166	49.675	28.030	48.600
1068	CZ	ARG	166	50.293	27.395	49.599
1069	NH1	ARG	166	51.050	26.324	49.349
1070	NH2	ARG	166	50.166	27.845	50.849
1071	N	ASN	167	49.362	31.725	47.800
1072	CA	ASN	167	49.096	32.887	48.649
1073	C	ASN	167	50.203	33.878	48.357
1074	O	ASN	167	51.075	34.122	49.199
1075	CB	ASN	167	49.150	32.488	50.120
1076	CG	ASN	167	47.858	31.855	50.641
1077	OD1	ASN	167	47.815	31.444	51.807
1078	ND2	ASN	167	46.814	31.837	49.829
1079	N	GLU	168	50.275	34.292	47.105
1080	CA	GLU	168	51.474	34.995	46.664
1081	C	GLU	168	51.251	36.194	45.758
1082	O	GLU	168	50.141	36.528	45.334
1083	CB	GLU	168	52.360	33.991	45.931
1084	CG	GLU	168	53.121	33.071	46.881
1085	CD	GLU	168	54.172	33.876	47.642
1086	OE1	GLU	168	54.374	35.021	47.246
1087	OE2	GLU	168	54.914	33.263	48.394
1088	N	ASN	169	52.373	36.860	45.546
1089	CA	ASN	169	52.522	37.953	44.583
1090	C	ASN	169	54.021	38.172	44.399
1091	O	ASN	169	54.447	38.933	43.521
1092	CB	ASN	169	51.871	39.227	45.121
1093	CG	ASN	169	52.640	39.790	46.319
1094	OD1	ASN	169	52.668	39.199	47.406
1095	ND2	ASN	169	53.292	40.916	46.086
1096	N	ALA	170	54.746	37.273	45.052
1097	CA	ALA	170	56.193	37.326	45.333
1098	C	ALA	170	57.136	38.161	44.479
1099	O	ALA	170	56.979	38.384	43.270
1100	CB	ALA	170	56.732	35.902	45.363
1101	N	GLN	171	58.077	38.699	45.232
1102	CA	GLN	171	59.291	39.321	44.716
1103	C	GLN	171	60.417	38.416	45.223
1104	O	GLN	171	60.097	37.360	45.783
1105	CB	GLN	171	59.395	40.726	45.298
1106	CG	GLN	171	60.104	41.700	44.362
1107	CD	GLN	171	60.324	43.017	45.091
1108	OE1	GLN	171	60.936	43.043	46.164
1109	NE2	GLN	171	59.817	44.087	44.507
1110	N	VAL	172	61.667	38.863	45.165
1111	CA	VAL	172	62.828	38.033	45.557
1112	C	VAL	172	62.763	36.718	44.784
1113	O	VAL	172	62.159	35.755	45.276
1114	CB	VAL	172	62.808	37.800	47.072
1115	CG1	VAL	172	64.021	36.999	47.538
1116	CG2	VAL	172	62.739	39.125	47.824
1117	N	PRO	173	63.665	36.572	43.824
1118	CA	PRO	173	63.304	36.520	42.383
1119	C	PRO	173	62.171	35.619	41.848
1120	O	PRO	173	62.031	35.532	40.622
1121	CB	PRO	173	64.610	36.212	41.720
1122	CG	PRO	173	65.720	36.679	42.649
1123	CD	PRO	173	65.003	37.164	43.899
1124	N	LEU	174	61.396	34.963	42.692
1125	CA	LEU	174	60.149	34.345	42.243
1126	C	LEU	174	59.142	35.475	42.058
1127	O	LEU	174	59.103	36.401	42.873
1128	CB	LEU	174	59.640	33.356	43.293
1129	CG	LEU	174	60.114	31.915	43.081
1130	CD1	LEU	174	59.750	31.426	41.684
1131	CD2	LEU	174	61.603	31.712	43.348
1132	N	ILE	175	58.457	35.473	40.929
1133	CA	ILE	175	57.511	36.553	40.609
1134	C	ILE	175	56.066	36.048	40.576
1135	O	ILE	175	55.830	34.891	40.217
1136	CB	ILE	175	57.965	37.141	39.269
1137	CG1	ILE	175	59.227	37.971	39.468
1138	CG2	ILE	175	56.896	37.976	38.577
1139	CD1	ILE	175	58.986	39.136	40.424
1140	N	GLY	176	55.138	36.840	41.094
1141	CA	GLY	176	53.711	36.472	41.054
1142	C	GLY	176	53.173	36.229	39.639
1143	O	GLY	176	53.485	36.974	38.704
1144	N	ARG	177	52.401	35.161	39.490
1145	CA	ARG	177	51.734	34.853	38.210
1146	C	ARG	177	50.207	34.806	38.358
1147	O	ARG	177	49.531	34.189	37.527
1148	CB	ARG	177	52.203	33.509	37.644
1149	CG	ARG	177	53.536	33.570	36.895
1150	CD	ARG	177	54.747	33.307	37.784
1151	NE	ARG	177	54.689	31.963	38.381
1152	CZ	ARG	177	55.676	31.445	39.115
1153	NH1	ARG	177	56.788	32.150	39.332
1154	NH2	ARG	177	55.559	30.217	39.622
1155	N	LEU	178	49.672	35.539	39.323
1156	CA	LEU	178	48.276	35.321	39.736
1157	C	LEU	178	47.269	36.479	39.612
1158	O	LEU	178	46.211	36.382	40.244
1159	CB	LEU	178	48.249	34.768	41.171
1160	CG	LEU	178	48.992	35.512	42.304
1161	CD1	LEU	178	50.449	35.099	42.496
1162	CD2	LEU	178	48.814	37.029	42.358
1163	N	LEU	179	47.557	37.550	38.889
1164	CA	LEU	179	46.581	38.659	38.852
1165	C	LEU	179	45.432	38.330	37.881
1166	O	LEU	179	45.615	37.588	36.909
1167	CB	LEU	179	47.292	39.964	38.503
1168	CG	LEU	179	46.504	41.188	38.964
1169	CD1	LEU	179	46.349	41.186	40.481
1170	CD2	LEU	179	47.160	42.481	38.498
1171	N	ARG	180	44.246	38.836	38.185
1172	CA	ARG	180	43.019	38.383	37.514
1173	C	ARG	180	42.192	39.498	36.863
1174	O	ARG	180	42.047	40.586	37.435
1175	CB	ARG	180	42.210	37.745	38.635
1176	CG	ARG	180	41.015	36.948	38.150
1177	CD	ARG	180	40.951	35.634	38.906
1178	NE	ARG	180	42.182	34.865	38.684
1179	CZ	ARG	180	43.045	34.570	39.656
1180	NH1	ARG	180	44.162	33.898	39.372
1181	NH2	ARG	180	42.803	34.967	40.907
1182	N	ALA	181	41.598	39.197	35.714
1183	CA	ALA	181	40.623	40.106	35.084
1184	C	ALA	181	39.205	39.833	35.598
1185	O	ALA	181	38.357	39.246	34.912
1186	CB	ALA	181	40.665	39.928	33.572
1187	N	VAL	182	38.969	40.332	36.799
1188	CA	VAL	182	37.721	40.154	37.555
1189	C	VAL	182	36.470	40.690	36.858
1190	O	VAL	182	36.492	41.774	36.265
1191	CB	VAL	182	37.973	40.916	38.836
1192	CG1	VAL	182	38.828	42.133	38.520
1193	CG2	VAL	182	36.697	41.260	39.600
1194	N	GLN	183	35.416	39.884	36.910
1195	CA	GLN	183	34.123	40.168	36.271
1196	C	GLN	183	33.115	39.055	36.576
1197	O	GLN	183	33.505	37.950	36.966
1198	CB	GLN	183	34.300	40.342	34.750
1199	CG	GLN	183	35.228	39.331	34.059
1200	CD	GLN	183	34.569	37.989	33.742
1201	OE1	GLN	183	33.369	37.803	33.959
1202	NE2	GLN	183	35.345	37.113	33.126
1203	N	PRO	184	31.834	39.380	36.520
1204	CA	PRO	184	31.340	40.729	36.798
1205	C	PRO	184	31.277	41.023	38.300
1206	O	PRO	184	30.882	40.169	39.111
1207	CB	PRO	184	29.958	40.718	36.224
1208	CG	PRO	184	29.530	39.270	36.030
1209	CD	PRO	184	30.726	38.429	36.450
1210	N	VAL	185	31.592	42.258	38.651
1211	CA	VAL	185	31.451	42.686	40.047
1212	C	VAL	185	29.998	42.829	40.486
1213	O	VAL	185	29.547	41.930	41.209
1214	CB	VAL	185	32.220	43.994	40.245
1215	CG1	VAL	185	31.761	44.840	41.431
1216	CG2	VAL	185	33.690	43.681	40.400
1217	N	LEU	186	29.241	43.612	39.728
1218	CA	LEU	186	27.954	44.177	40.182
1219	C	LEU	186	27.012	43.190	40.878
1220	O	LEU	186	27.024	41.991	40.577
1221	CB	LEU	186	27.260	44.873	39.014
1222	CG	LEU	186	27.516	46.385	38.952
1223	CD1	LEU	186	26.995	47.088	40.201
1224	CD2	LEU	186	28.976	46.758	38.703
1225	N	VAL	187	26.020	43.789	41.524
1226	CA	VAL	187	25.163	43.220	42.597
1227	C	VAL	187	24.665	41.766	42.504
1228	O	VAL	187	24.605	41.092	43.537
1229	CB	VAL	187	23.943	44.138	42.658
1230	CG1	VAL	187	22.945	43.710	43.731
1231	CG2	VAL	187	24.368	45.585	42.881
1232	N	SER	188	24.385	41.255	41.319
1233	CA	SER	188	23.894	39.879	41.201
1234	C	SER	188	25.006	38.838	41.037
1235	O	SER	188	24.699	37.645	40.935
1236	CB	SER	188	22.967	39.807	39.994
1237	OG	SER	188	21.912	40.733	40.209
1238	N	ARG	189	26.260	39.260	40.987
1239	CA	ARG	189	27.342	38.307	40.725
1240	C	ARG	189	28.432	38.231	41.796
1241	O	ARG	189	28.163	38.007	42.983
1242	CB	ARG	189	27.954	38.627	39.370
1243	CG	ARG	189	27.039	38.175	38.236
1244	CD	ARG	189	26.865	36.659	38.241
1245	NE	ARG	189	26.045	36.205	37.106
1246	CZ	ARG	189	25.115	35.254	37.215
1247	NH1	ARG	189	24.455	34.837	36.133
1248	NH2	ARG	189	24.882	34.682	38.397
1249	N	VAL	190	29.666	38.394	41.346
1250	CA	VAL	190	30.815	37.932	42.131
1251	C	VAL	190	31.410	38.958	43.092
1252	O	VAL	190	32.130	38.590	44.032
1253	CB	VAL	190	31.884	37.492	41.141
1254	CG1	VAL	190	33.053	36.863	41.878
1255	CG2	VAL	190	31.317	36.511	40.121
1256	N	ASP	191	31.086	40.226	42.954
1257	CA	ASP	191	31.668	41.178	43.906
1258	C	ASP	191	30.648	42.227	44.345
1259	O	ASP	191	30.400	43.196	43.620
1260	CB	ASP	191	32.881	41.873	43.287
1261	CG	ASP	191	33.909	40.884	42.729
1262	OD1	ASP	191	33.884	40.662	41.526
1263	OD2	ASP	191	34.700	40.383	43.512
1264	N	PRO	192	30.194	42.136	45.585
1265	CA	PRO	192	30.514	41.034	46.507
1266	C	PRO	192	29.631	39.813	46.249
1267	O	PRO	192	28.413	39.962	46.087
1268	CB	PRO	192	30.204	41.605	47.851
1269	CG	PRO	192	29.332	42.838	47.681
1270	CD	PRO	192	29.275	43.101	46.188
1271	N	ASP	193	30.209	38.624	46.289
1272	CA	ASP	193	29.434	37.436	45.913
1273	C	ASP	193	28.574	36.901	47.045
1274	O	ASP	193	29.033	36.145	47.918
1275	CB	ASP	193	30.356	36.337	45.406
1276	CG	ASP	193	29.517	35.141	44.965
1277	OD1	ASP	193	29.001	35.169	43.857
1278	OD2	ASP	193	29.367	34.227	45.772
1279	N	SER	194	27.298	37.248	46.925
1280	CA	SER	194	26.196	36.827	47.811
1281	C	SER	194	26.579	36.701	49.280
1282	O	SER	194	26.283	35.671	49.897
1283	CB	SER	194	25.666	35.484	47.311
1284	OG	SER	194	26.733	34.541	47.315
1285	N	ARG	195	27.152	37.766	49.829
1286	CA	ARG	195	27.715	37.849	51.202
1287	C	ARG	195	28.808	36.837	51.618
1288	O	ARG	195	29.822	37.291	52.165
1289	CB	ARG	195	26.585	37.808	52.221
1290	CG	ARG	195	26.119	39.202	52.649
1291	CD	ARG	195	25.244	39.921	51.624
1292	NE	ARG	195	24.000	39.176	51.364
1293	CZ	ARG	195	22.815	39.496	51.893
1294	NH1	ARG	195	21.723	38.814	51.543
1295	NH2	ARG	195	22.711	40.526	52.735
1296	N	LYS	196	28.686	35.560	51.276
1297	CA	LYS	196	29.666	34.521	51.641
1298	C	LYS	196	31.060	34.913	51.203
1299	O	LYS	196	31.925	35.312	51.994
1300	CB	LYS	196	29.418	33.257	50.823
1301	CG	LYS	196	28.002	32.714	50.761
1302	CD	LYS	196	28.051	31.457	49.891
1303	CE	LYS	196	26.710	30.750	49.769
1304	NZ	LYS	196	26.845	29.492	49.019
1305	N	ASN	197	31.154	35.033	49.891
1306	CA	ASN	197	32.417	35.274	49.210
1307	C	ASN	197	32.807	36.744	49.153
1308	O	ASN	197	33.837	37.060	48.550
1309	CB	ASN	197	32.322	34.679	47.811
1310	CG	ASN	197	32.238	33.160	47.924
1311	OD1	ASN	197	33.112	32.542	48.541
1312	ND2	ASN	197	31.184	32.579	47.377
1313	N	THR	198	32.129	37.594	49.911
1314	CA	THR	198	32.443	39.025	49.918
1315	C	THR	198	33.842	39.257	50.469
1316	O	THR	198	34.693	39.775	49.734
1317	CB	THR	198	31.444	39.732	50.823
1318	OG1	THR	198	30.154	39.579	50.250
1319	CG2	THR	198	31.746	41.222	50.945
1320	N	ILE	199	34.154	38.520	51.525
1321	CA	ILE	199	35.465	38.619	52.179
1322	C	ILE	199	36.577	37.940	51.382
1323	O	ILE	199	37.689	38.478	51.303
1324	CB	ILE	199	35.319	37.956	53.542
1325	CG1	ILE	199	34.463	38.825	54.449
1326	CG2	ILE	199	36.673	37.674	54.182
1327	CD1	ILE	199	35.169	40.129	54.803
1328	N	ASN	200	36.176	37.021	50.522
1329	CA	ASN	200	37.129	36.272	49.713
1330	C	ASN	200	37.469	37.010	48.413
1331	O	ASN	200	38.465	36.690	47.755
1332	CB	ASN	200	36.498	34.921	49.403
1333	CG	ASN	200	36.118	34.164	50.678
1334	OD1	ASN	200	36.763	34.285	51.727
1335	ND2	ASN	200	35.103	33.326	50.557
1336	N	GLU	201	36.736	38.073	48.115
1337	CA	GLU	201	37.063	38.874	46.933
1338	C	GLU	201	37.977	40.041	47.304
1339	O	GLU	201	38.630	40.592	46.412
1340	CB	GLU	201	35.813	39.483	46.299
1341	CG	GLU	201	34.585	38.580	46.194
1342	CD	GLU	201	34.773	37.297	45.380
1343	OE1	GLU	201	33.898	36.446	45.488
1344	OE2	GLU	201	35.794	37.138	44.727
1345	N	ILE	202	38.210	40.249	48.595
1346	CA	ILE	202	38.930	41.448	49.072
1347	C	ILE	202	40.459	41.375	48.888
1348	O	ILE	202	41.176	42.352	49.124
1349	CB	ILE	202	38.540	41.668	50.538
1350	CG1	ILE	202	37.025	41.762	50.660
1351	CG2	ILE	202	39.149	42.937	51.126
1352	CD1	ILE	202	36.613	42.138	52.078
1353	N	ILE	203	40.935	40.274	48.337
1354	CA	ILE	203	42.359	40.118	48.077
1355	C	ILE	203	42.742	40.403	46.610
1356	O	ILE	203	43.933	40.576	46.316
1357	CB	ILE	203	42.703	38.709	48.569
1358	CG1	ILE	203	44.019	38.158	48.045
1359	CG2	ILE	203	41.554	37.741	48.313
1360	CD1	ILE	203	44.242	36.738	48.545
1361	N	LYS	204	41.760	40.612	45.743
1362	CA	LYS	204	42.049	40.820	44.309
1363	C	LYS	204	41.122	41.865	43.663
1364	O	LYS	204	40.099	42.231	44.251
1365	CB	LYS	204	41.958	39.453	43.625
1366	CG	LYS	204	43.340	38.819	43.498
1367	CD	LYS	204	43.272	37.314	43.678
1368	CE	LYS	204	42.577	37.022	44.996
1369	NZ	LYS	204	42.859	35.669	45.478
1370	N	PRO	205	41.518	42.383	42.503
1371	CA	PRO	205	40.849	43.539	41.871
1372	C	PRO	205	39.354	43.364	41.592
1373	O	PRO	205	38.805	42.263	41.702
1374	CB	PRO	205	41.593	43.774	40.591
1375	CG	PRO	205	42.780	42.837	40.504
1376	CD	PRO	205	42.741	42.014	41.776
1377	N	THR	206	38.701	44.478	41.288
1378	CA	THR	206	37.273	44.489	40.922
1379	C	THR	206	36.998	45.307	39.644
1380	O	THR	206	37.335	46.495	39.543
1381	CB	THR	206	36.441	45.041	42.079
1382	OG1	THR	206	36.775	46.404	42.290
1383	CG2	THR	206	36.660	44.273	43.379
1384	N	THR	207	36.374	44.644	38.680
1385	CA	THR	207	35.981	45.260	37.401
1386	C	THR	207	34.529	44.879	37.051
1387	O	THR	207	34.029	43.824	37.463
1388	CB	THR	207	36.955	44.748	36.342
1389	OG1	THR	207	38.266	44.845	36.877
1390	CG2	THR	207	36.915	45.519	35.026
1391	N	SER	208	33.857	45.752	36.316
1392	CA	SER	208	32.434	45.582	35.958
1393	C	SER	208	32.115	44.350	35.103
1394	O	SER	208	32.835	43.344	35.116
1395	CB	SER	208	31.987	46.821	35.204
1396	OG	SER	208	31.985	47.911	36.112
1397	N	GLY	209	30.927	44.364	34.524
1398	CA	GLY	209	30.491	43.210	33.729
1399	C	GLY	209	30.271	43.517	32.251
1400	O	GLY	209	30.018	44.658	31.852
1401	N	GLY	210	30.329	42.460	31.457
1402	CA	GLY	210	30.051	42.557	30.019
1403	C	GLY	210	28.547	42.548	29.761
1404	O	GLY	210	27.966	43.569	29.382
1405	N	GLU	211	27.910	41.435	30.095
1406	CA	GLU	211	26.449	41.306	29.935
1407	C	GLU	211	25.660	41.947	31.079
1408	O	GLU	211	24.448	42.164	30.954
1409	CB	GLU	211	26.087	39.823	29.895
1410	CG	GLU	211	26.565	39.124	28.627
1411	CD	GLU	211	25.772	39.601	27.412
1412	OE1	GLU	211	26.344	39.594	26.332
1413	OE2	GLU	211	24.589	39.860	27.571
1414	N	TRP	212	26.358	42.357	32.124
1415	CA	TRP	212	25.689	42.905	33.308
1416	C	TRP	212	24.948	44.240	33.079
1417	O	TRP	212	23.751	44.253	33.395
1418	CB	TRP	212	26.696	43.046	34.447
1419	CG	TRP	212	26.083	42.705	35.790
1420	CD1	TRP	212	26.315	41.563	36.522
1421	CD2	TRP	212	25.149	43.499	36.554
1422	NE1	TRP	212	25.553	41.606	37.642
1423	CE2	TRP	212	24.822	42.737	37.690
1424	CE3	TRP	212	24.553	44.734	36.347
1425	CZ2	TRP	212	23.871	43.208	38.582
1426	CZ3	TRP	212	23.615	45.205	37.256
1427	CH2	TRP	212	23.272	44.444	38.367
1428	N	PRO	213	25.517	45.281	32.464
1429	CA	PRO	213	24.798	46.569	32.395
1430	C	PRO	213	23.600	46.630	31.436
1431	O	PRO	213	22.924	47.665	31.416
1432	CB	PRO	213	25.814	47.574	31.949
1433	CG	PRO	213	27.080	46.864	31.521
1434	CD	PRO	213	26.873	45.413	31.896
1435	N	GLN	214	23.235	45.533	30.788
1436	CA	GLN	214	22.179	45.572	29.774
1437	C	GLN	214	20.772	45.772	30.334
1438	O	GLN	214	19.918	46.304	29.616
1439	CB	GLN	214	22.191	44.241	29.027
1440	CG	GLN	214	23.484	44.006	28.253
1441	CD	GLN	214	23.610	44.998	27.099
1442	OE1	GLN	214	24.691	45.548	26.859
1443	NE2	GLN	214	22.511	45.205	26.392
1444	N	ILE	215	20.539	45.428	31.593
1445	CA	ILE	215	19.186	45.571	32.157
1446	C	ILE	215	19.155	45.952	33.639
1447	O	ILE	215	18.653	45.191	34.474
1448	CB	ILE	215	18.374	44.290	31.909
1449	CG1	ILE	215	19.220	43.011	31.841
1450	CG2	ILE	215	17.509	44.428	30.660
1451	CD1	ILE	215	19.683	42.496	33.203
1452	N	LEU	216	19.552	47.178	33.940
1453	CA	LEU	216	19.475	47.644	35.333
1454	C	LEU	216	18.649	48.925	35.458
1455	O	LEU	216	19.208	50.031	35.428
1456	CB	LEU	216	20.880	47.884	35.872
1457	CG	LEU	216	20.840	48.182	37.369
1458	CD1	LEU	216	20.207	47.027	38.140
1459	CD2	LEU	216	22.231	48.489	37.911
1460	N	VAL	217	17.356	48.736	35.702
1461	CA	VAL	217	16.354	49.819	35.847
1462	C	VAL	217	16.561	50.940	34.834
1463	O	VAL	217	17.292	51.901	35.118
1464	CB	VAL	217	16.424	50.374	37.269
1465	CG1	VAL	217	15.359	51.444	37.499
1466	CG2	VAL	217	16.265	49.256	38.292
1467	N	PHE	218	15.864	50.823	33.707
1468	CA	PHE	218	16.060	51.678	32.513
1469	C	PHE	218	17.507	52.152	32.420
1470	O	PHE	218	17.802	53.308	32.746
1471	CB	PHE	218	15.118	52.876	32.578
1472	CG	PHE	218	15.133	53.734	31.314
1473	CD1	PHE	218	15.161	53.126	30.065
1474	CD2	PHE	218	15.119	55.119	31.411
1475	CE1	PHE	218	15.181	53.902	28.914
1476	CE2	PHE	218	15.139	55.896	30.260
1477	CZ	PHE	218	15.171	55.288	29.012
1478	N	PRO	219	18.349	51.307	31.844
1479	CA	PRO	219	19.620	50.952	32.494
1480	C	PRO	219	20.490	52.126	32.946
1481	O	PRO	219	21.424	52.543	32.250
1482	CB	PRO	219	20.294	50.057	31.505
1483	CG	PRO	219	19.249	49.545	30.528
1484	CD	PRO	219	17.956	50.232	30.930
1485	N	GLU	220	20.331	52.455	34.219
1486	CA	GLU	220	21.039	53.582	34.831
1487	C	GLU	220	22.403	53.155	35.358
1488	O	GLU	220	23.360	53.939	35.325
1489	CB	GLU	220	20.177	54.084	35.982
1490	CG	GLU	220	18.826	54.571	35.471
1491	CD	GLU	220	17.837	54.680	36.625
1492	OE1	GLU	220	18.063	54.014	37.627
1493	OE2	GLU	220	16.921	55.485	36.523
1494	N	GLY	221	22.550	51.853	35.542
1495	CA	GLY	221	23.826	51.292	35.997
1496	C	GLY	221	24.792	50.999	34.850
1497	O	GLY	221	25.949	50.628	35.099
1498	N	THR	222	24.398	51.344	33.634
1499	CA	THR	222	25.226	51.052	32.465
1500	C	THR	222	26.434	51.971	32.390
1501	O	THR	222	27.560	51.469	32.281
1502	CB	THR	222	24.373	51.257	31.224
1503	OG1	THR	222	23.243	50.417	31.345
1504	CG2	THR	222	25.115	50.864	29.956
1505	N	CYS	223	26.244	53.214	32.804
1506	CA	CYS	223	27.341	54.184	32.760
1507	C	CYS	223	28.305	54.010	33.931
1508	O	CYS	223	29.505	54.258	33.773
1509	CB	CYS	223	26.744	55.584	32.788
1510	SG	CYS	223	25.602	55.958	31.438
1511	N	THR	224	27.850	53.329	34.971
1512	CA	THR	224	28.722	53.059	36.112
1513	C	THR	224	29.587	51.839	35.821
1514	O	THR	224	30.806	51.888	36.027
1515	CB	THR	224	27.852	52.806	37.335
1516	OG1	THR	224	27.008	53.936	37.510
1517	CG2	THR	224	28.692	52.631	38.595
1518	N	ASN	225	29.021	50.905	35.072
1519	CA	ASN	225	29.778	49.727	34.646
1520	C	ASN	225	30.825	50.111	33.612
1521	O	ASN	225	32.009	49.805	33.807
1522	CB	ASN	225	28.839	48.694	34.026
1523	CG	ASN	225	28.303	47.686	35.045
1524	OD1	ASN	225	28.887	46.608	35.235
1525	ND2	ASN	225	27.154	48.000	35.618
1526	N	ARG	226	30.455	51.004	32.708
1527	CA	ARG	226	31.389	51.431	31.668
1528	C	ARG	226	32.476	52.359	32.195
1529	O	ARG	226	33.637	52.167	31.818
1530	CB	ARG	226	30.609	52.117	30.558
1531	CG	ARG	226	29.716	51.113	29.843
1532	CD	ARG	226	28.945	51.759	28.701
1533	NE	ARG	226	28.174	50.745	27.966
1534	CZ	ARG	226	27.229	51.048	27.074
1535	NH1	ARG	226	26.919	52.325	26.837
1536	NH2	ARG	226	26.569	50.073	26.444
1537	N	SER	227	32.190	53.124	33.236
1538	CA	SER	227	33.235	53.974	33.813
1539	C	SER	227	34.209	53.173	34.679
1540	O	SER	227	35.408	53.478	34.660
1541	CB	SER	227	32.599	55.095	34.631
1542	OG	SER	227	31.836	54.518	35.682
1543	N	CYS	228	33.778	52.029	35.188
1544	CA	CYS	228	34.706	51.161	35.914
1545	C	CYS	228	35.554	50.340	34.949
1546	O	CYS	228	36.758	50.181	35.188
1547	CB	CYS	228	33.921	50.233	36.829
1548	SG	CYS	228	33.010	51.035	38.168
1549	N	LEU	229	35.025	50.087	33.762
1550	CA	LEU	229	35.804	49.403	32.723
1551	C	LEU	229	36.863	50.334	32.139
1552	O	LEU	229	38.029	49.936	32.022
1553	CB	LEU	229	34.861	48.968	31.606
1554	CG	LEU	229	33.863	47.915	32.073
1555	CD1	LEU	229	32.755	47.711	31.045
1556	CD2	LEU	229	34.558	46.596	32.391
1557	N	ILE	230	36.526	51.612	32.060
1558	CA	ILE	230	37.458	52.632	31.562
1559	C	ILE	230	38.486	53.053	32.620
1560	O	ILE	230	39.528	53.617	32.273
1561	CB	ILE	230	36.620	53.822	31.088
1562	CG1	ILE	230	35.714	53.401	29.937
1563	CG2	ILE	230	37.478	55.004	30.650
1564	CD1	ILE	230	34.841	54.557	29.464
1565	N	THR	231	38.279	52.652	33.863
1566	CA	THR	231	39.296	52.880	34.887
1567	C	THR	231	40.213	51.665	35.012
1568	O	THR	231	41.432	51.813	35.185
1569	CB	THR	231	38.592	53.136	36.214
1570	OG1	THR	231	37.756	54.272	36.049
1571	CG2	THR	231	39.583	53.436	37.333
1572	N	PHE	232	39.670	50.491	34.733
1573	CA	PHE	232	40.480	49.281	34.848
1574	C	PHE	232	41.288	49.000	33.586
1575	O	PHE	232	42.315	48.321	33.678
1576	CB	PHE	232	39.590	48.090	35.165
1577	CG	PHE	232	40.371	46.889	35.692
1578	CD1	PHE	232	40.825	46.892	37.005
1579	CD2	PHE	232	40.643	45.805	34.866
1580	CE1	PHE	232	41.540	45.808	37.496
1581	CE2	PHE	232	41.358	44.720	35.358
1582	CZ	PHE	232	41.805	44.721	36.673
1583	N	LYS	233	40.945	49.616	32.468
1584	CA	LYS	233	41.833	49.516	31.298
1585	C	LYS	233	43.208	50.190	31.497
1586	O	LYS	233	44.196	49.473	31.307
1587	CB	LYS	233	41.136	49.999	30.031
1588	CG	LYS	233	40.122	48.963	29.554
1589	CD	LYS	233	39.666	49.241	28.125
1590	CE	LYS	233	38.823	50.506	28.019
1591	NZ	LYS	233	37.511	50.312	28.654
1592	N	PRO	234	43.328	51.445	31.934
1593	CA	PRO	234	44.656	51.941	32.344
1594	C	PRO	234	45.242	51.236	33.580
1595	O	PRO	234	46.472	51.143	33.686
1596	CB	PRO	234	44.478	53.404	32.610
1597	CG	PRO	234	43.006	53.759	32.507
1598	CD	PRO	234	42.298	52.477	32.111
1599	N	GLY	235	44.404	50.633	34.414
1600	CA	GLY	235	44.890	49.742	35.479
1601	C	GLY	235	45.688	48.584	34.875
1602	O	GLY	235	46.885	48.438	35.150
1603	N	ALA	236	45.098	47.942	33.880
1604	CA	ALA	236	45.736	46.862	33.113
1605	C	ALA	236	46.746	47.324	32.048
1606	O	ALA	236	47.128	46.524	31.187
1607	CB	ALA	236	44.642	46.037	32.446
1608	N	PHE	237	47.158	48.584	32.092
1609	CA	PHE	237	48.227	49.086	31.226
1610	C	PHE	237	49.567	48.990	31.964
1611	O	PHE	237	50.641	49.042	31.345
1612	CB	PHE	237	47.912	50.533	30.861
1613	CG	PHE	237	48.847	51.156	29.830
1614	CD1	PHE	237	49.896	51.971	30.236
1615	CD2	PHE	237	48.636	50.917	28.479
1616	CE1	PHE	237	50.743	52.536	29.292
1617	CE2	PHE	237	49.481	51.485	27.535
1618	CZ	PHE	237	50.535	52.293	27.940
1619	N	ILE	238	49.492	48.656	33.244
1620	CA	ILE	238	50.702	48.390	34.040
1621	C	ILE	238	51.618	47.193	33.626
1622	O	ILE	238	52.797	47.323	33.975
1623	CB	ILE	238	50.245	48.283	35.500
1624	CG1	ILE	238	49.616	49.602	35.932
1625	CG2	ILE	238	51.380	47.941	36.460
1626	CD1	ILE	238	49.176	49.557	37.391
1627	N	PRO	239	51.263	46.178	32.818
1628	CA	PRO	239	52.295	45.243	32.294
1629	C	PRO	239	53.394	45.809	31.371
1630	O	PRO	239	54.190	45.021	30.847
1631	CB	PRO	239	51.558	44.169	31.556
1632	CG	PRO	239	50.083	44.494	31.522
1633	CD	PRO	239	49.935	45.770	32.322
1634	N	GLY	240	53.456	47.116	31.171
1635	CA	GLY	240	54.594	47.730	30.493
1636	C	GLY	240	55.737	48.034	31.472
1637	O	GLY	240	56.836	48.396	31.034
1638	N	VAL	241	55.517	47.846	32.768
1639	CA	VAL	241	56.594	48.095	33.743
1640	C	VAL	241	57.711	47.030	33.963
1641	O	VAL	241	58.566	47.362	34.792
1642	CB	VAL	241	55.992	48.475	35.098
1643	CG1	VAL	241	55.021	49.641	34.954
1644	CG2	VAL	241	55.320	47.307	35.809
1645	N	PRO	242	57.817	45.856	33.330
1646	CA	PRO	242	56.761	45.016	32.718
1647	C	PRO	242	55.864	44.299	33.738
1648	O	PRO	242	54.809	44.817	34.123
1649	CB	PRO	242	57.511	44.024	31.879
1650	CG	PRO	242	58.977	44.043	32.286
1651	CD	PRO	242	59.074	45.099	33.375
1652	N	VAL	243	56.283	43.087	34.083
1653	CA	VAL	243	55.663	42.158	35.051
1654	C	VAL	243	54.254	42.487	35.567
1655	O	VAL	243	54.084	43.241	36.532
1656	CB	VAL	243	56.646	42.004	36.216
1657	CG1	VAL	243	57.136	43.341	36.771
1658	CG2	VAL	243	56.089	41.121	37.325
1659	N	GLN	244	53.264	42.006	34.824
1660	CA	GLN	244	51.854	41.923	35.273
1661	C	GLN	244	51.149	40.774	34.550
1662	O	GLN	244	51.001	40.802	33.323
1663	CB	GLN	244	51.064	43.198	34.984
1664	CG	GLN	244	51.403	44.388	35.876
1665	CD	GLN	244	50.940	44.178	37.312
1666	OE1	GLN	244	49.739	44.092	37.588
1667	NE2	GLN	244	51.906	44.074	38.205
1668	N	PRO	245	50.897	39.705	35.284
1669	CA	PRO	245	50.094	38.578	34.785
1670	C	PRO	245	48.595	38.882	34.835
1671	O	PRO	245	48.163	39.649	35.700
1672	CB	PRO	245	50.419	37.462	35.723
1673	CG	PRO	245	51.074	38.053	36.965
1674	CD	PRO	245	51.300	39.524	36.677
1675	N	VAL	246	47.825	38.310	33.923
1676	CA	VAL	246	46.360	38.492	33.964
1677	C	VAL	246	45.565	37.313	33.374
1678	O	VAL	246	45.711	36.911	32.209
1679	CB	VAL	246	46.001	39.832	33.324
1680	CG1	VAL	246	46.795	40.098	32.057
1681	CG2	VAL	246	44.504	40.005	33.095
1682	N	LEU	247	44.779	36.729	34.266
1683	CA	LEU	247	43.895	35.577	33.995
1684	C	LEU	247	42.569	35.993	33.336
1685	O	LEU	247	41.960	36.988	33.747
1686	CB	LEU	247	43.575	34.912	35.339
1687	CG	LEU	247	44.603	33.911	35.887
1688	CD1	LEU	247	44.690	32.673	35.019
1689	CD2	LEU	247	45.998	34.458	36.190
1690	N	LEU	248	42.121	35.207	32.362
1691	CA	LEU	248	40.900	35.499	31.570
1692	C	LEU	248	40.011	34.258	31.392
1693	O	LEU	248	40.421	33.334	30.681
1694	CB	LEU	248	41.355	35.882	30.161
1695	CG	LEU	248	42.466	36.926	30.134
1696	CD1	LEU	248	43.181	36.921	28.788
1697	CD2	LEU	248	41.944	38.315	30.484
1698	N	ARG	249	38.786	34.264	31.904
1699	CA	ARG	249	37.933	33.057	31.780
1700	C	ARG	249	36.448	33.298	31.399
1701	O	ARG	249	35.933	34.417	31.551
1702	CB	ARG	249	38.005	32.306	33.109
1703	CG	ARG	249	39.337	31.609	33.358
1704	CD	ARG	249	39.344	30.817	34.662
1705	NE	ARG	249	40.532	29.956	34.720
1706	CZ	ARG	249	41.677	30.281	35.321
1707	NH1	ARG	249	41.716	31.303	36.175
1708	NH2	ARG	249	42.728	29.468	35.218
1709	N	TYR	250	35.810	32.259	30.852
1710	CA	TYR	250	34.335	32.249	30.566
1711	C	TYR	250	33.585	30.920	30.888
1712	O	TYR	250	32.967	30.893	31.951
1713	CB	TYR	250	34.038	32.667	29.119
1714	CG	TYR	250	32.552	32.795	28.684
1715	CD1	TYR	250	31.825	31.686	28.281
1716	CD2	TYR	250	31.945	34.038	28.611
1717	CE1	TYR	250	30.500	31.796	27.884
1718	CE2	TYR	250	30.617	34.160	28.216
1719	CZ	TYR	250	29.892	33.037	27.866
1720	OH	TYR	250	28.545	33.133	27.600
1721	N	PRO	251	33.833	29.798	30.211
1722	CA	PRO	251	32.729	29.044	29.572
1723	C	PRO	251	31.488	28.686	30.374
1724	O	PRO	251	31.573	28.244	31.522
1725	CB	PRO	251	33.352	27.815	29.010
1726	CG	PRO	251	34.836	28.064	28.894
1727	CD	PRO	251	35.069	29.427	29.524
1728	N	ASN	252	30.364	29.025	29.747
1729	CA	ASN	252	28.988	28.519	29.972
1730	C	ASN	252	27.989	29.618	30.366
1731	O	ASN	252	28.151	30.780	29.975
1732	CB	ASN	252	28.871	27.261	30.817
1733	CG	ASN	252	29.382	26.038	30.052
1734	OD1	ASN	252	30.588	25.894	29.809
1735	ND2	ASN	252	28.478	25.109	29.799
1736	N	LYS	253	26.880	29.213	30.967
1737	CA	LYS	253	25.727	30.118	31.084
1738	C	LYS	253	25.540	30.870	32.413
1739	O	LYS	253	24.907	31.928	32.384
1740	CB	LYS	253	24.492	29.270	30.822
1741	CG	LYS	253	24.698	28.406	29.585
1742	CD	LYS	253	23.502	27.503	29.319
1743	CE	LYS	253	23.806	26.495	28.218
1744	NZ	LYS	253	24.952	25.648	28.587
1745	N	LEU	254	26.110	30.414	33.519
1746	CA	LEU	254	25.912	31.091	34.816
1747	C	LEU	254	27.159	31.811	35.339
1748	O	LEU	254	27.608	32.807	34.755
1749	CB	LEU	254	25.455	30.095	35.878
1750	CG	LEU	254	23.988	29.717	35.721
1751	CD1	LEU	254	23.556	28.800	36.860
1752	CD2	LEU	254	23.109	30.963	35.695
1753	N	ASP	255	27.698	31.322	36.449
1754	CA	ASP	255	28.798	32.027	37.151
1755	C	ASP	255	29.843	31.080	37.767
1756	O	ASP	255	29.797	29.882	37.468
1757	CB	ASP	255	28.213	32.911	38.256
1758	CG	ASP	255	27.639	32.087	39.418
1759	OD1	ASP	255	26.568	31.519	39.251
1760	OD2	ASP	255	28.239	32.126	40.487
1761	N	THR	256	30.920	31.684	38.273
1762	CA	THR	256	31.948	31.120	39.204
1763	C	THR	256	33.097	30.150	38.780
1764	O	THR	256	32.848	29.063	38.269
1765	CB	THR	256	31.255	30.494	40.409
1766	OG1	THR	256	32.302	30.104	41.262
1767	CG2	THR	256	30.383	29.258	40.186
1768	N	VAL	257	34.346	30.573	39.024
1769	CA	VAL	257	35.489	29.663	39.269
1770	C	VAL	257	36.725	30.166	40.046
1771	O	VAL	257	37.145	29.369	40.887
1772	CB	VAL	257	35.974	28.849	38.059
1773	CG1	VAL	257	37.381	29.183	37.572
1774	CG2	VAL	257	36.057	27.429	38.542
1775	N	THR	258	37.294	31.356	39.862
1776	CA	THR	258	38.638	31.646	40.474
1777	C	THR	258	38.827	33.122	40.887
1778	O	THR	258	38.423	34.005	40.136
1779	CB	THR	258	39.701	31.104	39.516
1780	OG1	THR	258	39.815	29.703	39.775
1781	CG2	THR	258	41.092	31.677	39.739
1782	N	TRP	259	39.546	33.390	41.971
1783	CA	TRP	259	39.249	34.565	42.834
1784	C	TRP	259	39.127	35.929	42.189
1785	O	TRP	259	40.085	36.506	41.677
1786	CB	TRP	259	40.131	34.614	44.059
1787	CG	TRP	259	39.638	33.690	45.150
1788	CD1	TRP	259	40.370	32.719	45.783
1789	CD2	TRP	259	38.318	33.655	45.744
1790	NE1	TRP	259	39.552	32.030	46.613
1791	CE2	TRP	259	38.293	32.520	46.571
1792	CE3	TRP	259	37.155	34.386	45.541
1793	CZ2	TRP	259	37.095	32.075	47.103
1794	CZ3	TRP	259	35.966	33.962	46.109
1795	CH2	TRP	259	35.933	32.793	46.880
1796	N	THR	260	38.041	36.515	42.683
1797	CA	THR	260	37.216	37.591	42.093
1798	C	THR	260	36.415	37.070	40.903
1799	O	THR	260	36.025	37.822	40.000
1800	CB	THR	260	37.950	38.891	41.806
1801	OG1	THR	260	38.913	38.727	40.777
1802	CG2	THR	260	38.607	39.416	43.071
1803	N	TRP	261	36.269	35.752	40.921
1804	CA	TRP	261	35.292	34.979	40.155
1805	C	TRP	261	34.905	33.752	40.995
1806	O	TRP	261	34.244	32.890	40.425
1807	CB	TRP	261	35.834	34.407	38.844
1808	CG	TRP	261	36.496	35.287	37.798
1809	CD1	TRP	261	36.085	36.508	37.321
1810	CD2	TRP	261	37.691	34.949	37.061
1811	NE1	TRP	261	36.964	36.920	36.368
1812	CE2	TRP	261	37.933	36.013	36.178
1813	CE3	TRP	261	38.535	33.855	37.074
1814	CZ2	TRP	261	39.023	35.972	35.324
1815	CZ3	TRP	261	39.623	33.820	36.218
1816	CH2	TRP	261	39.869	34.874	35.344
1817	N	GLN	262	35.579	33.537	42.133
1818	CA	GLN	262	35.362	32.418	43.128
1819	C	GLN	262	36.612	31.516	43.363
1820	O	GLN	262	37.687	32.089	43.441
1821	CB	GLN	262	34.064	31.638	42.966
1822	CG	GLN	262	32.899	32.322	43.698
1823	CD	GLN	262	31.884	32.995	42.763
1824	OE1	GLN	262	32.210	33.892	41.982
1825	NE2	GLN	262	30.634	32.593	42.903
1826	N	GLY	263	36.518	30.235	43.686
1827	CA	GLY	263	37.737	29.432	44.092
1828	C	GLY	263	39.001	29.313	43.179
1829	O	GLY	263	39.026	28.456	42.285
1830	N	TYR	264	40.112	29.785	43.719
1831	CA	TYR	264	41.443	29.973	43.044
1832	C	TYR	264	42.254	28.765	42.491
1833	O	TYR	264	43.224	28.381	43.152
1834	CB	TYR	264	42.291	30.492	44.194
1835	CG	TYR	264	43.366	31.525	43.916
1836	CD1	TYR	264	43.835	31.776	42.634
1837	CD2	TYR	264	43.884	32.217	45.000
1838	CE1	TYR	264	44.800	32.754	42.439
1839	CE2	TYR	264	44.847	33.193	44.805
1840	CZ	TYR	264	45.290	33.471	43.522
1841	OH	TYR	264	46.130	34.544	43.321
1842	N	THR	265	42.013	28.353	41.249
1843	CA	THR	265	42.802	27.341	40.451
1844	C	THR	265	43.596	26.139	41.042
1845	O	THR	265	43.882	26.022	42.244
1846	CB	THR	265	43.880	28.128	39.710
1847	OG1	THR	265	44.771	28.685	40.674
1848	CG2	THR	265	43.318	29.252	38.856
1849	N	PHE	266	43.722	25.168	40.126
1850	CA	PHE	266	44.881	24.217	39.961
1851	C	PHE	266	44.624	22.698	39.832
1852	O	PHE	266	43.616	22.192	40.338
1853	CB	PHE	266	46.026	24.499	40.922
1854	CG	PHE	266	47.182	25.131	40.153
1855	CD1	PHE	266	48.151	24.318	39.583
1856	CD2	PHE	266	47.247	26.508	39.984
1857	CE1	PHE	266	49.196	24.879	38.861
1858	CE2	PHE	266	48.293	27.071	39.261
1859	CZ	PHE	266	49.267	26.256	38.699
1860	N	ILE	267	45.332	22.143	38.840
1861	CA	ILE	267	45.531	20.703	38.461
1862	C	ILE	267	44.937	20.217	37.078
1863	O	ILE	267	45.608	20.501	36.084
1864	CB	ILE	267	45.415	19.741	39.644
1865	CG1	ILE	267	46.417	20.176	40.711
1866	CG2	ILE	267	45.782	18.318	39.232
1867	CD1	ILE	267	46.274	19.372	41.990
1868	N	GLN	268	43.829	19.479	36.941
1869	CA	GLN	268	43.564	18.809	35.627
1870	C	GLN	268	42.177	18.868	34.925
1871	O	GLN	268	41.272	19.649	35.227
1872	CB	GLN	268	43.968	17.347	35.758
1873	CG	GLN	268	45.487	17.192	35.709
1874	CD	GLN	268	45.880	15.784	36.102
1875	OE1	GLN	268	45.854	15.437	37.288
1876	NE2	GLN	268	46.231	14.988	35.108
1877	N	LEU	269	42.108	18.016	33.905
1878	CA	LEU	269	41.142	18.066	32.764
1879	C	LEU	269	39.774	17.450	33.041
1880	O	LEU	269	39.565	16.852	34.095
1881	CB	LEU	269	41.674	17.277	31.549
1882	CG	LEU	269	43.139	17.473	31.137
1883	CD1	LEU	269	44.088	16.513	31.845
1884	CD2	LEU	269	43.295	17.217	29.649
1885	N	CYS	270	38.861	17.594	32.084
1886	CA	CYS	270	37.595	16.843	32.131
1887	C	CYS	270	36.717	16.900	30.869
1888	O	CYS	270	36.778	15.973	30.055
1889	CB	CYS	270	36.763	17.325	33.308
1890	SG	CYS	270	35.311	16.331	33.712
1891	N	MET	271	36.055	18.035	30.661
1892	CA	MET	271	34.840	18.191	29.801
1893	C	MET	271	34.985	17.869	28.300
1894	O	MET	271	35.598	16.863	27.933
1895	CB	MET	271	34.379	19.645	29.926
1896	CG	MET	271	34.468	20.222	31.343
1897	SD	MET	271	33.544	19.389	32.659
1898	CE	MET	271	33.722	20.603	33.988
1899	N	LEU	272	34.163	18.568	27.515
1900	CA	LEU	272	34.177	18.580	26.027
1901	C	LEU	272	33.205	19.662	25.520
1902	O	LEU	272	32.903	20.564	26.308
1903	CB	LEU	272	33.837	17.214	25.416
1904	CG	LEU	272	35.112	16.498	24.964
1905	CD1	LEU	272	34.837	15.138	24.330
1906	CD2	LEU	272	35.912	17.375	24.007
1907	N	THR	273	32.961	19.721	24.210
1908	CA	THR	273	31.882	20.543	23.574
1909	C	THR	273	32.397	21.932	23.147
1910	O	THR	273	33.311	22.473	23.782
1911	CB	THR	273	30.644	20.571	24.478
1912	OG1	THR	273	30.293	19.219	24.737
1913	CG2	THR	273	29.419	21.240	23.865
1914	N	PHE	274	31.826	22.474	22.072
1915	CA	PHE	274	32.488	23.547	21.312
1916	C	PHE	274	31.602	24.433	20.432
1917	O	PHE	274	32.089	24.874	19.384
1918	CB	PHE	274	33.478	22.867	20.369
1919	CG	PHE	274	33.163	21.440	19.909
1920	CD1	PHE	274	32.170	21.192	18.970
1921	CD2	PHE	274	33.906	20.383	20.424
1922	CE1	PHE	274	31.895	19.888	18.578
1923	CE2	PHE	274	33.631	19.080	20.032
1924	CZ	PHE	274	32.621	18.831	19.112
1925	N	CYS	275	30.365	24.714	20.804
1926	CA	CYS	275	29.507	25.471	19.871
1927	C	CYS	275	28.819	26.717	20.441
1928	O	CYS	275	28.225	27.482	19.673
1929	CB	CYS	275	28.428	24.526	19.356
1930	SG	CYS	275	29.005	23.112	18.388
1931	N	GLN	276	28.930	26.956	21.735
1932	CA	GLN	276	28.044	27.946	22.365
1933	C	GLN	276	28.666	29.319	22.709
1934	O	GLN	276	28.053	30.036	23.507
1935	CB	GLN	276	27.430	27.331	23.627
1936	CG	GLN	276	26.877	25.911	23.468
1937	CD	GLN	276	27.896	24.860	23.921
1938	OE1	GLN	276	28.632	24.305	23.092
1939	NE2	GLN	276	27.995	24.677	25.226
1940	N	LEU	277	29.829	29.667	22.167
1941	CA	LEU	277	30.480	30.992	22.396
1942	C	LEU	277	30.988	31.272	23.822
1943	O	LEU	277	30.211	31.575	24.733
1944	CB	LEU	277	29.542	32.119	21.977
1945	CG	LEU	277	29.261	32.085	20.481
1946	CD1	LEU	277	28.224	33.136	20.102
1947	CD2	LEU	277	30.545	32.273	19.681
1948	N	PHE	278	32.308	31.289	23.958
1949	CA	PHE	278	32.971	31.584	25.241
1950	C	PHE	278	34.107	32.601	25.127
1951	O	PHE	278	34.995	32.405	24.297
1952	CB	PHE	278	33.495	30.280	25.870
1953	CG	PHE	278	34.992	29.920	25.875
1954	CD1	PHE	278	35.428	28.812	25.161
1955	CD2	PHE	278	35.904	30.639	26.643
1956	CE1	PHE	278	36.765	28.444	25.183
1957	CE2	PHE	278	37.244	30.274	26.665
1958	CZ	PHE	278	37.674	29.175	25.934
1959	N	THR	279	33.980	33.699	25.868
1960	CA	THR	279	35.042	34.692	26.215
1961	C	THR	279	34.429	36.080	26.472
1962	O	THR	279	34.225	36.851	25.523
1963	CB	THR	279	36.208	34.767	25.217
1964	OG1	THR	279	37.069	33.659	25.471
1965	CG2	THR	279	37.077	35.994	25.433
1966	N	LYS	280	34.133	36.319	27.755
1967	CA	LYS	280	33.527	37.542	28.369
1968	C	LYS	280	32.346	37.151	29.275
1969	O	LYS	280	31.252	36.921	28.750
1970	CB	LYS	280	33.024	38.558	27.345
1971	CG	LYS	280	32.536	39.848	27.993
1972	CD	LYS	280	32.052	40.839	26.941
1973	CE	LYS	280	30.871	40.285	26.151
1974	NZ	LYS	280	29.726	40.026	27.039
1975	N	VAL	281	32.536	37.238	30.590
1976	CA	VAL	281	31.567	36.826	31.655
1977	C	VAL	281	31.074	35.367	31.563
1978	O	VAL	281	31.916	34.488	31.362
1979	CB	VAL	281	30.435	37.848	31.886
1980	CG1	VAL	281	30.988	39.137	32.480
1981	CG2	VAL	281	29.534	38.178	30.698
1982	N	GLU	282	29.858	35.131	32.046
1983	CA	GLU	282	29.129	33.825	32.088
1984	C	GLU	282	29.965	32.542	32.063
1985	O	GLU	282	30.553	32.129	31.058
1986	CB	GLU	282	28.032	33.772	31.032
1987	CG	GLU	282	26.991	34.876	31.234
1988	CD	GLU	282	26.521	34.987	32.691
1989	OE1	GLU	282	27.149	35.784	33.378
1990	OE2	GLU	282	25.420	34.554	32.987
1991	N	VAL	283	29.817	31.849	33.178
1992	CA	VAL	283	30.640	30.705	33.582
1993	C	VAL	283	29.809	29.413	33.642
1994	O	VAL	283	28.664	29.448	33.197
1995	CB	VAL	283	31.186	31.148	34.923
1996	CG1	VAL	283	32.336	30.320	35.455
1997	CG2	VAL	283	31.587	32.620	34.890
1998	N	GLU	284	30.309	28.305	34.171
1999	CA	GLU	284	29.657	27.007	33.928
2000	C	GLU	284	28.229	26.795	34.427
2001	O	GLU	284	27.578	27.666	35.023
2002	CB	GLU	284	30.577	25.848	34.275
2003	CG	GLU	284	31.544	25.658	33.108
2004	CD	GLU	284	32.527	24.526	33.344
2005	OE1	GLU	284	33.702	24.711	33.048
2006	OE2	GLU	284	32.101	23.500	33.863
2007	N	PHE	285	27.698	25.759	33.793
2008	CA	PHE	285	26.293	25.328	33.835
2009	C	PHE	285	26.181	24.128	32.898
2010	O	PHE	285	26.284	24.303	31.675
2011	CB	PHE	285	25.400	26.448	33.293
2012	CG	PHE	285	23.901	26.148	33.197
2013	CD1	PHE	285	23.389	25.444	32.113
2014	CD2	PHE	285	23.042	26.602	34.187
2015	CE1	PHE	285	22.028	25.183	32.027
2016	CE2	PHE	285	21.680	26.346	34.101
2017	CZ	PHE	285	21.172	25.634	33.023
2018	N	MET	286	26.013	22.938	33.450
2019	CA	MET	286	25.917	21.731	32.613
2020	C	MET	286	24.647	21.717	31.755
2021	O	MET	286	23.580	22.178	32.179
2022	CB	MET	286	26.000	20.464	33.469
2023	CG	MET	286	24.820	20.234	34.410
2024	SD	MET	286	24.849	21.096	35.997
2025	CE	MET	286	26.395	20.423	36.649
2026	N	PRO	287	24.832	21.307	30.507
2027	CA	PRO	287	23.793	21.383	29.470
2028	C	PRO	287	22.516	20.623	29.812
2029	O	PRO	287	22.529	19.568	30.458
2030	CB	PRO	287	24.422	20.841	28.224
2031	CG	PRO	287	25.881	20.526	28.498
2032	CD	PRO	287	26.117	20.877	29.955
2033	N	VAL	288	21.445	21.085	29.185
2034	CA	VAL	288	20.089	20.616	29.500
2035	C	VAL	288	19.741	19.251	28.904
2036	O	VAL	288	18.948	18.506	29.492
2037	CB	VAL	288	19.124	21.665	28.950
2038	CG1	VAL	288	17.686	21.380	29.371
2039	CG2	VAL	288	19.530	23.066	29.393
2040	N	GLN	289	20.422	18.864	27.840
2041	CA	GLN	289	20.103	17.581	27.212
2042	C	GLN	289	21.011	16.465	27.721
2043	O	GLN	289	20.607	15.294	27.770
2044	CB	GLN	289	20.268	17.735	25.700
2045	CG	GLN	289	19.954	16.451	24.931
2046	CD	GLN	289	18.470	16.094	25.012
2047	OE1	GLN	289	17.641	16.701	24.325
2048	NE2	GLN	289	18.153	15.130	25.860
2049	N	VAL	290	22.219	16.842	28.108
2050	CA	VAL	290	23.218	15.881	28.594
2051	C	VAL	290	23.983	16.535	29.745
2052	O	VAL	290	24.671	17.539	29.527
2053	CB	VAL	290	24.205	15.528	27.472
2054	CG1	VAL	290	25.003	14.285	27.837
2055	CG2	VAL	290	23.535	15.287	26.123
2056	N	PRO	291	23.957	15.901	30.909
2057	CA	PRO	291	24.348	16.554	32.174
2058	C	PRO	291	25.854	16.743	32.416
2059	O	PRO	291	26.220	17.315	33.449
2060	CB	PRO	291	23.785	15.675	33.249
2061	CG	PRO	291	23.251	14.395	32.629
2062	CD	PRO	291	23.351	14.583	31.126
2063	N	ASN	292	26.716	16.273	31.528
2064	CA	ASN	292	28.155	16.505	31.709
2065	C	ASN	292	28.425	17.970	31.404
2066	O	ASN	292	27.956	18.455	30.372
2067	CB	ASN	292	28.954	15.683	30.700
2068	CG	ASN	292	28.341	14.314	30.419
2069	OD1	ASN	292	28.041	13.527	31.326
2070	ND2	ASN	292	28.139	14.065	29.136
2071	N	ASP	293	29.169	18.664	32.251
2072	CA	ASP	293	29.433	20.087	31.976
2073	C	ASP	293	30.282	20.219	30.716
2074	O	ASP	293	31.216	19.441	30.496
2075	CB	ASP	293	30.123	20.735	33.160
2076	CG	ASP	293	29.598	22.155	33.334
2077	OD1	ASP	293	29.047	22.418	34.393
2078	OD2	ASP	293	29.540	22.875	32.346
2079	N	GLU	294	29.899	21.151	29.861
2080	CA	GLU	294	30.431	21.181	28.494
2081	C	GLU	294	30.610	22.606	27.978
2082	O	GLU	294	29.626	23.326	27.744
2083	CB	GLU	294	29.463	20.382	27.626
2084	CG	GLU	294	29.665	18.882	27.844
2085	CD	GLU	294	28.544	18.032	27.252
2086	OE1	GLU	294	28.544	16.842	27.556
2087	OE2	GLU	294	27.918	18.498	26.310
2088	N	GLU	295	31.851	22.912	27.638
2089	CA	GLU	295	32.258	24.282	27.340
2090	C	GLU	295	31.839	24.744	25.953
2091	O	GLU	295	31.029	24.119	25.254
2092	CB	GLU	295	33.770	24.440	27.478
2093	CG	GLU	295	34.583	23.684	26.428
2094	CD	GLU	295	35.911	24.421	26.268
2095	OE1	GLU	295	35.959	25.546	26.752
2096	OE2	GLU	295	36.884	23.796	25.873
2097	N	LYS	296	32.258	25.966	25.683
2098	CA	LYS	296	31.946	26.641	24.435
2099	C	LYS	296	33.200	26.891	23.587
2100	O	LYS	296	34.188	26.154	23.681
2101	CB	LYS	296	31.275	27.935	24.848
2102	CG	LYS	296	30.119	27.648	25.797
2103	CD	LYS	296	29.355	28.910	26.161
2104	CE	LYS	296	27.988	28.584	26.749
2105	NZ	LYS	296	27.181	29.803	26.908
2106	N	ASN	297	33.120	27.907	22.740
2107	CA	ASN	297	34.185	28.261	21.774
2108	C	ASN	297	34.227	29.778	21.550
2109	O	ASN	297	33.177	30.408	21.399
2110	CB	ASN	297	33.914	27.551	20.445
2111	CG	ASN	297	32.596	27.998	19.799
2112	OD1	ASN	297	31.524	27.955	20.420
2113	ND2	ASN	297	32.700	28.494	18.580
2114	N	ASP	298	35.413	30.360	21.543
2115	CA	ASP	298	35.563	31.829	21.534
2116	C	ASP	298	34.920	32.614	20.388
2117	O	ASP	298	35.064	32.268	19.210
2118	CB	ASP	298	37.049	32.161	21.529
2119	CG	ASP	298	37.705	32.055	22.906
2120	OD1	ASP	298	38.621	32.831	23.144
2121	OD2	ASP	298	37.425	31.096	23.610
2122	N	PRO	299	34.118	33.603	20.768
2123	CA	PRO	299	34.110	34.896	20.085
2124	C	PRO	299	35.418	35.637	20.363
2125	O	PRO	299	36.255	35.205	21.163
2126	CB	PRO	299	32.955	35.645	20.669
2127	CG	PRO	299	32.599	34.986	21.990
2128	CD	PRO	299	33.518	33.780	22.085
2129	N	VAL	300	35.553	36.791	19.741
2130	CA	VAL	300	36.839	37.488	19.741
2131	C	VAL	300	37.010	38.620	20.758
2132	O	VAL	300	38.075	38.699	21.385
2133	CB	VAL	300	36.967	38.080	18.345
2134	CG1	VAL	300	38.196	38.965	18.219
2135	CG2	VAL	300	36.963	36.986	17.288
2136	N	LEU	301	35.927	39.302	21.099
2137	CA	LEU	301	36.032	40.639	21.721
2138	C	LEU	301	36.911	40.756	22.966
2139	O	LEU	301	37.952	41.423	22.888
2140	CB	LEU	301	34.638	41.159	22.040
2141	CG	LEU	301	33.892	41.541	20.766
2142	CD1	LEU	301	32.484	42.027	21.089
2143	CD2	LEU	301	34.657	42.606	19.985
2144	N	PHE	302	36.646	39.970	23.996
2145	CA	PHE	302	37.367	40.169	25.260
2146	C	PHE	302	38.827	39.713	25.194
2147	O	PHE	302	39.705	40.468	25.631
2148	CB	PHE	302	36.620	39.405	26.348
2149	CG	PHE	302	37.168	39.557	27.765
2150	CD1	PHE	302	37.122	40.791	28.401
2151	CD2	PHE	302	37.697	38.456	28.428
2152	CE1	PHE	302	37.611	40.925	29.694
2153	CE2	PHE	302	38.185	38.590	29.721
2154	CZ	PHE	302	38.143	39.825	30.354
2155	N	ALA	303	39.110	38.704	24.386
2156	CA	ALA	303	40.482	38.195	24.316
2157	C	ALA	303	41.321	38.994	23.325
2158	O	ALA	303	42.507	39.230	23.582
2159	CB	ALA	303	40.450	36.727	23.914
2160	N	ASN	304	40.649	39.631	22.382
2161	CA	ASN	304	41.323	40.502	21.423
2162	C	ASN	304	41.672	41.840	22.057
2163	O	ASN	304	42.794	42.334	21.871
2164	CB	ASN	304	40.363	40.740	20.268
2165	CO	ASN	304	40.964	41.715	19.269
2166	OD1	ASN	304	42.091	41.526	18.800
2167	ND2	ASN	304	40.226	42.774	18.986
2168	N	LYS	305	40.837	42.278	22.984
2169	CA	LYS	305	41.102	43.530	23.690
2170	C	LYS	305	42.278	43.360	24.638
2171	O	LYS	305	43.241	44.135	24.555
2172	CB	LYS	305	39.863	43.900	24.493
2173	CG	LYS	305	40.085	45.177	25.298
2174	CD	LYS	305	38.912	45.452	26.230
2175	CE	LYS	305	38.760	44.344	27.267
2176	NZ	LYS	305	39.954	44.255	28.124
2177	N	VAL	306	42.336	42.201	25.276
2178	CA	VAL	306	43.436	41.918	26.194
2179	C	VAL	306	44.747	41.654	25.454
2180	O	VAL	306	45.766	42.240	25.838
2181	CB	VAL	306	43.052	40.712	27.041
2182	CG1	VAL	306	44.189	40.309	27.967
2183	CG2	VAL	306	41.797	41.002	27.853
2184	N	ARG	307	44.663	41.088	24.260
2185	CA	ARG	307	45.864	40.827	23.457
2186	C	ARG	307	46.495	42.114	22.926
2187	O	ARG	307	47.718	42.288	23.036
2188	CB	ARG	307	45.454	39.954	22.278
2189	CG	ARG	307	46.648	39.606	21.400
2190	CD	ARG	307	46.217	38.820	20.168
2191	NE	ARG	307	45.317	39.615	19.315
2192	CZ	ARG	307	45.721	40.197	18.183
2193	NH1	ARG	307	46.997	40.106	17.803
2194	NH2	ARG	307	44.854	40.888	17.440
2195	N	ASN	308	45.655	43.100	22.654
2196	CA	ASN	308	46.140	44.398	22.174
2197	C	ASN	308	46.690	45.276	23.298
2198	O	ASN	308	47.531	46.141	23.016
2199	CB	ASN	308	45.010	45.129	21.450
2200	CG	ASN	308	44.916	44.696	19.984
2201	OD1	ASN	308	45.597	45.259	19.119
2202	ND2	ASN	308	44.060	43.726	19.713
2203	N	LEU	309	46.471	44.883	24.545
2204	CA	LEU	309	47.026	45.642	25.670
2205	C	LEU	309	48.529	45.419	25.828
2206	O	LEU	309	49.232	46.390	26.133
2207	CB	LEU	309	46.320	45.237	26.960
2208	CG	LEU	309	44.850	45.643	26.960
2209	CD1	LEU	309	44.138	45.107	28.197
2210	CD2	LEU	309	44.698	47.158	26.866
2211	N	MET	310	49.049	44.295	25.352
2212	CA	MET	310	50.505	44.100	25.405
2213	C	MET	310	51.227	44.855	24.301
2214	O	MET	310	52.296	45.425	24.552
2215	CB	MET	310	50.842	42.627	25.265
2216	CG	MET	310	50.630	41.882	26.569
2217	SD	MET	310	51.614	42.430	27.978
2218	CE	MET	310	50.992	41.239	29.186
2219	N	ALA	311	50.533	45.091	23.200
2220	CA	ALA	311	51.132	45.858	22.110
2221	C	ALA	311	51.051	47.351	22.405
2222	O	ALA	311	52.025	48.076	22.176
2223	CB	ALA	311	50.380	45.542	20.822
2224	N	GLU	312	50.034	47.728	23.164
2225	CA	GLU	312	49.849	49.128	23.549
2226	C	GLU	312	50.741	49.526	24.726
2227	O	GLU	312	51.132	50.693	24.836
2228	CB	GLU	312	48.385	49.283	23.946
2229	CG	GLU	312	48.015	50.723	24.276
2230	CD	GLU	312	46.578	50.764	24.782
2231	OE1	GLU	312	46.239	51.712	25.476
2232	OE2	GLU	312	45.850	49.824	24.489
2233	N	ALA	313	51.120	48.557	25.543
2234	CA	ALA	313	52.023	48.821	26.667
2235	C	ALA	313	53.483	48.523	26.336
2236	O	ALA	313	54.363	48.793	27.164
2237	CB	ALA	313	51.586	47.968	27.853
2238	N	LEU	314	53.719	48.012	25.135
2239	CA	LEU	314	55.050	47.589	24.673
2240	C	LEU	314	55.673	46.575	25.629
2241	O	LEU	314	56.806	46.738	26.096
2242	CB	LEU	314	55.951	48.806	24.502
2243	CG	LEU	314	55.427	49.724	23.403
2244	CD1	LEU	314	56.236	51.014	23.335
2245	CD2	LEU	314	55.424	49.016	22.051
2246	N	GLY	315	54.929	45.509	25.867
2247	CA	GLY	315	55.379	44.435	26.755
2248	C	GLY	315	55.137	43.095	26.078
2249	O	GLY	315	54.021	42.811	25.630
2250	N	ILE	316	56.183	42.287	26.004
2251	CA	ILE	316	56.107	40.997	25.297
2252	C	ILE	316	55.137	40.039	25.987
2253	O	ILE	316	55.294	39.715	27.169
2254	CB	ILE	316	57.513	40.398	25.249
2255	CG1	ILE	316	58.471	41.324	24.506
2256	CG2	ILE	316	57.508	39.020	24.592
2257	CD1	ILE	316	58.075	41.485	23.041
2258	N	PRO	317	54.093	39.670	25.263
2259	CA	PRO	317	53.057	38.794	25.802
2260	C	PRO	317	53.516	37.347	25.857
2261	O	PRO	317	54.218	36.872	24.960
2262	CB	PRO	317	51.912	38.916	24.845
2263	CG	PRO	317	52.386	39.645	23.597
2264	CD	PRO	317	53.812	40.083	23.885
2265	N	VAL	318	53.209	36.699	26.965
2266	CA	VAL	318	53.329	35.241	27.048
2267	C	VAL	318	51.952	34.649	27.335
2268	O	VAL	318	51.555	34.474	28.492
2269	CB	VAL	318	54.337	34.879	28.133
2270	CG1	VAL	318	54.418	33.371	28.354
2271	CG2	VAL	318	55.712	35.428	27.771
2272	N	THR	319	51.195	34.438	26.273
2273	CA	THR	319	49.810	33.964	26.398
2274	C	THR	319	49.721	32.445	26.488
2275	O	THR	319	49.696	31.735	25.477
2276	CB	THR	319	49.027	34.452	25.186
2277	OG1	THR	319	49.162	35.865	25.128
2278	CG2	THR	319	47.544	34.112	25.294
2279	N	ASP	320	49.632	31.956	27.709
2280	CA	ASP	320	49.528	30.515	27.935
2281	C	ASP	320	48.068	30.086	28.025
2282	O	ASP	320	47.197	30.800	28.544
2283	CB	ASP	320	50.291	30.141	29.201
2284	CG	ASP	320	51.787	30.379	28.995
2285	OD1	ASP	320	52.230	30.301	27.854
2286	OD2	ASP	320	52.471	30.607	29.983
2287	N	HIS	321	47.798	28.951	27.411
2288	CA	HIS	321	46.432	28.429	27.392
2289	C	HIS	321	46.197	27.507	28.580
2290	O	HIS	321	47.087	26.756	28.991
2291	CB	HIS	321	46.212	27.758	26.046
2292	CG	HIS	321	46.386	28.768	24.927
2293	ND1	HIS	321	45.649	29.879	24.743
2294	CD2	HIS	321	47.330	28.745	23.926
2295	CE1	HIS	321	46.107	30.546	23.665
2296	NE2	HIS	321	47.146	29.845	23.160
2297	N	THR	322	45.070	27.712	29.232
2298	CA	THR	322	44.775	27.037	30.498
2299	C	THR	322	43.288	26.654	30.533
2300	O	THR	322	42.562	26.917	29.570
2301	CB	THR	322	45.192	28.056	31.569
2302	OG1	THR	322	46.567	28.347	31.352
2303	CG2	THR	322	45.073	27.632	33.026
2304	N	TYR	323	42.875	25.921	31.552
2305	CA	TYR	323	41.470	25.517	31.695
2306	C	TYR	323	41.156	25.228	33.164
2307	O	TYR	323	42.083	25.210	33.974
2308	CB	TYR	323	41.232	24.292	30.823
2309	CG	TYR	323	42.020	23.086	31.270
2310	CD1	TYR	323	41.419	22.185	32.128
2311	CD2	TYR	323	43.322	22.885	30.832
2312	CE1	TYR	323	42.130	21.092	32.571
2313	CE2	TYR	323	44.032	21.784	31.272
2314	CZ	TYR	323	43.433	20.897	32.148
2315	OH	TYR	323	44.166	19.882	32.699
2316	N	GLU	324	39.897	25.001	33.508
2317	CA	GLU	324	39.556	24.799	34.927
2318	C	GLU	324	38.363	23.858	35.172
2319	O	GLU	324	37.206	24.286	35.080
2320	CB	GLU	324	39.237	26.174	35.501
2321	CG	GLU	324	38.846	26.117	36.970
2322	CD	GLU	324	40.051	26.087	37.904
2323	OE1	GLU	324	40.373	27.144	38.429
2324	OE2	GLU	324	40.564	25.007	38.169
2325	N	ASP	325	38.654	22.632	35.588
2326	CA	ASP	325	37.614	21.664	35.999
2327	C	ASP	325	37.577	21.302	37.494
2328	O	ASP	325	38.447	20.604	38.020
2329	CB	ASP	325	37.819	20.349	35.252
2330	CG	ASP	325	36.981	19.245	35.914
2331	OD1	ASP	325	35.772	19.423	36.012
2332	OD2	ASP	325	37.566	18.290	36.399
2333	N	CYS	326	36.527	21.745	38.158
2334	CA	CYS	326	36.107	21.102	39.419
2335	C	CYS	326	34.594	21.081	39.521
2336	O	CYS	326	34.065	21.479	40.567
2337	CB	CYS	326	36.631	21.811	40.664
2338	SG	CYS	326	38.381	21.628	41.063
2339	N	ARG	327	33.940	20.397	38.594
2340	CA	ARG	327	32.477	20.505	38.476
2341	C	ARG	327	31.727	19.862	39.640
2342	O	ARG	327	30.671	20.362	40.042
2343	CB	ARG	327	32.028	19.817	37.194
2344	CG	ARG	327	30.526	19.985	36.986
2345	CD	ARG	327	29.966	18.942	36.029
2346	NE	ARG	327	30.080	17.591	36.595
2347	CZ	ARG	327	30.580	16.551	35.923
2348	NH1	ARG	327	31.107	16.729	34.709
2349	NH2	ARG	327	30.624	15.349	36.499
2350	N	LEU	328	32.372	18.930	40.317
2351	CA	LEU	328	31.736	18.295	41.466
2352	C	LEU	328	32.119	18.952	42.791
2353	O	LEU	328	31.535	18.589	43.814
2354	CB	LEU	328	32.103	16.817	41.495
2355	CG	LEU	328	31.459	16.066	40.336
2356	CD1	LEU	328	31.866	14.597	40.347
2357	CD2	LEU	328	29.940	16.197	40.388
2358	N	MET	329	32.991	19.950	42.785
2359	CA	MET	329	33.414	20.531	44.061
2360	C	MET	329	32.310	21.422	44.603
2361	O	MET	329	31.953	21.305	45.778
2362	CB	MET	329	34.705	21.322	43.900
2363	CG	MET	329	35.213	21.800	45.259
2364	SD	MET	329	35.777	20.525	46.413
2365	CE	MET	329	37.367	20.119	45.653
2366	N	ILE	330	31.756	22.273	43.753
2367	CA	ILE	330	30.519	22.995	44.096
2368	C	ILE	330	29.647	23.056	42.847
2369	O	ILE	330	29.590	24.103	42.187
2370	CB	ILE	330	30.773	24.424	44.573
2371	CG1	ILE	330	31.795	24.526	45.696
2372	CG2	ILE	330	29.459	25.007	45.090
2373	CD1	ILE	330	31.104	24.424	47.048
2374	N	SER	331	28.987	21.945	42.558
2375	CA	SER	331	28.194	21.759	41.331
2376	C	SER	331	27.238	22.912	41.036
2377	O	SER	331	26.365	23.276	41.834
2378	CB	SER	331	27.418	20.450	41.451
2379	OG	SER	331	26.589	20.518	42.605
2380	N	ALA	332	27.489	23.525	39.892
2381	CA	ALA	332	26.702	24.675	39.443
2382	C	ALA	332	25.902	24.343	38.189
2383	O	ALA	332	26.418	23.765	37.223
2384	CB	ALA	332	27.648	25.838	39.163
2385	N	GLY	333	24.642	24.734	38.205
2386	CA	GLY	333	23.771	24.478	37.060
2387	C	GLY	333	22.482	23.791	37.487
2388	O	GLY	333	22.496	22.856	38.299
2389	N	GLN	334	21.435	24.081	36.733
2390	CA	GLN	334	20.082	23.602	37.044
2391	C	GLN	334	19.882	22.118	36.724
2392	O	GLN	334	19.007	21.465	37.298
2393	CB	GLN	334	19.131	24.431	36.188
2394	CG	GLN	334	17.667	24.075	36.406
2395	CD	GLN	334	16.824	24.770	35.346
2396	OE1	GLN	334	16.782	26.003	35.272
2397	NE2	GLN	334	16.221	23.963	34.489
2398	N	LEU	335	20.817	21.544	35.988
2399	CA	LEU	335	20.717	20.135	35.603
2400	C	LEU	335	21.400	19.202	36.606
2401	O	LEU	335	21.507	17.999	36.343
2402	CB	LEU	335	21.276	19.913	34.196
2403	CG	LEU	335	20.329	20.354	33.074
2404	CD1	LEU	335	18.910	19.852	33.324
2405	CD2	LEU	335	20.318	21.862	32.829
2406	N	THR	336	21.785	19.727	37.762
2407	CA	THR	336	22.370	18.891	38.818
2408	C	THR	336	21.269	18.153	39.586
2409	O	THR	336	21.493	17.071	40.137
2410	CB	THR	336	23.126	19.802	39.786
2411	OG1	THR	336	24.092	20.549	39.060
2412	CG2	THR	336	23.854	19.019	40.873
2413	N	LEU	337	20.067	18.702	39.519
2414	CA	LEU	337	18.889	18.102	40.152
2415	C	LEU	337	17.672	18.667	39.419
2416	O	LEU	337	17.532	19.893	39.399
2417	CB	LEU	337	18.886	18.517	41.623
2418	CG	LEU	337	17.911	17.705	42.469
2419	CD1	LEU	337	18.295	16.228	42.470
2420	CD2	LEU	337	17.859	18.236	43.896
2421	N	PRO	338	16.751	17.848	38.924
2422	CA	PRO	338	16.451	16.501	39.447
2423	C	PRO	338	17.221	15.317	38.850
2424	O	PRO	338	16.838	14.177	39.139
2425	CB	PRO	338	14.993	16.303	39.169
2426	CG	PRO	338	14.529	17.354	38.176
2427	CD	PRO	338	15.689	18.321	38.030
2428	N	MET	339	18.197	15.544	37.985
2429	CA	MET	339	18.917	14.415	37.388
2430	C	MET	339	19.649	13.617	38.465
2431	O	MET	339	20.071	14.168	39.488
2432	CB	MET	339	19.876	14.945	36.333
2433	CG	MET	339	19.126	15.869	35.379
2434	SD	MET	339	19.915	16.172	33.783
2435	CE	MET	339	19.644	14.543	33.047
2436	N	GLU	340	19.675	12.306	38.291
2437	CA	GLU	340	20.241	11.442	39.333
2438	C	GLU	340	21.765	11.422	39.299
2439	O	GLU	340	22.382	10.721	38.490
2440	CB	GLU	340	19.707	10.019	39.185
2441	CG	GLU	340	20.205	9.152	40.339
2442	CD	GLU	340	19.706	7.712	40.244
2443	OE1	GLU	340	20.383	6.909	39.617
2444	OE2	GLU	340	18.625	7.450	40.757
2445	N	ALA	341	22.355	12.212	40.180
2446	CA	ALA	341	23.805	12.172	40.381
2447	C	ALA	341	24.169	11.261	41.554
2448	O	ALA	341	25.325	10.851	41.706
2449	CB	ALA	341	24.299	13.588	40.653
2450	N	GLY	342	23.165	10.903	42.338
2451	CA	GLY	342	23.383	10.012	43.480
2452	C	GLY	342	23.022	8.566	43.155
2453	O	GLY	342	21.933	8.278	42.644
2454	N	LEU	343	23.990	7.690	43.360
2455	CA	LEU	343	23.765	6.249	43.214
2456	C	LEU	343	22.842	5.792	44.344
2457	O	LEU	343	22.966	6.293	45.467
2458	CB	LEU	343	25.123	5.554	43.306
2459	CG	LEU	343	25.068	4.073	42.943
2460	CD1	LEU	343	24.573	3.880	41.513
2461	CD2	LEU	343	26.432	3.417	43.128
2462	N	VAL	344	21.916	4.895	44.023
2463	CA	VAL	344	20.896	4.399	44.969
2464	C	VAL	344	19.871	5.500	45.256
2465	O	VAL	344	20.211	6.596	45.713
2466	CB	VAL	344	21.556	3.857	46.245
2467	CG1	VAL	344	20.541	3.447	47.310
2468	CG2	VAL	344	22.480	2.685	45.926
2469	N	GLU	345	18.606	5.152	45.076
2470	CA	GLU	345	17.495	6.120	45.133
2471	C	GLU	345	17.062	6.561	46.540
2472	O	GLU	345	16.094	7.320	46.658
2473	CB	GLU	345	16.296	5.466	44.457
2474	CG	GLU	345	16.571	5.149	42.992
2475	CD	GLU	345	15.438	4.288	42.442
2476	OE1	GLU	345	15.176	4.373	41.251
2477	OE2	GLU	345	14.946	3.468	43.205
2478	N	PHE	346	17.728	6.086	47.578
2479	CA	PHE	346	17.326	6.433	48.942
2480	C	PHE	346	18.503	7.009	49.717
2481	O	PHE	346	19.631	6.519	49.587
2482	CB	PHE	346	16.812	5.184	49.651
2483	CG	PHE	346	15.574	4.557	49.014
2484	CD1	PHE	346	14.380	5.264	48.976
2485	CD2	PHE	346	15.642	3.278	48.475
2486	CE1	PHE	346	13.254	4.695	48.396
2487	CE2	PHE	346	14.515	2.709	47.895
2488	CZ	PHE	346	13.322	3.418	47.855
2489	N	THR	347	18.203	8.022	50.522
2490	CA	THR	347	19.165	8.669	51.439
2491	C	THR	347	20.143	9.586	50.692
2492	O	THR	347	20.597	9.260	49.589
2493	CB	THR	347	19.906	7.596	52.247
2494	OG1	THR	347	18.937	6.716	52.801
2495	CG2	THR	347	20.751	8.154	53.389
2496	N	LYS	348	20.338	10.767	51.270
2497	CA	LYS	348	21.287	11.802	50.805
2498	C	LYS	348	20.701	12.708	49.728
2499	O	LYS	348	20.402	12.290	48.603
2500	CB	LYS	348	22.617	11.211	50.338
2501	CG	LYS	348	23.392	10.594	51.496
2502	CD	LYS	348	24.735	10.042	51.034
2503	CE	LYS	348	25.512	9.452	52.204
2504	NZ	LYS	348	25.723	10.464	53.251
2505	N	ILE	349	20.510	13.953	50.128
2506	CA	ILE	349	20.027	15.009	49.231
2507	C	ILE	349	21.200	15.502	48.379
2508	O	ILE	349	22.337	15.531	48.864
2509	CB	ILE	349	19.469	16.128	50.119
2510	CG1	ILE	349	18.383	15.589	51.046
2511	CG2	ILE	349	18.907	17.293	49.307
2512	CD1	ILE	349	17.159	15.113	50.268
2513	N	SER	350	20.937	15.795	47.113
2514	CA	SER	350	21.986	16.278	46.202
2515	C	SER	350	22.645	17.557	46.713
2516	O	SER	350	21.991	18.551	47.047
2517	CB	SER	350	21.389	16.522	44.822
2518	OG	SER	350	20.957	15.271	44.303
2519	N	ARG	351	23.959	17.474	46.803
2520	CA	ARG	351	24.789	18.556	47.332
2521	C	ARG	351	25.483	19.354	46.235
2522	O	ARG	351	25.732	18.855	45.130
2523	CB	ARG	351	25.832	17.881	48.212
2524	CG	ARG	351	26.321	16.609	47.525
2525	CD	ARG	351	27.268	15.800	48.400
2526	NE	ARG	351	27.445	14.443	47.859
2527	CZ	ARG	351	28.513	13.677	48.096
2528	NH1	ARG	351	29.573	14.181	48.730
2529	NH2	ARG	351	28.559	12.435	47.607
2530	N	LYS	352	25.738	20.618	46.527
2531	CA	LYS	352	26.590	21.392	45.631
2532	C	LYS	352	28.035	21.070	45.959
2533	O	LYS	352	28.790	20.628	45.085
2534	CB	LYS	352	26.362	22.888	45.792
2535	CG	LYS	352	24.946	23.311	45.429
2536	CD	LYS	352	24.861	24.831	45.366
2537	CE	LYS	352	25.448	25.464	46.623
2538	NZ	LYS	352	25.407	26.932	46.554
2539	N	LEU	353	28.360	21.173	47.236
2540	CA	LEU	353	29.711	20.861	47.704
2541	C	LEU	353	29.902	19.350	47.757
2542	O	LEU	353	29.072	18.628	48.319
2543	CB	LEU	353	29.901	21.498	49.079
2544	CG	LEU	353	31.274	21.254	49.705
2545	CD1	LEU	353	32.424	21.732	48.828
2546	CD2	LEU	353	31.361	21.917	51.071
2547	N	LYS	354	30.932	18.891	47.071
2548	CA	LYS	354	31.284	17.471	47.029
2549	C	LYS	354	32.787	17.311	46.778
2550	O	LYS	354	33.398	18.106	46.053
2551	CB	LYS	354	30.438	16.827	45.927
2552	CG	LYS	354	30.906	15.439	45.510
2553	CD	LYS	354	30.006	14.847	44.436
2554	CE	LYS	354	30.611	13.566	43.877
2555	NZ	LYS	354	30.925	12.615	44.955
2556	N	LEU	355	33.384	16.355	47.476
2557	CA	LEU	355	34.812	16.032	47.302
2558	C	LEU	355	35.155	15.875	45.830
2559	O	LEU	355	34.458	15.186	45.078
2560	CB	LEU	355	35.161	14.717	47.994
2561	CG	LEU	355	35.273	14.811	49.512
2562	CD1	LEU	355	33.932	14.559	50.202
2563	CD2	LEU	355	36.285	13.777	49.987
2564	N	ASP	356	36.221	16.530	45.415
2565	CA	ASP	356	36.517	16.527	43.989
2566	C	ASP	356	38.017	16.545	43.717
2567	O	ASP	356	38.833	16.835	44.600
2568	CB	ASP	356	35.833	17.756	43.396
2569	CG	ASP	356	35.549	17.572	41.911
2570	OD1	ASP	356	35.279	18.558	41.236
2571	OD2	ASP	356	35.556	16.433	41.471
2572	N	TRP	357	38.345	16.100	42.515
2573	CA	TRP	357	39.675	16.159	41.924
2574	C	TRP	357	40.120	17.619	41.800
2575	O	TRP	357	40.054	18.352	42.791
2576	CB	TRP	357	39.579	15.472	40.560
2577	CG	TRP	357	39.396	13.953	40.592
2578	CD1	TRP	357	40.362	13.036	40.254
2579	CD2	TRP	357	38.212	13.176	40.926
2580	NE1	TRP	357	39.866	11.785	40.420
2581	CE2	TRP	357	38.599	11.827	40.864
2582	CE3	TRP	357	36.926	13.508	41.320
2583	CZ2	TRP	357	37.719	10.835	41.283
2584	CZ3	TRP	357	36.037	12.510	41.699
2585	CH2	TRP	357	36.438	11.177	41.693
2586	N	ASP	358	40.633	18.030	40.650
2587	CA	ASP	358	41.127	19.422	40.502
2588	C	ASP	358	41.168	19.903	39.037
2589	O	ASP	358	41.184	19.046	38.146
2590	CB	ASP	358	42.492	19.529	41.159
2591	CG	ASP	358	42.363	19.983	42.608
2592	OD1	ASP	358	41.467	20.776	42.859
2593	OD2	ASP	358	43.248	19.653	43.383
2594	N	GLY	359	41.484	21.180	38.811
2595	CA	GLY	359	41.154	21.838	37.516
2596	C	GLY	359	42.160	22.453	36.501
2597	O	GLY	359	41.904	22.331	35.300
2598	N	VAL	360	43.061	23.317	36.933
2599	CA	VAL	360	43.957	24.073	36.011
2600	C	VAL	360	45.321	23.461	35.640
2601	O	VAL	360	46.225	23.380	36.483
2602	CB	VAL	360	44.228	25.436	36.653
2603	CG1	VAL	360	45.435	26.176	36.091
2604	CG2	VAL	360	43.009	26.331	36.599
2605	N	ARG	361	45.487	23.112	34.372
2606	CA	ARG	361	46.843	22.886	33.827
2607	C	ARG	361	47.330	24.116	33.070
2608	O	ARG	361	46.532	24.935	32.597
2609	CB	ARG	361	46.895	21.755	32.810
2610	CG	ARG	361	47.061	20.342	33.350
2611	CD	ARG	361	47.150	19.414	32.140
2612	NE	ARG	361	47.385	18.003	32.472
2613	CZ	ARG	361	47.503	17.093	31.502
2614	NH1	ARG	361	47.288	17.451	30.235
2615	NH2	ARG	361	47.737	15.815	31.800
2616	N	LYS	362	48.639	24.202	32.918
2617	CA	LYS	362	49.241	25.243	32.081
2618	C	LYS	362	49.795	24.631	30.795
2619	O	LYS	362	50.844	23.974	30.812
2620	CB	LYS	362	50.380	25.902	32.848
2621	CG	LYS	362	49.913	26.513	34.164
2622	CD	LYS	362	48.989	27.708	33.964
2623	CE	LYS	362	48.610	28.318	35.310
2624	NZ	LYS	362	47.730	29.484	35.140
2625	N	HIS	363	49.111	24.878	29.691
2626	CA	HIS	363	49.522	24.341	28.388
2627	C	HIS	363	50.730	25.119	27.865
2628	O	HIS	363	51.069	26.191	28.383
2629	CB	HIS	363	48.329	24.458	27.435
2630	CG	HIS	363	48.413	23.670	26.142
2631	ND1	HIS	363	48.385	22.330	26.021
2632	CD2	HIS	363	48.537	24.187	24.875
2633	CE1	HIS	363	48.494	21.999	24.720
2634	NE2	HIS	363	48.588	23.147	24.013
2635	N	LEU	364	51.385	24.528	26.878
2636	CA	LEU	364	52.592	25.066	26.234
2637	C	LEU	364	52.480	26.546	25.878
2638	O	LEU	364	51.383	27.106	25.737
2639	CB	LEU	364	52.822	24.267	24.956
2640	CG	LEU	364	53.003	22.780	25.248
2641	CD1	LEU	364	52.987	21.962	23.961
2642	CD2	LEU	364	54.280	22.521	26.043
2643	N	ASP	365	53.645	27.167	25.786
2644	CA	ASP	365	53.755	28.608	25.536
2645	C	ASP	365	53.060	29.008	24.234
2646	O	ASP	365	53.074	28.269	23.243
2647	CB	ASP	365	55.244	28.959	25.499
2648	CG	ASP	365	55.493	30.469	25.502
2649	OD1	ASP	365	54.650	31.194	26.014
2650	OD2	ASP	365	56.528	30.871	24.991
2651	N	GLU	366	52.383	30.144	24.335
2652	CA	GLU	366	51.621	30.833	23.275
2653	C	GLU	366	51.840	30.423	21.825
2654	O	GLU	366	52.963	30.256	21.332
2655	CB	GLU	366	51.969	32.311	23.385
2656	CG	GLU	366	53.469	32.549	23.241
2657	CD	GLU	366	53.766	34.012	23.491
2658	OE1	GLU	366	54.939	34.334	23.626
2659	OE2	GLU	366	52.807	34.698	23.837
2660	N	TYR	367	50.717	30.365	21.132
2661	CA	TYR	367	50.716	30.143	19.684
2662	C	TYR	367	51.051	31.433	18.947
2663	O	TYR	367	50.942	32.535	19.498
2664	CB	TYR	367	49.344	29.640	19.255
2665	CG	TYR	367	49.031	28.249	19.784
2666	CD1	TYR	367	47.758	27.947	20.250
2667	CD2	TYR	367	50.028	27.281	19.797
2668	CE1	TYR	367	47.486	26.677	20.739
2669	CE2	TYR	367	49.756	26.011	20.284
2670	CZ	TYR	367	48.486	25.714	20.754
2671	OH	TYR	367	48.216	24.447	21.215
2672	N	ALA	368	51.535	31.276	17.729
2673	CA	ALA	368	51.892	32.439	16.916
2674	C	ALA	368	50.661	33.105	16.312
2675	O	ALA	368	50.010	32.549	15.419
2676	CB	ALA	368	52.829	31.989	15.801
2677	N	SER	369	50.492	34.377	16.639
2678	CA	SER	369	49.381	35.160	16.077
2679	C	SER	369	49.667	35.583	14.635
2680	O	SER	369	48.738	35.691	13.827
2681	CB	SER	369	49.158	36.403	16.934
2682	OG	SER	369	50.311	37.229	16.836
2683	N	ILE	370	50.934	35.497	14.257
2684	CA	ILE	370	51.342	35.784	12.881
2685	C	ILE	370	51.010	34.612	11.954
2686	O	ILE	370	50.701	34.834	10.776
2687	CB	ILE	370	52.845	36.052	12.884
2688	CG1	ILE	370	53.182	37.227	13.798
2689	CG2	ILE	370	53.359	36.323	11.474
2690	CD1	ILE	370	52.555	38.527	13.299
2691	N	ALA	371	50.776	33.448	12.544
2692	CA	ALA	371	50.370	32.290	11.755
2693	C	ALA	371	48.939	32.492	11.281
2694	O	ALA	371	48.762	32.676	10.073
2695	CB	ALA	371	50.468	31.030	12.606
2696	N	SER	372	48.073	32.904	12.196
2697	CA	SER	372	46.663	33.123	11.845
2698	C	SER	372	46.440	34.404	11.040
2699	O	SER	372	45.539	34.451	10.195
2700	CB	SER	372	45.848	33.204	13.129
2701	OG	SER	372	44.507	33.508	12.766
2702	N	SER	373	47.374	35.338	11.121
2703	CA	SER	373	47.246	36.569	10.333
2704	C	SER	373	47.758	36.429	8.899
2705	O	SER	373	47.568	37.352	8.099
2706	CB	SER	373	48.011	37.693	11.021
2707	OG	SER	373	49.392	37.371	10.987
2708	N	SER	374	48.386	35.315	8.561
2709	CA	SER	374	48.835	35.137	7.180
2710	C	SER	374	48.307	33.850	6.558
2711	O	SER	374	47.822	33.841	5.419
2712	CB	SER	374	50.357	35.106	7.169
2713	OG	SER	374	50.761	34.855	5.830
2714	N	LYS	375	48.349	32.788	7.336
2715	CA	LYS	375	47.997	31.457	6.848
2716	C	LYS	375	47.054	30.764	7.823
2717	O	LYS	375	47.451	30.328	8.910
2718	CB	LYS	375	49.289	30.662	6.715
2719	CG	LYS	375	49.065	29.296	6.074
2720	CD	LYS	375	50.345	28.470	5.916
2721	CE	LYS	375	51.315	29.001	4.854
2722	NZ	LYS	375	52.237	30.034	5.364
2723	N	GLY	376	45.816	30.615	7.390
2724	CA	GLY	376	44.791	30.024	8.250
2725	C	GLY	376	44.175	31.114	9.114
2726	O	GLY	376	44.217	31.059	10.349
2727	N	GLY	377	43.661	32.125	8.437
2728	CA	GLY	377	43.034	33.263	9.110
2729	C	GLY	377	42.499	34.257	8.090
2730	O	GLY	377	41.505	34.942	8.348
2731	N	ARG	378	43.184	34.345	6.960
2732	CA	ARG	378	42.758	35.175	5.815
2733	C	ARG	378	42.874	36.677	6.071
2734	O	ARG	378	43.111	37.124	7.198
2735	CB	ARG	378	41.349	34.806	5.357
2736	CG	ARG	378	41.299	33.393	4.777
2737	CD	ARG	378	42.256	33.230	3.596
2738	NE	ARG	378	41.926	34.154	2.498
2739	CZ	ARG	378	42.829	34.953	1.924
2740	NH1	ARG	378	44.090	34.965	2.364
2741	NH2	ARG	378	42.466	35.758	0.925
2742	N	ILE	379	42.612	37.439	5.020
2743	CA	ILE	379	42.951	38.872	4.983
2744	C	ILE	379	42.018	39.822	5.744
2745	O	ILE	379	42.326	41.017	5.837
2746	CB	ILE	379	43.000	39.302	3.521
2747	CG1	ILE	379	41.706	38.938	2.797
2748	CG2	ILE	379	44.203	38.681	2.820
2749	GDI	ILE	379	41.727	39.409	1.348
2750	N	GLY	380	40.917	39.334	6.284
2751	CA	GLY	380	40.072	40.203	7.103
2752	C	GLY	380	40.597	40.195	8.531
2753	O	GLY	380	40.881	39.122	9.074
2754	N	ILE	381	40.555	41.339	9.194
2755	CA	ILE	381	41.075	41.406	10.568
2756	C	ILE	381	40.176	40.672	11.570
2757	O	ILE	381	40.702	39.964	12.437
2758	CB	ILE	381	41.278	42.870	10.963
2759	CG1	ILE	381	41.676	42.997	12.431
2760	CG2	ILE	381	40.048	43.722	10.658
2761	CD1	ILE	381	41.870	44.454	12.834
2762	N	GLU	382	38.899	40.539	11.239
2763	CA	GLU	382	38.006	39.739	12.076
2764	C	GLU	382	38.151	38.250	11.767
2765	O	GLU	382	37.988	37.433	12.675
2766	CB	GLU	382	36.566	40.171	11.827
2767	CG	GLU	382	35.596	39.433	12.746
2768	CD	GLU	382	34.161	39.819	12.407
2769	OE1	GLU	382	33.277	39.006	12.637
2770	OE2	GLU	382	33.986	40.901	11.863
2771	N	GLU	383	38.713	37.924	10.615
2772	CA	GLU	383	38.904	36.521	10.259
2773	C	GLU	383	40.175	36.004	10.919
2774	O	GLU	383	40.118	34.977	11.606
2775	CB	GLU	383	39.013	36.399	8.748
2776	CG	GLU	383	37.725	36.752	8.025
2777	CD	GLU	383	37.950	36.588	6.525
2778	OE1	GLU	383	37.050	36.097	5.861
2779	OE2	GLU	383	38.996	37.025	6.057
2780	N	PHE	384	41.169	36.876	10.992
2781	CA	PHE	384	42.395	36.594	11.746
2782	C	PHE	384	42.097	36.465	13.235
2783	O	PHE	384	42.536	35.495	13.865
2784	CB	PHE	384	43.360	37.758	11.503
2785	CG	PHE	384	44.415	38.035	12.582
2786	CD1	PHE	384	44.648	39.349	12.969
2787	CD2	PHE	384	45.134	37.006	13.179
2788	CE1	PHE	384	45.594	39.633	13.945
2789	CE2	PHE	384	46.077	37.289	14.157
2790	CZ	PHE	384	46.308	38.603	14.540
2791	N	ALA	385	41.199	37.295	13.734
2792	CA	ALA	385	40.857	37.233	15.149
2793	C	ALA	385	40.004	36.010	15.488
2794	O	ALA	385	40.323	35.313	16.462
2795	CB	ALA	385	40.127	38.519	15.499
2796	N	LYS	386	39.146	35.588	14.572
2797	CA	LYS	386	38.358	34.375	14.814
2798	C	LYS	386	39.220	33.127	14.702
2799	O	LYS	386	39.119	32.259	15.571
2800	CB	LYS	386	37.213	34.273	13.815
2801	CG	LYS	386	36.163	35.358	14.028
2802	CD	LYS	386	34.961	35.261	13.081
2803	CE	LYS	386	35.250	35.663	11.631
2804	NZ	LYS	386	35.855	34.584	10.827
2805	N	TYR	387	40.233	33.176	13.854
2806	CA	TYR	387	41.187	32.069	13.734
2807	C	TYR	387	42.365	32.164	14.708
2808	O	TYR	387	43.342	31.422	14.564
2809	CB	TYR	387	41.679	31.976	12.299
2810	CG	TYR	387	40.675	31.330	11.348
2811	CD1	TYR	387	40.553	29.946	11.328
2812	CD2	TYR	387	39.885	32.110	10.511
2813	CE1	TYR	387	39.644	29.341	10.470
2814	CE2	TYR	387	38.976	31.507	9.653
2815	CZ	TYR	387	38.858	30.123	9.635
2816	OH	TYR	387	37.955	29.523	8.786
2817	N	LEU	388	42.301	33.089	15.650
2818	CA	LEU	388	43.248	33.094	16.760
2819	C	LEU	388	42.513	32.565	17.990
2820	O	LEU	388	42.998	31.654	18.674
2821	CB	LEU	388	43.707	34.538	16.968
2822	CG	LEU	388	45.011	34.687	17.753
2823	CD1	LEU	388	45.564	36.095	17.583
2824	CD2	LEU	388	44.878	34.353	19.237
2825	N	LYS	389	41.257	32.965	18.106
2826	CA	LYS	389	40.444	32.608	19.276
2827	C	LYS	389	39.812	31.220	19.141
2828	O	LYS	389	39.569	30.529	20.144
2829	CB	LYS	389	39.365	33.679	19.429
2830	CG	LYS	389	39.614	34.600	20.627
2831	CD	LYS	389	40.892	35.428	20.518
2832	CE	LYS	389	40.803	36.480	19.419
2833	NZ	LYS	389	42.051	37.253	19.335
2834	N	LEU	390	39.686	30.768	17.907
2835	CA	LEU	390	39.273	29.387	17.643
2836	C	LEU	390	40.357	28.376	18.048
2837	O	LEU	390	39.999	27.506	18.847
2838	CB	LEU	390	38.874	29.215	16.180
2839	CG	LEU	390	38.263	27.840	15.928
2840	CD1	LEU	390	37.014	27.637	16.780
2841	CD2	LEU	390	37.938	27.651	14.451
2842	N	PRO	391	41.625	28.465	17.631
2843	CA	PRO	391	42.634	27.541	18.181
2844	C	PRO	391	42.860	27.646	19.692
2845	O	PRO	391	43.110	26.597	20.302
2846	CB	PRO	391	43.906	27.821	17.448
2847	CG	PRO	391	43.681	28.959	16.476
2848	CD	PRO	391	42.221	29.348	16.622
2849	N	VAL	392	42.554	28.782	20.307
2850	CA	VAL	392	42.569	28.860	21.774
2851	C	VAL	392	41.532	27.903	22.361
2852	O	VAL	392	41.907	26.985	23.103
2853	CB	VAL	392	42.238	30.286	22.208
2854	CG1	VAL	392	42.087	30.388	23.723
2855	CG2	VAL	392	43.280	31.277	21.710
2856	N	SER	393	40.346	27.904	21.774
2857	CA	SER	393	39.283	27.001	22.223
2858	C	SER	393	39.544	25.554	21.806
2859	O	SER	393	39.381	24.654	22.635
2860	CB	SER	393	37.974	27.457	21.595
2861	OG	SER	393	37.761	28.816	21.940
2862	N	ASP	394	40.172	25.361	20.657
2863	CA	ASP	394	40.480	24.015	20.152
2864	C	ASP	394	41.439	23.272	21.072
2865	O	ASP	394	41.123	22.157	21.509
2866	CB	ASP	394	41.149	24.121	18.782
2867	CG	ASP	394	40.236	24.736	17.722
2868	OD1	ASP	394	39.074	24.364	17.678
2869	OD2	ASP	394	40.763	25.433	16.863
2870	N	VAL	395	42.460	23.965	21.553
2871	CA	VAL	395	43.429	23.305	22.426
2872	C	VAL	395	42.968	23.292	23.877
2873	O	VAL	395	43.342	22.375	24.613
2874	CB	VAL	395	44.789	23.970	22.267
2875	CG1	VAL	395	45.170	23.954	20.792
2876	CG2	VAL	395	44.814	25.394	22.810
2877	N	LEU	396	41.931	24.060	24.169
2878	CA	LEU	396	41.308	24.029	25.494
2879	C	LEU	396	40.336	22.850	25.598
2880	O	LEU	396	40.187	22.282	26.684
2881	CB	LEU	396	40.587	25.358	25.721
2882	CG	LEU	396	41.389	26.363	26.557
2883	CD1	LEU	396	42.881	26.399	26.250
2884	CD2	LEU	396	40.798	27.762	26.451
2885	N	ARG	397	39.913	22.333	24.452
2886	CA	ARG	397	39.137	21.087	24.421
2887	C	ARG	397	40.047	19.866	24.320
2888	O	ARG	397	39.648	18.763	24.699
2889	CB	ARG	397	38.220	21.098	23.214
2890	CG	ARG	397	37.404	22.377	23.163
2891	CD	ARG	397	36.593	22.407	21.886
2892	NE	ARG	397	36.556	23.756	21.311
2893	CZ	ARG	397	36.668	23.934	19.993
2894	NH1	ARG	397	36.432	25.132	19.456
2895	NH2	ARG	397	36.848	22.873	19.202
2896	N	GLN	398	41.305	20.083	23.971
2897	CA	GLN	398	42.296	19.001	24.050
2898	C	GLN	398	42.785	18.883	25.492
2899	O	GLN	398	43.055	17.788	26.003
2900	CB	GLN	398	43.443	19.354	23.115
2901	CG	GLN	398	42.913	19.472	21.694
2902	CD	GLN	398	43.941	20.122	20.778
2903	OE1	GLN	398	45.009	20.566	21.215
2904	NE2	GLN	398	43.554	20.261	19.523
2905	N	LEU	399	42.642	20.001	26.183
2906	CA	LEU	399	42.819	20.104	27.629
2907	C	LEU	399	41.539	19.774	28.411
2908	O	LEU	399	41.504	19.870	29.645
2909	CB	LEU	399	43.221	21.537	27.915
2910	CG	LEU	399	44.625	21.844	27.406
2911	CD1	LEU	399	44.934	23.332	27.561
2912	CD2	LEU	399	45.671	20.994	28.132
2913	N	PHE	400	40.517	19.335	27.703
2914	CA	PHE	400	39.259	18.909	28.315
2915	C	PHE	400	38.831	17.578	27.719
2916	O	PHE	400	37.972	17.548	26.835
2917	CB	PHE	400	38.172	19.934	28.024
2918	CG	PHE	400	37.905	20.922	29.154
2919	CD1	PHE	400	37.088	22.021	28.931
2920	CD2	PHE	400	38.440	20.693	30.419
2921	CE1	PHE	400	36.823	22.898	29.962
2922	CE2	PHE	400	38.175	21.581	31.464
2923	CZ	PHE	400	37.361	22.683	31.222
2924	N	ALA	401	39.564	16.536	28.075
2925	CA	ALA	401	39.207	15.173	27.654
2926	C	ALA	401	39.919	14.089	28.463
2927	O	ALA	401	39.277	13.214	29.057
2928	CB	ALA	401	39.574	15.003	26.185
2929	N	LEU	402	41.231	14.226	28.570
2930	CA	LEU	402	42.090	13.146	29.093
2931	C	LEU	402	41.753	12.726	30.517
2932	O	LEU	402	41.336	11.585	30.747
2933	CB	LEU	402	43.533	13.630	29.060
2934	CG	LEU	402	43.936	14.095	27.670
2935	CD1	LEU	402	45.313	14.745	27.697
2936	CD2	LEU	402	43.881	12.953	26.665
2937	N	PHE	403	41.664	13.709	31.393
2938	CA	PHE	403	41.385	13.438	32.804
2939	C	PHE	403	39.897	13.245	33.089
2940	O	PHE	403	39.568	12.901	34.225
2941	CB	PHE	403	41.967	14.575	33.630
2942	CG	PHE	403	41.971	14.488	35.156
2943	CD1	PHE	403	40.984	15.127	35.896
2944	CD2	PHE	403	42.990	13.810	35.808
2945	CE1	PHE	403	41.010	15.080	37.282
2946	CE2	PHE	403	43.015	13.758	37.193
2947	CZ	PHE	403	42.028	14.395	37.929
2948	N	ASP	404	39.051	13.181	32.070
2949	CA	ASP	404	37.647	12.834	32.305
2950	C	ASP	404	37.564	11.344	32.627
2951	O	ASP	404	36.916	10.966	33.614
2952	CB	ASP	404	36.848	13.118	31.040
2953	CG	ASP	404	35.358	12.956	31.308
2954	OD1	ASP	404	34.963	13.227	32.433
2955	OD2	ASP	404	34.674	12.427	30.442
2956	N	ARG	405	38.527	10.617	32.077
2957	CA	ARG	405	38.704	9.189	32.355
2958	C	ARG	405	39.549	8.909	33.606
2959	O	ARG	405	39.815	7.745	33.936
2960	CB	ARG	405	39.356	8.594	31.117
2961	CG	ARG	405	38.380	8.674	29.948
2962	CD	ARG	405	39.045	8.394	28.607
2963	NE	ARG	405	39.882	9.526	28.176
2964	CZ	ARG	405	40.070	9.824	26.888
2965	NH1	ARG	405	40.802	10.885	26.545
2966	NH2	ARG	405	39.495	9.080	25.941
2967	N	ASN	406	39.928	9.958	34.320
2968	CA	ASN	406	40.676	9.805	35.567
2969	C	ASN	406	39.846	10.361	36.727
2970	O	ASN	406	40.003	9.952	37.883
2971	CB	ASN	406	41.977	10.597	35.461
2972	CG	ASN	406	42.827	10.225	34.241
2973	OD1	ASN	406	42.598	9.211	33.572
2974	ND2	ASN	406	43.883	10.994	34.044
2975	N	HIS	407	38.914	11.229	36.362
2976	CA	HIS	407	37.986	11.890	37.286
2977	C	HIS	407	36.747	11.027	37.475
2978	O	HIS	407	36.333	10.733	38.597
2979	CB	HIS	407	37.606	13.214	36.614
2980	CG	HIS	407	36.792	14.218	37.408
2981	ND1	HIS	407	37.170	15.475	37.715
2982	CD2	HIS	407	35.526	14.046	37.917
2983	CE1	HIS	407	36.190	16.073	38.422
2984	NE2	HIS	407	35.173	15.191	38.544
2985	N	ASP	408	36.196	10.576	36.363
2986	CA	ASP	408	35.060	9.652	36.399
2987	C	ASP	408	35.520	8.217	36.145
2988	O	ASP	408	34.715	7.280	36.192
2989	CB	ASP	408	34.034	10.075	35.349
2990	CG	ASP	408	33.428	11.436	35.698
2991	OD1	ASP	408	33.057	12.148	34.777
2992	OD2	ASP	408	33.310	11.722	36.882
2993	N	GLY	409	36.810	8.056	35.900
2994	CA	GLY	409	37.375	6.729	35.646
2995	C	GLY	409	38.391	6.361	36.722
2996	O	GLY	409	38.054	6.314	37.910
2997	N	SER	410	39.618	6.108	36.295
2998	CA	SER	410	40.677	5.700	37.225
2999	C	SER	410	42.050	5.638	36.562
3000	O	SER	410	43.011	5.194	37.202
3001	CB	SER	410	40.356	4.306	37.750
3002	OG	SER	410	40.367	3.423	36.638
3003	N	ILE	411	42.182	6.168	35.355
3004	CA	ILE	411	43.439	6.008	34.593
3005	C	ILE	411	44.386	7.199	34.826
3006	O	ILE	411	45.100	7.641	33.915
3007	CB	ILE	411	43.060	5.879	33.116
3008	CG1	ILE	411	41.844	4.974	32.944
3009	CG2	ILE	411	44.202	5.279	32.307
3010	CD1	ILE	411	42.196	3.507	33.179
3011	N	ASP	412	44.583	7.516	36.097
3012	CA	ASP	412	45.133	8.819	36.513
3013	C	ASP	412	46.557	9.141	36.035
3014	O	ASP	412	46.801	10.293	35.655
3015	CB	ASP	412	44.999	8.964	38.037
3016	CG	ASP	412	45.928	8.078	38.878
3017	OD1	ASP	412	46.290	8.529	39.955
3018	OD2	ASP	412	46.287	6.996	38.432
3019	N	PHE	413	47.421	8.150	35.880
3020	CA	PHE	413	48.744	8.422	35.307
3021	C	PHE	413	48.897	7.845	33.903
3022	O	PHE	413	49.693	8.354	33.105
3023	CB	PHE	413	49.826	7.829	36.203
3024	CG	PHE	413	50.066	8.579	37.509
3025	CD1	PHE	413	50.787	9.766	37.496
3026	CD2	PHE	413	49.575	8.078	38.708
3027	CE1	PHE	413	51.017	10.452	38.681
3028	CE2	PHE	413	49.804	8.764	39.893
3029	CZ	PHE	413	50.525	9.951	39.879
3030	N	ARG	414	48.009	6.933	33.546
3031	CA	ARG	414	48.167	6.188	32.293
3032	C	ARG	414	47.406	6.820	31.132
3033	O	ARG	414	47.497	6.352	29.994
3034	CB	ARG	414	47.704	4.760	32.525
3035	CG	ARG	414	48.546	4.092	33.604
3036	CD	ARG	414	47.991	2.718	33.938
3037	NE	ARG	414	46.598	2.841	34.391
3038	CZ	ARG	414	46.036	1.992	35.252
3039	NH1	ARG	414	44.775	2.181	35.647
3040	NH2	ARG	414	46.744	0.970	35.738
3041	N	GLU	415	46.703	7.904	31.418
3042	CA	GLU	415	46.050	8.699	30.375
3043	C	GLU	415	46.986	9.790	29.825
3044	O	GLU	415	46.534	10.701	29.118
3045	CB	GLU	415	44.793	9.314	30.983
3046	CG	GLU	415	43.761	9.702	29.932
3047	CD	GLU	415	43.253	8.461	29.204
3048	OE1	GLU	415	43.154	8.523	27.986
3049	OE2	GLU	415	43.059	7.449	29.863
3050	N	TYR	416	48.248	9.742	30.229
3051	CA	TYR	416	49.282	10.662	29.739
3052	C	TYR	416	49.453	10.630	28.219
3053	O	TYR	416	49.713	9.585	27.613
3054	CB	TYR	416	50.595	10.245	30.408
3055	CG	TYR	416	51.872	10.715	29.711
3056	CD1	TYR	416	52.314	12.022	29.864
3057	CD2	TYR	416	52.601	9.823	28.931
3058	CE1	TYR	416	53.466	12.444	29.213
3059	CE2	TYR	416	53.753	10.245	28.280
3060	CZ	TYR	416	54.178	11.559	28.417
3061	OH	TYR	416	55.241	12.019	27.672
3062	N	VAL	417	49.242	11.785	27.612
3063	CA	VAL	417	49.590	11.979	26.201
3064	C	VAL	417	51.039	12.457	26.151
3065	O	VAL	417	51.429	13.294	26.970
3066	CB	VAL	417	48.603	12.984	25.605
3067	CG1	VAL	417	48.921	13.393	24.168
3068	CG2	VAL	417	47.199	12.403	25.670
3069	N	ILE	418	51.775	12.053	25.125
3070	CA	ILE	418	53.230	12.287	25.042
3071	C	ILE	418	53.672	13.762	24.994
3072	O	ILE	418	54.777	14.076	25.451
3073	CB	ILE	418	53.704	11.572	23.779
3074	CG1	ILE	418	53.262	10.113	23.801
3075	CG2	ILE	418	55.219	11.653	23.620
3076	CD1	ILE	418	53.703	9.382	22.538
3077	N	GLY	419	52.766	14.667	24.660
3078	CA	GLY	419	53.102	16.094	24.639
3079	C	GLY	419	52.814	16.793	25.973
3080	O	GLY	419	53.342	17.882	26.229
3081	N	LEU	420	52.016	16.163	26.820
3082	CA	LEU	420	51.610	16.789	28.086
3083	C	LEU	420	51.963	15.910	29.287
3084	O	LEU	420	51.137	15.124	29.772
3085	CB	LEU	420	50.106	17.043	28.039
3086	CG	LEU	420	49.749	18.104	27.000
3087	CD1	LEU	420	48.244	18.187	26.771
3088	CD2	LEU	420	50.317	19.466	27.387
3089	N	ALA	421	53.159	16.132	29.809
3090	CA	ALA	421	53.679	15.342	30.938
3091	C	ALA	421	53.174	15.804	32.304
3092	O	ALA	421	53.652	16.798	32.866
3093	CB	ALA	421	55.202	15.408	30.912
3094	N	VAL	422	52.239	15.044	32.846
3095	CA	VAL	422	51.694	15.357	34.169
3096	C	VAL	422	52.483	14.690	35.297
3097	O	VAL	422	52.727	13.478	35.297
3098	CB	VAL	422	50.228	14.931	34.202
3099	CG1	VAL	422	50.033	13.484	33.757
3100	CG2	VAL	422	49.603	15.171	35.569
3101	N	LEU	423	52.931	15.520	36.223
3102	CA	LEU	423	53.589	15.035	37.439
3103	C	LEU	423	52.570	14.952	38.572
3104	O	LEU	423	51.358	14.994	38.322
3105	CB	LEU	423	54.721	15.987	37.804
3106	CG	LEU	423	55.772	16.037	36.700
3107	CD1	LEU	423	56.794	17.136	36.965
3108	CD2	LEU	423	56.458	14.684	36.528
3109	N	CYS	424	53.061	14.816	39.792
3110	CA	CYS	424	52.200	14.710	40.982
3111	C	CYS	424	53.034	14.987	42.221
3112	O	CYS	424	53.793	14.121	42.668
3113	CB	CYS	424	51.615	13.308	41.082
3114	SG	CYS	424	50.525	13.031	42.499
3115	N	ASN	425	52.837	16.154	42.810
3116	CA	ASN	425	53.762	16.609	43.858
3117	C	ASN	425	53.061	16.900	45.186
3118	O	ASN	425	52.685	18.048	45.446
3119	CB	ASN	425	54.421	17.905	43.379
3120	CG	ASN	425	54.456	18.004	41.851
3121	OD1	ASN	425	55.094	17.200	41.156
3122	ND2	ASN	425	53.741	18.997	41.350
3123	N	PRO	426	52.914	15.896	46.035
3124	CA	PRO	426	52.399	16.147	47.382
3125	C	PRO	426	53.420	16.914	48.221
3126	O	PRO	426	54.545	16.449	48.435
3127	CB	PRO	426	52.137	14.789	47.956
3128	CG	PRO	426	52.727	13.737	47.027
3129	CD	PRO	426	53.297	14.496	45.840
3130	N	SER	427	53.022	18.094	48.666
3131	CA	SER	427	53.892	18.923	49.509
3132	C	SER	427	54.086	18.293	50.886
3133	O	SER	427	53.173	17.616	51.339
3134	CB	SER	427	53.264	20.303	49.669
3135	OG	SER	427	52.045	20.146	50.381
3136	OXT	SER	427	55.152	18.487	51.452

[1366]

TABLE VI
	ATOM		Residue
ATOM	Type	Residue	Position	X Coord	Y Coord	Z Coord
1	N	ARG	57	30.099	48.792	65.403
2	CA	ARG	57	31.287	47.928	65.329
3	C	ARG	57	30.912	46.553	64.793
4	O	ARG	57	29.761	46.120	64.922
5	CB	ARG	57	31.890	47.743	66.714
6	CG	ARG	57	32.220	49.070	67.384
7	CD	ARG	57	32.743	48.838	68.798
8	NE	ARG	57	31.752	48.100	69.600
9	CZ	ARG	57	32.004	46.927	70.189
10	NH1	ARG	57	33.206	46.360	70.064
11	NH2	ARG	57	31.048	46.315	70.891
12	N	LYS	58	31.881	45.889	64.183
13	CA	LYS	58	31.673	44.515	63.714
14	C	LYS	58	31.576	43.598	64.926
15	O	LYS	58	32.550	43.444	65.671
16	CB	LYS	58	32.872	44.099	62.872
17	CG	LYS	58	33.150	45.094	61.752
18	CD	LYS	58	34.407	44.700	60.987
19	CE	LYS	58	34.745	45.710	59.899
20	NZ	LYS	58	35.931	45.287	59.138
21	N	ARG	59	30.416	42.993	65.111
22	CA	ARG	59	30.176	42.203	66.323
23	C	ARG	59	30.835	40.825	66.257
24	O	ARG	59	30.408	39.948	65.496
25	CB	ARG	59	28.673	42.041	66.493
26	CG	ARG	59	28.324	41.625	67.916
27	CD	ARG	59	26.867	41.210	68.010
28	NE	ARG	59	26.647	40.027	67.169
29	CZ	ARG	59	25.442	39.616	66.779
30	NH1	ARG	59	24.363	40.341	67.075
31	NH2	ARG	59	25.328	38.509	66.045
32	N	PRO	60	31.746	40.594	67.193
33	CA	PRO	60	32.574	39.376	67.229
34	C	PRO	60	31.898	38.141	67.844
35	O	PRO	60	32.573	37.122	68.035
36	CB	PRO	60	33.760	39.759	68.059
37	CG	PRO	60	33.454	41.058	68.791
38	CD	PRO	60	32.115	41.534	68.256
39	N	PHE	61	30.582	38.158	68.001
40	CA	PHE	61	29.891	37.099	68.756
41	C	PHE	61	29.863	35.763	68.023
42	O	PHE	61	30.003	34.720	68.672
43	CB	PHE	61	28.446	37.511	69.021
44	CG	PHE	61	28.177	38.456	70.193
45	CD1	PHE	61	29.179	39.259	70.723
46	CD2	PHE	61	26.899	38.500	70.735
47	CE1	PHE	61	28.901	40.109	71.786
48	CE2	PHE	61	26.620	39.349	71.797
49	CZ	PHE	61	27.621	40.155	72.322
50	N	VAL	62	30.008	35.801	66.708
51	CA	VAL	62	29.995	34.565	65.921
52	C	VAL	62	31.363	33.862	65.911
53	O	VAL	62	31.475	32.729	65.430
54	CB	VAL	62	29.537	34.905	64.509
55	CG1	VAL	62	28.925	33.672	63.858
56	CG2	VAL	62	28.491	36.014	64.551
57	N	GLY	63	32.334	34.439	66.605
58	CA	GLY	63	33.644	33.810	66.770
59	C	GLY	63	33.684	32.854	67.965
60	O	GLY	63	34.656	32.110	68.134
61	N	ARG	64	32.609	32.826	68.739
62	CA	ARG	64	32.534	31.975	69.933
63	C	ARG	64	31.878	30.610	69.682
64	O	ARG	64	31.601	29.881	70.643
65	CB	ARG	64	31.723	32.747	70.965
66	CG	ARG	64	32.251	34.171	71.081
67	CD	ARG	64	31.342	35.052	71.925
68	NE	ARG	64	31.795	36.449	71.865
69	CZ	ARG	64	31.636	37.312	72.869
70	NH1	ARG	64	31.049	36.916	74.000
71	NH2	ARG	64	32.075	38.567	72.746
72	N	CYS	65	31.608	30.272	68.432
73	CA	CYS	65	30.878	29.031	68.142
74	C	CYS	65	31.744	27.774	68.220
75	O	CYS	65	32.776	27.651	67.553
76	CB	CYS	65	30.295	29.138	66.744
77	SG	CYS	65	29.365	30.644	66.411
78	N	CYS	66	31.326	26.860	69.079
79	CA	CYS	66	31.960	25.538	69.142
80	C	CYS	66	30.953	24.448	68.783
81	O	CYS	66	31.318	23.280	68.608
82	CB	CYS	66	32.515	25.302	70.541
83	SG	CYS	66	33.759	26.491	71.095
84	N	TYR	67	29.688	24.829	68.765
85	CA	TYR	67	28.613	23.937	68.304
86	C	TYR	67	27.826	24.687	67.245
87	O	TYR	67	27.705	25.906	67.380
88	CB	TYR	67	27.653	23.626	69.454
89	CG	TYR	67	28.245	22.976	70.703
90	CD1	TYR	67	27.809	23.397	71.953
91	CD2	TYR	67	29.190	21.962	70.601
92	CE1	TYR	67	28.335	22.823	73.103
93	CE2	TYR	67	29.719	21.388	71.750
94	CZ	TYR	67	29.292	21.824	72.997
95	OH	TYR	67	29.835	21.275	74.138
96	N	SER	68	27.101	23.982	66.387
97	CA	SER	68	26.275	24.654	65.359
98	C	SER	68	24.948	25.185	65.923
99	O	SER	68	24.327	26.078	65.326
100	CB	SER	68	25.978	23.685	64.221
101	OG	SER	68	25.057	22.716	64.701
102	N	CYS	69	24.683	24.829	67.172
103	CA	CYS	69	23.514	25.306	67.916
104	C	CYS	69	23.731	26.712	68.491
105	O	CYS	69	22.813	27.285	69.085
106	CB	CYS	69	23.265	24.312	69.048
107	SG	CYS	69	21.796	24.578	70.069
108	N	THR	70	24.936	27.244	68.367
109	CA	THR	70	25.136	28.652	68.710
110	C	THR	70	25.245	29.621	67.504
111	O	THR	70	24.791	30.753	67.703
112	CB	THR	70	26.269	28.801	69.729
113	OG1	THR	70	26.298	30.147	70.183
114	CG2	THR	70	27.649	28.403	69.241
115	N	PRO	71	25.804	29.304	66.332
116	CA	PRO	71	25.531	30.157	65.173
117	C	PRO	71	24.091	30.066	64.663
118	O	PRO	71	23.339	31.032	64.848
119	CB	PRO	71	26.480	29.721	64.098
120	CG	PRO	71	27.159	28.436	64.529
121	CD	PRO	71	26.647	28.170	65.931
122	N	GLN	72	23.679	28.910	64.155
123	CA	GLN	72	22.448	28.865	63.356
124	C	GLN	72	21.181	28.411	64.087
125	O	GLN	72	20.299	29.256	64.289
126	CB	GLN	72	22.711	28.069	62.068
127	CG	GLN	72	23.547	26.795	62.227
128	CD	GLN	72	22.662	25.550	62.251
129	OE1	GLN	72	22.732	24.739	63.183
130	NE2	GLN	72	21.783	25.460	61.268
131	N	SER	73	21.144	27.177	64.575
132	CA	SER	73	19.921	26.540	65.110
133	C	SER	73	18.691	26.639	64.201
134	O	SER	73	18.515	27.561	63.396
135	CB	SER	73	19.573	27.116	66.472
136	OG	SER	73	20.598	26.735	67.374
137	N	TRP	74	17.846	25.630	64.316
138	CA	TRP	74	16.579	25.651	63.583
139	C	TRP	74	15.466	26.229	64.456
140	O	TRP	74	14.383	26.573	63.969
141	CB	TRP	74	16.259	24.241	63.104
142	CG	TRP	74	17.336	23.694	62.184
143	CD1	TRP	74	18.202	22.658	62.453
144	CD2	TRP	74	17.659	24.164	60.855
145	NE1	TRP	74	19.018	22.489	61.382
146	CE2	TRP	74	18.730	23.370	60.406
147	CE3	TRP	74	17.147	25.168	60.048
148	CZ2	TRP	74	19.274	23.595	59.149
149	CZ3	TRP	74	17.700	25.387	58.791
150	CH2	TRP	74	18.758	24.603	58.344
151	N	LYS	75	15.748	26.324	65.745
152	CA	LYS	75	14.909	27.108	66.650
153	C	LYS	75	15.637	28.422	66.914
154	O	LYS	75	16.749	28.429	67.460
155	CB	LYS	75	14.692	26.339	67.944
156	CG	LYS	75	14.063	24.975	67.691
157	CD	LYS	75	13.882	24.205	68.993
158	CE	LYS	75	13.252	22.839	68.749
159	NZ	LYS	75	13.075	22.109	70.015
160	N	PHE	76	14.948	29.521	66.657
161	CA	PHE	76	15.603	30.837	66.596
162	C	PHE	76	15.837	31.538	67.941
163	O	PHE	76	16.276	32.691	67.950
164	CB	PHE	76	14.824	31.744	65.640
165	CG	PHE	76	13.619	32.509	66.187
166	CD1	PHE	76	12.460	31.847	66.573
167	CD2	PHE	76	13.687	33.894	66.271
168	CE1	PHE	76	11.376	32.570	67.055
169	CE2	PHE	76	12.603	34.617	66.751
170	CZ	PHE	76	11.447	33.954	67.143
171	N	PHE	77	15.609	30.855	69.050
172	CA	PHE	77	15.896	31.445	70.363
173	C	PHE	77	16.924	30.651	71.165
174	O	PHE	77	17.198	31.014	72.315
175	CB	PHE	77	14.610	31.546	71.172
176	CG	PHE	77	13.790	32.803	70.903
177	CD1	PHE	77	14.434	33.991	70.581
178	CD2	PHE	77	12.406	32.766	70.999
179	CE1	PHE	77	13.692	35.141	70.347
180	CE2	PHE	77	11.664	33.917	70.766
181	CZ	PHE	77	12.307	35.104	70.440
182	N	ASN	78	17.528	29.644	70.550
183	CA	ASN	78	18.359	28.674	71.291
184	C	ASN	78	19.536	29.266	72.065
185	O	ASN	78	20.439	29.907	71.513
186	CB	ASN	78	18.868	27.617	70.321
187	CG	ASN	78	17.768	26.599	70.032
188	OD1	ASN	78	16.584	26.823	70.314
189	ND2	ASN	78	18.188	25.451	69.531
190	N	PRO	79	19.460	29.074	73.373
191	CA	PRO	79	20.559	29.392	74.282
192	C	PRO	79	21.693	28.379	74.158
193	O	PRO	79	21.486	27.161	74.196
194	CB	PRO	79	19.951	29.349	75.649
195	CG	PRO	79	18.576	28.705	75.555
196	CD	PRO	79	18.336	28.448	74.076
197	N	SER	80	22.883	28.915	73.984
198	CA	SER	80	24.094	28.112	73.863
199	C	SER	80	25.325	28.877	74.355
200	O	SER	80	25.284	29.550	75.391
201	CB	SER	80	24.219	27.727	72.396
202	OG	SER	80	23.854	28.871	71.629
203	N	ILE	81	26.423	28.712	73.639
204	CA	ILE	81	27.716	29.333	73.980
205	C	ILE	81	27.675	30.847	73.730
206	O	ILE	81	26.897	31.281	72.875
207	CB	ILE	81	28.733	28.640	73.067
208	CG1	ILE	81	28.573	27.133	73.195
209	CG2	ILE	81	30.183	29.011	73.364
210	CD1	ILE	81	29.625	26.408	72.371
211	N	PRO	82	28.392	31.641	74.525
212	CA	PRO	82	29.089	31.209	75.747
213	C	PRO	82	28.259	31.358	77.024
214	O	PRO	82	28.847	31.497	78.104
215	CB	PRO	82	30.248	32.150	75.832
216	CG	PRO	82	29.871	33.414	75.075
217	CD	PRO	82	28.577	33.082	74.348
218	N	SER	83	26.941	31.365	76.895
219	CA	SER	83	26.032	31.689	77.995
220	C	SER	83	26.206	33.136	78.434
221	O	SER	83	26.692	33.979	77.666
222	CB	SER	83	26.212	30.709	79.148
223	OG	SER	83	25.973	29.412	78.619
224	N	LEU	84	25.609	33.427	79.576
225	CA	LEU	84	25.637	34.760	80.190
226	C	LEU	84	24.767	35.771	79.444
227	O	LEU	84	25.193	36.451	78.497
228	CB	LEU	84	27.072	35.256	80.323
229	CG	LEU	84	27.838	34.456	81.371
230	CD1	LEU	84	29.319	34.815	81.365
231	CD2	LEU	84	27.234	34.660	82.757
232	N	GLY	85	23.515	35.800	79.870
233	CA	GLY	85	22.552	36.827	79.454
234	C	GLY	85	22.117	36.742	77.995
235	O	GLY	85	21.264	35.932	77.608
236	N	LEU	86	22.675	37.642	77.206
237	CA	LEU	86	22.279	37.761	75.807
238	C	LEU	86	23.291	37.108	74.872
239	O	LEU	86	22.905	36.672	73.780
240	CB	LEU	86	22.109	39.249	75.499
241	CG	LEU	86	21.632	39.520	74.075
242	CD1	LEU	86	20.458	40.492	74.063
243	CD2	LEU	86	22.769	40.022	73.189
244	N	ARG	87	24.458	36.762	75.392
245	CA	ARG	87	25.500	36.214	74.517
246	C	ARG	87	25.297	34.732	74.210
247	O	ARG	87	25.911	34.197	73.282
248	CB	ARG	87	26.851	36.470	75.164
249	CG	ARG	87	27.060	37.973	75.282
250	CD	ARG	87	28.422	38.322	75.861
251	NE	ARG	87	28.563	37.822	77.235
252	CZ	ARG	87	28.723	38.645	78.273
253	NH1	ARG	87	28.732	39.966	78.081
254	NH2	ARG	87	28.864	38.151	79.504
255	N	ASN	88	24.327	34.129	74.875
256	CA	ASN	88	23.931	32.761	74.565
257	C	ASN	88	22.821	32.640	73.522
258	O	ASN	88	22.617	31.523	73.034
259	CB	ASN	88	23.453	32.081	75.847
260	CG	ASN	88	22.669	33.020	76.765
261	OD1	ASN	88	23.221	33.523	77.749
262	ND2	ASN	88	21.372	33.125	76.539
263	N	VAL	89	22.137	33.705	73.137
264	CA	VAL	89	20.939	33.470	72.311
265	C	VAL	89	21.169	33.562	70.806
266	O	VAL	89	20.655	34.479	70.157
267	CB	VAL	89	19.773	34.366	72.730
268	CG1	VAL	89	19.066	33.828	73.966
269	CG2	VAL	89	20.159	35.829	72.905
270	N	ILE	90	21.605	32.427	70.281
271	CA	ILE	90	21.813	32.144	68.850
272	C	ILE	90	22.219	33.348	67.972
273	O	ILE	90	21.404	34.197	67.574
274	CB	ILE	90	20.548	31.423	68.380
275	CG1	ILE	90	20.792	30.739	67.058
276	CG2	ILE	90	19.313	32.308	68.318
277	CD1	ILE	90	21.828	29.656	67.276
278	N	TYR	91	23.445	33.266	67.482
279	CA	TYR	91	24.105	34.417	66.849
280	C	TYR	91	23.538	34.841	65.504
281	O	TYR	91	23.303	36.039	65.338
282	CB	TYR	91	25.574	34.088	66.643
283	CG	TYR	91	26.337	33.824	67.930
284	CD1	TYR	91	26.145	34.636	69.041
285	CD2	TYR	91	27.232	32.767	67.984
286	CE1	TYR	91	26.846	34.383	70.211
287	CE2	TYR	91	27.935	32.513	69.152
288	CZ	TYR	91	27.739	33.323	70.260
289	OH	TYR	91	28.513	33.131	71.374
290	N	ILE	92	23.085	33.917	64.674
291	CA	ILE	92	22.591	34.327	63.351
292	C	ILE	92	21.203	34.963	63.425
293	O	ILE	92	20.980	35.996	62.781
294	CB	ILE	92	22.601	33.116	62.420
295	CG1	ILE	92	24.035	32.700	62.113
296	CG2	ILE	92	21.848	33.395	61.126
297	CD1	ILE	92	24.078	31.551	61.113
298	N	ASN	93	20.456	34.601	64.455
299	CA	ASN	93	19.142	35.209	64.663
300	C	ASN	93	19.278	36.525	65.432
301	O	ASN	93	18.526	37.470	65.160
302	CB	ASN	93	18.239	34.208	65.382
303	CG	ASN	93	17.936	33.023	64.459
304	OD1	ASN	93	17.160	33.154	63.507
305	ND2	ASN	93	18.492	31.866	64.779
306	N	GLU	94	20.404	36.687	66.111
307	CA	GLU	94	20.741	37.986	66.704
308	C	GLU	94	21.259	38.962	65.654
309	O	GLU	94	20.894	40.139	65.711
310	CB	GLU	94	21.832	37.806	67.750
311	CG	GLU	94	21.324	37.101	68.993
312	CD	GLU	94	22.481	36.868	69.960
313	OE1	GLU	94	23.194	35.886	69.785
314	OE2	GLU	94	22.698	37.733	70.798
315	N	THR	95	21.843	38.443	64.586
316	CA	THR	95	22.360	39.299	63.512
317	C	THR	95	21.183	39.877	62.737
318	O	THR	95	21.151	41.092	62.466
319	CB	THR	95	23.221	38.462	62.560
320	OG1	THR	95	24.135	37.669	63.296
321	CG2	THR	95	24.044	39.320	61.613
322	N	HIS	96	20.144	39.060	62.622
323	CA	HIS	96	18.890	39.457	61.981
324	C	HIS	96	18.175	40.533	62.776
325	O	HIS	96	17.989	41.646	62.270
326	CB	HIS	96	17.979	38.237	61.936
327	CG	HIS	96	16.681	38.462	61.186
328	ND1	HIS	96	16.557	39.027	59.973
329	CD2	HIS	96	15.417	38.116	61.598
330	CE1	HIS	96	15.256	39.053	59.619
331	NE2	HIS	96	14.552	38.489	60.626
332	N	THR	97	18.030	40.280	64.068
333	CA	THR	97	17.307	41.200	64.961
334	C	THR	97	18.092	42.454	65.352
335	O	THR	97	17.535	43.333	66.020
336	CB	THR	97	16.925	40.454	66.234
337	OG1	THR	97	18.118	39.988	66.852
338	CG2	THR	97	16.026	39.258	65.940
339	N	ARG	98	19.359	42.531	64.984
340	CA	ARG	98	20.107	43.765	65.191
341	C	ARG	98	20.041	44.650	63.957
342	O	ARG	98	19.307	45.646	63.953
343	CB	ARG	98	21.558	43.452	65.535
344	CG	ARG	98	21.665	42.840	66.925
345	CD	ARG	98	21.083	43.769	67.982
346	NE	ARG	98	21.131	43.145	69.313
347	CZ	ARG	98	21.558	43.792	70.399
348	NH1	ARG	98	21.540	43.185	71.587
349	NH2	ARG	98	21.974	45.056	70.302
350	N	HIS	99	20.762	44.268	62.912
351	CA	HIS	99	20.884	45.159	61.748
352	C	HIS	99	21.392	44.470	60.484
353	O	HIS	99	20.893	44.691	59.374
354	CB	HIS	99	21.915	46.228	62.109
355	CG	HIS	99	21.397	47.650	62.111
356	ND1	HIS	99	20.197	48.065	62.555
357	CD2	HIS	99	22.069	48.767	61.673
358	CE1	HIS	99	20.097	49.400	62.397
359	NE2	HIS	99	21.257	49.833	61.852
360	N	ARG	100	22.400	43.639	60.679
361	CA	ARG	100	23.241	43.164	59.573
362	C	ARG	100	22.921	41.764	59.055
363	O	ARG	100	23.670	41.228	58.231
364	CB	ARG	100	24.672	43.234	60.086
365	CG	ARG	100	24.697	42.801	61.545
366	CD	ARG	100	26.013	43.134	62.234
367	NE	ARG	100	25.881	42.940	63.687
368	CZ	ARG	100	25.487	43.908	64.520
369	NH1	ARG	100	25.272	45.144	64.061
370	NH2	ARG	100	25.359	43.656	65.823
371	N	GLY	101	21.843	41.168	59.523
372	CA	GLY	101	21.538	39.802	59.100
373	C	GLY	101	20.235	39.728	58.329
374	O	GLY	101	19.192	39.364	58.879
375	N	TRP	102	20.301	40.039	57.051
376	CA	TRP	102	19.099	39.952	56.223
377	C	TRP	102	18.757	38.498	55.927
378	O	TRP	102	19.644	37.639	55.853
379	CB	TRP	102	19.287	40.779	54.959
380	CG	TRP	102	19.216	42.264	55.253
381	CD1	TRP	102	20.234	43.083	55.687
382	CD2	TRP	102	18.039	43.100	55.146
383	NE1	TRP	102	19.745	44.335	55.857
384	CE2	TRP	102	18.433	44.387	55.545
385	CE3	TRP	102	16.730	42.851	54.770
386	CZ2	TRP	102	17.504	45.417	55.560
387	CZ3	TRP	102	15.804	43.888	54.787
388	CH2	TRP	102	16.190	45.165	55.180
389	N	LEU	103	17.482	38.261	55.668
390	CA	LEU	103	16.938	36.900	55.540
391	C	LEU	103	17.644	36.048	54.486
392	O	LEU	103	18.169	34.988	54.844
393	CB	LEU	103	15.460	37.027	55.182
394	CG	LEU	103	14.785	35.670	55.005
395	CD1	LEU	103	14.847	34.846	56.286
396	CD2	LEU	103	13.339	35.842	54.556
397	N	ALA	104	17.942	36.626	53.332
398	CA	ALA	104	18.589	35.855	52.259
399	C	ALA	104	20.071	35.575	52.520
400	O	ALA	104	20.559	34.496	52.157
401	CB	ALA	104	18.441	36.629	50.955
402	N	ARG	105	20.673	36.368	53.393
403	CA	ARG	105	22.080	36.169	53.726
404	C	ARG	105	22.197	35.069	54.765
405	O	ARG	105	23.050	34.187	54.625
406	CB	ARG	105	22.636	37.455	54.320
407	CG	ARG	105	22.440	38.640	53.388
408	CD	ARG	105	22.973	39.914	54.027
409	NE	ARG	105	22.741	41.072	53.154
410	CZ	ARG	105	23.047	42.320	53.511
411	NH1	ARG	105	23.586	42.557	54.709
412	NH2	ARG	105	22.808	43.331	52.673
413	N	ARG	106	21.186	34.964	55.612
414	CA	ARG	106	21.182	33.925	56.639
415	C	ARG	106	20.652	32.597	56.111
416	O	ARG	106	21.045	31.538	56.616
417	CB	ARG	106	20.318	34.398	57.788
418	CG	ARG	106	20.769	35.767	58.274
419	CD	ARG	106	19.905	36.207	59.441
420	NE	ARG	106	18.486	36.039	59.101
421	CZ	ARG	106	17.666	35.284	59.835
422	NH1	ARG	106	16.385	35.154	59.487
423	NH2	ARG	106	18.132	34.658	60.916
424	N	LEU	107	19.949	32.642	54.992
425	CA	LEU	107	19.559	31.401	54.322
426	C	LEU	107	20.776	30.782	53.649
427	O	LEU	107	21.065	29.601	53.879
428	CB	LEU	107	18.496	31.701	53.271
429	CG	LEU	107	17.195	32.185	53.899
430	CD1	LEU	107	16.209	32.630	52.825
431	CD2	LEU	107	16.580	31.115	54.792
432	N	SER	108	21.629	31.635	53.106
433	CA	SER	108	22.859	31.152	52.475
434	C	SER	108	23.880	30.747	53.535
435	O	SER	108	24.514	29.691	53.411
436	CB	SER	108	23.427	32.275	51.619
437	OG	SER	108	22.425	32.685	50.699
438	N	TYR	109	23.837	31.449	54.656
439	CA	TYR	109	24.634	31.129	55.844
440	C	TYR	109	24.403	29.700	56.306
441	O	TYR	109	25.327	28.879	56.226
442	CB	TYR	109	24.171	32.049	56.967
443	CG	TYR	109	25.211	32.992	57.557
444	CD1	TYR	109	26.487	32.532	57.853
445	CD2	TYR	109	24.866	34.311	57.823
446	CE1	TYR	109	27.423	33.398	58.402
447	CE2	TYR	109	25.803	35.179	58.370
448	CZ	TYR	109	27.081	34.719	58.656
449	OH	TYR	109	28.029	35.592	59.148
450	N	VAL	110	23.148	29.349	56.548
451	CA	VAL	110	22.851	28.017	57.081
452	C	VAL	110	22.954	26.904	56.033
453	O	VAL	110	23.308	25.780	56.411
454	CB	VAL	110	21.468	28.024	57.735
455	CG1	VAL	110	21.415	29.043	58.865
456	CG2	VAL	110	20.339	28.287	56.744
457	N	LEU	111	22.935	27.249	54.753
458	CA	LEU	111	23.136	26.235	53.715
459	C	LEU	111	24.616	25.926	53.539
460	O	LEU	111	24.982	24.746	53.439
461	CB	LEU	111	22.560	26.735	52.396
462	CG	LEU	111	21.040	26.835	52.452
463	CD1	LEU	111	20.489	27.468	51.180
464	CD2	LEU	111	20.407	25.469	52.699
465	N	PHE	112	25.457	26.923	53.763
466	CA	PHE	112	26.902	26.697	53.712
467	C	PHE	112	27.378	25.976	54.961
468	O	PHE	112	28.122	24.997	54.838
469	CB	PHE	112	27.630	28.030	53.584
470	CG	PHE	112	27.577	28.638	52.187
471	CD1	PHE	112	27.379	30.003	52.026
472	CD2	PHE	112	27.737	27.823	51.074
473	CE1	PHE	112	27.335	30.551	50.751
474	CE2	PHE	112	27.696	28.372	49.800
475	CZ	PHE	112	27.493	29.736	49.638
476	N	ILE	113	26.744	26.264	56.086
477	CA	ILE	113	27.073	25.559	57.326
478	C	ILE	113	26.727	24.077	57.211
479	O	ILE	113	27.642	23.240	57.264
480	CB	ILE	113	26.288	26.202	58.468
481	CG1	ILE	113	26.764	27.632	58.696
482	CG2	ILE	113	26.400	25.389	59.754
483	CD1	ILE	113	25.992	28.312	59.820
484	N	GLN	114	25.530	23.796	56.723
485	CA	GLN	114	25.073	22.411	56.630
486	C	GLN	114	25.857	21.609	55.595
487	O	GLN	114	26.516	20.635	55.984
488	CB	GLN	114	23.596	22.426	56.267
489	CG	GLN	114	23.018	21.018	56.233
490	CD	GLN	114	21.523	21.089	55.948
491	OE1	GLN	114	21.011	22.119	55.492
492	NE2	GLN	114	20.836	20.000	56.243
493	N	GLU	115	26.051	22.175	54.415
494	CA	GLU	115	26.738	21.447	53.341
495	C	GLU	115	28.238	21.276	53.590
496	O	GLU	115	28.772	20.178	53.371
497	CB	GLU	115	26.518	22.212	52.039
498	CG	GLU	115	25.147	21.958	51.413
499	CD	GLU	115	25.075	20.567	50.776
500	OE1	GLU	115	24.814	19.624	51.511
501	OE2	GLU	115	25.075	20.496	49.550
502	N	ARG	116	28.859	22.236	54.254
503	CA	ARG	116	30.289	22.110	54.523
504	C	ARG	116	30.569	21.188	55.701
505	O	ARG	116	31.479	20.353	55.589
506	CB	ARG	116	30.875	23.490	54.756
507	CG	ARG	116	30.898	24.279	53.451
508	CD	ARG	116	31.284	25.732	53.696
509	NE	ARG	116	32.510	25.807	54.501
510	CZ	ARG	116	32.575	26.469	55.658
511	NH1	ARG	116	33.647	26.328	56.437
512	NH2	ARG	116	31.506	27.129	56.109
513	N	ASP	117	29.610	21.086	56.610
514	CA	ASP	117	29.732	20.121	57.705
515	C	ASP	117	29.547	18.705	57.171
516	O	ASP	117	30.400	17.839	57.418
517	CB	ASP	117	28.658	20.398	58.754
518	CG	ASP	117	28.865	21.747	59.440
519	OD1	ASP	117	30.016	22.144	59.574
520	OD2	ASP	117	27.894	22.256	59.987
521	N	VAL	118	28.657	18.588	56.200
522	CA	VAL	118	28.374	17.300	55.573
523	C	VAL	118	29.539	16.761	54.746
524	O	VAL	118	29.911	15.604	54.968
525	CB	VAL	118	27.137	17.473	54.691
526	CG1	VAL	118	26.976	16.352	53.674
527	CG2	VAL	118	25.876	17.615	55.535
528	N	HIS	119	30.275	17.602	54.038
529	CA	HIS	119	31.315	17.021	53.179
530	C	HIS	119	32.625	16.717	53.918
531	O	HIS	119	33.217	15.667	53.632
532	CB	HIS	119	31.551	17.895	51.947
533	CG	HIS	119	32.579	19.000	52.045
534	ND1	HIS	119	32.506	20.130	52.785
535	CD2	HIS	119	33.787	19.037	51.392
536	CE1	HIS	119	33.607	20.867	52.580
537	NE2	HIS	119	34.406	20.190	51.724
538	N	LYS	120	32.916	17.409	55.013
539	CA	LYS	120	34.151	17.081	55.740
540	C	LYS	120	33.897	15.927	56.706
541	O	LYS	120	34.792	15.108	56.968
542	CB	LYS	120	34.671	18.300	56.499
543	CG	LYS	120	34.994	19.468	55.571
544	CD	LYS	120	35.649	20.618	56.333
545	CE	LYS	120	35.732	21.904	55.513
546	NZ	LYS	120	36.574	21.746	54.317
547	N	GLY	121	32.628	15.752	57.039
548	CA	GLY	121	32.197	14.608	57.835
549	C	GLY	121	32.168	13.336	56.995
550	O	GLY	121	32.839	12.357	57.346
551	N	MET	122	31.554	13.413	55.824
552	CA	MET	122	31.362	12.224	54.983
553	C	MET	122	32.636	11.643	54.381
554	O	MET	122	32.727	10.415	54.283
555	CB	MET	122	30.410	12.560	53.842
556	CG	MET	122	28.960	12.603	54.304
557	SD	MET	122	27.749	12.813	52.980
558	CE	MET	122	26.236	12.669	53.958
559	N	PHE	123	33.659	12.445	54.130
560	CA	PHE	123	34.903	11.835	53.643
561	C	PHE	123	35.882	11.501	54.774
562	O	PHE	123	37.057	11.222	54.506
563	CB	PHE	123	35.562	12.686	52.568
564	CG	PHE	123	35.951	11.836	51.357
565	CD1	PHE	123	35.563	12.224	50.083
566	CD2	PHE	123	36.661	10.655	51.531
567	CE1	PHE	123	35.893	11.442	48.985
568	CE2	PHE	123	36.996	9.873	50.433
569	CZ	PHE	123	36.612	10.267	49.158
570	N	ALA	124	35.399	11.561	56.006
571	CA	ALA	124	36.150	11.135	57.188
572	C	ALA	124	37.471	11.864	57.356
573	O	ALA	124	38.549	11.279	57.198
574	CB	ALA	124	36.389	9.629	57.121
575	N	THR	125	37.381	13.162	57.569
576	CA	THR	125	38.582	13.887	57.971
577	C	THR	125	38.776	13.615	59.455
578	O	THR	125	37.819	13.730	60.225
579	CB	THR	125	38.414	15.378	57.689
580	OG1	THR	125	37.291	15.862	58.413
581	CG2	THR	125	38.162	15.629	56.207
582	N	ASN	126	40.000	13.350	59.881
583	CA	ASN	126	40.229	13.011	61.301
584	C	ASN	126	40.178	14.231	62.221
585	O	ASN	126	39.980	14.108	63.434
586	CB	ASN	126	41.580	12.320	61.442
587	CG	ASN	126	41.544	10.945	60.779
588	OD1	ASN	126	40.472	10.370	60.562
589	ND2	ASN	126	42.724	10.410	60.521
590	N	VAL	127	40.214	15.404	61.614
591	CA	VAL	127	40.024	16.658	62.333
592	C	VAL	127	38.622	17.231	62.108
593	O	VAL	127	38.430	18.431	62.337
594	CB	VAL	127	41.082	17.636	61.848
595	CG1	VAL	127	42.451	17.292	62.423
596	CG2	VAL	127	41.121	17.653	60.326
597	N	THR	128	37.687	16.365	61.728
598	CA	THR	128	36.290	16.685	61.323
599	C	THR	128	35.752	18.000	61.865
600	O	THR	128	36.003	19.074	61.301
601	CB	THR	128	35.301	15.620	61.820
602	OG1	THR	128	35.907	14.355	62.030
603	CG2	THR	128	34.128	15.444	60.860
604	N	GLU	129	35.199	17.924	63.066
605	CA	GLU	129	34.491	19.066	63.654
606	C	GLU	129	35.428	20.135	64.214
607	O	GLU	129	35.029	21.300	64.285
608	CB	GLU	129	33.587	18.542	64.766
609	CG	GLU	129	32.695	19.639	65.340
610	CD	GLU	129	31.900	19.099	66.521
611	OE1	GLU	129	31.597	17.914	66.490
612	OE2	GLU	129	31.768	19.822	67.499
613	N	ASN	130	36.708	19.826	64.316
614	CA	ASN	130	37.656	20.801	64.843
615	C	ASN	130	37.934	21.837	63.761
616	O	ASN	130	37.743	23.040	63.990
617	CB	ASN	130	38.950	20.077	65.201
618	CG	ASN	130	38.670	18.827	66.035
619	OD1	ASN	130	37.816	18.820	66.931
620	ND2	ASN	130	39.407	17.774	65.728
621	N	VAL	131	38.075	21.349	62.538
622	CA	VAL	131	38.297	22.249	61.410
623	C	VAL	131	36.978	22.779	60.867
624	O	VAL	131	36.929	23.956	60.499
625	CB	VAL	131	39.077	21.522	60.321
626	CG1	VAL	131	39.170	22.359	59.049
627	CG2	VAL	131	40.470	21.168	60.824
628	N	LEU	132	35.897	22.038	61.070
629	CA	LEU	132	34.566	22.541	60.707
630	C	LEU	132	34.223	23.787	61.502
631	O	LEU	132	34.132	24.866	60.902
632	CB	LEU	132	33.515	21.475	60.984
633	CG	LEU	132	33.458	20.461	59.854
634	CD1	LEU	132	32.502	19.321	60.186
635	CD2	LEU	132	33.046	21.158	58.566
636	N	ASN	133	34.372	23.690	62.814
637	CA	ASN	133	34.097	24.818	63.700
638	C	ASN	133	35.024	25.981	63.395
639	O	ASN	133	34.531	26.994	62.892
640	CB	ASN	133	34.314	24.399	65.149
641	CG	ASN	133	33.277	23.387	65.630
642	OD1	ASN	133	32.279	23.090	64.959
643	ND2	ASN	133	33.555	22.840	66.800
644	N	SER	134	36.319	25.719	63.339
645	CA	SER	134	37.288	26.806	63.143
646	C	SER	134	37.152	27.529	61.801
647	O	SER	134	37.148	28.768	61.780
648	CB	SER	134	38.689	26.220	63.237
649	OG	SER	134	39.605	27.272	62.970
650	N	SER	135	36.842	26.809	60.739
651	CA	SER	135	36.736	27.465	59.439
652	C	SER	135	35.379	28.143	59.251
653	O	SER	135	35.360	29.329	58.899
654	CB	SER	135	36.991	26.436	58.340
655	OG	SER	135	35.980	25.437	58.371
656	N	ARG	136	34.335	27.558	59.815
657	CA	ARG	136	32.978	28.088	59.647
658	C	ARG	136	32.733	29.301	60.533
659	O	ARG	136	32.175	30.308	60.081
660	CB	ARG	136	32.017	26.990	60.077
661	CG	ARG	136	30.561	27.413	59.954
662	CD	ARG	136	29.673	26.488	60.776
663	NE	ARG	136	29.924	26.668	62.216
664	CZ	ARG	136	30.113	25.655	63.065
665	NH1	ARG	136	30.149	24.401	62.610
666	NH2	ARG	136	30.311	25.901	64.363
667	N	VAL	137	33.372	29.290	61.688
668	CA	VAL	137	33.228	30.371	62.657
669	C	VAL	137	33.993	31.618	62.241
670	O	VAL	137	33.407	32.707	62.222
671	CB	VAL	137	33.759	29.828	63.975
672	CG1	VAL	137	34.042	30.914	64.996
673	CG2	VAL	137	32.808	28.784	64.535
674	N	GLN	138	35.142	31.424	61.615
675	CA	GLN	138	35.914	32.579	61.157
676	C	GLN	138	35.408	33.073	59.798
677	O	GLN	138	35.426	34.284	59.538
678	CB	GLN	138	37.386	32.188	61.142
679	CG	GLN	138	37.860	31.874	62.564
680	CD	GLN	138	39.331	31.462	62.575
681	OE1	GLN	138	40.173	32.093	63.228
682	NE2	GLN	138	39.611	30.356	61.912
683	N	GLU	139	34.694	32.198	59.103
684	CA	GLU	139	33.969	32.574	57.887
685	C	GLU	139	32.783	33.463	58.237
686	O	GLU	139	32.625	34.539	57.647
687	CB	GLU	139	33.441	31.289	57.251
688	CG	GLU	139	32.561	31.525	56.028
689	CD	GLU	139	33.380	32.060	54.860
690	OE1	GLU	139	33.359	33.263	54.647
691	OE2	GLU	139	33.972	31.239	54.175
692	N	ALA	140	32.129	33.143	59.341
693	CA	ALA	140	30.969	33.911	59.780
694	C	ALA	140	31.348	35.225	60.457
695	O	ALA	140	30.617	36.210	60.294
696	CB	ALA	140	30.161	33.036	60.725
697	N	ILE	141	32.575	35.322	60.943
698	CA	ILE	141	33.066	36.606	61.454
699	C	ILE	141	33.290	37.587	60.307
700	O	ILE	141	32.758	38.705	60.351
701	CB	ILE	141	34.391	36.391	62.178
702	CG1	1LE	141	34.232	35.470	63.377
703	CG2	ILE	141	34.985	37.723	62.623
704	CD1	ILE	141	35.577	35.220	64.048
705	N	ALA	142	33.807	37.086	59.195
706	CA	ALA	142	34.049	37.957	58.042
707	C	ALA	142	32.776	38.231	57.244
708	O	ALA	142	32.619	39.328	56.690
709	CB	ALA	142	35.088	37.297	57.147
710	N	GLU	143	31.795	37.354	57.376
711	CA	GLU	143	30.508	37.596	56.731
712	C	GLU	143	29.668	38.596	57.519
713	O	GLU	143	29.118	39.506	56.890
714	CB	GLU	143	29.784	36.268	56.572
715	CG	GLU	143	30.475	35.402	55.526
716	CD	GLU	143	29.902	33.991	55.554
717	OE1	GLU	143	29.946	33.397	56.625
718	OE2	GLU	143	29.634	33.450	54.488
719	N	VAL	144	29.824	38.637	58.835
720	CA	VAL	144	29.140	39.669	59.631
721	C	VAL	144	29.833	41.022	59.488
722	O	VAL	144	29.147	42.048	59.358
723	CB	VAL	144	29.115	39.240	61.098
724	CG1	VAL	144	28.717	40.384	62.025
725	CG2	VAL	144	28.191	38.047	61.302
726	N	ALA	145	31.129	40.983	59.219
727	CA	ALA	145	31.880	42.207	58.934
728	C	ALA	145	31.383	42.854	57.645
729	O	ALA	145	30.773	43.927	57.728
730	CB	ALA	145	33.357	41.857	58.797
731	N	ALA	146	31.287	42.056	56.591
732	CA	ALA	146	30.831	42.568	55.291
733	C	ALA	146	29.316	42.787	55.192
734	O	ALA	146	28.865	43.535	54.316
735	CB	ALA	146	31.281	41.599	54.206
736	N	GLU	147	28.563	42.256	56.143
737	CA	GLU	147	27.125	42.532	56.230
738	C	GLU	147	26.846	43.862	56.922
739	O	GLU	147	25.796	44.474	56.693
740	CB	GLU	147	26.459	41.435	57.052
741	CG	GLU	147	26.242	40.141	56.277
742	CD	GLU	147	25.671	39.069	57.205
743	OE1	GLU	147	26.374	38.685	58.134
744	OE2	GLU	147	24.618	38.537	56.874
745	N	LEU	148	27.789	44.324	57.723
746	CA	LEU	148	27.625	45.615	58.384
747	C	LEU	148	28.362	46.693	57.595
748	O	LEU	148	28.057	47.888	57.699
749	CB	LEU	148	28.201	45.495	59.789
750	CG	LEU	148	27.894	46.724	60.634
751	CD1	LEU	148	26.389	46.945	60.747
752	CD2	LEU	148	28.521	46.596	62.014
753	N	ASN	149	29.352	46.256	56.835
754	CA	ASN	149	30.090	47.149	55.938
755	C	ASN	149	30.803	46.380	54.825
756	O	ASN	149	31.827	45.715	55.032
757	CB	ASN	149	31.075	48.013	56.734
758	CG	ASN	149	31.840	47.232	57.804
759	OD1	ASN	149	32.701	46.395	57.505
760	ND2	ASN	149	31.559	47.574	59.050
761	N	PRO	150	30.210	46.438	53.646
762	CA	PRO	150	30.904	45.999	52.438
763	C	PRO	150	32.088	46.917	52.141
764	O	PRO	150	31.929	48.138	52.030
765	CB	PRO	150	29.874	46.084	51.354
766	CG	PRO	150	28.629	46.770	51.895
767	CD	PRO	150	28.916	47.060	53.359
768	N	ASP	151	33.271	46.331	52.066
769	CA	ASP	151	34.467	47.109	51.727
770	C	ASP	151	34.412	47.551	50.271
771	O	ASP	151	34.138	46.740	49.379
772	CB	ASP	151	35.705	46.244	51.952
773	CG	ASP	151	36.981	46.994	51.566
774	OD1	ASP	151	37.142	48.110	52.041
775	OD2	ASP	151	37.823	46.381	50.923
776	N	GLY	152	34.631	48.840	50.057
777	CA	GLY	152	34.685	49.396	48.701
778	C	GLY	152	35.729	48.661	47.870
779	O	GLY	152	36.827	48.365	48.359
780	N	SER	153	35.288	48.180	46.721
781	CA	SER	153	36.175	47.436	45.828
782	C	SER	153	36.072	47.951	44.398
783	O	SER	153	34.975	48.074	43.842
784	CB	SER	153	35.807	45.961	45.908
785	OG	SER	153	35.987	45.562	47.262
786	N	ALA	154	37.217	48.306	43.841
787	CA	ALA	154	37.263	48.828	42.469
788	C	ALA	154	38.543	48.420	41.745
789	O	ALA	154	39.028	47.295	41.930
790	CB	ALA	154	37.171	50.349	42.521
791	N	GLN	155	38.917	49.278	40.800
792	CA	GLN	155	40.189	49.282	40.031
793	C	GLN	155	41.161	48.153	40.340
794	O	GLN	155	40.850	46.967	40.186
795	CB	GLN	155	40.912	50.573	40.408
796	CG	GLN	155	40.117	51.825	40.064
797	CD	GLN	155	40.085	52.006	38.555
798	OE1	GLN	155	39.027	51.884	37.925
799	NE2	GLN	155	41.245	52.320	38.005
800	N	GLN	156	42.378	48.547	40.668
801	CA	GLN	156	43.363	47.600	41.196
802	C	GLN	156	43.201	47.510	42.709
803	O	GLN	156	43.942	48.158	43.460
804	CB	GLN	156	44.777	48.085	40.879
805	CG	GLN	156	45.083	48.158	39.385
806	CD	GLN	156	45.352	46.785	38.768
807	OE1	GLN	156	45.226	46.617	37.549
808	NE2	GLN	156	45.761	45.839	39.596
809	N	GLN	157	42.220	46.732	43.132
810	CA	GLN	157	41.906	46.597	44.556
811	C	GLN	157	43.058	45.944	45.305
812	O	GLN	157	43.418	44.791	45.041
813	CB	GLN	157	40.659	45.733	44.688
814	CG	GLN	157	40.212	45.555	46.134
815	CD	GLN	157	39.581	46.843	46.647
816	OE1	GLN	157	39.322	47.776	45.872
817	NE2	GLN	157	39.332	46.874	47.943
818	N	SER	158	43.599	46.681	46.260
819	CA	SER	158	44.738	46.196	47.040
820	C	SER	158	44.371	45.011	47.921
821	O	SER	158	43.269	44.921	48.477
822	CB	SER	158	45.281	47.334	47.894
823	OG	SER	158	45.796	48.320	47.010
824	N	LYS	159	45.302	44.075	47.958
825	CA	LYS	159	45.185	42.867	48.775
826	C	LYS	159	45.166	43.161	50.272
827	O	LYS	159	45.782	44.118	50.764
828	CB	LYS	159	46.370	41.972	48.434
829	CG	LYS	159	47.668	42.770	48.349
830	CD	LYS	159	48.849	41.854	48.061
831	CE	LYS	159	50.146	42.622	47.843
832	NZ	LYS	159	51.275	41.693	47.655
833	N	ALA	160	44.454	42.315	50.992
834	CA	ALA	160	44.398	42.442	52.450
835	C	ALA	160	45.533	41.655	53.088
836	O	ALA	160	45.488	40.424	53.205
837	CB	ALA	160	43.054	41.951	52.967
838	N	VAL	161	46.596	42.389	53.375
839	CA	VAL	161	47.776	41.844	54.051
840	C	VAL	161	48.029	42.537	55.393
841	O	VAL	161	49.118	42.418	55.964
842	CB	VAL	161	48.984	42.027	53.139
843	CG1	VAL	161	48.884	41.145	51.900
844	CG2	VAL	161	49.162	43.490	52.743
845	N	ASN	162	47.036	43.267	55.873
846	CA	ASN	162	47.195	44.083	57.083
847	C	ASN	162	46.949	43.257	58.352
848	O	ASN	162	47.728	42.348	58.658
849	CB	ASN	162	46.296	45.325	56.967
850	CG	ASN	162	44.892	45.044	56.407
851	OD1	ASN	162	44.015	44.572	57.141
852	ND2	ASN	162	44.645	45.509	55.194
853	N	LYS	163	45.916	43.600	59.107
854	CA	LYS	163	45.513	42.778	60.252
855	C	LYS	163	44.628	41.668	59.708
856	O	LYS	163	44.606	40.534	60.200
857	CB	LYS	163	44.707	43.632	61.224
858	CG	LYS	163	45.511	44.810	61.763
859	CD	LYS	163	46.690	44.345	62.610
860	CE	LYS	163	47.457	45.536	63.175
861	NZ	LYS	163	46.577	46.377	64.001
862	N	VAL	164	43.962	42.015	58.621
863	CA	VAL	164	43.252	41.046	57.800
864	C	VAL	164	44.204	40.573	56.710
865	O	VAL	164	44.605	41.368	55.850
866	CB	VAL	164	42.042	41.741	57.182
867	CG1	VAL	164	41.281	40.821	56.235
868	CG2	VAL	164	41.117	42.285	58.265
869	N	LYS	165	44.668	39.344	56.858
870	CA	LYS	165	45.570	38.710	55.886
871	C	LYS	165	45.183	37.232	55.760
872	O	LYS	165	45.975	36.310	56.001
873	CB	LYS	165	46.989	38.890	56.416
874	CG	LYS	165	48.089	38.469	55.448
875	CD	LYS	165	49.450	38.678	56.105
876	CE	LYS	165	50.599	38.362	55.155
877	NZ	LYS	165	51.898	38.512	55.825
878	N	LYS	166	43.980	37.035	55.243
879	CA	LYS	166	43.300	35.729	55.318
880	C	LYS	166	43.484	34.883	54.059
881	O	LYS	166	42.511	34.286	53.580
882	CB	LYS	166	41.798	35.961	55.496
883	CG	LYS	166	41.446	37.088	56.469
884	CD	LYS	166	41.969	36.873	57.888
885	CE	LYS	166	41.611	38.046	58.791
886	NZ	LYS	166	42.361	37.990	60.057
887	N	LYS	167	44.711	34.773	53.575
888	CA	LYS	167	44.962	34.087	52.298
889	C	LYS	167	44.788	32.571	52.446
890	O	LYS	167	43.660	32.062	52.554
891	CB	LYS	167	46.378	34.416	51.824
892	CG	LYS	167	46.499	34.365	50.300
893	CD	LYS	167	47.956	34.334	49.860
894	CE	LYS	167	48.647	33.087	50.405
895	NZ	LYS	167	50.073	33.052	50.043
896	N	ALA	168	45.901	31.860	52.410
897	CA	ALA	168	45.880	30.410	52.590
898	C	ALA	168	45.614	30.115	54.050
899	O	ALA	168	44.498	29.757	54.441
900	CB	ALA	168	47.231	29.841	52.179
901	N	LYS	169	46.665	30.307	54.827
902	CA	LYS	169	46.628	30.288	56.292
903	C	LYS	169	47.874	31.027	56.759
904	O	LYS	169	48.401	30.794	57.853
905	CB	LYS	169	46.592	28.861	56.845
906	CG	LYS	169	47.687	27.948	56.295
907	CD	LYS	169	47.143	26.973	55.251
908	CE	LYS	169	48.244	26.076	54.704
909	NZ	LYS	169	48.857	25.288	55.783
910	N	ARG	170	48.143	32.098	56.029
911	CA	ARG	170	49.448	32.773	56.057
912	C	ARG	170	49.675	33.689	57.263
913	O	ARG	170	50.823	34.023	57.572
914	CB	ARG	170	49.552	33.558	54.754
915	CG	ARG	170	50.904	34.236	54.574
916	CD	ARG	170	51.023	34.831	53.182
917	NE	ARC	170	49.894	35.727	52.905
918	CZ	ARG	170	49.938	36.664	51.958
919	NH1	ARG	170	48.881	37.452	51.751
920	NH2	ARG	170	51.040	36.811	51.220
921	N	ILE	171	48.629	33.952	58.028
922	CA	ILE	171	48.813	34.690	59.275
923	C	ILE	171	49.220	33.789	60.438
924	O	ILE	171	49.826	34.300	61.386
925	CB	ILE	171	47.518	35.408	59.618
926	CG1	ILE	171	46.310	34.649	59.086
927	CG2	ILE	171	47.537	36.841	59.114
928	CD1	ILE	171	45.030	35.407	59.407
929	N	LEU	172	49.054	32.481	60.268
930	CA	LEU	172	49.385	31.461	61.276
931	C	LEU	172	48.716	31.713	62.634
932	O	LEU	172	48.828	32.786	63.236
933	CB	LEU	172	50.905	31.384	61.408
934	CG	LEU	172	51.347	30.031	61.950
935	CD1	LEU	172	50.846	28.901	61.053
936	CD2	LEU	172	52.862	29.964	62.099
937	N	GLN	173	48.023	30.697	63.117
938	CA	GLN	173	47.315	30.815	64.397
939	C	GLN	173	48.271	30.636	65.576
940	O	GLN	173	49.181	31.455	65.750
941	CB	GLN	173	46.166	29.814	64.394
942	CG	GLN	173	46.356	28.776	63.290
943	CD	GLN	173	45.005	28.210	62.863
944	OE1	GLN	173	44.535	27.202	63.401
945	NE2	GLN	173	44.388	28.887	61.909
946	N	GLU	174	48.063	29.599	66.373
947	CA	GLU	174	48.948	29.323	67.522
948	C	GLU	174	48.983	30.499	68.495
949	O	GLU	174	48.042	31.301	68.558
950	CB	GLU	174	50.381	29.004	67.069
951	CG	GLU	174	50.593	27.589	66.518
952	CD	GLU	174	49.970	27.389	65.137
953	OE1	GLU	174	50.499	27.951	64.190
954	OE2	GLU	174	48.861	26.875	65.094
955	N	MET	175	50.043	30.546	69.285
956	CA	MET	175	50.224	31.592	70.304
957	C	MET	175	49.055	31.666	71.281
958	O	MET	175	48.182	30.787	71.317
959	CB	MET	175	50.421	32.946	69.624
960	CG	MET	175	51.725	33.047	68.832
961	SD	MET	175	53.266	33.123	69.785
962	CE	MET	175	53.655	31.365	69.963
963	N	VAL	176	48.994	32.785	71.983
964	CA	VAL	176	48.034	32.987	73.083
965	C	VAL	176	46.653	33.466	72.604
966	O	VAL	176	46.170	34.523	73.026
967	CB	VAL	176	48.645	34.025	74.023
968	CG1	VAL	176	48.002	33.965	75.406
969	CG2	VAL	176	50.148	33.803	74.153
970	N	ALA	177	46.072	32.717	71.680
971	CA	ALA	177	44.740	33.001	71.142
972	C	ALA	177	44.300	31.852	70.244
973	O	ALA	177	43.134	31.436	70.254
974	CB	ALA	177	44.800	34.279	70.311
975	N	THR	178	45.283	31.316	69.536
976	CA	THR	178	45.113	30.288	68.499
977	C	THR	178	43.947	30.591	67.557
978	O	THR	178	43.002	29.808	67.423
979	CB	THR	178	44.974	28.933	69.180
980	OG1	THR	178	45.994	28.863	70.169
981	CG2	THR	178	45.177	27.777	68.202
982	N	VAL	179	44.025	31.751	66.925
983	CA	VAL	179	43.020	32.156	65.934
984	C	VAL	179	43.701	32.763	64.715
985	O	VAL	179	44.744	33.414	64.835
986	CB	VAL	179	42.035	33.163	66.530
987	CG1	VAL	179	41.017	32.504	67.453
988	CG2	VAL	179	42.744	34.322	67.224
989	N	SER	180	43.084	32.536	63.567
990	CA	SER	180	43.570	33.004	62.255
991	C	SER	180	42.614	32.560	61.154
992	O	SER	180	42.670	31.398	60.733
993	CB	SER	180	44.947	32.432	61.920
994	OG	SER	180	45.956	33.328	62.368
995	N	PRO	181	41.686	33.425	60.778
996	CA	PRO	181	40.856	33.178	59.594
997	C	PRO	181	41.686	33.191	58.312
998	O	PRO	181	42.637	33.964	58.183
999	CB	PRO	181	39.835	34.272	59.603
1000	CG	PRO	181	40.134	35.229	60.746
1001	CD	PRO	181	41.411	34.723	61.396
1002	N	ALA	182	41.322	32.320	57.389
1003	CA	ALA	182	42.017	32.217	56.106
1004	C	ALA	182	41.253	31.266	55.192
1005	O	ALA	182	41.067	30.082	55.506
1006	CB	ALA	182	43.439	31.744	56.344
1007	N	MET	183	40.905	31.767	54.020
1008	CA	MET	183	39.929	31.080	53.171
1009	C	MET	183	40.462	29.833	52.463
1010	O	MET	183	39.713	28.853	52.337
1011	CB	MET	183	39.438	32.086	52.137
1012	CG	MET	183	38.556	31.436	51.077
1013	SD	MET	183	37.003	30.731	51.666
1014	CE	MET	183	36.256	32.254	52.278
1015	N	ILE	184	41.760	29.740	52.237
1016	CA	ILE	184	42.234	28.560	51.511
1017	C	ILE	184	42.429	27.356	52.437
1018	O	ILE	184	42.117	26.233	52.023
1019	CB	ILE	184	43.492	28.934	50.738
1020	CG1	ILE	184	43.151	30.005	49.706
1021	CG2	ILE	184	44.136	27.724	50.069
1022	CD1	ILE	184	44.372	30.415	48.895
1023	N	ARG	185	42.613	27.609	53.725
1024	CA	ARG	185	42.627	26.510	54.698
1025	C	ARC	185	41.203	26.147	55.111
1026	O	ARG	185	40.898	24.966	55.333
1027	CB	ARC	185	43.380	26.959	55.941
1028	CG	ARG	185	43.451	25.851	56.990
1029	CD	ARG	185	43.262	26.403	58.402
1030	NE	ARG	185	41.888	26.908	58.577
1031	CZ	ARG	185	41.592	28.203	58.717
1032	NH1	ARG	185	40.317	28.600	58.717
1033	NH2	ARG	185	42.571	29.108	58.730
1034	N	LEU	186	40.309	27.110	54.945
1035	CA	LEU	186	38.887	26.928	55.249
1036	C	LEU	186	38.248	25.947	54.269
1037	O	LEU	186	37.454	25.089	54.672
1038	CB	LEU	186	38.255	28.321	55.139
1039	CG	LEU	186	36.754	28.413	55.410
1040	CD1	LEU	186	36.413	29.791	55.947
1041	CD2	LEU	186	35.894	28.112	54.187
1042	N	THR	187	38.727	25.976	53.036
1043	CA	THR	187	38.258	25.043	52.002
1044	C	THR	187	39.275	23.944	51.691
1045	O	THR	187	39.147	23.263	50.665
1046	CB	THR	187	37.924	25.813	50.731
1047	OG1	THR	187	39.035	26.635	50.406
1048	CG2	THR	187	36.718	26.720	50.930
1049	N	GLY	188	40.211	23.720	52.601
1050	CA	GLY	188	41.295	22.744	52.406
1051	C	GLY	188	40.801	21.349	52.026
1052	O	GLY	188	41.105	20.867	50.926
1053	N	TRP	189	39.868	20.829	52.810
1054	CA	TRP	189	39.349	19.463	52.612
1055	C	TRP	189	38.310	19.304	51.491
1056	O	TRP	189	37.594	18.296	51.495
1057	CB	TRP	189	38.709	18.972	53.907
1058	CG	TRP	189	39.582	19.016	55.146
1059	CD1	TRP	189	39.204	19.505	56.376
1060	CD2	TRP	189	40.947	18.556	55.289
1061	NE1	TRP	189	40.249	19.382	57.230
1062	CE2	TRP	189	41.313	18.824	56.623
1063	CE3	TRP	189	41.854	17.969	54.423
1064	CZ2	TRP	189	42.589	18.512	57.062
1065	CZ3	TRP	189	43.132	17.653	54.874
1066	CH2	TRP	189	43.497	17.925	56.187
1067	N	VAL	190	38.172	20.265	50.588
1068	CA	VAL	190	37.224	20.078	49.488
1069	C	VAL	190	37.911	19.377	48.311
1070	O	VAL	190	37.230	18.813	47.443
1071	CB	VAL	190	36.628	21.429	49.075
1072	CG1	VAL	190	37.570	22.259	48.208
1073	CG2	VAL	190	35.302	21.240	48.348
1074	N	LEU	191	39.236	19.300	48.363
1075	CA	LEU	191	39.993	18.601	47.321
1076	C	LEU	191	40.633	17.313	47.819
1077	O	LEU	191	41.288	17.270	48.868
1078	CB	LEU	191	41.102	19.497	46.789
1079	CG	LEU	191	40.573	20.729	46.071
1080	CD1	LEU	191	41.744	21.540	45.541
1081	CD2	LEU	191	39.635	20.352	44.928
1082	N	LEU	192	40.481	16.277	47.016
1083	CA	LEU	192	41.174	15.012	47.280
1084	C	LEU	192	42.566	15.043	46.662
1085	O	LEU	192	42.735	14.901	45.443
1086	CB	LEU	192	40.383	13.851	46.692
1087	CG	LEU	192	39.005	13.726	47.330
1088	CD1	LEU	192	38.189	12.648	46.628
1089	CD2	LEU	192	39.118	13.435	48.823
1090	N	LYS	193	43.562	15.055	47.529
1091	CA	LYS	193	44.952	15.160	47.073
1092	C	LYS	193	45.542	13.833	46.590
1093	O	LYS	193	46.488	13.859	45.799
1094	CB	LYS	193	45.796	15.715	48.217
1095	CG	LYS	193	45.740	14.818	49.449
1096	CD	LYS	193	46.602	15.365	50.578
1097	CE	LYS	193	46.635	14.407	51.763
1098	NZ	LYS	193	47.509	14.922	52.828
1099	N	LEU	194	44.839	12.733	46.822
1100	CA	LEU	194	45.343	11.415	46.416
1101	C	LEU	194	44.977	11.070	44.974
1102	O	LEU	194	45.464	10.074	44.428
1103	CB	LEU	194	44.744	10.370	47.350
1104	CG	LEU	194	45.154	10.616	48.798
1105	CD1	LEU	194	44.397	9.692	49.744
1106	CD2	LEU	194	46.662	10.465	48.980
1107	N	PHE	195	44.118	11.878	44.376
1108	CA	PHE	195	43.756	11.686	42.972
1109	C	PHE	195	44.010	12.977	42.199
1110	O	PHE	195	43.527	13.141	41.072
1111	CB	PHE	195	42.286	11.298	42.862
1112	CG	PHE	195	41.849	10.096	43.696
1113	CD1	PHE	195	41.067	10.287	44.829
1114	CD2	PHE	195	42.212	8.812	43.312
1115	CE1	PHE	195	40.666	9.196	45.589
1116	CE2	PHE	195	41.811	7.721	44.072
1117	CZ	PHE	195	41.039	7.913	45.211
1118	N	ASN	196	44.694	13.903	42.852
1119	CA	ASN	196	44.973	15.223	42.280
1120	C	ASN	196	45.978	15.096	41.140
1121	O	ASN	196	47.077	14.561	41.323
1122	CB	ASN	196	45.559	16.073	43.403
1123	CG	ASN	196	45.532	17.570	43.106
1124	OD1	ASN	196	45.851	18.036	42.008
1125	ND2	ASN	196	45.225	18.320	44.150
1126	N	SER	197	45.605	15.611	39.980
1127	CA	SER	197	46.477	15.494	38.808
1128	C	SER	197	47.067	16.835	38.378
1129	O	SER	197	46.382	17.772	37.938
1130	CB	SER	197	45.723	14.847	37.656
1131	OG	SER	197	46.648	14.680	36.589
1132	N	PHE	198	48.385	16.834	38.409
1133	CA	PHE	198	49.220	17.987	38.065
1134	C	PHE	198	49.826	17.782	36.684
1135	O	PHE	198	50.573	16.817	36.482
1136	CB	PHE	198	50.404	18.062	39.035
1137	CG	PHE	198	50.173	18.392	40.513
1138	CD1	PHE	198	50.964	19.371	41.098
1139	CD2	PHE	198	49.237	17.713	41.287
1140	CE1	PHE	198	50.798	19.690	42.437
1141	CE2	PHE	198	49.071	18.033	42.627
1142	CZ	PHE	198	49.849	19.026	43.202
1143	N	PHE	199	49.639	18.737	35.793
1144	CA	PHE	199	50.269	18.619	34.472
1145	C	PHE	199	51.781	18.841	34.577
1146	O	PHE	199	52.324	18.971	35.684
1147	CB	PHE	199	49.644	19.619	33.494
1148	CG	PHE	199	50.210	21.040	33.496
1149	CD1	PHE	199	50.862	21.506	32.362
1150	CD2	PHE	199	50.068	21.867	34.603
1151	CE1	PHE	199	51.395	22.785	32.343
1152	CE2	PHE	199	50.600	23.149	34.583
1153	CZ	PHE	199	51.269	23.605	33.454
1154	N	TRP	200	52.454	18.626	33.458
1155	CA	TRP	200	53.870	18.996	33.291
1156	C	TRP	200	54.175	20.372	33.900
1157	O	TRP	200	53.997	21.416	33.261
1158	CB	TRP	200	54.114	19.019	31.789
1159	CG	TRP	200	55.519	19.357	31.336
1160	CD1	TRP	200	55.949	20.559	30.821
1161	CD2	TRP	200	56.657	18.476	31.341
1162	NE1	TRP	200	57.264	20.443	30.509
1163	CE2	TRP	200	57.727	19.215	30.792
1164	CE3	TRP	200	56.844	17.160	31.728
1165	CZ2	TRP	200	58.964	18.610	30.631
1166	CZ3	TRP	200	58.090	16.567	31.572
1167	CH2	TRP	200	59.146	17.289	31.023
1168	N	ASN	201	54.873	20.335	35.025
1169	CA	ASN	201	55.073	21.513	35.883
1170	C	ASN	201	56.221	22.410	35.434
1171	O	ASN	201	56.327	23.554	35.892
1172	CB	ASN	201	55.330	21.037	37.311
1173	CG	ASN	201	54.139	21.338	38.224
1174	OD1	ASN	201	54.249	22.153	39.149
1175	ND2	ASN	201	53.014	20.699	37.954
1176	N	ILE	202	56.925	21.998	34.392
1177	CA	ILE	202	57.995	22.836	33.857
1178	C	ILE	202	57.438	23.927	32.934
1179	O	ILE	202	58.096	24.958	32.767
1180	CB	ILE	202	59.016	21.943	33.162
1181	CG1	ILE	202	59.513	20.882	34.137
1182	CG2	ILE	202	60.195	22.749	32.625
1183	CD1	ILE	202	60.609	20.022	33.519
1184	N	GLN	203	56.158	23.850	32.590
1185	CA	GLN	203	55.525	24.991	31.916
1186	C	GLN	203	55.125	26.064	32.929
1187	O	GLN	203	55.186	27.254	32.608
1188	CB	GLN	203	54.285	24.540	31.161
1189	CG	GLN	203	54.633	23.666	29.966
1190	CD	GLN	203	53.347	23.255	29.261
1191	OE1	GLN	203	52.339	23.969	29.308
1192	NE2	GLN	203	53.401	22.112	28.602
1193	N	ILE	204	55.008	25.670	34.187
1194	CA	ILE	204	54.747	26.628	35.265
1195	C	ILE	204	56.052	27.279	35.716
1196	O	ILE	204	56.096	28.490	35.972
1197	CB	ILE	204	54.110	25.869	36.424
1198	CG1	ILE	204	52.699	25.425	36.081
1199	CG2	ILE	204	54.085	26.709	37.687
1200	CD1	ILE	204	51.781	26.626	35.880
1201	N	HIS	205	57.140	26.553	35.529
1202	CA	HIS	205	58.454	27.114	35.828
1203	C	HIS	205	58.932	28.002	34.674
1204	O	HIS	205	59.558	29.040	34.920
1205	CB	HIS	205	59.414	25.958	36.068
1206	CG	HIS	205	60.667	26.358	36.815
1207	ND1	HIS	205	61.819	25.667	36.881
1208	CD2	HIS	205	60.833	27.492	37.575
1209	CE1	HIS	205	62.701	26.344	37.646
1210	NE2	HIS	205	62.090	27.473	38.073
1211	N	LYS	206	58.403	27.752	33.485
1212	CA	LYS	206	58.638	28.633	32.336
1213	C	LYS	206	57.750	29.873	32.417
1214	O	LYS	206	58.181	30.971	32.040
1215	CB	LYS	206	58.311	27.851	31.073
1216	CG	LYS	206	58.494	28.688	29.814
1217	CD	LYS	206	58.054	27.898	28.591
1218	CE	LYS	206	56.600	27.462	28.732
1219	NZ	LYS	206	56.191	26.635	27.589
1220	N	GLY	207	56.623	29.729	33.097
1221	CA	GLY	207	55.777	30.865	33.470
1222	C	GLY	207	56.555	31.811	34.375
1223	O	GLY	207	56.688	32.996	34.051
1224	N	GLN	208	57.248	31.245	35.353
1225	CA	GLN	208	58.119	32.036	36.233
1226	C	GLN	208	59.295	32.685	35.502
1227	O	GLN	208	59.573	33.864	35.756
1228	CB	GLN	208	58.686	31.111	37.304
1229	CG	GLN	208	57.607	30.581	38.234
1230	CD	GLN	208	57.700	31.252	39.603
1231	OE1	GLN	208	57.204	30.706	40.598
1232	NE2	GLN	208	58.323	32.416	39.644
1233	N	LEU	209	59.835	32.022	34.491
1234	CA	LEU	209	60.943	32.600	33.717
1235	C	LEU	209	60.478	33.755	32.830
1236	O	LEU	209	61.070	34.839	32.886
1237	CB	LEU	209	61.545	31.510	32.836
1238	CG	LEU	209	62.140	30.373	33.659
1239	CD1	LEU	209	62.548	29.206	32.766
1240	CD2	LEU	209	63.318	30.851	34.502
1241	N	GLU	210	59.286	33.626	32.272
1242	CA	GLU	210	58.714	34.677	31.420
1243	C	GLU	210	58.169	35.843	32.247
1244	O	GLU	210	58.176	37.000	31.799
1245	CB	GLU	210	57.574	34.026	30.641
1246	CG	GLU	210	56.845	34.997	29.721
1247	CD	GLU	210	55.633	34.298	29.114
1248	OE1	GLU	210	54.549	34.855	29.210
1249	OE2	GLU	210	55.782	33.145	28.727
1250	N	MET	211	57.896	35.562	33.509
1251	CA	MET	211	57.419	36.580	34.433
1252	C	MET	211	58.577	37.443	34.919
1253	O	MET	211	58.494	38.672	34.808
1254	CB	MET	211	56.768	35.849	35.600
1255	CG	MET	211	56.086	36.803	36.565
1256	SD	MET	211	55.291	36.028	37.987
1257	CE	MET	211	54.648	37.511	38.794
1258	N	VAL	212	59.730	36.825	35.137
1259	CA	VAL	212	60.906	37.596	35.570
1260	C	VAL	212	61.666	38.213	34.390
1261	O	VAL	212	62.580	39.018	34.597
1262	CB	VAL	212	61.831	36.721	36.417
1263	CG1	VAL	212	61.100	36.202	37.652
1264	CG2	VAL	212	62.437	35.564	35.632
1265	N	LYS	213	61.264	37.868	33.174
1266	CA	LYS	213	61.754	38.562	31.978
1267	C	LYS	213	60.809	39.683	31.541
1268	O	LYS	213	61.090	40.370	30.550
1269	CB	LYS	213	61.922	37.561	30.840
1270	CG	LYS	213	63.015	36.546	31.153
1271	CD	LYS	213	64.356	37.229	31.397
1272	CE	LYS	213	65.429	36.219	31.783
1273	NZ	LYS	213	66.713	36.891	32.038
1274	N	ALA	214	59.708	39.837	32.264
1275	CA	ALA	214	58.727	40.904	32.035
1276	C	ALA	214	58.073	40.858	30.657
1277	O	ALA	214	58.352	41.686	29.779
1278	CB	ALA	214	59.376	42.265	32.266
1279	N	ALA	215	57.235	39.854	30.460
1280	CA	ALA	215	56.368	39.838	29.277
1281	C	ALA	215	55.207	40.789	29.541
1282	O	ALA	215	55.026	41.219	30.687
1283	CB	ALA	215	55.863	38.425	29.019
1284	N	THR	216	54.469	41.157	28.507
1285	CA	THR	216	53.381	42.119	28.700
1286	C	THR	216	52.334	41.467	29.578
1287	O	THR	216	51.666	40.509	29.175
1288	CB	THR	216	52.745	42.569	27.394
1289	OG1	THR	216	53.744	42.797	26.407
1290	CG2	THR	216	51.982	43.869	27.628
1291	N	GLU	217	52.055	42.148	30.676
1292	CA	GLU	217	51.425	41.551	31.857
1293	C	GLU	217	49.904	41.390	31.851
1294	O	GLU	217	49.265	41.493	32.902
1295	CB	GLU	217	51.898	42.356	33.061
1296	CG	GLU	217	53.372	42.058	33.343
1297	CD	GLU	217	54.316	43.146	32.840
1298	OE1	GLU	217	55.491	43.087	33.178
1299	OE2	GLU	217	53.806	44.102	32.269
1300	N	ASN	218	49.322	41.226	30.679
1301	CA	ASN	218	47.912	40.875	30.559
1302	C	ASN	218	47.906	39.420	30.089
1303	O	ASN	218	48.747	38.630	30.538
1304	CB	ASN	218	47.272	41.816	29.540
1305	CG	ASN	218	45.759	41.893	29.725
1306	OD1	ASN	218	45.001	41.445	28.858
1307	ND2	ASN	218	45.354	42.305	30.911
1308	N	LEU	219	47.113.	39.114	29.080
1309	CA	LEU	219	47.192	37.789	28.452
1310	C	LEU	219	48.491	37.423	27.686
1311	O	LEU	219	48.752	36.215	27.631
1312	CB	LEU	219	45.990	37.645	27.538
1313	CG	LEU	219	44.744	37.420	28.375
1314	CD1	LEU	219	43.496	37.308	27.508
1315	CD2	LEU	219	44.930	36.167	29.216
1316	N	PRO	220	49.331	38.324	27.163
1317	CA	PRO	220	50.694	37.898	26.783
1318	C	PRO	220	51.638	37.497	27.934
1319	O	PRO	220	52.828	37.301	27.653
1320	CB	PRO	220	51.286	39.048	26.033
1321	CG	PRO	220	50.361	40.240	26.128
1322	CD	PRO	220	49.156	39.768	26.909
1323	N	LEU	221	51.178	37.487	29.178
1324	CA	LEU	221	51.937	36.879	30.266
1325	C	LEU	221	51.138	35.733	30.900
1326	O	LEU	221	50.960	35.775	32.130
1327	CB	LEU	221	52.304	37.913	31.326
1328	CG	LEU	221	53.761	37.764	31.781
1329	CD1	LEU	221	54.110	38.743	32.890
1330	CD2	LEU	221	54.108	36.353	32.237
1331	N	LEU	222	50.406	35.002	30.059
1332	CA	LEU	222	49.996	33.591	30.308
1333	C	LEU	222	48.616	33.168	29.782
1334	O	LEU	222	48.265	33.359	28.614
1335	CB	LEU	222	50.182	33.079	31.736
1336	CG	LEU	222	51.438	32.200	31.857
1337	CD1	LEU	222	51.594	31.313	30.628
1338	CD2	LEU	222	52.721	32.999	32.042
1339	N	PHE	223	47.953	32.394	30.628
1340	CA	PHE	223	46.872	31.474	30.224
1341	C	PHE	223	45.485	32.070	29.926
1342	O	PHE	223	45.014	33.014	30.577
1343	CB	PHE	223	46.724	30.457	31.343
1344	CG	PHE	223	47.971	29.700	31.808
1345	CD1	PHE	223	48.829	29.096	30.899
1346	CD2	PHE	223	48.226	29.595	33.169
1347	CE1	PHE	223	49.938	28.390	31.349
1348	CE2	PHE	223	49.336	28.894	33.620
1349	CZ	PHE	223	50.191	28.289	32.711
1350	N	LEU	224	44.804	31.371	29.025
1351	CA	LEU	224	43.491	31.763	28.491
1352	C	LEU	224	42.850	30.563	27.747
1353	O	LEU	224	43.543	29.571	27.484
1354	CB	LEU	224	43.899	32.894	27.521
1355	CG	LEU	224	42.849	33.733	26.779
1356	CD1	LEU	224	42.415	33.174	25.432
1357	CD2	LEU	224	41.670	34.178	27.625
1358	N	PRO	225	41.539	30.565	27.538
1359	CA	PRO	225	40.482	30.821	28.535
1360	C	PRO	225	39.736	29.572	29.087
1361	O	PRO	225	39.010	28.958	28.300
1362	CB	PRO	225	39.514	31.517	27.632
1363	CG	PRO	225	39.670	30.923	26.228
1364	CD	PRO	225	40.912	30.047	26.326
1365	N	VAL	226	39.829	29.234	30.375
1366	CA	VAL	226	38.927	28.189	30.993
1367	C	VAL	226	38.828	28.237	32.546
1368	O	VAL	226	39.856	28.298	33.231
1369	CB	VAL	226	39.320	26.759	30.564
1370	CG1	VAL	226	38.939	25.730	31.611
1371	CG2	VAL	226	38.711	26.316	29.236
1372	N	HIS	227	37.601	28.259	33.076
1373	CA	HIS	227	37.345	28.093	34.529
1374	C	HIS	227	35.893	27.743	34.875
1375	O	HIS	227	35.004	27.796	34.007
1376	CB	HIS	227	37.638	29.373	35.301
1377	CG	HIS	227	36.464	30.347	35.487
1378	ND1	HIS	227	35.967	30.759	36.670
1379	CD2	HIS	227	35.708	30.949	34.509
1380	CE1	HIS	227	34.944	31.608	36.453
1381	NE2	HIS	227	34.784	31.725	35.118
1382	N	ARG	228	35.753	27.211	36.088
1383	CA	ARG	228	34.587	27.460	36.980
1384	C	ARG	228	34.098	26.286	37.813
1385	O	ARG	228	33.233	25.502	37.409
1386	CB	ARG	228	33.427	28.168	36.294
1387	CG	ARG	228	32.124	28.303	37.093
1388	CD	ARG	228	32.207	29.137	38.377
1389	NE	ARG	228	30.845	29.390	38.898
1390	CZ	ARG	228	30.117	28.546	39.638
1391	NH1	ARG	228	30.616	27.370	40.010
1392	NH2	ARG	228	28.889	28.886	40.029
1393	N	SER	229	34.863	26.078	38.864
1394	CA	SER	229	34.302	25.705	40.165
1395	C	SER	229	34.221	27.042	40.898
1396	O	SER	229	35.047	27.921	40.613
1397	CB	SER	229	35.217	24.749	40.918
1398	OG	SER	229	36.399	25.450	41.272
1399	N	HIS	230	33.287	27.201	41.819
1400	CA	HIS	230	33.095	28.497	42.487
1401	C	HIS	230	34.383	29.001	43.132
1402	O	HIS	230	34.870	30.080	42.772
1403	CB	HIS	230	31.980	28.340	43.514
1404	CG	HIS	230	31.797	29.499	44.470
1405	ND1	HIS	230	31.705	29.405	45.808
1406	CD2	HIS	230	31.700	30.834	44.151
1407	CE1	HIS	230	31.559	30.638	46.332
1408	NE2	HIS	230	31.557	31.522	45.307
1409	N	ILE	231	35.040	28.157	43.907
1410	CA	ILE	231	36.367	28.541	44.390
1411	C	ILE	231	37.443	27.811	43.587
1412	O	ILE	231	37.945	26.746	43.969
1413	CB	ILE	231	36.494	28.288	45.890
1414	CG1	ILE	231	35.440	29.098	46.637
1415	CG2	ILE	231	37.886	28.662	46.393
1416	CD1	ILE	231	35.611	28.981	48.147
1417	N	ASP	232	37.873	28.470	42.521
1418	CA	ASP	232	38.927	27.927	41.646
1419	C	ASP	232	40.337	28.052	42.216
1420	O	ASP	232	41.246	27.327	41.788
1421	CB	ASP	232	38.889	28.687	40.329
1422	CG	ASP	232	37.706	28.244	39.481
1423	OD1	ASP	232	37.604	27.043	39.266
1424	OD2	ASP	232	37.124	29.102	38.834
1425	N	TYR	233	40.476	28.794	43.302
1426	CA	TYR	233	41.788	28.978	43.919
1427	C	TYR	233	42.255	27.820	44.775
1428	O	TYR	233	43.452	27.744	45.066
1429	CB	TYR	233	41.776	30.248	44.739
1430	CG	TYR	233	42.050	31.426	43.838
1431	CD1	TYR	233	43.185	31.404	43.040
1432	CD2	TYR	233	41.170	32.495	43.778
1433	CE1	TYR	233	43.457	32.467	42.196
1434	CE2	TYR	233	41.449	33.564	42.943
1435	CZ	TYR	233	42.588	33.547	42.156
1436	OH	TYR	233	42.865	34.610	41.328
1437	N	LEU	234	41.406	26.834	44.995
1438	CA	LEU	234	41.901	25.641	45.667
1439	C	LEU	234	42.625	24.763	44.649
1440	O	LEU	234	43.723	24.285	44.955
1441	CB	LEU	234	40.735	24.918	46.330
1442	CG	LEU	234	40.882	24.919	47.849
1443	CD1	LEU	234	41.909	23.899	48.325
1444	CD2	LEU	234	41.228	26.309	48.371
1445	N	LEU	235	42.225	24.882	43.391
1446	CA	LEU	235	42.898	24.145	42.319
1447	C	LEU	235	44.247	24.789	42.022
1448	O	LEU	235	45.276	24.110	42.084
1449	CB	LEU	235	42.066	24.148	41.031
1450	CG	LEU	235	40.818	23.259	41.061
1451	CD1	LEU	235	39.591	23.993	41.603
1452	CD2	LEU	235	40.504	22.764	39.653
1453	N	LEU	236	44.270	26.110	41.964
1454	CA	LEU	236	45.533	26.793	41.668
1455	C	LEU	236	46.508	26.756	42.837
1456	O	LEU	236	47.557	26.098	42.758
1457	CB	LEU	236	45.267	28.259	41.358
1458	CG	LEU	236	46.577	28.968	41.023
1459	CD1	LEU	236	47.128	28.486	39.687
1460	CD2	LEU	236	46.409	30.480	41.022
1461	N	THR	237	46.068	27.269	43.972
1462	CA	THR	237	47.009	27.573	45.044
1463	C	THR	237	47.414	26.342	45.833
1464	O	THR	237	48.601	26.228	46.146
1465	CB	THR	237	46.374	28.597	45.974
1466	OG1	THR	237	45.899	29.676	45.179
1467	CG2	THR	237	47.380	29.139	46.985
1468	N	PHE	238	46.564	25.327	45.880
1469	CA	PHE	238	46.925	24.112	46.618
1470	C	PHE	238	47.713	23.133	45.746
1471	O	PHE	238	48.403	22.249	46.268
1472	CB	PHE	238	45.649	23.463	47.145
1473	CG	PHE	238	45.853	22.183	47.947
1474	CD1	PHE	238	45.399	20.970	47.444
1475	CD2	PHE	238	46.484	22.229	49.183
1476	CE1	PHE	238	45.584	19.803	48.173
1477	CE2	PHE	238	46.670	21.062	49.912
1478	CZ	PHE	238	46.220	19.849	49.407
1479	N	ILE	239	47.723	23.362	44.444
1480	CA	ILE	239	48.558	22.540	43.574
1481	C	ILE	239	49.956	23.142	43.464
1482	O	ILE	239	50.944	22.439	43.719
1483	CB	ILE	239	47.857	22.417	42.221
1484	CG1	ILE	239	46.765	21.355	42.302
1485	CG2	ILE	239	48.815	22.127	41.071
1486	CD1	ILE	239	46.083	21.140	40.957
1487	N	LEU	240	50.014	24.462	43.412
1488	CA	LEU	240	51.305	25.152	43.302
1489	C	LEU	240	51.892	25.569	44.650
1490	O	LEU	240	52.926	26.250	44.670
1491	CB	LEU	240	51.140	26.389	42.427
1492	CG	LEU	240	50.700	26.037	41.010
1493	CD1	LEU	240	50.559	27.299	40.168
1494	CD2	LEU	240	51.673	25.066	40.346
1495	N	PHE	241	51.373	25.028	45.740
1496	CA	PHE	241	51.726	25.523	47.075
1497	C	PHE	241	53.097	25.028	47.538
1498	O	PHE	241	53.713	25.647	48.410
1499	CB	PHE	241	50.639	25.025	48.024
1500	CG	PHE	241	50.534	25.729	49.369
1501	CD1	PHE	241	51.193	25.225	50.483
1502	CD2	PHE	241	49.746	26.867	49.482
1503	CE1	PHE	241	51.081	25.874	51.706
1504	CE2	PHE	241	49.633	27.514	50.704
1505	CZ	PHE	241	50.303	27.019	51.816
1506	N	CYS	242	53.618	24.006	46.883
1507	CA	CYS	242	54.975	23.547	47.177
1508	C	CYS	242	55.993	24.000	46.122
1509	O	CYS	242	57.201	23.855	46.337
1510	CB	CYS	242	54.930	22.023	47.244
1511	SG	CYS	242	56.431	21.186	47.807
1512	N	HIS	243	55.536	24.615	45.042
1513	CA	HIS	243	56.464	24.907	43.943
1514	C	HIS	243	56.586	26.399	43.632
1515	O	HIS	243	57.688	26.888	43.364
1516	CB	HIS	243	55.967	24.148	42.709
1517	CG	HIS	243	56.816	24.271	41.452
1518	ND1	HIS	243	56.375	24.174	40.181
1519	CD2	HIS	243	58.173	24.485	41.383
1520	CE1	HIS	243	57.408	24.339	39.332
1521	NE2	HIS	243	58.521	24.533	40.076
1522	N	ASN	244	55.491	27.129	43.743
1523	CA	ASN	244	55.482	28.518	43.266
1524	C	ASN	244	55.032	29.510	44.327
1525	O	ASN	244	54.344	30.495	44.010
1526	CB	ASN	244	54.548	28.599	42.069
1527	CG	ASN	244	55.030	27.635	40.993
1528	OD1	ASN	244	54.441	26.563	40.804
1529	ND2	ASN	244	56.110	28.008	40.332
1530	N	ILE	245	55.495	29.294	45.547
1531	CA	ILE	245	55.081	30.115	46.692
1532	C	ILE	245	56.289	30.707	47.442
1533	O	ILE	245	56.153	31.203	48.569
1534	CB	ILE	245	54.276	29.206	47.615
1535	CG1	ILE	245	53.435	30.003	48.606
1536	CG2	ILE	245	55.209	28.250	48.351
1537	CD1	ILE	245	52.675	29.083	49.551
1538	N	LYS	246	57.446	30.696	46.799
1539	CA	LYS	246	58.708	31.094	47.447
1540	C	LYS	246	58.874	32.612	47.589
1541	O	LYS	246	59.522	33.271	46.769
1542	CB	LYS	246	59.838	30.535	46.592
1543	CG	LYS	246	59.650	29.039	46.369
1544	CD	LYS	246	60.676	28.484	45.389
1545	CE	LYS	246	60.464	26.992	45.157
1546	NZ	LYS	246	61.413	26.473	44.159
1547	N	ALA	247	58.305	33.139	48.661
1548	CA	ALA	247	58.394	34.566	48.989
1549	C	ALA	247	59.105	34.734	50.365
1550	O	ALA	247	60.340	34.729	50.330
1551	CB	ALA	247	56.976	35.105	48.835
1552	N	PRO	248	58.463	35.015	51.500
1553	CA	PRO	248	57.460	36.082	51.696
1554	C	PRO	248	58.014	37.506	51.515
1555	O	PRO	248	58.069	38.020	50.389
1556	CB	PRO	248	56.953	35.871	53.091
1557	CG	PRO	248	57.911	34.940	53.821
1558	CD	PRO	248	59.003	34.627	52.809
1559	N	TYR	249	58.579	38.049	52.584
1560	CA	TYR	249	58.879	39.485	52.684
1561	C	TYR	249	60.102	39.968	51.902
1562	O	TYR	249	60.102	41.134	51.494
1563	CB	TYR	249	59.063	39.830	54.167
1564	CG	TYR	249	60.287	39.222	54.865
1565	CD1	TYR	249	60.228	37.944	55.411
1566	CD2	TYR	249	61.456	39.967	54.976
1567	CE1	TYR	249	61.344	37.398	56.032
1568	CE2	TYR	249	62.573	39.424	55.599
1569	CZ	TYR	249	62.515	38.138	56.120
1570	OH	TYR	249	63.638	37.579	56.689
1571	N	ILE	250	60.969	39.067	51.465
1572	CA	ILE	250	62.180	39.502	50.755
1573	C	ILE	250	61.880	39.826	49.292
1574	O	ILE	250	62.545	40.668	48.678
1575	CB	ILE	250	63.204	38.374	50.835
1576	CG1	ILE	250	63.437	37.969	52.284
1577	CG2	ILE	250	64.524	38.780	50.188
1578	CD1	ILE	250	64.454	36.838	52.388
1579	N	ALA	251	60.775	39.287	48.808
1580	CA	ALA	251	60.346	39.546	47.438
1581	C	ALA	251	58.961	40.183	47.413
1582	O	ALA	251	58.358	40.302	46.340
1583	CB	ALA	251	60.326	38.217	46.695
1584	N	SER	252	58.495	40.597	48.586
1585	CA	SER	252	57.102	41.034	48.827
1586	C	SER	252	56.079	40.183	48.067
1587	O	SER	252	55.251	40.700	47.306
1588	CB	SER	252	56.940	42.518	48.491
1589	OG	SER	252	57.214	42.733	47.113
1590	N	GLY	253	56.109	38.889	48.347
1591	CA	GLY	253	55.245	37.919	47.663
1592	C	GLY	253	55.487	37.902	46.153
1593	O	GLY	253	54.671	38.442	45.394
1594	N	ASN	254	56.517	37.199	45.712
1595	CA	ASN	254	56.827	37.225	44.279
1596	C	ASN	254	57.225	35.863	43.711
1597	O	ASN	254	58.413	35.541	43.571
1598	CB	ASN	254	57.961	38.211	44.061
1599	CG	ASN	254	57.985	38.630	42.602
1600	OD1	ASN	254	58.911	38.301	41.851
1601	ND2	ASN	254	56.962	39.379	42.231
1602	N	ASN	255	56.225	35.070	43.373
1603	CA	ASN	255	56.462	33.789	42.705
1604	C	ASN	255	55.414	33.560	41.615
1605	O	ASN	255	55.371	34.346	40.662
1606	CB	ASN	255	56.456	32.685	43.740
1607	CG	ASN	255	57.758	31.893	43.660
1608	OD1	ASN	255	57.754	30.675	43.877
1609	ND2	ASN	255	58.863	32.606	43.548
1610	N	LEU	256	54.663	32.470	41.679
1611	CA	LEU	256	53.633	32.272	40.648
1612	C	LEU	256	52.228	32.006	41.216
1613	O	LEU	256	51.276	31.882	40.432
1614	CB	LEU	256	54.055	31.167	39.686
1615	CG	LEU	256	53.376	31.327	38.326
1616	CD1	LEU	256	53.663	32.701	37.729
1617	CD2	LEU	256	53.793	30.234	37.353
1618	N	ASN	257	52.070	31.863	42.521
1619	CA	ASN	257	50.693	31.930	43.048
1620	C	ASN	257	50.446	33.289	43.711
1621	O	ASN	257	49.322	33.804	43.719
1622	CB	ASN	257	50.336	30.731	43.933
1623	CG	ASN	257	51.347	30.391	45.026
1624	OD1	ASN	257	51.989	31.263	45.623
1625	ND2	ASN	257	51.397	29.107	45.339
1626	N	ILE	258	51.494	33.825	44.310
1627	CA	ILE	258	51.555	35.256	44.634
1628	C	ILE	258	52.559	35.865	43.652
1629	O	ILE	258	53.396	35.083	43.193
1630	CB	ILE	258	51.973	35.492	46.088
1631	CG1	ILE	258	53.388	35.007	46.403
1632	CG2	ILE	258	50.973	34.835	47.029
1633	CD1	ILE	258	53.422	33.655	47.113
1634	N	PRO	259	52.510	37.139	43.271
1635	CA	PRO	259	51.697	38.213	43.875
1636	C	PRO	259	50.211	37.909	43.877
1637	O	PRO	259	49.680	37.345	42.913
1638	CB	PRO	259	51.998	39.451	43.086
1639	CG	PRO	259	53.090	39.146	42.075
1640	CD	PRO	259	53.436	37.680	42.270
1641	N	ILE	260	49.578	38.355	44.950
1642	CA	ILE	260	48.237	37.904	45.342
1643	C	ILE	260	47.215	38.030	44.221
1644	O	ILE	260	46.902	39.115	43.720
1645	CB	ILE	260	47.771	38.626	46.619
1646	CG1	ILE	260	48.328	38.010	47.912
1647	CG2	ILE	260	46.252	38.675	46.721
1648	CD1	ILE	260	49.796	38.325	48.191
1649	N	PHE	261	46.821	36.851	43.781
1650	CA	PHE	261	45.782	36.617	42.788
1651	C	PHE	261	44.498	37.428	42.964
1652	O	PHE	261	44.186	37.919	44.054
1653	CB	PHE	261	45.485	35.126	42.874
1654	CG	PHE	261	45.526	34.501	44.269
1655	CD1	PHE	261	46.361	33.419	44.494
1656	CD2	PHE	261	44.726	34.982	45.300
1657	CE1	PHE	261	46.431	32.841	45.747
1658	CE2	PHE	261	44.807	34.409	46.564
1659	CZ	PHE	261	45.661	33.336	46.788
1660	N	SER	262	43.774	37.563	41.863
1661	CA	SER	262	42.490	38.269	41.831
1662	C	SER	262	41.376	37.264	42.111
1663	O	SER	262	41.436	36.568	43.130
1664	CB	SER	262	42.316	38.889	40.457
1665	OG	SER	262	41.390	39.965	40.537
1666	N	THR	263	40.386	37.164	41.236
1667	CA	THR	263	39.313	36.189	41.485
1668	C	THR	263	39.538	34.914	40.693
1669	O	THR	263	39.047	33.850	41.075
1670	CB	THR	263	37.933	36.759	41.153
1671	OG1	THR	263	37.857	37.092	39.771
1672	CG2	THR	263	37.624	38.005	41.963
1673	N	LEU	264	40.307	35.015	39.623
1674	CA	LEU	264	40.646	33.827	38.841
1675	C	LEU	264	42.130	33.807	38.506
1676	O	LEU	264	42.671	34.799	38.015
1677	CB	LEU	264	39.822	33.768	37.563
1678	CG	LEU	264	38.643	32.814	37.671
1679	CD1	LEU	264	39.118	31.514	38.291
1680	CD2	LEU	264	37.475	33.387	38.461
1681	N	ILE	265	42.723	32.650	38.765
1682	CA	ILE	265	44.151	32.297	38.576
1683	C	ILE	265	45.108	33.482	38.409
1684	O	ILE	265	45.174	34.100	37.340
1685	CB	ILE	265	44.236	31.383	37.362
1686	CG1	ILE	265	43.163	30.297	37.399
1687	CG2	ILE	265	45.613	30.733	37.289
1688	CD1	ILE	265	43.395	29.285	38.519
1689	N	HIS	266	45.949	33.661	39.421
1690	CA	HIS	266	46.827	34.838	39.548
1691	C	HIS	266	45.981	36.098	39.340
1692	O	HIS	266	44.785	36.103	39.654
1693	CB	HIS	266	48.009	34.768	38.574
1694	CG	HIS	266	49.337	35.277	39.138
1695	ND1	HIS	266	50.343	34.521	39.612
1696	CD2	HIS	266	49.748	36.586	39.252
1697	CE1	HIS	266	51.357	35.315	40.014
1698	NE2	HIS	266	50.986	36.594	39.792
1699	N	LYS	267	46.617	37.197	38.989
1700	CA	LYS	267	45.885	38.444	38.818
1701	C	LYS	267	45.152	38.421	37.482
1702	O	LYS	267	45.576	37.767	36.524
1703	CB	LYS	267	46.866	39.591	38.979
1704	CG	LYS	267	47.514	39.449	40.359
1705	CD	LYS	267	48.484	40.561	40.759
1706	CE	LYS	267	47.810	41.796	41.360
1707	NZ	LYS	267	47.067	42.597	40.374
1708	N	LEU	268	43.999	39.062	37.482
1709	CA	LEU	268	43.021	38.902	36.404
1710	C	LEU	268	41.898	39.922	36.574
1711	O	LEU	268	41.699	40.415	37.693
1712	CB	LEU	268	42.528	37.449	36.518
1713	CG	LEU	268	41.224	37.086	35.813
1714	CD1	LEU	268	41.305	35.708	35.176
1715	CD2	LEU	268	40.047	37.146	36.782
1716	N	GLY	269	41.302	40.341	35.464
1717	CA	GLY	269	40.088	41.176	35.499
1718	C	GLY	269	39.024	40.496	36.363
1719	O	GLY	269	38.396	39.514	35.952
1720	N	GLY	270	38.785	41.089	37.519
1721	CA	GLY	270	38.045	40.436	38.604
1722	C	GLY	270	36.594	40.211	38.232
1723	O	GLY	270	36.020	40.994	37.473
1724	N	PHE	271	36.061	39.080	38.655
1725	CA	PHE	271	34.650	38.783	38.371
1726	C	PHE	271	33.701	39.678	39.166
1727	O	PHE	271	33.252	39.382	40.277
1728	CB	PHE	271	34.387	37.298	38.528
1729	CG	PHE	271	34.739	36.565	37.238
1730	CD1	PHE	271	36.049	36.169	36.991
1731	CD2	PHE	271	33.757	36.327	36.288
1732	CE1	PHE	271	36.371	35.523	35.802
1733	CE2	PHE	271	34.078	35.683	35.104
1734	CZ	PHE	271	35.381	35.280	34.858
1735	N	PHE	272	33.187	40.594	38.369
1736	CA	PHE	272	32.546	41.855	38.749
1737	C	PHE	272	31.277	41.759	39.588
1738	O	PHE	272	30.775	40.676	39.935
1739	CB	PHE	272	32.172	42.547	37.430
1740	CG	PHE	272	33.054	42.168	36.235
1741	CD1	PHE	272	32.620	41.203	35.333
1742	CD2	PHE	272	34.264	42.814	36.022
1743	CE1	PHE	272	33.433	40.824	34.275
1744	CE2	PHE	272	35.076	42.439	34.961
1745	CZ	PHE	272	34.668	41.433	34.097
1746	N	ILE	273	30.913	42.947	40.053
1747	CA	ILE	273	29.570	43.295	40.558
1748	C	ILE	273	29.039	42.389	41.689
1749	O	ILE	273	29.732	41.481	42.167
1750	CB	ILE	273	28.682	43.370	39.299
1751	CG1	ILE	273	27.680	44.519	39.363
1752	CG2	ILE	273	27.970	42.061	38.958
1753	CD1	ILE	273	28.380	45.860	39.552
1754	N	ARG	274	27.810	42.645	42.116
1755	CA	ARG	274	27.154	41.936	43.225
1756	C	ARG	274	26.864	40.438	43.012
1757	O	ARG	274	26.355	39.792	43.934
1758	CB	ARG	274	25.839	42.651	43.531
1759	CG	ARG	274	26.055	44.108	43.941
1760	CD	ARG	274	25.630	45.103	42.859
1761	NE	ARG	274	24.177	45.059	42.631
1762	CZ	ARG	274	23.614	45.177	41.425
1763	NH1	ARG	274	24.374	45.173	40.328
1764	NH2	ARG	274	22.285	45.174	41.311
1765	N	ARG	275	27.242	39.874	41.875
1766	CA	ARG	275	27.125	38.431	41.691
1767	C	ARG	275	28.369	37.692	42.186
1768	O	ARG	275	28.228	36.574	42.694
1769	CB	ARG	275	26.879	38.129	40.217
1770	CG	ARG	275	25.458	38.496	39.805
1771	CD	ARG	275	25.238	38.209	38.327
1772	NE	ARG	275	23.818	38.309	37.965
1773	CZ	ARG	275	23.379	38.131	36.718
1774	NH1	ARG	275	22.068	38.098	36.473
1775	NH2	ARG	275	24.248	37.886	35.735
1776	N	ARG	276	29.540	38.313	42.145
1777	CA	ARG	276	30.717	37.650	42.733
1778	C	ARG	276	31.518	38.567	43.648
1779	O	ARG	276	31.561	38.328	44.863
1780	CB	ARG	276	31.626	37.074	41.656
1781	CG	ARG	276	31.070	35.774	41.085
1782	CD	ARG	276	32.111	35.063	40.231
1783	NE	ARG	276	33.327	34.790	41.018
1784	CZ	ARG	276	34.128	33.744	40.799
1785	NH1	ARG	276	35.218	33.571	41.551
1786	NH2	ARG	276	33.844	32.876	39.826
1787	N	LEU	277	31.949	39.701	43.120
1788	CA	LEU	277	32.782	40.636	43.901
1789	C	LEU	277	32.018	41.411	44.970
1790	O	LEU	277	32.625	42.103	45.794
1791	CB	LEU	277	33.447	41.633	42.962
1792	CG	LEU	277	34.683	41.023	42.322
1793	CD1	LEU	277	35.351	41.981	41.345
1794	CD2	LEU	277	35.664	40.592	43.393
1795	N	ASP	278	30.700	41.360	44.926
1796	CA	ASP	278	29.891	41.903	46.014
1797	C	ASP	278	28.757	40.929	46.328
1798	O	ASP	278	27.633	41.366	46.602
1799	CB	ASP	278	29.307	43.260	45.619
1800	CG	ASP	278	30.367	44.257	45.142
1801	OD1	ASP	278	30.685	45.149	45.917
1802	OD2	ASP	278	30.595	44.278	43.936
1803	N	GLU	279	29.038	39.637	46.217
1804	CA	GLU	279	27.993	38.613	46.365
1805	C	GLU	279	27.517	38.468	47.807
1806	O	GLU	279	28.224	37.860	48.631
1807	CB	GLU	279	28.542	37.278	45.870
1808	CG	GLU	279	27.460	36.203	45.807
1809	CD	GLU	279	28.021	34.911	45.214
1810	OE1	GLU	279	27.213	34.076	44.828
1811	OE2	GLU	279	29.221	34.707	45.342
1812	N	THR	280	26.246	38.830	47.988
1813	CA	THR	280	25.506	38.864	49.274
1814	C	THR	280	26.219	38.140	50.402
1815	O	THR	280	26.259	36.904	50.416
1816	CB	THR	280	24.134	38.237	49.048
1817	OG1	THR	280	24.323	36.970	48.428
1818	CG2	THR	280	23.289	39.088	48.108
1819	N	PRO	281	26.677	38.920	51.371
1820	CA	PRO	281	28.054	38.794	51.898
1821	C	PRO	281	28.487	37.435	52.452
1822	O	PRO	281	28.668	37.269	53.662
1823	CB	PRO	281	28.154	39.865	52.939
1824	CG	PRO	281	27.023	40.856	52.725
1825	CD	PRO	281	26.199	40.289	51.584
1826	N	ASP	282	28.780	36.515	51.546
1827	CA	ASP	282	29.283	35.194	51.918
1828	C	ASP	282	30.651	35.001	51.290
1829	O	ASP	282	31.653	34.873	52.005
1830	CB	ASP	282	28.330	34.115	51.405
1831	CG	ASP	282	26.941	34.233	52.033
1832	OD1	ASP	282	25.984	33.936	51.333
1833	OD2	ASP	282	26.857	34.637	53.185
1834	N	GLY	283	30.711	35.392	50.024
1835	CA	GLY	283	31.944	35.276	49.235
1836	C	GLY	283	32.829	36.515	49.358
1837	O	GLY	283	33.914	36.580	48.762
1838	N	ARG	284	32.489	37.358	50.320
1839	CA	ARG	284	33.212	38.605	50.524
1840	C	ARG	284	34.484	38.363	51.317
1841	O	ARG	284	35.493	39.008	51.018
1842	CB	ARG	284	32.317	39.585	51.266
1843	CG	ARG	284	31.046	39.877	50.481
1844	CD	ARG	284	31.333	40.493	49.116
1845	NE	ARG	284	32.107	41.739	49.229
1846	CZ	ARG	284	31.560	42.950	49.348
1847	NH1	ARG	284	32.341	44.031	49.347
1848	NH2	ARG	284	30.232	43.087	49.396
1849	N	LYS	285	34.538	37.241	52.020
1850	CA	LYS	285	35.783	36.872	52.695
1851	C	LYS	285	36.821	36.405	51.677
1852	O	LYS	285	37.996	36.760	51.808
1853	CB	LYS	285	35.518	35.759	53.700
1854	CG	LYS	285	36.815	35.366	54.399
1855	CD	LYS	285	36.616	34.249	55.414
1856	CE	LYS	285	37.948	33.856	56.041
1857	NZ	LYS	285	37.774	32.782	57.029
1858	N	ASP	286	36.351	35.892	50.550
1859	CA	ASP	286	37.247	35.526	49.456
1860	C	ASP	286	37.761	36.785	48.773
1861	O	ASP	286	38.922	37.182	48.957
1862	CB	ASP	286	36.469	34.736	48.401
1863	CG	ASP	286	35.846	33.457	48.950
1864	OD1	ASP	286	34.719	33.523	49.423
1865	OD2	ASP	286	36.473	32.417	48.808
1866	N	VAL	287	36.818	37.532	48.223
1867	CA	VAL	287	37.154	38.617	47.298
1868	C	VAL	287	37.693	39.896	47.947
1869	O	VAL	287	38.286	40.709	47.232
1870	CB	VAL	287	35.906	38.934	46.477
1871	CG1	VAL	287	35.414	37.689	45.746
1872	CG2	VAL	287	34.784	39.522	47.324
1873	N	LEU	288	37.646	40.013	49.266
1874	CA	LEU	288	38.202	41.207	49.907
1875	C	LEU	288	39.672	41.068	50.294
1876	O	LEU	288	40.273	42.064	50.713
1877	CB	LEU	288	37.367	41.579	51.126
1878	CG	LEU	288	36.001	42.111	50.703
1879	CD1	LEU	288	35.135	42.431	51.918
1880	CD2	LEU	288	36.153	43.340	49.810
1881	N	TYR	289	40.267	39.892	50.158
1882	CA	TYR	289	41.716	39.857	50.363
1883	C	TYR	289	42.472	39.707	49.047
1884	O	TYR	289	43.677	39.986	49.000
1885	CB	TYR	289	42.138	38.790	51.377
1886	CG	TYR	289	42.007	37.316	51.004
1887	CD1	TYR	289	40.939	36.577	51.493
1888	CD2	TYR	289	42.966	36.704	50.207
1889	CE1	TYR	289	40.831	35.226	51.190
1890	CE2	TYR	289	42.859	35.355	49.903
1891	CZ	TYR	289	41.800	34.614	50.407
1892	OH	TYR	289	41.873	33.239	50.382
1893	N	ARG	290	41.757	39.375	47.985
1894	CA	ARG	290	42.396	39.165	46.682
1895	C	ARG	290	42.587	40.489	45.936
1896	O	ARG	290	41.783	41.416	46.091
1897	CB	ARG	290	41.518	38.205	45.889
1898	CG	ARG	290	41.167	36.980	46.732
1899	CD	ARG	290	40.462	35.906	45.909
1900	NE	ARG	290	39.814	34.869	46.736
1901	CZ	ARG	290	40.365	33.714	47.121
1902	NH1	ARG	290	41.662	33.484	46.918
1903	NH2	ARG	290	39.644	32.834	47.816
1904	N	ALA	291	43.643	40.567	45.142
1905	CA	ALA	291	43.966	41.805	44.420
1906	C	ALA	291	43.218	41.879	43.093
1907	O	ALA	291	43.624	41.322	42.064
1908	CB	ALA	291	45.468	41.900	44.200
1909	N	LEU	292	42.153	42.657	43.127
1910	CA	LEU	292	41.186	42.691	42.024
1911	C	LEU	292	41.540	43.679	40.918
1912	O	LEU	292	42.421	44.535	41.060
1913	CB	LEU	292	39.823	43.077	42.586
1914	CG	LEU	292	39.443	42.236	43.800
1915	CD1	LEU	292	38.200	42.800	44.480
1916	CD2	LEU	292	39.257	40.768	43.440
1917	N	LEU	293	40.934	43.419	39.772
1918	CA	LEU	293	40.894	44.372	38.657
1919	C	LEU	293	39.425	44.542	38.247
1920	O	LEU	293	38.958	43.957	37.262
1921	CB	LEU	293	41.754	43.830	37.520
1922	CG	LEU	293	41.866	44.811	36.361
1923	CD1	LEU	293	42.250	46.205	36.848
1924	CD2	LEU	293	42.848	44.299	35.314
1925	N	HIS	294	38.704	45.304	39.052
1926	CA	HIS	294	37.232	45.342	38.996
1927	C	HIS	294	36.666	46.333	37.971
1928	O	HIS	294	36.827	47.554	38.086
1929	CB	HIS	294	36.790	45.727	40.408
1930	CG	HIS	294	35.339	45.569	40.839
1931	ND1	HIS	294	34.220	45.583	40.086
1932	CD2	HIS	294	34.931	45.384	42.140
1933	CE1	HIS	294	33.143	45.419	40.878
1934	NE2	HIS	294	33.583	45.294	42.149
1935	N	GLY	295	35.925	45.776	37.023
1936	CA	GLY	295	35.105	46.563	36.081
1937	C	GLY	295	33.630	46.187	36.262
1938	O	GLY	295	33.278	45.607	37.295
1939	N	ILE	296	32.773	46.547	35.316
1940	CA	ILE	296	31.341	46.185	35.422
1941	C	ILE	296	30.809	45.469	34.170
1942	O	ILE	296	30.952	45.943	33.039
1943	CB	ILE	296	30.521	47.440	35.746
1944	CG1	ILE	296	30.790	47.904	37.174
1945	CG2	ILE	296	29.020	47.231	35.549
1946	CD1	ILE	296	29.930	49.107	37.542
1947	N	VAL	297	30.164	44.337	34.420
1948	CA	VAL	297	29.596	43.445	33.391
1949	C	VAL	297	28.592	44.119	32.443
1950	O	VAL	297	27.544	44.623	32.868
1951	CB	VAL	297	28.929	42.316	34.176
1952	CG1	VAL	297	28.270	42.864	35.432
1953	CG2	VAL	297	27.947	41.483	33.359
1954	N	GLU	298	28.818	43.885	31.156
1955	CA	GLU	298	28.025	44.485	30.069
1956	C	GLU	298	26.517	44.256	30.141
1957	O	GLU	298	25.755	45.223	30.062
1958	CB	GLU	298	28.478	43.868	28.757
1959	CG	GLU	298	29.934	44.157	28.441
1960	CD	GLU	298	30.298	43.381	27.184
1961	OE1	GLU	298	30.383	43.989	26.128
1962	OE2	GLU	298	30.535	42.191	27.329
1963	N	LEU	299	26.076	43.035	30.395
1964	CA	LEU	299	24.629	42.792	30.342
1965	C	LEU	299	23.877	43.123	31.635
1966	O	LEU	299	22.652	43.271	31.581
1967	CB	LEU	299	24.336	41.369	29.882
1968	CG	LEU	299	24.737	41.160	28.420
1969	CD1	LEU	299	24.252	39.806	27.919
1970	CD2	LEU	299	24.171	42.249	27.516
1971	N	LEU	300	24.585	43.432	32.712
1972	CA	LEU	300	23.908	43.966	33.903
1973	C	LEU	300	23.951	45.485	33.865
1974	O	LEU	300	23.140	46.179	34.492
1975	CB	LEU	300	24.587	43.477	35.172
1976	CG	LEU	300	24.288	42.011	35.443
1977	CD1	LEU	300	24.997	41.567	36.715
1978	CD2	LEU	300	22.784	41.788	35.565
1979	N	ARG	301	24.838	45.970	33.015
1980	CA	ARG	301	24.971	47.388	32.712
1981	C	ARG	301	23.902	47.811	31.698
1982	O	ARG	301	23.419	48.948	31.729
1983	CB	ARG	301	26.381	47.504	32.135
1984	CG	ARG	301	26.771	48.889	31.662
1985	CD	ARG	301	28.198	48.904	31.134
1986	NE	ARG	301	28.347	48.027	29.966
1987	CZ	ARG	301	28.844	48.458	28.806
1988	NH1	ARG	301	29.224	49.730	28.678
1989	NH2	ARG	301	28.958	47.621	27.773
1990	N	GLN	302	23.376	46.820	30.996
1991	CA	GLN	302	22.293	47.006	30.026
1992	C	GLN	302	20.964	47.412	30.643
1993	O	GLN	302	20.579	48.587	30.608
1994	CB	GLN	302	22.072	45.669	29.334
1995	CG	GLN	302	23.080	45.430	28.224
1996	CD	GLN	302	22.587	46.081	26.941
1997	OE1	GLN	302	21.394	46.024	26.623
1998	NE2	GLN	302	23.522	46.630	26.187
1999	N	GLN	303	20.295	46.441	31.246
2000	CA	GLN	303	18.893	46.637	31.636
2001	C	GLN	303	18.675	47.323	32.985
2002	O	GLN	303	17.518	47.544	33.365
2003	CB	GLN	303	18.126	45.316	31.527
2004	CG	GLN	303	18.890	44.092	32.029
2005	CD	GLN	303	19.117	44.147	33.535
2006	OE1	GLN	303	20.249	44.367	33.983
2007	NE2	GLN	303	18.027	44.081	34.281
2008	N	GLN	304	19.739	47.699	33.678
2009	CA	GLN	304	19.581	48.597	34.829
2010	C	GLN	304	19.761	50.041	34.342
2011	O	GLN	304	20.696	50.781	34.697
2012	CB	GLN	304	20.540	48.167	35.928
2013	CG	GLN	304	20.151	46.751	36.351
2014	CD	GLN	304	20.989	46.242	37.517
2015	OE1	GLN	304	20.486	46.086	38.636
2016	NE2	GLN	304	22.237	45.930	37.225
2017	N	PHE	305	18.713	50.435	33.632
2018	CA	PHE	305	18.666	51.616	32.767
2019	C	PHE	305	19.002	52.929	33.437
2020	O	PHE	305	18.742	53.148	34.627
2021	CB	PHE	305	17.261	51.721	32.182
2022	CG	PHE	305	17.194	51.435	30.686
2023	CD1	PHE	305	18.143	50.616	30.090
2024	CD2	PHE	305	16.187	52.005	29.918
2025	CE1	PHE	305	18.084	50.362	28.728
2026	CE2	PHE	305	16.128	51.750	28.553
2027	CZ	PHE	305	17.077	50.928	27.958
2028	N	LEU	306	19.739	53.715	32.662
2029	CA	LEU	306	20.142	55.103	32.967
2030	C	LEU	306	20.896	55.305	34.284
2031	O	LEU	306	20.902	56.414	34.826
2032	CB	LEU	306	18.875	55.955	32.980
2033	CG	LEU	306	18.146	55.900	31.640
2034	CD1	LEU	306	16.756	56.517	31.738
2035	CD2	LEU	306	18.961	56.559	30.532
2036	N	GLU	307	21.493	54.248	34.811
2037	CA	GLU	307	22.246	54.342	36.059
2038	C	GLU	307	23.526	53.539	35.932
2039	O	GLU	307	24.601	54.068	35.609
2040	CB	GLU	307	21.398	53.722	37.168
2041	CG	GLU	307	20.043	54.405	37.325
2042	CD	GLU	307	19.122	53.533	38.168
2043	OE1	GLU	307	19.382	52.338	38.231
2044	OE2	GLU	307	18.231	54.083	38.800
2045	N	ILE	308	23.321	52.233	35.900
2046	CA	ILE	308	24.439	51.291	35.915
2047	C	ILE	308	25.054	51.091	34.529
2048	O	ILE	308	26.222	50.696	34.441
2049	CB	ILE	308	23.937	49.994	36.546
2050	CG1	ILE	308	23.467	50.305	37.965
2051	CG2	ILE	308	25.010	48.909	36.571
2052	CD1	ILE	308	23.051	49.057	38.731
2053	N	PHE	309	24.417	51.640	33.506
2054	CA	PHE	309	25.053	51.655	32.189
2055	C	PHE	309	26.200	52.662	32.137
2056	O	PHE	309	27.317	52.298	31.745
2057	CB	PHE	309	24.029	52.001	31.114
2058	CG	PHE	309	24.588	51.854	29.700
2059	CD1	PHE	309	24.661	50.595	29.117
2060	CD2	PHE	309	25.038	52.968	29.002
2061	CE1	PHE	309	25.179	50.450	27.837
2062	CE2	PHE	309	25.557	52.822	27.722
2063	CZ	PHE	309	25.628	51.563	27.139
2064	N	LEU	310	26.013	53.793	32.797
2065	CA	LEU	310	27.024	54.848	32.743
2066	C	LEU	310	28.133	54.582	33.749
2067	O	LEU	310	29.317	54.681	33.399
2068	CB	LEU	310	26.345	56.174	33.057
2069	CG	LEU	310	25.291	56.519	32.012
2070	CD1	LEU	310	24.489	57.746	32.432
2071	CD2	LEU	310	25.926	56.730	30.641
2072	N	GLU	311	27.757	53.964	34.858
2073	CA	GLU	311	28.746	53.609	35.878
2074	C	GLU	311	29.577	52.411	35.425
2075	O	GLU	311	30.793	52.386	35.652
2076	CB	GLU	311	28.009	53.255	37.165
2077	CG	GLU	311	28.965	53.125	38.348
2078	CD	GLU	311	29.501	54.500	38.741
2079	OE1	GLU	311	30.589	54.555	39.296
2080	OE2	GLU	311	28.754	55.455	38.579
2081	N	GLY	312	28.970	51.558	34.616
2082	CA	GLY	312	29.670	50.428	34.018
2083	C	GLY	312	30.709	50.909	33.025
2084	O	GLY	312	31.899	50.629	33.207
2085	N	THR	313	30.296	51.817	32.154
2086	CA	THR	313	31.193	52.366	31.128
2087	C	THR	313	32.416	53.053	31.738
2088	O	THR	313	33.551	52.673	31.414
2089	CB	THR	313	30.416	53.393	30.308
2090	OG1	THR	313	29.287	52.759	29.724
2091	CG2	THR	313	31.264	53.973	29.182
2092	N	ARG	314	32.201	53.833	32.785
2093	CA	ARG	314	33.319	54.550	33.403
2094	C	ARG	314	34.206	53.660	34.274
2095	O	ARG	314	35.431	53.834	34.248
2096	CB	ARG	314	32.753	55.695	34.231
2097	CG	ARG	314	32.032	56.692	33.332
2098	CD	ARG	314	31.485	57.872	34.124
2099	NE	ARG	314	30.465	57.443	35.093
2100	CZ	ARG	314	29.211	57.902	35.065
2101	NH1	ARG	314	28.341	57.526	36.004
2102	NH2	ARG	314	28.840	58.771	34.122
2103	N	SER	315	33.657	52.581	34.809
2104	CA	SER	315	34.478	51.672	35.616
2105	C	SER	315	35.247	50.681	34.745
2106	O	SER	315	36.341	50.263	35.133
2107	CB	SER	315	33.597	50.910	36.598
2108	OG	SER	315	32.719	50.080	35.852
2109	N	ARG	316	34.808	50.479	33.513
2110	CA	ARG	316	35.571	49.634	32.591
2111	C	ARG	316	36.710	50.437	31.973
2112	O	ARG	316	37.825	49.918	31.832
2113	CB	ARG	316	34.637	49.135	31.495
2114	CG	ARG	316	33.495	48.314	32.079
2115	CD	ARG	316	32.432	47.991	31.034
2116	NE	ARG	316	32.931	47.041	30.029
2117	CZ	ARG	316	32.962	47.298	28.720
2118	NH1	ARG	316	32.609	48.503	28.266
2119	NH2	ARG	316	33.411	46.371	27.871
2120	N	SER	317	36.503	51.741	31.876
2121	CA	SER	317	37.552	52.633	31.376
2122	C	SER	317	38.633	52.825	32.434
2123	O	SER	317	39.824	52.643	32.142
2124	CB	SER	317	36.925	53.981	31.041
2125	OG	SER	317	35.905	53.764	30.075
2126	N	GLY	318	38.201	52.969	33.677
2127	CA	GLY	318	39.125	53.077	34.808
2128	C	GLY	318	39.944	51.802	34.972
2129	O	GLY	318	41.185	51.864	35.031
2130	N	LYS	319	39.258	50.670	34.973
2131	CA	LYS	319	39.896	49.355	35.068
2132	C	LYS	319	40.977	49.166	34.011
2133	O	LYS	319	42.155	49.061	34.377
2134	CB	LYS	319	38.810	48.308	34.846
2135	CG	LYS	319	39.368	46.893	34.784
2136	CD	LYS	319	38.318	45.922	34.264
2137	CE	LYS	319	37.818	46.362	32.893
2138	NZ	LYS	319	36.755	45.470	32.405
2139	N	THR	320	40.638	49.445	32.761
2140	CA	THR	320	41.565	49.186	31.656
2141	C	THR	320	42.733	50.169	31.605
2142	O	THR	320	43.874	49.730	31.410
2143	CB	THR	320	40.774	49.267	30.355
2144	OG1	THR	320	39.747	48.286	30.407
2145	CG2	THR	320	41.646	48.973	29.142
2146	N	SER	321	42.514	51.398	32.040
2147	CA	SER	321	43.601	52.383	32.015
2148	C	SER	321	44.612	52.170	33.141
2149	O	SER	321	45.821	52.259	32.889
2150	CB	SER	321	43.008	53.788	32.096
2151	OG	SER	321	42.256	53.907	33.298
2152	N	CYS	322	44.164	51.637	34.267
2153	CA	CYS	322	45.105	51.387	35.359
2154	C	CYS	322	45.754	50.021	35.182
2155	O	CYS	322	46.951	49.862	35.463
2156	CB	CYS	322	44.367	51.454	36.686
2157	SG	CYS	322	45.419	51.470	38.153
2158	N	ALA	323	45.055	49.167	34.450
2159	CA	ALA	323	45.595	47.864	34.084
2160	C	ALA	323	46.733	48.022	33.093
2161	O	ALA	323	47.812	47.493	33.372
2162	CB	ALA	323	44.492	47.025	33.451
2163	N	ARG	324	46.615	48.956	32.160
2164	CA	ARG	324	47.696	49.185	31.193
2165	C	ARG	324	48.902	49.903	31.788
2166	O	ARG	324	50.033	49.579	31.406
2167	CB	ARG	324	47.157	49.988	30.023
2168	CG	ARG	324	46.221	49.147	29.172
2169	CD	ARG	324	45.705	49.951	27.989
2170	NE	ARG	324	44.949	51.120	28.455
2171	CZ	ARG	324	43.910	51.619	27.785
2172	NH1	ARG	324	43.223	52.647	28.287
2173	NH2	ARG	324	43.528	51.057	26.636
2174	N	ALA	325	48.701	50.636	32.871
2175	CA	ALA	325	49.848	51.211	33.579
2176	C	ALA	325	50.628	50.091	34.268
2177	O	ALA	325	51.845	49.970	34.066
2178	CB	ALA	325	49.342	52.211	34.613
2179	N	GLY	326	49.882	49.129	34.788
2180	CA	GLY	326	50.462	47.910	35.361
2181	C	GLY	326	51.205	47.073	34.318
2182	O	GLY	326	52.392	46.789	34.527
2183	N	LEU	327	50.623	46.935	33.131
2184	CA	LEU	327	51.182	46.090	32.051
2185	C	LEU	327	52.414	46.688	31.367
2186	O	LEU	327	52.942	46.060	30.441
2187	CB	LEU	327	50.167	45.887	30.922
2188	CG	LEU	327	48.729	45.617	31.347
2189	CD1	LEU	327	47.821	45.484	30.131
2190	CD2	LEU	327	48.571	44.414	32.264
2191	N	LEU	328	52.775	47.914	31.710
2192	CA	LEU	328	53.998	48.515	31.187
2193	C	LEU	328	55.079	48.596	32.272
2194	O	LEU	328	56.261	48.777	31.953
2195	CB	LEU	328	53.612	49.903	30.661
2196	CG	LEU	328	54.746	50.666	29.976
2197	CD1	LEU	328	54.261	51.341	28.698
2198	CD2	LEU	328	55.391	51.688	30.911
2199	N	SER	329	54.713	48.364	33.524
2200	CA	SER	329	55.682	48.616	34.597
2201	C	SER	329	55.963	47.442	35.539
2202	O	SER	329	57.071	47.362	36.082
2203	CB	SER	329	55.177	49.801	35.413
2204	OG	SER	329	53.904	49.462	35.949
2205	N	VAL	330	54.990	46.580	35.784
2206	CA	VAL	330	55.209	45.514	36.772
2207	C	VAL	330	54.988	44.121	36.199
2208	O	VAL	330	53.942	43.857	35.601
2209	CB	VAL	330	54.321	45.737	37.997
2210	CG1	VAL	330	54.811	46.910	38.840
2277	CG2	VAL	330	52.851	45.908	37.633
2212	N	VAL	331	55.780	43.209	36.745
2213	CA	VAL	331	55.953	41.800	36.312
2214	C	VAL	331	54.767	40.816	36.500
2215	O	VAL	331	54.826	39.685	36.003
2216	CB	VAL	331	57.198	41.379	37.107
2217	CG1	VAL	331	57.316	39.907	37.472
2218	CG2	VAL	331	58.477	41.894	36.455
2219	N	VAL	332	53.643	41.312	36.989
2220	CA	VAL	332	52.443	40.512	37.302
2221	C	VAL	332	51.929	39.618	36.156
2222	O	VAL	332	51.798	40.047	35.008
2223	CB	VAL	332	51.379	41.543	37.675
2224	CG1	VAL	332	49.956	41.004	37.626
2225	CG2	VAL	332	51.688	42.188	39.021
2226	N	ASP	333	51.720	38.347	36.463
2227	CA	ASP	333	51.091	37.416	35.509
2228	C	ASP	333	49.579	37.656	35.511
2229	O	ASP	333	48.980	37.775	36.589
2230	CB	ASP	333	51.436	36.001	35.986
2231	CG	ASP	333	50.946	34.875	35.071
2232	OD1	ASP	333	49.736	34.759	34.930
2233	OD2	ASP	333	51.740	33.960	34.908
2234	N	THR	334	48.974	37.762	34.337
2235	CA	THR	334	47.524	38.003	34.296
2236	C	THR	334	46.772	37.069	33.351
2237	O	THR	334	46.945	37.091	32.126
2238	CB	THR	334	47.270	39.461	33.946
2239	OG1	THR	334	47.786	40.237	35.018
2240	CG2	THR	334	45.787	39.792	33.807
2241	N	LEU	335	45.857	36.322	33.943
2242	CA	LEU	335	45.046	35.359	33.193
2243	C	LEU	335	43.694	35.898	32.736
2244	O	LEU	335	43.311	37.055	32.973
2245	CB	LEU	335	44.760	34.140	34.058
2246	CG	LEU	335	45.708	32.992	33.764
2247	CD1	LEU	335	46.976	33.066	34.605
2248	CD2	LEU	335	44.987	31.678	34.006
2249	N	SER	336	43.030	35.041	31.981
2250	CA	SER	336	41.611	35.210	31.646
2251	C	SER	336	40.959	33.843	31.423
2252	O	SER	336	41.331	33.082	30.524
2253	CB	SER	336	41.451	36.094	30.426
2254	OG	SER	336	40.074	36.098	30.076
2255	N	THR	337	39.945	33.564	32.221
2256	CA	THR	337	39.324	32.229	32.211
2257	C	THR	337	38.092	32.163	31.306
2258	O	THR	337	38.256	32.606	30.168
2259	CB	THR	337	39.019	31.860	33.647
2260	OG1	THR	337	38.221	32.869	34.247
2261	CG2	THR	337	40.317	31.734	34.448
2262	N	ASN	338	37.115	31.318	31.659
2263	CA	ASN	338	35.758	31.223	31.029
2264	C	ASN	338	35.447	29.923	30.216
2265	O	ASN	338	36.310	29.422	29.489
2266	CB	ASN	338	35.429	32.567	30.339
2267	CG	ASN	338	35.222	32.539	28.834
2268	OD1	ASN	338	34.175	32.979	28.348
2269	ND2	ASN	338	36.335	32.428	28.147
2270	N	VAL	339	34.293	29.306	30.496
2271	CA	VAL	339	33.830	28.016	29.869
2272	C	VAL	339	32.394	27.981	29.239
2273	O	VAL	339	32.342	27.975	28.006
2274	CB	VAL	339	34.027	26.879	30.888
2275	CG1	VAL	339	33.427	25.546	30.471
2276	CG2	VAL	339	35.488	26.631	31.147
2211	N	ILE	340	31.292	27.863	29.995
2278	CA	ILE	340	29.891	27.802	29.432
2279	C	ILE	340	28.940	28.915	29.958
2280	O	ILE	340	28.817	29.065	31.178
2281	CB	ILE	340	29.261	26.448	29.800
2282	CG1	ILE	340	29.925	25.288	29.092
2283	CG2	ILE	340	27.760	26.374	29.538
2284	CD1	ILE	340	29.064	24.038	29.244
2285	N	PRO	341	28.241	29.622	29.068
2286	CA	PRO	341	27.704	30.972	29.367
2287	C	PRO	341	26.640	31.057	30.464
2288	O	PRO	341	25.919	30.081	30.718
2289	CB	PRO	341	27.135	31.465	28.068
2290	CG	PRO	341	27.377	30.433	26.980
2291	CD	PRO	341	28.169	29.312	27.635
2292	N	ASP	342	26.628	32.198	31.151
2293	CA	ASP	342	25.573	32.518	32.143
2294	C	ASP	342	25.679	33.931	32.760
2295	O	ASP	342	24.938	34.852	32.391
2296	CB	ASP	342	25.559	31.480	33.262
2297	CG	ASP	342	24.169	30.846	33.347
2298	OD1	ASP	342	23.341	31.204	32.520
2299	OD2	ASP	342	23.907	30.205	34.356
2300	N	ILE	343	26.568	34.051	33.739
2301	CA	ILE	343	26.687	35.227	34.638
2302	C	ILE	343	27.340	36.506	34.054
2303	O	ILE	343	26.680	37.302	33.377
2304	CB	ILE	343	27.504	34.776	35.851
2305	CG1	ILE	343	27.480	33.262	35.987
2306	CG2	ILE	343	26.964	35.377	37.143
2307	CD1	ILE	343	28.264	32.824	37.221
2308	N	LEU	344	28.595	36.739	34.424
2309	CA	LEU	344	29.280	38.041	34.204
2310	C	LEU	344	30.068	38.138	32.884
2311	O	LEU	344	31.298	38.014	32.887
2312	CB	LEU	344	30.215	38.250	35.392
2313	CG	LEU	344	29.436	38.219	36.703
2314	CD1	LEU	344	30.368	38.209	37.902
2315	CD2	LEU	344	28.449	39.374	36.789
2316	N	ILE	345	29.392	38.706	31.897
2317	CA	ILE	345	29.677	38.563	30.449
2318	C	ILE	345	30.736	39.477	29.759
2319	O	ILE	345	30.862	39.411	28.534
2320	CB	ILE	345	28.262	38.656	29.841
2321	CG1	ILE	345	27.428	37.493	30.369
2322	CG2	ILE	345	28.171	38.669	28.321
2323	CD1	ILE	345	26.077	37.385	29.672
2324	N	ILE	346	31.566	40.210	30.486
2325	CA	ILE	346	32.534	41.121	29.817
2326	C	ILE	346	33.451	40.391	28.800
2327	O	ILE	346	34.033	39.362	29.158
2328	CB	ILE	346	33.283	41.868	30.924
2329	CG1	ILE	346	32.596	43.205	31.181
2330	CG2	ILE	346	34.776	42.064	30.678
2331	CD1	ILE	346	33.420	44.078	32.115
2332	N	PRO	347	33.748	41.036	27.667
2333	CA	PRO	347	33.716	40.400	26.315
2334	C	PRO	347	34.750	39.329	25.902
2335	O	PRO	347	35.018	39.234	24.692
2336	CB	PRO	347	33.813	41.528	25.336
2337	CG	PRO	347	33.824	42.849	26.067
2338	CD	PRO	347	33.641	42.495	27.528
2339	N	VAL	348	35.471	38.714	26.821
2340	CA	VAL	348	36.213	37.501	26.471
2341	C	VAL	348	35.655	36.379	27.331
2342	O	VAL	348	35.410	35.266	26.846
2343	CB	VAL	348	37.732	37.642	26.635
2344	CG1	VAL	348	38.175	38.030	28.039
2345	CG2	VAL	348	38.453	36.374	26.191
2346	N	GLY	349	35.131	36.817	28.462
2347	CA	GLY	349	34.566	35.940	29.472
2348	C	GLY	349	33.051	36.085	29.445
2349	O	GLY	349	32.479	36.942	30.130
2350	N	ILE	350	32.434	35.283	28.600
2351	CA	ILE	350	30.972	35.260	28.450
2352	C	ILE	350	30.455	34.006	29.138
2353	O	ILE	350	29.295	33.893	29.564
2354	CB	ILE	350	30.648	35.120	26.966
2355	CG1	ILE	350	31.386	36.149	26.131
2356	CG2	ILE	350	29.144	35.246	26.711
2357	CD1	ILE	350	30.693	37.501	26.175
2358	N	SER	351	31.382	33.087	29.319
2359	CA	SER	351	31.005	31.754	29.748
2360	C	SER	351	31.749	31.291	31.013
2361	O	SER	351	32.887	31.690	31.237
2362	CB	SER	351	31.268	30.890	28.520
2363	OG	SER	351	32.655	30.813	28.253
2364	N	TYR	352	31.087	30.552	31.892
2365	CA	TYR	352	31.649	30.090	33.191
2366	C	TYR	352	31.005	28.742	33.523
2367	O	TYR	352	29.851	28.723	33.960
2368	CB	TYR	352	31.288	31.080	34.315
2369	CG	TYR	352	31.032	32.459	33.744
2370	CD1	TYR	352	32.078	33.352	33.547
2371	CD2	TYR	352	29.739	32.812	33.395
2372	CE1	TYR	352	31.846	34.558	32.907
2373	CE2	TYR	352	29.513	34.008	32.749
2374	CZ	TYR	352	30.564	34.848	32.468
2375	OH	TYR	352	30.378	35.775	31.494
2376	N	ASP	353	31.812	27.684	33.467
2377	CA	ASP	353	31.379	26.255	33.497
2378	C	ASP	353	29.997	25.963	34.089
2379	O	ASP	353	29.773	26.007	35.305
2380	CB	ASP	353	32.410	25.445	34.277
2381	CG	ASP	353	32.069	23.952	34.299
2382	OD1	ASP	353	32.592	23.270	33.428
2383	OD2	ASP	353	31.516	23.491	35.292
2384	N	ARG	354	29.067	25.740	33.178
2385	CA	ARG	354	27.738	25.264	33.540
2386	C	ARG	354	27.562	23.868	32.980
2387	O	ARG	354	28.456	23.326	32.321
2388	CB	ARG	354	26.650	26.172	32.957
2389	CG	ARG	354	26.477	27.447	33.767
2390	CD	ARG	354	26.231	27.096	35.232
2391	NE	ARG	354	25.797	28.261	36.020
2392	CZ	ARG	354	26.607	29.142	36.608
2393	NH1	ARG	354	27.931	29.041	36.480
2394	NH2	ARG	354	26.080	30.142	37.314
2395	N	ILE	355	26.443	23.271	33.328
2396	CA	ILE	355	26.087	21.959	32.805
2397	C	ILE	355	25.479	22.146	31.423
2398	O	ILE	355	24.722	23.100	31.211
2399	CB	ILE	355	25.038	21.417	33.760
2400	CG1	ILE	355	25.424	21.823	35.174
2401	CG2	ILE	355	24.935	19.899	33.658
2402	CD1	ILE	355	24.205	21.908	36.078
2403	N	ILE	356	25.900	21.337	30.467
2404	CA	ILE	356	25.246	21.356	29.158
2405	C	ILE	356	23.813	20.882	29.346
2406	O	ILE	356	23.566	19.683	29.545
2407	CB	ILE	356	26.011	20.479	28.166
2408	CG1	ILE	356	27.378	21.087	27.875
2409	CG2	ILE	356	25.239	20.288	26.864
2410	CD1	ILE	356	28.082	20.361	26.738
2411	N	GLU	357	22.899	21.791	29.026
2412	CA	GLU	357	21.472	21.686	29.375
2413	C	GLU	357	20.682	20.635	28.590
2414	O	GLU	357	19.497	20.425	28.871
2415	CB	GLU	357	20.849	23.058	29.124
2416	CG	GLU	357	19.661	23.328	30.045
2417	CD	GLU	357	20.160	23.540	31.472
2418	OE1	GLU	357	19.432	23.207	32.396
2419	OE2	GLU	357	21.242	24.093	31.612
2420	N	GLY	358	21.318	19.992	27.627
2421	CA	GLY	358	20.704	18.852	26.966
2422	C	GLY	358	20.674	17.684	27.945
2423	O	GLY	358	19.595	17.187	28.291
2424	N	HIS	359	21.839	17.328	28.468
2425	CA	HIS	359	21.922	16.152	29.339
2426	C	HIS	359	22.843	16.307	30.552
2427	O	HIS	359	22.357	16.329	31.688
2428	CB	HIS	359	22.382	14.946	28.524
2429	CG	HIS	359	21.332	14.320	27.624
2430	ND1	HIS	359	20.009	14.244	27.863
2431	CD2	HIS	359	21.558	13.717	26.410
2432	CE1	HIS	359	19.409	13.609	26.834
2433	NE2	HIS	359	20.366	13.286	25.937
2434	N	TYR	360	24.149	16.354	30.327
2435	CA	TYR	360	25.058	16.103	31.459
2436	C	TYR	360	26.442	16.769	31.438
2437	O	TYR	360	26.944	17.116	32.513
2438	CB	TYR	360	25.233	14.576	31.587
2439	CG	TYR	360	26.003	13.807	30.495
2440	CD1	TYR	360	25.562	13.783	29.175
2441	CD2	TYR	360	27.137	13.085	30.849
2442	CE1	TYR	360	26.271	13.085	28.207
2443	CE2	TYR	360	27.847	12.381	29.884
2444	CZ	TYR	360	27.418	12.392	28.563
2445	OH	TYR	360	28.207	11.834	27.581
2446	N	ASN	361	27.018	17.015	30.272
2447	CA	ASN	361	28.450	17.380	30.211
2448	C	ASN	361	28.832	18.675	30.920
2449	O	ASN	361	28.211	19.724	30.723
2450	CB	ASN	361	28.890	17.499	28.756
2451	CG	ASN	361	29.045	16.129	28.112
2452	OD1	ASN	361	28.894	15.098	28.774
2453	ND2	ASN	361	29.442	16.135	26.853
2454	N	GLY	362	29.921	18.603	31.669
2455	CA	GLY	362	30.552	19.803	32.244
2456	C	GLY	362	31.738	20.191	31.361
2457	O	GLY	362	32.905	20.134	31.760
2458	N	GLU	363	31.398	20.557	30.138
2459	CA	GLU	363	32.375	20.757	29.065
2460	C	GLU	363	32.555	22.252	28.804
2461	O	GLU	363	31.923	23.063	29.481
2462	CB	GLU	363	31.778	20.062	27.841
2463	CG	GLU	363	32.788	19.672	26.764
2464	CD	GLU	363	32.040	19.117	25.558
2465	OE1	GLU	363	30.979	18.540	25.769
2466	OE2	GLU	363	32.568	19.220	24.461
2467	N	GLN	364	33.528	22.606	27.984
2468	CA	GLN	364	33.644	23.986	27.501
2469	C	GLN	364	32.599	24.316	26.441
2470	O	GLN	364	32.059	23.427	25.769
2471	CB	GLN	364	35.004	24.167	26.863
2472	CG	GLN	364	35.205	23.106	25.791
2473	CD	GLN	364	36.191	23.619	24.761
2474	OE1	GLN	364	37.364	23.862	25.063
2475	NE2	GLN	364	35.663	23.878	23.579
2476	N	LEU	365	32.322	25.602	26.315
2477	CA	LEU	365	31.474	26.113	25.238
2478	C	LEU	365	32.274	27.126	24.422
2479	O	LEU	365	33.243	26.753	23.749
2480	CB	LEU	365	30.231	26.764	25.836
2481	CG	LEU	365	28.927	26.216	25.252
2482	CD1	LEU	365	28.731	26.633	23.798
2483	CD2	LEU	365	28.834	24.699	25.402
2484	N	LYS	366	31.851	28.383	24.458
2485	CA	LYS	366	32.510	29.433	23.662
2486	C	LYS	366	32.819	30.715	24.445
2487	O	LYS	366	31.960	31.319	25.098
2488	CB	LYS	366	31.634	29.784	22.460
2489	CG	LYS	366	31.467	28.607	21.502
2490	CD	LYS	366	30.711	29.003	20.239
2491	CE	LYS	366	31.507	30.006	19.409
2492	NZ	LYS	366	32.797	29.435	18.979
2493	N	PRO	367	34.093	31.068	24.402
2494	CA	PRO	367	34.580	32.417	24.731
2495	C	PRO	367	34.248	33.451	23.652
2496	O	PRO	367	33.815	33.104	22.547
2497	CB	PRO	367	36.067	32.257	24.808
2498	CG	PRO	367	36.457	30.914	24.214
2499	CD	PRO	367	35.154	30.239	23.836
2500	N	LYS	368	34.448	34.716	23.985
2501	CA	LYS	368	34.323	35.770	22.970
2502	C	LYS	368	35.692	36.388	22.669
2503	O	LYS	368	36.430	36.837	23.552
2504	CB	LYS	368	33.310	36.825	23.411
2505	CG	LYS	368	33.119	37.922	22.365
2506	CD	LYS	368	32.008	38.900	22.730
2507	CE	LYS	368	30.631	38.269	22.568
2508	NZ	LYS	368	29.572	39.245	22.873
2509	N	LYS	369	35.975	36.480	21.383
2510	CA	LYS	369	37.259	36.983	20.880
2511	C	LYS	369	37.453	38.506	20.922
2512	O	LYS	369	38.575	38.971	20.685
2513	CB	LYS	369	37.415	36.467	19.448
2514	CG	LYS	369	36.077	36.337	18.715
2515	CD	LYS	369	35.455	37.668	18.292
2516	CE	LYS	369	33.989	37.475	17.926
2517	NZ	LYS	369	33.350	38.759	17.597
2518	N	ASN	370	36.475	39.259	21.398
2519	CA	ASN	370	36.610	40.717	21.351
2520	C	ASN	370	37.579	41.229	22.401
2521	O	ASN	370	38.544	41.918	22.046
2522	CB	ASN	370	35.249	41.371	21.538
2523	CG	ASN	370	34.418	41.183	20.276
2524	OD1	ASN	370	33.284	40.695	20.325
2525	ND2	ASN	370	35.013	41.532	19.148
2526	N	GLU	371	37.501	40.693	23.606
2527	CA	GLU	371	38.449	41.146	24.625
2528	C	GLU	371	39.746	40.329	24.609
2529	O	GLU	371	40.742	40.761	25.201
2530	CB	GLU	371	37.783	41.147	25.992
2531	CG	GLU	371	38.644	41.793	27.074
2532	CD	GLU	371	37.898	41.735	28.398
2533	OE1	GLU	371	38.275	42.453	29.312
2534	OE2	GLU	371	36.911	41.008	28.445
2535	N	SER	372	39.818	39.298	23.781
2536	CA	SER	372	41.117	38.649	23.585
2537	C	SER	372	41.919	39.443	22.554
2538	O	SER	372	43.135	39.595	22.721
2539	CB	SER	372	40.949	37.197	23.145
2540	OG	SER	372	40.378	37.159	21.846
2541	N	LEU	373	41.209	40.192	21.721
2542	CA	LEU	373	41.851	41.140	20.809
2543	C	LEU	373	42.192	42.433	21.549
2544	O	LEU	373	43.239	43.033	21.281
2545	CB	LEU	373	40.884	41.438	19.670
2546	CG	LEU	373	41.517	42.319	18.599
2547	CD1	LEU	373	42.768	41.664	18.022
2548	CD2	LEU	373	40.517	42.636	17.492
2549	N	TRP	374	41.468	42.697	22.627
2550	CA	TRP	374	41.838	43.787	23.538
2551	C	TRP	374	43.106	43.469	24.317
2552	O	TRP	374	43.979	44.336	24.437
2553	CB	TRP	374	40.722	44.010	24.550
2554	CG	TRP	374	39.699	45.048	24.153
2555	CD1	TRP	374	38.468	44.836	23.573
2556	CD2	TRP	374	39.832	46.473	24.332
2557	NE1	TRP	374	37.868	46.039	23.392
2558	CE2	TRP	374	38.649	47.046	23.834
2559	CE3	TRP	374	40.832	47.276	24.860
2560	CZ2	TRP	374	38.483	48.421	23.870
2561	CZ3	TRP	374	40.657	48.654	24.894
2562	CH2	TRP	374	39.488	49.224	24.401
2563	N	SER	375	43.310	42.198	24.618
2564	CA	SER	375	44.523	41.773	25.315
2565	C	SER	375	45.718	41.684	24.372
2566	O	SER	375	46.854	41.915	24.802
2567	CB	SER	375	44.261	40.403	25.913
2568	OG	SER	375	43.161	40.507	26.806
2569	N	VAL	376	45.449	41.539	23.083
2570	CA	VAL	376	46.517	41.612	22.084
2571	C	VAL	376	46.914	43.064	21.844
2572	O	VAL	376	48.111	43.383	21.836
2573	CB	VAL	376	46.029	40.997	20.772
2574	CG1	VAL	376	47.027	41.228	19.642
2575	CG2	VAL	376	45.735	39.510	20.920
2576	N	ALA	377	45.930	43.946	21.909
2577	CA	ALA	377	46.185	45.375	21.747
2578	C	ALA	377	46.968	45.927	22.928
2579	O	ALA	377	48.074	46.437	22.715
2580	CB	ALA	377	44.852	46.105	21.625
2581	N	ARG	378	46.573	45.561	24.137
2582	CA	ARG	378	47.296	46.030	25.325
2583	C	ARG	378	48.675	45.382	25.440
2584	O	ARG	378	49.649	46.088	25.726
2585	CB	ARG	378	46.458	45.724	26.562
2586	CG	ARG	378	45.151	46.509	26.533
2587	CD	ARG	378	44.325	46.292	27.796
2588	NE	ARG	378	43.887	44.895	27.927
2589	CZ	ARG	378	42.599	44.554	28.016
2590	NH1	ARG	378	42.257	43.280	28.208
2591	NH2	ARG	378	41.654	45.495	27.967
2592	N	GLY	379	48.788	44.153	24.961
2593	CA	GLY	379	50.077	43.467	24.878
2594	C	GLY	379	51.089	44.221	24.021
2595	O	GLY	379	52.108	44.713	24.533
2596	N	VAL	380	50.705	44.479	22.783
2597	CA	VAL	380	51.616	45.123	21.836
2598	C	VAL	380	51.834	46.610	22.123
2599	O	VAL	380	52.982	47.061	22.047
2600	CB	VAL	380	51.029	44.954	20.439
2601	CG1	VAL	380	51.880	45.659	19.388
2602	CG2	VAL	380	50.870	43.479	20.092
2603	N	ILE	381	50.848	47.277	22.704
2604	CA	ILE	381	50.979	48.715	22.972
2605	C	ILE	381	51.798	49.017	24.230
2606	O	ILE	381	52.429	50.079	24.301
2607	CB	ILE	381	49.572	49.307	23.073
2608	CG1	ILE	381	48.865	49.221	21.725
2609	CG2	ILE	381	49.588	50.755	23.548
2610	CD1	ILE	381	47.449	49.779	21.808
2611	N	ARG	382	51.957	48.040	25.111
2612	CA	ARG	382	52.814	48.260	26.281
2613	C	ARG	382	54.254	47.805	26.027
2614	O	ARG	382	55.122	47.975	26.892
2615	CB	ARG	382	52.199	47.586	27.501
2616	CG	ARG	382	50.793	48.105	27.841
2617	CD	ARG	382	50.726	49.535	28.391
2618	NE	ARG	382	50.788	50.588	27.361
2619	CZ	ARG	382	50.319	51.827	27.528
2620	NH1	ARG	382	49.701	52.162	28.663
2621	NH2	ARG	382	50.441	52.722	26.546
2622	N	MET	383	54.479	47.251	24.842
2623	CA	MET	383	55.821	46.992	24.291
2624	C	MET	383	56.686	46.054	25.124
2625	O	MET	383	57.833	46.384	25.450
2626	CB	MET	383	56.549	48.325	24.133
2627	CG	MET	383	55.823	49.263	23.174
2628	SD	MET	383	55.715	48.702	21.460
2629	CE	MET	383	54.734	50.061	20.783
2630	N	LEU	384	56.153	44.889	25.446
2631	CA	LEU	384	56.952	43.862	26.128
2632	C	LEU	384	56.790	42.530	25.402
2633	O	LEU	384	56.053	42.450	24.413
2634	CB	LEU	384	56.518	43.731	27.585
2635	CG	LEU	384	56.818	44.959	28.434
2636	CD1	LEU	384	56.158	44.847	29.803
2637	CD2	LEU	384	58.323	45.172	28.579
2638	N	ARG	385	57.439	41.497	25.919
2639	CA	ARG	385	57.395	40.155	25.303
2640	C	ARG	385	55.948	39.636	25.235
2641	O	ARG	385	55.106	40.055	26.035
2642	CB	ARG	385	58.298	39.239	26.135
2643	CG	ARG	385	58.565	37.901	25.458
2644	CD	ARG	385	59.553	37.042	26.238
2645	NE	ARG	385	59.742	35.743	25.566
2646	CZ	ARG	385	60.675	35.507	24.640
2647	NH1	ARG	385	61.569	36.449	24.328
2648	NH2	ARG	385	60.751	34.304	24.067
2649	N	LYS	386	55.632	38.826	24.238
2650	CA	LYS	386	54.234	38.431	24.030
2651	C	LYS	386	54.043	36.916	23.928
2652	O	LYS	386	54.214	36.328	22.852
2653	CB	LYS	386	53.767	39.099	22.743
2654	CG	LYS	386	52.275	38.907	22.520
2655	CD	LYS	386	51.809	39.629	21.265
2656	CE	LYS	386	50.291	39.603	21.182
2657	NZ	LYS	386	49.720	40.212	22.393
2658	N	ASN	387	53.593	36.311	25.016
2659	CA	ASN	387	53.377	34.858	25.038
2660	C	ASN	387	52.008	34.452	25.601
2661	O	ASN	387	51.754	34.514	26.811
2662	CB	ASN	387	54.472	34.228	25.886
2663	CG	ASN	387	55.839	34.341	25.222
2664	OD1	ASN	387	56.488	35.395	25.259
2665	ND2	ASN	387	56.290	33.222	24.688
2666	N	TYR	388	51.139	34.016	24.704
2667	CA	TYR	388	49.817	33.491	25.091
2668	C	TYR	388	49.849	31.996	25.400
2669	O	TYR	388	50.301	31.197	24.573
2670	CB	TYR	388	48.847	33.696	23.936
2671	CG	TYR	388	48.044	34.990	23.946
2672	CD1	TYR	388	46.756	34.978	24.466
2673	CD2	TYR	388	48.574	36.163	23.424
2674	CE1	TYR	388	45.996	36.138	24.464
2675	CE2	TYR	388	47.816	37.326	23.426
2676	CZ	TYR	388	46.528	37.309	23.945
2677	OH	TYR	388	45.770	38.458	23.946
2678	N	GLY	389	49.251	31.620	26.516
2679	CA	GLY	389	49.164	30.203	26.902
2680	C	GLY	389	47.722	29.790	27.195
2681	O	GLY	389	46.789	30.579	27.016
2682	N	CYS	390	47.542	28.543	27.598
2683	CA	CYS	390	46.199	28.044	27.947
2684	C	CYS	390	46.158	27.324	29.290
2685	O	CYS	390	47.199	26.926	29.824
2686	CB	CYS	390	45.712	27.099	26.865
2687	SG	CYS	390	45.546	27.821	25.227
2688	N	VAL	391	44.951	27.073	29.765
2689	CA	VAL	391	44.759	26.452	31.082
2690	C	VAL	391	43.346	25.881	31.212
2691	O	VAL	391	42.348	26.541	30.892
2692	CB	VAL	391	45.015	27.493	32.178
2693	CG1	VAL	391	43.961	28.599	32.195
2694	CG2	VAL	391	45.126	26.860	33.561
2695	N	ARG	392	43.270	24.657	31.696
2696	CA	ARG	392	41.977	24.048	32.001
2697	C	ARG	392	41.734	24.009	33.513
2698	O	ARG	392	42.083	23.048	34.207
2699	CB	ARG	392	41.926	22.661	31.355
2700	CG	ARG	392	40.770	21.772	31.821
2701	CD	ARG	392	39.398	22.357	31.524
2702	NE	ARG	392	39.181	22.515	30.086
2703	CZ	ARG	392	37.970	22.691	29.557
2704	NH1	ARG	392	37.830	22.748	28.234
2705	NH2	ARG	392	36.893	22.744	30.345
2706	N	VAL	393	41.164	25.088	34.024
2707	CA	VAL	393	40.661	25.093	35.402
2708	C	VAL	393	39.277	24.448	35.391
2709	O	VAL	393	38.264	25.101	35.105
2710	CB	VAL	393	40.586	26.531	35.893
2711	CG1	VAL	393	40.188	26.587	37.361
2712	CG2	VAL	393	41.919	27.235	35.681
2713	N	ASP	394	39.250	23.181	35.771
2714	CA	ASP	394	38.084	22.305	35.551
2715	C	ASP	394	36.786	22.710	36.262
2716	O	ASP	394	36.706	23.706	36.998
2717	CB	ASP	394	38.476	20.891	35.956
2718	CG	ASP	394	38.163	19.917	34.819
2719	OD1	ASP	394	37.615	18.867	35.114
2720	OD2	ASP	394	38.236	20.346	33.676
2721	N	PHE	395	35.756	21.973	35.874
2722	CA	PHE	395	34.367	22.085	36.343
2723	C	PHE	395	34.105	22.336	37.827
2724	O	PHE	395	34.960	22.173	38.708
2725	CB	PHE	395	33.645	20.795	35.932
2726	CG	PHE	395	34.317	19.455	36.286
2727	CD1	PHE	395	34.294	18.426	35.351
2728	CD2	PHE	395	34.931	19.245	37.516
2729	CE1	PHE	395	34.887	17.201	35.643
2730	CE2	PHE	395	35.527	18.026	37.805
2731	CZ	PHE	395	35.505	17.002	36.871
2732	N	ALA	396	32.824	22.569	38.068
2733	CA	ALA	396	32.275	22.944	39.378
2734	C	ALA	396	32.007	21.819	40.380
2735	O	ALA	396	31.263	22.045	41.340
2736	CB	ALA	396	30.974	23.692	39.126
2737	N	GLN	397	32.625	20.661	40.225
2738	CA	GLN	397	32.353	19.546	41.156
2739	C	GLN	397	32.527	19.890	42.653
2740	O	GLN	397	31.505	19.805	43.350
2741	CB	GLN	397	33.166	18.319	40.762
2742	CG	GLN	397	32.457	17.488	39.695
2743	CD	GLN	397	31.213	16.822	40.284
2744	OE1	GLN	397	31.313	15.961	41.164
2745	NE2	GLN	397	30.059	17.195	39.756
2746	N	PRO	398	33.661	20.414	43.126
2747	CA	PRO	398	33.752	20.807	44.545
2748	C	PRO	398	32.978	22.067	44.969
2749	O	PRO	398	32.941	22.339	46.173
2750	CB	PRO	398	35.215	21.002	44.802
2751	CG	PRO	398	35.972	20.984	43.488
2752	CD	PRO	398	34.936	20.665	42.426
2753	N	PHE	399	32.305	22.749	44.050
2754	CA	PHE	399	31.604	24.017	44.331
2755	C	PHE	399	30.751	24.418	43.125
2756	O	PHE	399	31.224	25.143	42.239
2757	CB	PHE	399	32.611	25.123	44.641
2758	CG	PHE	399	32.922	25.317	46.121
2759	CD1	PHE	399	31.896	25.598	47.013
2760	CD2	PHE	399	34.232	25.221	46.576
2761	CE1	PHE	399	32.173	25.766	48.362
2762	CE2	PHE	399	34.509	25.388	47.928
2763	CZ	PHE	399	33.479	25.658	48.821
2764	N	SER	400	29.489	24.022	43.171
2765	CA	SER	400	28.552	24.131	42.039
2766	C	SER	400	27.208	24.764	42.400
2767	O	SER	400	26.904	25.059	43.561
2768	CB	SER	400	28.255	22.717	41.554
2769	OG	SER	400	27.664	22.008	42.638
2770	N	LEU	401	26.415	24.977	41.362
2771	CA	LEU	401	25.043	25.476	41.523
2772	C	LEU	401	24.003	24.465	41.038
2773	O	LEU	401	24.329	23.329	40.670
2774	CB	LEU	401	24.871	26.805	40.797
2775	CG	LEU	401	25.485	27.951	41.595
2776	CD1	LEU	401	25.357	29.270	40.843
2777	CD2	LEU	401	24.834	28.063	42.970
2778	N	LYS	402	22.760	24.918	41.018
2779	CA	LYS	402	21.601	24.049	40.759
2780	C	LYS	402	21.433	23.668	39.291
2781	O	LYS	402	22.224	22.875	38.762
2782	CB	LYS	402	20.346	24.763	41.246
2783	CG	LYS	402	20.462	25.100	42.728
2784	CD	LYS	402	20.605	23.840	43.579
2785	CE	LYS	402	21.015	24.187	45.004
2786	NZ	LYS	402	22.321	24.868	45.016
2787	N	TYR	403	20.455	24.283	38.639
2788	CA	TYR	403	20.014	23.873	37.289
2789	C	TYR	403	19.839	22.361	37.203
2790	O	TYR	403	19.141	21.765	38.034
2791	CB	TYR	403	21.010	24.336	36.231
2792	CG	TYR	403	21.015	25.839	35.980
2793	CD1	TYR	403	19.950	26.428	35.309
2794	CD2	TYR	403	22.077	26.617	36.422
2795	CE1	TYR	403	19.952	27.797	35.070
2796	CE2	TYR	403	22.079	27.985	36.184
2797	CZ	TYR	403	21.020	28.570	35.505
2798	OH	TYR	403	21.066	29.913	35.197
2799	N	LEU	404	20.608	21.734	36.326
2800	CA	LEU	404	20.505	20.280	36.151
2801	C	LEU	404	21.012	19.471	37.344
2802	O	LEU	404	20.419	18.418	37.590
2803	CB	LEU	404	21.276	19.841	34.910
2804	CG	LEU	404	20.582	20.261	33.621
2805	CD1	LEU	404	21.380	19.790	32.412
2806	CD2	LEU	404	19.164	19.703	33.563
2807	N	GLU	405	21.779	20.067	38.249
2808	CA	GLU	405	22.266	19.338	39.434
2809	C	GLU	405	21.203	19.214	40.528
2810	O	GLU	405	21.439	18.558	41.546
2811	CB	GLU	405	23.480	20.041	40.034
2812	CG	GLU	405	24.626	20.200	39.043
2813	CD	GLU	405	25.026	18.861	38.430
2814	OE1	GLU	405	24.554	18.593	37.332
2815	OE2	GLU	405	25.929	18.235	38.966
2816	N	SER	406	20.033	19.790	40.294
2817	CA	SER	406	18.906	19.628	41.207
2818	C	SER	406	18.105	18.353	40.901
2819	O	SER	406	17.160	18.032	41.635
2820	CB	SER	406	18.019	20.861	41.056
2821	OG	SER	406	16.955	20.779	41.993
2822	N	GLN	407	18.440	17.648	39.828
2823	CA	GLN	407	17.729	16.398	39.548
2824	C	GLN	407	18.570	15.373	38.781
2825	O	GLN	407	18.208	14.190	38.734
2826	CB	GLN	407	16.445	16.748	38.794
2827	CG	GLN	407	15.480	15.573	38.639
2828	CD	GLN	407	14.964	15.032	39.979
2829	OE1	GLN	407	14.723	13.827	40.105
2830	NE2	GLN	407	14.808	15.905	40.963
2831	N	SER	408	19.673	15.812	38.201
2832	CA	SER	408	20.573	14.883	37.510
2833	C	SER	408	21.249	13.974	38.522
2834	O	SER	408	21.789	14.428	39.538
2835	CB	SER	408	21.632	15.654	36.722
2836	OG	SER	408	22.431	16.402	37.632
2837	N	GLN	409	21.197	12.687	38.237
2838	CA	GLN	409	21.774	11.697	39.144
2839	C	GLN	409	23.235	11.459	38.792
2840	O	GLN	409	23.571	10.624	37.944
2841	CB	GLN	409	20.967	10.410	39.031
2842	CG	GLN	409	19.486	10.660	39.314
2843	CD	GLN	409	19.269	11.139	40.750
2844	OE1	GLN	409	19.801	10.554	41.700
2845	NE2	GLN	409	18.523	12.222	40.887
2846	N	LYS	410	24.082	12.267	39.403
2847	CA	LYS	410	25.521	12.187	39.160
2848	C	LYS	410	26.105	10.944	39.813
2849	O	LYS	410	25.555	10.436	40.795
2850	CB	LYS	410	26.176	13.450	39.711
2851	CG	LYS	410	25.747	14.664	38.897
2852	CD	LYS	410	26.137	14.483	37.434
2853	CE	LYS	410	25.632	15.624	36.562
2854	NZ	LYS	410	25.985	15.394	35.155
2855	N	PRO	411	27.112	10.383	39.163
2856	CA	PRO	411	27.884	9.280	39.742
2857	C	PRO	411	28.624	9.730	40.999
2858	O	PRO	411	27.994	10.159	41.974
2859	CB	PRO	411	28.834	8.857	38.664
2860	CG	PRO	411	28.708	9.805	37.480
2861	CD	PRO	411	27.629	10.805	37.858
2862	N	VAL	412	29.946	9.595	40.971
2863	CA	VAL	412	30.825	10.002	42.089
2864	C	VAL	412	30.561	9.134	43.338
2865	O	VAL	412	29.507	8.500	43.454
2866	CB	VAL	412	30.619	11.512	42.332
2867	CG1	VAL	412	31.517	12.105	43.417
2868	CG2	VAL	412	30.825	12.299	41.041
2869	N	SER	413	31.583	8.965	44.163
2870	CA	SER	413	31.442	8.223	45.427
2871	C	SER	413	30.239	8.716	46.229
2872	O	SER	413	29.855	9.889	46.130
2873	CB	SER	413	32.707	8.408	46.260
2874	OG	SER	413	33.794	7.821	45.556
2875	N	ALA	414	29.807	7.888	47.169
2876	CA	ALA	414	28.577	8.114	47.961
2877	C	ALA	414	28.646	9.204	49.043
2878	O	ALA	414	27.777	9.271	49.918
2879	CB	ALA	414	28.187	6.791	48.611
2880	N	LEU	415	29.677	10.031	48.986
2881	CA	LEU	415	29.866	11.137	49.924
2882	C	LEU	415	29.533	12.447	49.201
2883	O	LEU	415	29.783	13.542	49.722
2884	CB	LEU	415	31.314	11.179	50.430
2885	CG	LEU	415	31.807	9.950	51.212
2886	CD1	LEU	415	30.721	9.325	52.090
2887	CD2	LEU	415	32.464	8.891	50.328
2888	N	LEU	416	29.095	12.290	47.958
2889	CA	LEU	416	28.667	13.373	47.056
2890	C	LEU	416	27.739	14.404	47.705
2891	O	LEU	416	26.564	14.132	47.975
2892	CB	LEU	416	27.911	12.673	45.923
2893	CG	LEU	416	27.367	13.613	44.848
2894	CD1	LEU	416	28.495	14.213	44.021
2895	CD2	LEU	416	26.401	12.868	43.933
2896	N	SER	417	28.288	15.580	47.966
2897	CA	SER	417	27.478	16.714	48.418
2898	C	SER	417	26.938	17.444	47.195
2899	O	SER	417	27.666	17.632	46.214
2900	CB	SER	417	28.335	17.643	49.263
2901	OG	SER	417	28.779	16.925	50.406
2902	N	LEU	418	25.719	17.945	47.295
2903	CA	LEU	418	25.034	18.452	46.098
2904	C	LEU	418	25.534	19.814	45.632
2905	O	LEU	418	25.765	20.005	44.432
2906	CB	LEU	418	23.540	18.541	46.379
2907	CG	LEU	418	22.907	17.161	46.526
2908	CD1	LEU	418	21.439	17.285	46.915
2909	CD2	LEU	418	23.056	16.351	45.241
2910	N	GLU	419	25.816	20.710	46.561
2911	CA	GLU	419	26.287	22.032	46.146
2912	C	GLU	419	27.812	22.095	46.111
2913	O	GLU	419	28.390	22.996	45.495
2914	CB	GLU	419	25.734	23.063	47.124
2915	CG	GLU	419	25.980	24.495	46.657
2916	CD	GLU	419	25.404	25.474	47.672
2917	OE1	GLU	419	24.598	25.029	48.479
2918	OE2	GLU	419	25.864	26.607	47.710
2919	N	GLN	420	28.460	21.112	46.707
2920	CA	GLN	420	29.927	21.119	46.807
2921	C	GLN	420	30.494	19.731	47.093
2922	O	GLN	420	30.870	19.401	48.225
2923	CB	GLN	420	30.402	22.134	47.859
2924	CG	GLN	420	29.391	22.514	48.942
2925	CD	GLN	420	29.018	21.336	49.830
2926	OE1	GLN	420	27.907	20.797	49.722
2927	NE2	GLN	420	29.940	20.957	50.688
2928	N	ALA	421	30.635	18.956	46.037
2929	CA	ALA	421	31.118	17.584	46.175
2930	C	ALA	421	32.636	17.508	46.298
2931	O	ALA	421	33.372	18.024	45.453
2932	CB	ALA	421	30.662	16.801	44.953
2933	N	LEU	422	33.065	16.880	47.379
2934	CA	LEU	422	34.479	16.559	47.665
2935	C	LEU	422	35.195	15.812	46.527
2936	O	LEU	422	35.155	14.580	46.436
2937	CB	LEU	422	34.463	15.723	48.948
2938	CG	LEU	422	33.131	14.984	49.168
2939	CD1	LEU	422	32.982	13.711	48.330
2940	CD2	LEU	422	32.958	14.619	50.635
2941	N	LEU	423	35.934	16.559	45.725
2942	CA	LEU	423	36.509	16.005	44.487
2943	C	LEU	423	38.000	16.318	44.381
2944	O	LEU	423	38.489	17.266	45.001
2945	CB	LEU	423	35.767	16.612	43.288
2946	CG	LEU	423	34.671	15.734	42.660
2947	CD1	LEU	423	35.223	14.538	41.901
2948	CD2	LEU	423	33.578	15.284	43.619
2949	N	PRO	424	38.746	15.425	43.753
2950	CA	PRO	424	40.150	15.704	43.443
2951	C	PRO	424	40.300	16.894	42.503
2952	O	PRO	424	39.380	17.237	41.753
2953	CB	PRO	424	40.671	14.452	42.819
2954	CG	PRO	424	39.538	13.448	42.682
2955	CD	PRO	424	38.308	14.123	43.252
2956	N	ALA	425	41.422	17.578	42.632
2957	CA	ALA	425	41.699	18.712	41.748
2958	C	ALA	425	42.539	18.277	40.557
2959	O	ALA	425	43.262	17.277	40.621
2960	CB	ALA	425	42.433	19.803	42.513
2961	N	ILE	426	42.302	18.938	39.441
2962	CA	ILE	426	43.117	18.735	38.240
2963	C	ILE	426	43.442	20.078	37.598
2964	O	ILE	426	42.570	20.949	37.482
2965	CB	ILE	426	42.376	17.840	37.250
2966	CG1	ILE	426	40.913	18.235	37.104
2967	CG2	ILE	426	42.497	16.370	37.622
2968	CD1	ILE	426	40.187	17.269	36.176
2969	N	LEU	427	44.696	20.247	37.213
2970	CA	LEU	427	45.080	21.493	36.532
2971	C	LEU	427	46.038	21.266	35.356
2972	O	LEU	427	47.258	21.176	35.545
2973	CB	LEU	427	45.726	22.420	37.555
2974	CG	LEU	427	45.902	23.832	37.006
2975	CD1	LEU	427	44.562	24.408	36.563
2976	CD2	LEU	427	46.558	24.737	38.045
2977	N	PRO	428	45.469	21.021	34.184
2978	CA	PRO	428	46.214	21.075	32.921
2979	C	PRO	428	46.440	22.490	32.398
2980	O	PRO	428	45.688	23.425	32.699
2981	CB	PRO	428	45.345	20.355	31.945
2982	CG	PRO	428	43.953	20.228	32.539
2983	CD	PRO	428	44.046	20.785	33.947
2984	N	SER	429	47.472	22.617	31.584
2985	CA	SER	429	47.715	23.849	30.828
2986	C	SER	429	48.280	23.528	29.445
2987	O	SER	429	48.320	22.362	29.027
2988	CB	SER	429	48.668	24.763	31.582
2989	OG	SER	429	48.017	25.192	32.769
2990	N	ARG	430	48.521	24.585	28.694
2991	CA	ARG	430	49.112	24.490	27.351
2992	C	ARG	430	50.178	25.576	27.214
2993	O	ARG	430	49.912	26.739	27.550
2994	CB	ARG	430	47.970	24.643	26.335
2995	CG	ARG	430	48.358	24.637	24.852
2996	CD	ARG	430	48.642	26.041	24.320
2997	NE	ARG	430	49.097	26.015	22.919
2998	CZ	ARG	430	48.610	26.829	21.979
2999	NH1	ARG	430	49.108	26.791	20.741
3000	NH2	ARG	430	47.652	27.706	22.284
3001	N	PRO	431	51.298	25.213	26.600
3002	CA	PRO	431	52.500	26.056	26.569
3003	C	PRO	431	52.234	27.469	26.058
3004	O	PRO	431	51.315	27.718	25.267
3005	CB	PRO	431	53.470	25.318	25.698
3006	CG	PRO	431	52.895	23.964	25.325
3007	CD	PRO	431	51.534	23.899	25.990
3008	N	SER	432	53.028	28.397	26.563
3009	CA	SER	432	52.827	29.822	26.280
3010	C	SER	432	53.473	30.249	24.962
3011	O	SER	432	54.527	30.898	24.937
3012	CB	SER	432	53.419	30.611	27.440
3013	OG	SER	432	53.027	31.965	27.288
3014	N	ASP	433	52.778	29.951	23.876
3015	CA	ASP	433	53.273	30.224	22.525
3016	C	ASP	433	52.185	30.097	21.457
3017	O	ASP	433	52.478	29.625	20.351
3018	CB	ASP	433	54.410	29.256	22.202
3019	CG	ASP	433	54.011	27.811	22.493
3020	OD1	ASP	433	53.451	27.174	21.613
3021	OD2	ASP	433	54.369	27.341	23.567
3022	N	ALA	434	50.962	30.499	21.774
3023	CA	ALA	434	49.894	30.516	20.759
3024	C	ALA	434	50.296	31.382	19.567
3025	O	ALA	434	50.668	32.554	19.723
3026	CB	ALA	434	48.617	31.070	21.377
3027	N	ALA	435	50.192	30.806	18.381
3028	CA	ALA	435	50.684	31.475	17.170
3029	C	ALA	435	49.674	32.429	16.545
3030	O	ALA	435	49.182	32.191	15.434
3031	CB	ALA	435	51.094	30.424	16.146
3032	N	ASP	436	49.615	33.623	17.114
3033	CA	ASP	436	48.716	34.656	16.594
3034	C	ASP	436	49.278	35.270	15.321
3035	O	ASP	436	48.522	35.452	14.361
3036	CB	ASP	436	48.530	35.741	17.648
3037	CG	ASP	436	47.768	35.178	18.841
3038	OD1	ASP	436	46.974	34.272	18.622
3039	OD2	ASP	436	47.951	35.693	19.935
3040	N	GLU	437	50.593	35.207	15.186
3041	CA	GLU	437	51.255	35.702	13.973
3042	C	GLU	437	51.060	34.723	12.816
3043	O	GLU	437	50.776	35.165	11.698
3044	CB	GLU	437	52.759	35.892	14.209
3045	CG	GLU	437	53.138	37.112	15.059
3046	CD	GLU	437	52.999	36.855	16.559
3047	OE1	GLU	437	52.911	35.684	16.918
3048	OE2	GLU	437	52.730	37.808	17.273
3049	N	GLY	438	50.889	33.453	13.151
3050	CA	GLY	438	50.644	32.422	12.141
3051	C	GLY	438	49.223	32.564	11.616
3052	O	GLY	438	49.015	32.717	10.404
3053	N	ARG	439	48.301	32.777	12.540
3054	CA	ARG	439	46.898	32.961	12.175
3055	C	ARG	439	46.672	34.248	11.379
3056	O	ARG	439	46.085	34.179	10.291
3057	CB	ARG	439	46.087	33.017	13.463
3058	CG	ARG	439	44.581	32.973	13.218
3059	CD	ARG	439	44.035	31.551	13.103
3060	NE	ARG	439	44.410	30.860	11.859
3061	CZ	ARG	439	44.826	29.593	11.841
3062	NH1	ARG	439	44.858	28.887	12.973
3063	NH2	ARG	439	45.167	29.018	10.686
3064	N	ASP	440	47.411	35.292	11.726
3065	CA	ASP	440	47.321	36.589	11.035
3066	C	ASP	440	48.060	36.636	9.691
3067	O	ASP	440	47.974	37.647	8.984
3068	CB	ASP	440	47.935	37.662	11.935
3069	CG	ASP	440	47.185	37.804	13.259
3070	OD1	ASP	440	45.974	37.627	13.254
3071	OD2	ASP	440	47.816	38.223	14.223
3072	N	THR	441	48.797	35.592	9.351
3073	CA	THR	441	49.462	35.544	8.050
3074	C	THR	441	48.769	34.537	7.136
3075	O	THR	441	48.878	34.609	5.904
3076	CB	THR	441	50.920	35.157	8.284
3077	OG1	THR	441	51.483	36.136	9.146
3078	CG2	THR	441	51.739	35.140	6.997
3079	N	SER	442	47.990	33.658	7.742
3080	CA	SER	442	47.256	32.655	6.967
3081	C	SER	442	45.829	33.105	6.663
3082	O	SER	442	45.194	32.588	5.735
3083	CB	SER	442	47.228	31.345	7.749
3084	OG	SER	442	46.570	31.574	8.988
3085	N	ILE	443	45.333	34.052	7.439
3086	CA	ILE	443	44.006	34.619	7.184
3087	C	ILE	443	44.116	36.131	7.003
3088	O	ILE	443	44.537	36.851	7.916
3089	CB	ILE	443	43.091	34.273	8.360
3090	CG1	ILE	443	42.919	32.764	8.497
3091	CG2	ILE	443	41.723	34.915	8.187
3092	CD1	ILE	443	42.150	32.191	7.308
3093	N	ASN	444	43.691	36.602	5.840
3094	CA	ASN	444	43.769	38.035	5.508
3095	C	ASN	444	42.647	38.859	6.153
3096	O	ASN	444	42.742	40.089	6.243
3097	CB	ASN	444	43.707	38.187	3.983
3098	CG	ASN	444	42.307	37.900	3.428
3099	OD1	ASN	444	41.721	36.831	3.652
3100	ND2	ASN	444	41.766	38.896	2.751
3101	N	GLU	445	41.605	38.187	6.613
3102	CA	GLU	445	40.535	38.868	7.341
3103	C	GLU	445	40.882	38.909	8.823
3104	O	GLU	445	40.849	37.864	9.482
3105	CB	GLU	445	39.234	38.093	7.154
3106	CG	GLU	445	38.876	37.888	5.684
3107	CD	GLU	445	38.566	39.218	4.999
3108	OE1	GLU	445	38.998	39.385	3.865
3109	OE2	GLU	445	37.950	40.060	5.638
3110	N	SER	446	40.940	40.108	9.381
3111	CA	SER	446	41.341	40.266	10.790
3112	C	SER	446	40.257	39.828	11.776
3113	O	SER	446	40.585	39.270	12.829
3114	CB	SER	446	41.682	41.732	11.033
3115	OG	SER	446	42.788	42.065	10.206
3116	N	ARG	447	39.020	39.796	11.310
3117	CA	ARG	447	37.902	39.312	12.126
3118	C	ARG	447	37.925	37.784	12.242
3119	O	ARG	447	37.832	37.248	13.356
3120	CB	ARG	447	36.638	39.790	11.416
3121	CG	ARG	447	35.343	39.196	11.955
3122	CD	ARG	447	35.088	39.523	13.424
3123	NE	ARG	447	33.747	39.048	13.809
3124	CZ	ARG	447	33.462	37.785	14.138
3125	NH1	ARG	447	34.445	36.902	14.324
3126	NH2	ARG	447	32.203	37.442	14.417
3127	N	ASN	448	38.409	37.149	11.188
3128	CA	ASN	448	38.493	35.691	11.146
3129	C	ASN	448	39.771	35.254	11.859
3130	O	ASN	448	39.737	34.270	12.608
3131	CB	ASN	448	38.534	35.301	9.667
3132	CG	ASN	448	38.195	33.839	9.339
3133	OD1	ASN	448	37.638	33.581	8.266
3134	ND2	ASN	448	38.530	32.907	10.216
3135	N	ALA	449	40.793	36.091	11.818
3136	CA	ALA	449	42.043	35.771	12.507
3137	C	ALA	449	41.920	35.933	14.020
3138	O	ALA	449	42.354	35.036	14.753
3139	CB	ALA	449	43.136	36.688	11.972
3140	N	THR	450	41.094	36.871	14.455
3141	CA	THR	450	40.868	37.054	15.893
3142	C	THR	450	40.010	35.931	16.461
3143	O	THR	450	40.422	35.262	17.421
3144	CB	THR	450	40.154	38.386	16.101
3145	OG1	THR	450	41.031	39.425	15.687
3146	CG2	THR	450	39.813	38.617	17.567
3147	N	ASP	451	39.003	35.542	15.695
3148	CA	ASP	451	38.092	34.490	16.144
3149	C	ASP	451	38.754	33.118	16.110
3150	O	ASP	451	38.632	32.355	17.076
3151	CB	ASP	451	36.889	34.496	15.209
3152	CG	ASP	451	35.789	33.576	15.726
3153	OD1	ASP	451	35.020	33.098	14.904
3154	OD2	ASP	451	35.684	33.441	16.937
3155	N	GLU	452	39.646	32.912	15.159
3156	CA	GLU	452	40.287	31.608	15.041
3157	C	GLU	452	41.549	31.493	15.894
3158	O	GLU	452	41.901	30.370	16.266
3159	CB	GLU	452	40.570	31.348	13.571
3160	CG	GLU	452	40.808	29.869	13.293
3161	CD	GLU	452	40.864	29.658	11.785
3162	OE1	GLU	452	41.411	28.650	11.362
3163	OE2	GLU	452	40.314	30.497	11.083
3164	N	SER	453	42.074	32.604	16.390
3165	CA	SER	453	43.154	32.530	17.381
3166	C	SER	453	42.567	32.156	18.734
3167	O	SER	453	43.095	31.268	19.418
3168	CB	SER	453	43.857	33.879	17.498
3169	OG	SER	453	44.574	34.121	16.297
3170	N	LEU	454	41.340	32.604	18.947
3171	CA	LEU	454	40.592	32.216	20.139
3172	C	LEU	454	40.213	30.742	20.076
3173	O	LEU	454	40.446	30.013	21.047
3174	CB	LEU	454	39.314	33.036	20.189
3175	CG	LEU	454	38.473	32.642	21.393
3176	CD1	LEU	454	39.070	33.220	22.673
3177	CD2	LEU	454	37.033	33.099	21.212
3178	N	ARG	455	39.895	30.265	18.883
3179	CA	ARG	455	39.563	28.849	18.711
3180	C	ARG	455	40.782	27.923	18.719
3181	O	ARG	455	40.639	26.780	19.169
3182	CB	ARG	455	38.769	28.687	17.422
3183	CG	ARG	455	37.406	29.356	17.560
3184	CD	ARG	455	36.549	29.176	16.313
3185	NE	ARG	455	37.134	29.865	15.154
3186	CZ	ARG	455	36.468	30.048	14.012
3187	NH1	ARG	455	35.240	29.544	13.870
3188	NH2	ARG	455	37.040	30.705	13.000
3189	N	ARG	456	41.976	28.458	18.507
3190	CA	ARG	456	43.198	27.662	18.684
3191	C	ARG	456	43.380	27.316	20.152
3192	O	ARG	456	43.418	26.135	20.527
3193	CB	ARG	456	44.412	28.492	18.284
3194	CG	ARG	456	44.489	28.808	16.799
3195	CD	ARG	456	45.707	29.686	16.536
3196	NE	ARG	456	46.894	29.064	17.141
3197	CZ	ARG	456	47.863	28.476	16.436
3198	NH1	ARG	456	48.777	27.733	17.062
3199	NH2	ARG	456	47.814	28.484	15.101
3200	N	ARG	457	43.188	28.332	20.976
3201	CA	ARG	457	43.358	28.183	22.418
3202	C	ARG	457	42.166	27.490	23.076
3203	O	ARG	457	42.335	26.750	24.054
3204	CB	ARG	457	43.550	29.587	22.971
3205	CG	ARG	457	44.778	30.213	22.318
3206	CD	ARG	457	45.043	31.626	22.814
3207	NE	ARG	457	43.954	32.537	22.433
3208	CZ	ARG	457	44.170	33.686	21.791
3209	NH1	ARG	457	45.397	33.985	21.365
3210	NH2	ARG	457	43.151	34.500	21.511
3211	N	LEU	458	41.036	27.515	22.393
3212	CA	LEU	458	39.855	26.810	22.874
3213	C	LEU	458	39.967	25.310	22.606
3214	O	LEU	458	39.739	24.520	23.528
3215	CB	LEU	458	38.647	27.378	22.144
3216	CG	LEU	458	37.350	26.829	22.715
3217	CD1	LEU	458	37.215	27.197	24.190
3218	CD2	LEU	458	36.150	27.323	21.915
3219	N	ILE	459	40.585	24.938	21.496
3220	CA	ILE	459	40.777	23.515	21.198
3221	C	ILE	459	41.941	22.931	22.000
3222	O	ILE	459	41.878	21.764	22.414
3223	CB	ILE	459	41.018	23.366	19.697
3224	CG1	ILE	459	39.780	23.797	18.919
3225	CG2	ILE	459	41.394	21.934	19.332
3226	CD1	ILE	459	40.009	23.711	17.414
3227	N	ALA	460	42.834	23.801	22.446
3228	CA	ALA	460	43.911	23.373	23.339
3229	C	ALA	460	43.362	23.010	24.718
3230	O	ALA	460	43.569	21.873	25.168
3231	CB	ALA	460	44.916	24.510	23.459
3232	N	ASN	461	42.434	23.811	25.219
3233	CA	ASN	461	41.811	23.491	26.507
3234	C	ASN	461	40.780	22.376	26.401
3235	O	ASN	461	40.714	21.556	27.324
3236	CB	ASN	461	41.155	24.733	27.078
3237	CG	ASN	461	42.234	25.734	27.456
3238	OD1	ASN	461	43.282	25.368	27.995
3239	ND2	ASN	461	41.917	26.997	27.261
3240	N	LEU	462	40.230	22.165	25.216
3241	CA	LEU	462	39.332	21.027	24.976
3242	C	LEU	462	40.103	19.709	25.092
3243	O	LEU	462	39.663	18.806	25.818
3244	CB	LEU	462	38.782	21.184	23.556
3245	CG	LEU	462	37.449	20.478	23.286
3246	CD1	LEU	462	36.878	20.924	21.944
3247	CD2	LEU	462	37.533	18.956	23.327
3248	N	ALA	463	41.332	19.692	24.601
3249	CA	ALA	463	42.153	18.481	24.703
3250	C	ALA	463	42.692	18.270	26.119
3251	O	ALA	463	42.713	17.129	26.598
3252	CB	ALA	463	43.313	18.597	23.722
3253	N	GLU	464	42.839	19.358	26.860
3254	CA	GLU	464	43.258	19.274	28.265
3255	C	GLU	464	42.116	18.792	29.157
3256	O	GLU	464	42.345	17.998	30.081
3257	CB	GLU	464	43.671	20.668	28.719
3258	CG	GLU	464	44.853	21.203	27.924
3259	CD	GLU	464	45.064	22.677	28.251
3260	OE1	GLU	464	44.956	23.026	29.419
3261	OE2	GLU	464	45.322	23.430	27.321
3262	N	HIS	465	40.895	19.085	28.740
3263	CA	HIS	465	39.706	18.617	29.445
3264	C	HIS	465	39.537	17.124	29.256
3265	O	HIS	465	39.451	16.402	30.254
3266	CB	HIS	465	38.490	19.303	28.848
3267	CG	HIS	465	37.192	18.985	29.557
3268	ND1	HIS	465	36.967	19.037	30.883
3269	CD2	HIS	465	36.014	18.598	28.964
3270	CE1	HIS	465	35.689	18.686	31.131
3271	NE2	HIS	465	35.101	18.414	29.945
3272	N	ILE	466	39.772	16.657	28.040
3273	CA	ILE	466	39.664	15.223	27.763
3274	C	ILE	466	40.733	14.430	28.510
3275	O	ILE	466	40.384	13.490	29.236
3276	CB	ILE	466	39.827	15.003	26.263
3277	CG1	ILE	466	38.744	15.740	25.487
3278	CG2	ILE	466	39.796	13.516	25.926
3279	CD1	ILE	466	38.909	15.530	23.987
3280	N	LEU	467	41.934	14.984	28.577
3281	CA	LEU	467	43.037	14.314	29.274
3282	C	LEU	467	42.794	14.197	30.773
3283	O	LEU	467	42.766	13.082	31.313
3284	CB	LEU	467	44.317	15.121	29.084
3285	CG	LEU	467	45.273	14.506	28.068
3286	CD1	LEU	467	44.732	14.593	26.645
3287	CD2	LEU	467	46.631	15.192	28.155
3288	N	PHE	468	42.423	15.299	31.397
3289	CA	PHE	468	42.327	15.295	32.857
3290	C	PHE	468	40.982	14.819	33.383
3291	O	PHE	468	40.930	14.289	34.500
3292	CB	PHE	468	42.679	16.671	33.399
3293	CG	PHE	468	44.183	16.916	33.523
3294	CD1	PHE	468	44.743	17.113	34.777
3295	CD2	PHE	468	44.994	16.948	32.394
3296	CE1	PHE	468	46.104	17.341	34.904
3297	CE2	PHE	468	46.357	17.180	32.523
3298	CZ	PHE	468	46.912	17.374	33.779
3299	N	THR	469	39.973	14.779	32.533
3300	CA	THR	469	38.706	14.190	32.953
3301	C	THR	469	38.758	12.679	32.763
3302	O	THR	469	38.238	11.949	33.612
3303	CB	THR	469	37.570	14.808	32.150
3304	OG1	THR	469	37.566	16.203	32.429
3305	CG2	THR	469	36.213	14.245	32.556
3306	N	ALA	470	39.599	12.218	31.852
3307	CA	ALA	470	39.810	10.777	31.741
3308	C	ALA	470	40.680	10.302	32.898
3309	O	ALA	470	40.238	9.454	33.686
3310	CB	ALA	470	40.497	10.472	30.415
3311	N	SER	471	41.719	11.067	33.186
3312	CA	SER	471	42.636	10.676	34.257
3313	C	SER	471	42.017	10.754	35.653
3314	O	SER	471	42.154	9.784	36.410
3315	CB	SER	471	43.887	11.549	34.178
3316	OG	SER	471	43.534	12.911	34.367
3317	N	LYS	472	41.155	11.724	35.904
3318	CA	LYS	472	40.596	11.846	37.249
3319	C	LYS	472	39.229	11.182	37.401
3320	O	LYS	472	39.030	10.426	38.357
3321	CB	LYS	472	40.453	13.324	37.574
3322	CG	LYS	472	40.036	13.519	39.026
3323	CD	LYS	472	39.562	14.942	39.283
3324	CE	LYS	472	38.276	15.230	38.520
3325	NZ	LYS	472	37.210	14.300	38.923
3326	N	SER	473	38.376	11.301	36.396
3327	CA	SER	473	36.996	10.813	36.538
3328	C	SER	473	36.853	9.349	36.131
3329	O	SER	473	35.856	8.707	36.481
3330	CB	SER	473	36.070	11.663	35.676
3331	OG	SER	473	36.338	13.029	35.960
3332	N	CYS	474	37.829	8.830	35.403
3333	CA	CYS	474	37.880	7.385	35.160
3334	C	CYS	474	38.879	6.745	36.120
3335	O	CYS	474	38.976	5.514	36.203
3336	CB	CYS	474	38.285	7.118	33.715
3337	SG	CYS	474	37.230	7.881	32.461
3338	N	ALA	475	39.608	7.605	36.819
3339	CA	ALA	475	40.558	7.229	37.877
3340	C	ALA	475	41.717	6.368	37.389
3341	O	ALA	475	42.087	5.378	38.030
3342	CB	ALA	475	39.812	6.521	39.004
3343	N	ILE	476	42.320	6.781	36.286
3344	CA	ILE	476	43.500	6.082	35.763
3345	C	ILE	476	44.526	7.141	35.362
3346	O	ILE	476	45.148	7.071	34.293
3347	CB	ILE	476	43.143	5.194	34.569
3348	CG1	ILE	476	41.675	4.782	34.558
3349	CG2	ILE	476	43.996	3.932	34.601
3350	CD1	ILE	476	41.353	3.888	33.366
3351	N	MET	477	44.778	8.016	36.326
3352	CA	MET	477	45.573	9.255	36.191
3353	C	MET	477	46.688	9.232	35.149
3354	O	MET	477	46.452	9.523	33.967
3355	CB	MET	477	46.188	9.550	37.553
3356	CG	MET	477	45.114	9.766	38.614
3357	SD	MET	477	45.735	9.981	40.298
3358	CE	MET	477	46.840	11.384	40.023
3359	N	SER	478	47.826	8.687	35.542
3360	CA	SER	478	49.032	8.731	34.702
3361	C	SER	478	49.063	7.738	33.534
3362	O	SER	478	50.069	7.698	32.820
3363	CB	SER	478	50.247	8.468	35.581
3364	OG	SER	478	50.187	7.112	35.999
3365	N	THR	479	47.999	6.986	33.293
3366	CA	THR	479	48.007	6.071	32.149
3367	C	THR	479	47.349	6.730	30.943
3368	O	THR	479	47.333	6.159	29.847
3369	CB	THR	479	47.245	4.801	32.488
3370	OG1	THR	479	45.857	5.088	32.406
3371	CG2	THR	479	47.586	4.289	33.883
3372	N	HIS	480	46.803	7.918	31.152
3373	CA	HIS	480	46.242	8.703	30.049
3374	C	HIS	480	47.222	9.742	29.501
3375	O	HIS	480	46.805	10.673	28.801
3376	CB	HIS	480	44.962	9.373	30.525
3377	CG	HIS	480	43.855	8.377	30.794
3378	ND1	HIS	480	43.312	7.529	29.902
3379	CD2	HIS	480	43.225	8.153	31.993
3380	CE1	HIS	480	42.350	6.802	30.505
3381	NE2	HIS	480	42.296	7.191	31.798
3382	N	ILE	481	48.490	9.614	29.862
3383	CA	ILE	481	49.513	10.544	29.376
3384	C	ILE	481	49.720	10.412	27.866
3385	O	ILE	481	49.856	9.313	27.317
3386	CB	ILE	481	50.822	10.266	30.110
3387	CGl	ILE	481	51.261	8.815	29.951
3388	CG2	ILE	481	50.694	10.613	31.585
3389	CD1	ILE	481	52.580	8.551	30.668
3390	N	VAL	482	49.641	11.546	27.195
3391	CA	VAL	482	49.888	11.576	25.748
3392	C	VAL	482	50.860	12.683	25.364
3393	O	VAL	482	51.601	13.215	26.200
3394	CB	VAL	482	48.568	11.757	25.002
3395	CG1	VAL	482	48.105	10.463	24.338
3396	CG2	VAL	482	47.487	12.333	25.907
3397	N	ALA	483	50.745	13.111	24.116
3398	CA	ALA	483	51.605	14.171	23.568
3399	C	ALA	483	51.174	15.575	23.999
3400	O	ALA	483	51.899	16.550	23.778
3401	CB	ALA	483	51.589	14.073	22.047
3402	N	CYS	484	50.055	15.645	24.706
3403	CA	CYS	484	49.587	16.885	25.327
3404	C	CYS	484	50.148	17.066	26.745
3405	O	CYS	484	49.580	17.850	27.515
3406	CB	CYS	484	48.064	16.870	25.365
3407	SG	CYS	484	47.249	16.719	23.760
3408	N	LEU	485	51.100	16.211	27.112
3409	CA	LEU	485	51.929	16.321	28.334
3410	C	LEU	485	51.460	15.409	29.465
3411	O	LEU	485	50.328	14.908	29.485
3412	CB	LEU	485	52.136	17.755	28.833
3413	CG	LEU	485	53.310	18.471	28.150
3414	CD1	LEU	485	54.545	17.576	28.118
3415	CD2	LEU	485	52.992	18.975	26.742
3416	N	LEU	486	52.413	15.138	30.345
3417	CA	LEU	486	52.248	14.211	31.477
3418	C	LEU	486	51.267	14.710	32.537
3419	O	LEU	486	51.049	15.918	32.700
3420	CB	LEU	486	53.609	14.005	32.129
3421	CG	LEU	486	54.645	13.476	31.143
3422	CD1	LEU	486	56.019	13.394	31.799
3423	CD2	LEU	486	54.243	12.117	30.579
3424	N	LEU	487	50.693	13.746	33.245
3425	CA	LEU	487	49.659	14.009	34.257
3426	C	LEU	487	50.071	13.376	35.588
3427	O	LEU	487	49.486	12.364	35.999
3428	CB	LEU	487	48.344	13.330	33.852
3429	CG	LEU	487	48.099	13.170	32.349
3430	CD1	LEU	487	46.918	12.242	32.106
3431	CD2	LEU	487	47.873	14.486	31.619
3432	N	TYR	488	51.014	13.988	36.280
3433	CA	TYR	488	51.542	13.387	37.513
3434	C	TYR	488	50.983	14.054	38.768
3435	O	TYR	488	49.821	14.474	38.780
3436	CB	TYR	488	53.071	13.382	37.497
3437	CG	TYR	488	53.796	14.644	37.025
3438	CD1	TYR	488	53.939	15.739	37.869
3439	CD2	TYR	488	54.329	14.681	35.742
3440	CE1	TYR	488	54.625	16.865	37.434
3441	CE2	TYR	488	55.016	15.805	35.307
3442	CZ	TYR	488	55.170	16.889	36.158
3443	OH	TYR	488	56.025	17.905	35.805
3444	N	ARG	489	51.737	13.992	39.854
3445	CA	ARG	489	51.283	14.582	41.119
3446	C	ARG	489	52.451	14.983	42.023
3447	O	ARG	489	53.073	14.144	42.687
3448	CB	ARG	489	50.396	13.560	41.822
3449	CG	ARG	489	49.934	14.015	43.202
3450	CD	ARG	489	49.088	12.923	43.841
3451	NE	ARG	489	49.726	11.614	43.618
3452	CZ	ARG	489	50.452	10.955	44.525
3453	NH1	ARG	489	50.550	11.417	45.772
3454	NH2	ARG	489	51.017	9.790	44.201
3455	N	HIS	490	52.740	16.273	42.030
3456	CA	HIS	490	53.763	16.827	42.925
3457	C	HIS	490	53.123	17.198	44.261
3458	O	HIS	490	52.571	18.293	44.417
3459	CB	HIS	490	54.361	18.066	42.257
3460	CG	HIS	490	55.385	18.826	43.082
3461	ND1	HIS	490	55.598	20.156	43.055
3462	CD2	HIS	490	56.271	18.298	43.992
3463	CE1	HIS	490	56.582	20.468	43.923
3464	NE2	HIS	490	56.996	19.319	44.503
3465	N	ARG	491	53.158	16.273	45.203
3466	CA	ARG	491	52.533	16.539	46.499
3467	C	ARG	491	53.278	17.575	47.322
3468	O	ARG	491	54.394	18.003	47.011
3469	CB	ARG	491	52.345	15.266	47.307
3470	CG	ARG	491	50.974	14.666	47.022
3471	CD	ARG	491	50.241	14.326	48.317
3472	NE	ARG	491	49.978	15.541	49.109
3473	CZ	ARG	491	50.405	15.716	50.363
3474	NH1	ARG	491	50.143	16.857	51.003
3475	NH2	ARG	491	51.111	14.760	50.969
3476	N	GLN	492	52.553	18.049	48.316
3477	CA	GLN	492	53.009	19.140	49.167
3478	C	GLN	492	53.777	18.556	50.349
3479	O	GLN	492	54.245	17.414	50.281
3480	CB	GLN	492	51.762	19.889	49.625
3481	CG	GLN	492	50.742	20.030	48.488
3482	CD	GLN	492	51.187	21.018	47.405
3483	OE1	GLN	492	51.471	22.179	47.708
3484	NE2	GLN	492	51.281	20.548	46.172
3485	N	ILE	493	53.928	19.339	51.404
3486	CA	ILE	493	54.650	18.862	52.592
3487	C	ILE	493	55.051	20.034	53.488
3488	O	ILE	493	56.102	19.942	54.108
3489	CB	ILE	493	53.772	17.862	53.350
3490	CG1	ILE	493	52.480	18.497	53.851
3491	CG2	ILE	493	54.536	17.219	54.503
3492	CD1	ILE	493	51.616	17.480	54.589
3493	OXT	ILE	493	54.351	21.036	53.461

[1367]

Claims

1. An isolated nucleic acid molecule comprising a polynucleotide having a nucleotide sequence selected from the group consisting of: (a) a polynucleotide fragment of SEQ ID NO: 1 which is hybridizable to SEQ ID NO: 1; (b) a polynucleotide encoding a polypeptide fragment of SEQ ID NO: 2 which is hybridizable to SEQ ID NO: 1; (c) a polynucleotide encoding a polypeptide domain of SEQ ID NO: 2 which is hybridizable to SEQ ID NO: 1; (d) a polynucleotide encoding a polypeptide epitope of SEQ ID NO: 2 which is hybridizable to SEQ ID NO: 1; (e) a polynucleotide encoding a polypeptide of SEQ ID NO: 2 which is hybridizable to SEQ ID NO: 1, having acetyltransferase activity; (f) an isolated polynucleotide comprising nucleotides 4 to 2478 of SEQ ID NO: 1, wherein said nucleotides encode a polypeptide corresponding to amino acids 2 to 826 of SEQ ID NO: 2 minus the start codon; (g) an isolated polynucleotide comprising nucleotides 1 to 2478 of SEQ ID NO: 1, wherein said nucleotides encode a polypeptide corresponding to amino acids 1 to 826 of SEQ ID NO: 2 including the start codon; (h) a polynucleotide which represents the complimentary sequence (antisense) of SEQ ID NO: 1; (i) a polynucleotide fragment of SEQ ID NO: 3 which is hybridizable to SEQ ID NO: 3; (j) a polynucleotide encoding a polypeptide fragment of SEQ ID NO: 4 which is hybridizable to SEQ ID NO: 3; (k) a polynucleotide encoding a polypeptide domain of SEQ ID NO: 4 which is hybridizable to SEQ ID NO: 3; (l) a polynucleotide encoding a polypeptide epitope of SEQ ID NO: 4 which is hybridizable to SEQ ID NO: 3; (m) a polynucleotide encoding a polypeptide of SEQ ID NO: 4 which is hybridizable to SEQ ID NO: 3, having acetyltransferase activity; (n) an isolated polynucleotide comprising nucleotides 4 to 1629 of SEQ ID NO: 3, wherein said nucleotides encode a polypeptide corresponding to amino acids 2 to 542 of SEQ ID NO: 4 minus the start codon; (o) an isolated polynucleotide comprising nucleotides 1 to 1629 of SEQ ID NO: 3, wherein said nucleotides encode a polypeptide corresponding to amino acids 1 to 542 of SEQ ID NO: 4 including the start codon; (p) a polynucleotide which represents the complimentary sequence (antisense) of SEQ ID NO: 3; (q) a polynucleotide fragment of SEQ ID NO: 7 which is hybridizable to SEQ ID NO: 7; (r) a polynucleotide encoding a polypeptide fragment of SEQ ID NO: 8 which is hybridizable to SEQ ID NO: 7; (s) a polynucleotide encoding a polypeptide domain of SEQ ID NO: 8 which is hybridizable to SEQ ID NO: 7; (t) a polynucleotide encoding a polypeptide epitope of SEQ ID NO: 8 which is hybridizable to SEQ ID NO: 7; (u) a polynucleotide encoding a polypeptide of SEQ ID NO: 8 which is hybridizable to SEQ ID NO: 7, having acetyltransferase activity; (v) an isolated polynucleotide comprising nucleotides 111 to 1739 of SEQ ID NO: 7, wherein said nucleotides encode a polypeptide corresponding to amino acids 2 to 544 of SEQ ID NO: 8 minus the start codon; (w) an isolated polynucleotide comprising nucleotides 108 to 1739 of SEQ ID NO: 7, wherein said nucleotides encode a polypeptide corresponding to amino acids 1 to 544 of SEQ ID NO: 8 including the start codon; (x) a polynucleotide which represents the complimentary sequence (antisense) of SEQ ID NO: 7; (y) a polynucleotide fragment of SEQ ID NO: 202 or a polynucleotide fragment of the cDNA sequence included in ATCC Deposit No: PTA-4803, which is hybridizable to SEQ ID NO: 202; (z) a polynucleotide encoding a polypeptide fragment of SEQ ID NO: 203 or a polypeptide fragment encoded by the cDNA sequence included in ATCC Deposit No: PTA-4803, which is hybridizable to SEQ ID NO: 202; (aa) a polynucleotide encoding a polypeptide domain of SEQ ID NO: 203 or a polypeptide domain encoded by the cDNA sequence included in ATCC Deposit No: PTA-4803, which is hybridizable to SEQ ID NO: 202; (bb) a polynucleotide encoding a polypeptide epitope of SEQ ID NO: 203 or a polypeptide epitope encoded by the cDNA sequence included in ATCC Deposit No: PTA-4803, which is hybridizable to SEQ ID NO: 202; (cc) a polynucleotide encoding a polypeptide of SEQ ID NO: 203 or the cDNA sequence included in ATCC Deposit No: PTA-4803, which is hybridizable to SEQ ID NO: 202, having acetyltransferase activity; (dd) an isolated polynucleotide comprising nucleotides 149 to 1696 of SEQ ID NO: 202, wherein said nucleotides encode a polypeptide corresponding to amino acids 2 to 517 of SEQ ID NO: 203 minus the start codon; (ee) an isolated polynucleotide comprising nucleotides 146 to 1696 of SEQ ID NO: 202, wherein said nucleotides encode a polypeptide corresponding to amino acids 1 to 517 of SEQ ID NO: 203 including the start codon; (ff) a polynucleotide which represents the complimentary sequence (antisense) of SEQ ID NO: 202; and (gg) a polynucleotide capable of hybridizing under stringent conditions to any one of the polynucleotides specified in (a)-(ff), wherein said polynucleotide does not hybridize under stringent conditions to a nucleic acid molecule having a nucleotide sequence of only A residues or of only T residues.

2. The isolated nucleic acid molecule of claim 1, wherein the polynucleotide fragment consists of a nucleotide sequence encoding a glycerol-3-phosphate acyltransferase.

3. A recombinant vector comprising the isolated nucleic acid molecule of claim 1.

4. A recombinant host cell comprising the vector sequences of claim 3.

5. An isolated polypeptide comprising an amino acid sequence selected from the group consisting of: (a) a polypeptide fragment of SEQ ID NO: 2; (b) a polypeptide fragment of SEQ ID NO: 2 having acetyltransferase activity; (c) a polypeptide domain of SEQ ID NO: 2; (d) a polypeptide epitope of SEQ ID NO: 2; (e) a full length protein of SEQ ID NO: 2; (f) a polypeptide comprising amino acids 2 to 826 of SEQ ID NO: 2, wherein said amino acids 2 to 826 comprising a polypeptide of SEQ ID NO: 2 minus the start methionine; (g) a polypeptide comprising amino acids 1 to 826 of SEQ ID NO: 2; (h) a polypeptide fragment of SEQ ID NO: 4; (i) a polypeptide fragment of SEQ ID NO: 4 having acetyltransferase activity; a polypeptide domain of SEQ ID NO: 4; (k) a polypeptide epitope of SEQ ID NO: 4; (l) a full length protein of SEQ ID NO: 4; (m) a polypeptide comprising amino acids 2 to 542 of SEQ ID NO: 4, wherein said amino acids 2 to 542 comprising a polypeptide of SEQ ID NO: 4 minus the start methionine; (n) a polypeptide comprising amino acids 1 to 542 of SEQ ID NO: 4; (o) a polypeptide fragment of SEQ ID NO: 8; (p) a polypeptide fragment of SEQ ID NO: 8 having acetyltransferase activity; (q) a polypeptide domain of SEQ ID NO: 8; (r) a polypeptide epitope of SEQ ID NO: 8; (s) a full length protein of SEQ ID NO: 8; (t) a polypeptide comprising amino acids 2 to 544 of SEQ ID NO: 8, wherein said amino acids 2 to 544 comprising a polypeptide of SEQ ID NO: 8 minus the start methionine; (u) a polypeptide comprising amino acids 1 to 544 of SEQ ID NO: 8; (v) a polypeptide fragment of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803; (w) a polypeptide fragment of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803, having acetyltransferase activity; (x) a polypeptide domain of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803; (y) a polypeptide epitope of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803; (z) a full length protein of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803; (aa) a polypeptide comprising amino acids 2 to 517 of SEQ ID NO: 203, wherein said amino acids 2 to 517 comprising a polypeptide of SEQ ID NO: 203 minus the start methionine; and (bb) a polypeptide comprising amino acids 1 to 517 of SEQ ID NO: 203.

6. The isolated polypeptide of claim 5, wherein the full length protein comprises sequential amino acid deletions from either the C-terminus or the N-terminus.

7. An isolated antibody that binds specifically to the isolated polypeptide of claim 5.

8. A recombinant host cell that expresses the isolated polypeptide of claim 5.

9. A method of making an isolated polypeptide comprising: (a) culturing the recombinant host cell of claim 8 under conditions such that said polypeptide is expressed; and (b) recovering said polypeptide.

10. The polypeptide produced by claim 9.

11. A method for preventing, treating, or ameliorating a medical condition, comprising the step of administering to a mammalian subject a therapeutically effective amount of the polypeptide of claim 5, or a modulator thereof.

12. A method of diagnosing a pathological condition or a susceptibility to a pathological condition in a subject comprising: (a) determining the presence or absence of a mutation in the polynucleotide of claim 1; and (b) diagnosing a pathological condition or a susceptibility to a pathological condition based on the presence or absence of said mutation.

13. A method of diagnosing a pathological condition or a susceptibility to a pathological condition in a subject comprising: (a) determining the presence or amount of expression of the polypeptide of claim 5 in a biological sample; and (b) diagnosing a pathological condition or a susceptibility to a pathological condition based on the presence or amount of expression of the polypeptide.

14. An isolated nucleic acid molecule consisting of a polynucleotide having a nucleotide sequence selected from the group consisting of: (a) a polynucleotide encoding a polypeptide of SEQ ID NO: 4; (b) an isolated polynucleotide consisting of nucleotides 4 to 1629 of SEQ ID NO: 3, wherein said nucleotides encode a polypeptide corresponding to amino acids 2 to 542 of SEQ ID NO: 4 minus the start codon; (c) an isolated polynucleotide consisting of nucleotides 1 to 1629 of SEQ ID NO: 3, wherein said nucleotides encode a polypeptide corresponding to amino acids 1 to 542 of SEQ ID NO: 4 including the start codon; (d) a polynucleotide which represents the complimentary sequence (antisense) of SEQ ID NO: 3; (e) a polynucleotide encoding a polypeptide of SEQ ID NO: 4; (f) an isolated polynucleotide consisting of nucleotides 4 to 1629 of SEQ ID NO: 3, wherein said nucleotides encode a polypeptide corresponding to amino acids 2 to 542 of SEQ ID NO: 4 minus the start codon; (g) an isolated polynucleotide consisting of nucleotides 1 to 1629 of SEQ ID NO: 3, wherein said nucleotides encode a polypeptide corresponding to amino acids 1 to 542 of SEQ ID NO: 4 including the start codon; (h) a polynucleotide which represents the complimentary sequence (antisense) of SEQ ID NO: 3; (i) a polynucleotide encoding a polypeptide of SEQ ID NO: 8; (j) an isolated polynucleotide consisting of nucleotides 111 to 1739 of SEQ ID NO: 7, wherein said nucleotides encode a polypeptide corresponding to amino acids 2 to 544 of SEQ ID NO: 8 minus the start codon; (k) an isolated polynucleotide consisting of nucleotides 108 to 1739 of SEQ ID NO: 7, wherein said nucleotides encode a polypeptide corresponding to amino acids 1 to 544 of SEQ ID NO: 8 including the start codon; (1) a polynucleotide which represents the complimentary sequence (antisense) of SEQ ID NO: 7; (m) a polynucleotide encoding a polypeptide of SEQ ID NO: 2; (n) an isolated polynucleotide consisting of nucleotides 149 to 1696 of SEQ ID NO: 202, wherein said nucleotides encode a polypeptide corresponding to amino acids 2 to 517of SEQ ID NO: 203 minus the start codon; (o) an isolated polynucleotide consisting of nucleotides 146 to 1696 of SEQ ID NO: 202, wherein said nucleotides encode a polypeptide corresponding to amino acids 1 to 517 of SEQ ID NO: 203 including the start codon; (p) a polynucleotide encoding the Microsomal GPAT_hlog3_v1 polypeptide encoded by the cDNA clone contained in ATCC Deposit No. PTA-4803; and (q) a polynucleotide which represents the complimentary sequence (antisense) of SEQ ID NO: 202.

15. The isolated nucleic acid molecule of claim 14, wherein the polynucleotide comprises a nucleotide sequence encoding a glycerol-3-phosphate acyltransferase.

16. A recombinant vector comprising the isolated nucleic acid molecule of claim 15.

17. A recombinant host cell comprising the recombinant vector of claim 16.

18. An isolated polypeptide consisting of an amino acid sequence selected from the group consisting of: (a) a polypeptide fragment of SEQ ID NO: 2; (b) a polypeptide fragment of SEQ ID NO: 2 having acetyltransferase activity; (c) a polypeptide domain of SEQ ID NO: 2; (d) a polypeptide epitope of SEQ ID NO: 2; (e) a full length protein of SEQ ID NO: 2; (f) a polypeptide comprising amino acids 2 to 826 of SEQ ID NO: 2, wherein said amino acids 2 to 826 comprising a polypeptide of SEQ ID NO: 2 minus the start methionine; (g) a polypeptide comprising amino acids 1 to 826 of SEQ ID NO: 2; (h) a polypeptide fragment of SEQ ID NO: 4; (i) a polypeptide fragment of SEQ ID NO: 4 having acetyltransferase activity; (j) a polypeptide domain of SEQ ID NO: 4; (k) a polypeptide epitope of SEQ ID NO: 4; (l) a full length protein of SEQ ID NO: 4; (m) a polypeptide comprising amino acids 2 to 542 of SEQ ID NO: 4, wherein said amino acids 2 to 542 comprising a polypeptide of SEQ ID NO: 4 minus the start methionine; (n) a polypeptide comprising amino acids 1 to 542 of SEQ ID NO: 4; (o) a polypeptide fragment of SEQ ID NO: 8; (p) a polypeptide fragment of SEQ ID NO: 8 having acetyltransferase activity; (q) a polypeptide domain of SEQ ID NO: 8; (r) a polypeptide epitope of SEQ ID NO: 8; (s) a full length protein of SEQ ID NO: 8; (t) a polypeptide comprising amino acids 2 to 544 of SEQ ID NO: 8, wherein said amino acids 2 to 544 comprising a polypeptide of SEQ ID NO: 8 minus the start methionine; (u) a polypeptide comprising amino acids 1 to 544 of SEQ ID NO: 8; (v) a polypeptide fragment of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803; (w) a polypeptide fragment of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803, having acetyltransferase activity; (x) a polypeptide domain of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803; (y) a polypeptide epitope of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803; (z) a full length protein of SEQ ID NO: 203 or the encoded sequence included in ATCC Deposit No: PTA-4803; (aa) a polypeptide comprising amino acids 2 to 517 of SEQ ID NO: 203, wherein said amino acids 2 to 517 comprising a polypeptide of SEQ ID NO: 203 minus the start methionine; and (bb) a polypeptide comprising amino acids 1 to 517 of SEQ ID NO: 203.

19. The method for preventing, treating, or ameliorating a medical condition of claim 11, wherein the medical condition is selected from the group consisting of obesity, type 2 diabetes, dyslipidemia, cardivascular disease, hypertension, hypercholesterolemia, cancer; an immune disorder; a hematopoietic disorder; an inflammatory disorder; a pulmonary disorder; a neural disorder; a metabolic disorder; a reproductive disorder; a mammary gland disorder; a disorder related to abnormal levels of triglyceride; a disorder related to abnormal levels of LPA; a disorder related to abnormal levels of PA; a disorder related to abnormal levels of DAG; and a disorder related to any of the foregoing wherein acyltransferase activity or expression is aberrant.

20. The method of diagnosing a pathological condition of claim 13 wherein the condition is a member of the group consisting of: wherein the medical condition is selected from the group consisting of obesity, type 2 diabetes, dyslipidemia, cardivascular disease, hypertension, hypercholesterolemia, cancer; an immune disorder; a hematopoietic disorder; an inflammatory disorder; a pulmonary disorder; a neural disorder; a metabolic disorder; a reproductive disorder; a mammary gland disorder; a disorder related to abnormal levels of triglyceride; a disorder related to abnormal levels of LPA; a disorder related to abnormal levels of PA; a disorder related to abnormal levels of DAG; and a disorder related to any of the foregoing wherein acyltransferase activity or expression is aberrant.