This application contains a sequence listing submitted in Computer Readable Form (CRF). The CFR file containing the sequence listing entitled “PA150-0055-ST25.txt”, which was created on Oct. 9, 2019, and is 30,870 bytes in size. The information in the sequence listing is incorporated herein by reference in its entirety.
The invention belongs to the field of biomedicine, and relates to a polypeptide and a composition thereof, in particular to a polypeptide and a composition thereof for treating diseases of metabolic system.
Diabetes is a comprehensive metabolic disease involving a disorder of the metabolism of carbohydrate, protein and fat, which is resulted from relative or absolute insufficiency of insulin secretion in vivo, the inability of insulin to play its normal physiological role in target cells, and/or excessive glucagon secretion, and characterized by long-term hyperglycemia in patients.
The main harm of diabetes is the complications. Long-term diabetes can damage multiple systems of the body, especially the cardiovascular system, leading to chronic progressive pathological changes in tissues including eyes, kidneys, nerves, heart, blood vessels, etc., causing functional defects and failures, such as cardiovascular and cerebrovascular atherosclerosis, retinal and renal microangiopathy, neuropathy and lower limb gangrene, etc. Diabetic retinopathy (DR) and diabetic nephropathy (DN) are common microvascular complications of diabetes.
According to the statistics from the World Health Organization, diabetes is a main cause of blindness, kidney failure, heart attack, stroke and lower limb amputation. At present, diabetes has become the third leading cause of death in the elderly besides heart disease and cancer.
Currently, the main anti-diabetic agents are insulin, oral hypoglycemic agents, incretin, etc. The existing agents have obvious drawbacks; for example, metformin easily leads to lacticacidemia, thiazolidinediones have side-effects such as hepatotoxicity and bone loss, etc., sulfonylureas when taken for long term causes hypoglycemia easily, DD-IV inhibitors when taken for long term induces cough easily, GLP-1 easily causes nausea and vomit in patients, and insulin has a series of problems such as incapable oral administration, inconvenient storage and use, hypoglycemic reaction in patients, and insulin resistance and lipatrophy when taken for long term.
At present, all kinds of hypoglycemic agents used in clinic have various defects, and cannot cure diabetes completely, and the patients need lifelong medication. Therefore, it is urgent to develop new, safe and effective hypoglycemic agents, especially convenient for oral administration, so as to meet the needs of increasing patients with diabetes worldwide.
Meanwhile, as diabetes is a metabolic disease involving a disorder of three major metabolic systems of carbohydrates, fats and proteins caused by absolute or relative insufficiency of insulin secretion, patients with diabetes are often accompanied with hyperlipidemia, characterized by relatively high levels of cholesterol, triglyceride and low-density lipoprotein, or a relatively low level of high-density lipoprotein.
Diabetes is closely associated with hyperlipidemia. On the one hand, when insulin is insufficient, the activity of lipase in diabetic patients is also reduced and blood lipids are elevated; moreover, besides glucose metabolic disorder, diabetes is also accompanied by disorders of fats, proteins, water and electrolytes, and thus free fatty acids are often released from adipose depots, thereby increasing the triglyceride and free fatty acid levels in the blood; furthermore, people with type 2 diabetes eat too much, which promotes the synthesis of lipids in the body and also increases the blood lipids. On the other hand, as obese individuals with hyperlipidemia have relatively decreased numbers of insulin receptors, they have insulin resistance, which in turn easily induces diabetes.
Hyperlipidemia is a secondary disease of diabetes, which can easily lead to cardiovascular and cerebrovascular complications. According to statistics, about 40% of diabetic patients have hyperlipidemia, and diabetes combined with hyperlipidemia is more likely to develop stroke, coronary heart disease, limb necrosis, fundus diseases, kidney diseases, neuropathy and the like. Therefore, it is necessary to develop new medicaments to lower both blood glucose and blood lipids in patients with diabetes.
The invention provides a polypeptide and a composition thereof, which have excellent hypoglycemic and hypolipidemic activities and are resistance to enzymatic hydrolysis by pepsin and trypsin at the same time, so that they can be administered either by injection or orally. The polypeptide and the composition thereof also have the activity of protecting and repairing the function of pancreatic β cells, without causing hypoglycemic reaction and insulin resistance in patients, have no toxic side-effects, are convenient and safe to be administered, have long-term storage stability, and are a new type of hypoglycemic and hypolipidemic agents.
The inventor of the invention has found that natural polypeptides composed of multiple amino acids extracted from leguminous plants and the polypeptides with similar structures have excellent hypoglycemic activities. Further studies have revealed that the polypeptides also have excellent hypolipidemic activity, and recent studies have further revealed that better hypoglycemic and hypolipidemic effects can be achieved when these polypeptides were used in combination with certain amino acids. Thus, the invention was completed.
According to one aspect of the invention, the invention relates to a method for lowering blood glucose and/or blood lipid level in a mammal, characterized in that a therapeutically effective amount of one polypeptide of the sequence as shown in the following general formula (I) or a mixture of two or more polypeptides of the sequences as shown in the following general formula (I) in any proportion is administered to the mammal:
X1SCNGVCSPFX2X3PPCGX4X5X6CRCIPX7GLX8X9GX10CRNPX11G (I)
wherein, X1-X11 is independently selected from the group consisting of A, C, D, E, F, G, H, I, K, L, M, N, P, Q, R, S, T, V, W, Y and Mox.
According to another aspect of the invention, the invention relates to a method for preventing and/or treating diabetes and/or hyperlipidemia in a mammal, characterized in that a therapeutically effective amount of one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion is administered to the mammal.
According to another aspect of the invention, the invention relates to a method for lowering blood glucose and/or blood lipid level in a mammal, characterized in that a therapeutically effective amount of one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion is administered to the mammal in combination with other hypoglycemic agents and/or hypolipidemic agents.
According to another aspect of the invention, the invention relates to a method for preventing and/or treating diabetes and/or hyperlipidemia in a mammal, characterized in that a therapeutically effective amount of one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion is administered to the mammal in combination with other hypoglycemic agents and/or hypolipidemic agents.
According to another aspect of the invention, the invention relates to the use of one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion in the manufacture of a medicament, food, health food or formula food for special medical purposes, for lowering blood glucose and/or blood lipid level in a mammal.
According to another aspect of the invention, the invention relates to the use of one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion in the manufacture of a medicament for preventing and/or treating diabetes and/or hyperlipidemia in a mammal.
According to another aspect of the invention, the invention relates to the use of one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion in the manufacture of a medicament, food, health food or formula food for special medical purposes, for lowering blood glucose and/or blood lipid level in a mammal in combination with other hypoglycemic agents and/or hypolipidemic agents.
According to another aspect of the invention, the invention relates to the use of one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion in the manufacture of a medicament for preventing and/or treating diabetes and/or hyperlipidemia in a mammal in combination with other hypoglycemic agents and/or hypolipidemic agents.
According to another aspect of the invention, the invention relates to an oral pharmaceutical composition or preparation, food, health food or formula food for special medical purposes, comprising one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion and pharmaceutically acceptable carriers.
According to another aspect of the invention, the invention relates to a pharmaceutical composition or preparation for intravenous, intramuscular or subcutaneous injection, comprising one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion and pharmaceutically acceptable carriers.
According to another aspect of the invention, the invention relates to a composition, comprising one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion and at least one amino acid.
According to one aspect of the invention, the invention relates to a method for lowering blood glucose and/or blood lipid level in a mammal, characterized in that a therapeutically effective amount of the above composition is administered to the mammal.
According to another aspect of the invention, the invention relates to a method for preventing and/or treating diabetes and/or hyperlipidemia in a mammal, characterized in that a therapeutically effective amount of the above composition is administered to the mammal.
According to one aspect of the invention, the invention relates to a method for lowering blood glucose and/or blood lipid level in a mammal, characterized in that a therapeutically effective amount of the above composition is administered to the mammal in combination with other hypoglycemic agents and/or hypolipidemic agents.
According to another aspect of the invention, the invention relates to a method for preventing and/or treating diabetes and/or hyperlipidemia in a mammal, characterized in that a therapeutically effective amount of the above composition is administered to the mammal in combination with other hypoglycemic agents and/or hypolipidemic agents.
According to another aspect of the invention, the invention relates to the use of the above composition in the manufacture of a medicament, food, health food or formula food for special medical purposes, for lowering blood glucose and/or blood lipid level in a mammal.
According to another aspect of the invention, the invention relates to the use of the above composition in the manufacture of a medicament for preventing and/or treating diabetes and/or hyperlipidemia in a mammal.
According to another aspect of the invention, the invention relates to the use of the above composition in the manufacture of a medicament, food, health food or formula food for special medical purposes, for lowering blood glucose and/or blood lipid level in a mammal in combination with other hypoglycemic agents and/or hypolipidemic agents.
According to another aspect of the invention, the invention relates to the use of the above composition in the manufacture of a medicament for preventing and/or treating diabetes and/or hyperlipidemia in a mammal in combination with other hypoglycemic agents and/or hypolipidemic agents.
Preferably, the mammal, such as a diabetic patient has a glycosylated hemoglobin value >7.0%, preferably >7.5% before the administration of the polypeptide or the composition thereof of the invention, and has glycosylated hemoglobin value <7.5%, preferably <7.0% after the administration of the polypeptide or the composition thereof of the invention.
According to another aspect of the invention, the invention relates to an oral pharmaceutical preparation, food, health food or formula food for special medical purposes, comprising the above composition and pharmaceutically acceptable carriers.
According to another aspect of the invention, the invention relates to a pharmaceutical composition or preparation for intravenous, intramuscular or subcutaneous injection, comprising the above composition and pharmaceutically acceptable carriers.
In a preferred embodiment, the polypeptide of the invention has the sequences as shown in general formula (I). Preferably, X1 is a hydrophobic amino acid, selected from the group consisting of A, L, V, I, P, F, M, W, and Mox; X2 is an acidic amino acid, selected from E, and D; X3 is a hydrophobic amino acid, selected from the group consisting of A, L, V, I, P, F, M, W, and Mox; X4 is a polar neutral amino acid except cysteine, selected from the group consisting of G, S, T, Y, N, and Q; X5 is a neutral amino acid except cysteine, selected from the group consisting of G, S, T, Y, N, Q, A, L, V, I, P, F, M, and W; X6 is a hydrophobic amino acid, selected from the group consisting of A, L, V, I, P, F, M, W, and Mox; X7 is a neutral amino acid except cysteine, selected from the group consisting of G, S, T, Y, N, Q, A, L, V, I, P, F, M, and W; X8 is a hydrophobic amino acid, selected from the group consisting of A, L, V, I, P, F, M, W, and Mox; X9 is a hydrophobic amino acid, selected from the group consisting of A, L, V, I, P, F, M, W, and Mox; X10 is selected from Y, K, and N; and X11 is a polar neutral amino acid except cysteine, selected from the group consisting of G, S, T, Y, N, and Q. More preferably, X1 is A, I or V; X2 is E or D; X3 is M, Mox or I; X4 is S or T; X5 is S or P; X6 is A or L; X7 is V, A or Y; X8 is V, F or L; X9 is V or I; X10 is Y, K or N; and X11 is S, T or Y. More preferably, X2X3 is one selected from the group consisting of DI, EI, DM, EM, DMox, and EMox; X4X5X6 is one selected from the group consisting of SPL, SPA, SSL, SSA, TPL, TPA, TSL and TSA; and X8X9 is one selected from the group consisting of VI, VV, FI, FV, LI, and LV. More preferably, the polypeptide of the invention is one having the following sequence or a mixture of two or more polypeptides having the following sequences in any proportion:
More preferably, the polypeptide of the invention is one having the above mentioned SEQ ID No.1-SEQ ID No.12 or a mixture of two or more polypeptides having the above mentioned SEQ ID No.1-SEQ ID No.12 in any proportion.
The polypeptide of the invention comprises six cysteines located at positions 3, 7, 15, 20, 22 and 32, respectively. The six cysteines form three pairs of disulfide bonds in the polypeptide chain, namely Cys3-Cys20, Cys7-Cys22 and Cys15-Cys32, and thus form “cystine knot motif”. In the motif, the Cys3-Cys20 and Cys7-Cys22 disulfide bonds form the backbone and the Cys15-Cys32 disulfide bond threads the backbone. The motif belongs to the inhibitor cystine knot (ICK) structure. The polypeptide of the invention further comprises 14 to 16 hydrophobic amino acids. Among them, the amino acids at positions 1, 6, 9, 10, 12, 13, 14, 19, 23, 24, 27, 28, 29 and 35 are all hydrophobic amino acids, and the positions of these hydrophobic amino acids in the amino acid sequences are highly consistent. Owing to the above structural characterization, the polypeptides of the invention are resistant to enzymatic hydrolysis by pepsin and trypsin and have excellent hypoglycemic and hypolipidemic activities, regardless of being administered orally or injected subcutaneously, intramuscularly or intravenously.
In a preferred embodiment, the polypeptide and the mixture thereof of the invention are derived from an extract of seeds of a leguminous plant or the by-product of the seeds after processing—bean meal. The leguminous plant includes, but is not limited to, soybean, faba bean, pea, red bean, mung bean, cowpea, green bean, lentil, etc., and is one of them or a mixture of two or more of them in any proportion; preferably, the leguminous plant is one selected from pea, soybean, and mung bean or a mixture of two or more selected from them in any proportion. Preferably, the extract includes the above-described polypeptides of SEQ ID No.1-SEQ ID No.12. Preferably, the total content of the 12 polypeptides is at least 5%, preferably at least 8%, more preferably at least 10%, more preferably at least 20%, more preferably at least 30%, more preferably at least 50%, more preferably at least 80%, further preferably at least 90%, further preferably at least 95%, further preferably at least 97%, and most preferably at least 98%. The inventor has found by research that the extract would have good hypoglycemic and hypolipidemic activities even of low purity, for example but not limited to a content of 10% for the 12 polypeptides.
According to the invention, the extract is an organic solvent extract. The organic solvent is one selected from the group consisting of n-butanol, isopropanol, ethanol, methanol, formic acid and acetic acid, or a mixture of two or more organic solvents selected from the group in any proportion; and prefereably the organic solvent is n-butanol. Preferably, the extraction method includes the following steps:
(1) pulverizing the seeds of a leguminous plant or the by-product of the seeds after processing—bean meal, adding an organic solvent, extracting at low or room temperature, centrifuging and filtering, and collecting the supernatant to give crude polypeptides;
(2) purifying the crude polypeptides by reversed-phase HPLC to yield the polypeptide extract. Preferably, before extraction with the organic solvent in step (1), the pulverized seeds of the leguminous plant or the by-product of the seeds after processing—bean meal are decolorized and degreased. More preferably, one organic solvent selected from the group consisting of chloroform, cyclohexane and petroleum ether or a mixture of two or more organic solvents selected from the group in any proportion is used for the decolorizing and degreasing; and most preferably, chloroform is used for the decolorizing and degreasing.
Preferably, the extraction temperature is 0-30° C., more preferably 10° C.
Preferably, the extraction time is 1-40 hours, more preferably 20-30 hours.
Preferably, in the invention, the amino acid is one selected from the group consisting of methionine, histidine and tyrosine, or a mixture of two or more selected from the group in any proportion. As those skilled in the art will understand, methionine, histidine and tyrosine can be in D-form, L-form or DL-form, preferably L-form.
Preferably, in the invention, the polypeptide and the amino acid are at a weight ration in the range of 100:1-1:100, more preferably 50:1-1:50, further preferably 50:1-1:2, most preferably 20:1-10:1.
In the invention, the composition comprising the polypeptide of the invention and the composition comprising the polypeptide of the invention and the amino acid can be a liquid composition or solid composition. Preferably, in the invention, the composition comprising the polypeptide of the invention and the composition comprising the polypeptide of the invention and the amino acid can further comprise recombinant human serum albumin and/or bovine serum albumin for improving the stability of the polypeptide of the invention, with the content of the recombinant human serum albumin and/or bovine serum albumin in the range of 0.5-50 mg/ml (in a liquid composition), more preferably 1-20 mg/ml, most preferably 5-10 mg/ml, or 0.5-50 mg/g (in a solid composition), more preferably 1-20 mg/g, most preferably 5-10 mg/g.
Preferably, in the invention, the composition comprising the polypeptide of the invention and the composition comprising the polypeptide of the invention and the amino acid can further comprise sodium chloride for increasing ionic strength and preventing the aggregation of polypeptide, with the content of sodium chloride in the range of 1-20 mg/ml (in a liquid composition), more preferably 5-15 mg/ml, most preferably 8-12 mg/ml, or 1-20 mg/g (in a solid composition), more preferably 5-15 mg/g, most preferably 8-12 mg/g.
Preferably, in the invention, the composition comprising the polypeptide of the invention and the composition comprising the polypeptide of the invention and the amino acid can further comprise ethylenediaminetetraacetic acid disodium salt for chelating metal ions and preventing the oxidation of the polypeptide, with the content of ethylenediaminetetraacetic acid disodium salt in the range of 0.05-0.1 mg/ml (in a liquid composition) or 0.05-0.2 mg/g (in a solid composition).
Preferably, in the invention, the composition comprising the polypeptide of the invention and the composition comprising the polypeptide of the invention and the amino acid can further comprise sodium acetate, acetic acid for adjusting pH and ionic strength and increasing the solubility of the polypeptide in water. The content of sodium acetate is in the range of 0.5-3 mg/ml (in a liquid composition), more preferably 1-2.5 mg/ml, most preferably 1.5-2 mg/ml.
Preferably, in the invention, the composition comprising the polypeptide of the invention and the composition comprising the polypeptide of the invention and the amino acid can further comprise one, two or more of glycerol, mannitol and sorbitol as excipients for improving the stability of the polypeptide, with the content thereof in the range of 0.5-100 mg/ml (in a liquid composition), more preferably 1-50 mg/ml, most preferably 8-15 mg/ml, or 0.5-100 mg/g (in a solid composition), more preferably 1-50 mg/g, most preferably 8-15 mg/g.
Preferably, when the composition comprising the polypeptide of the invention and the composition comprising the polypeptide of the invention and the amino acid are liquid compositions, the pH values are in the range of 3.5-6.5, more preferably 4-5, most preferably 4.5; preferably, when the composition comprising the polypeptide of the invention and the composition comprising the polypeptide of the invention and the amino acid are solid compositions, the pH values of the 5% solutions of the compositions are in the range of 3.5-6.5, more preferably 4-5, most preferably 4.5.
In a preferred embodiment, the composition comprising the polypeptide of the invention and the amino acid is a liquid composition, comprising:
(a) one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion;
(b) at least one amino acid, which is one selected from the group consisting of methionine, histidine and tyrosine or a mixture of two or more selected from the group in any proportion;
(c) sodium acetate;
(d) acetic acid;
(e) glycerol; and
(f) water for injection.
In a preferred embodiment, the composition comprising the polypeptide of the invention and the amino acid is a solid composition, comprising:
(a) one polypeptide of the sequence as shown in general formula (I) or a mixture of two or more polypeptides of the sequences as shown in general formula (I) in any proportion;
(b) at least one amino acid, which is one selected from the group consisting of methionine, histidine and tyrosine or a mixture of two or more selected from the group in any proportion;
(c) D-mannitol; and
(d) ethylenediaminetetraacetic acid disodium salt. Preferably, the composition further comprises sodium chloride.
In the invention, preferably, the mammal is a human being.
The polypeptide and the composition thereof of the invention can reduce the increased blood glucose and/or blood lipid level caused by various reasons. The increased blood glucose occurs in but not limited to type 1 and/or type 2 diabetes, preferably type 2 diabetes, and the increased blood lipid level occurs in but not limited to hyperlipidemia.
As those skilled in the art will understand, the polypeptide and the composition thereof of the invention can be made into pharmaceutical composition or preparation, food, health food or formula food for special medical purposes.
As those skilled in the art will understand, the therapeutically effective amount of the polypeptide or the composition thereof the invention can be determined by a limited number of routine experiments. The therapeutically effective amount of the polypeptide or the mixture thereof the invention may be, for example, 1-20 mg/(kg·d); and the therapeutically effective amount of the composition comprising the polypeptide of the invention and the amino acid may be, for example, 1-30 mg/(kg·d).
As those skilled in the art will understand, the polypeptide or the composition thereof of the invention can be used in combination with other hypoglycemic agents and/or hypolipidemic agents. For instance, other hypoglycemic agents include but are not limited to insulin and the derivatives thereof, such as long-acting insulin, oral hypoglycemic agents, incretin, etc., and any combination thereof. As those skilled in the art will understand, various oral hypoglycemic agents can be used in the invention, including but not limited to biguanides such as metformin, sulfonylurea secretion enhancers, thiazolidinediones such as glitazone, α-glucodidase inhibitors such as acarbose, etc., and any combination thereof. For example, other hypolipidemic agents include but are not limited to lovastatin, simvastatin, pravastatin, fenofibrate, gemfibrozil, bezafibrate, alginic sodium diester, etc. As those skilled in the art will understand, the polypeptide or the composition thereof of the invention and other hypoglycemic agents and/or hypolipidemic agents may be administered simultaneously as a single composition, or may be administered simultaneously in separate compositions, or may be administered sequentially in separate compositions. As those skilled in the art will understand, the sequence of the sequential administration does not affect the therapeutic effects of the polypeptide or the composition thereof of the invention and other hypoglycemic agents and/or hypolipidemic agents. The polypeptide or the composition thereof of the invention can be prepared into various dosage forms suitable for oral administration, intravenous injection, intramuscular injection or subcutaneous injection, including but not limited to tablets suitable for oral administration (including but not limited to various coated tablets, sustained-release or controlled-release tablets), lozenges, capsules (including soft capsules and hard capsules), granules, dispersible powders, aqueous or oily suspensions, emulsions, elixirs or syrups, etc.; injections suitable for intravenous injection, intramuscular injection or subcutaneous injection, powder for injection, etc.
When a pharmaceutical preparation is made from the polypeptide or the composition thereof of the invention, it can further comprise pharmaceutically acceptable carriers, including but not limited to various organic or inorganic drug carriers, such as excipients, lubricants, binders, disintegrants, water-soluble polymers, inorganic salts, solvents, dissolution auxiliary agents, suspensions, isotonic agents, buffers, preservatives, antioxidants, coloring agents, sweeteners, acidity regulators, foaming agents and flavoring agents, etc.
As those skilled in the art will understand, the polypeptide of the invention can be purchased commercially or obtained by various methods known in the art, including but not limited to extracting from a leguminous plant, chemical synthesis (e.g. solid phase synthesis), method for obtaining recombinant proteins by recombinant DNA technology, etc., preferably the method of extracting from a leguminous plant.
As those skilled in the art will understand, the composition, pharmaceutical preparation, food, health food or formula food for special medical purposes of the invention can be prepared by various methods known in the art. In a preferred embodiment, the polypeptide or the composition thereof, pharmaceutical preparation, food, health food or formula food for special medical purposes of the invention are stored under the protection of inert gas, preferably under nitrogen protection.
In the invention, according to the internationally accepted conventions for amino acid abbreviations, in the amino acid sequence, A represents alanine, C represents cysteine, D represents aspartic acid, E represents glutamic acid, F represents phenylalanine, G represents glycine, H represents histidine, I represents isoleucine, K represents lysine, L represents leucine, M represents methionine, N represents asparagine, P represents proline, Q represents glutamine, R represents arginine, S represents serine, T represents threonine, V represents valine, W represents tryptophan, and Y represents tyrosine. In the invention, Mox represents methionine sulfoxide.
The invention has the following advantages and beneficial effects compared with the prior art:
The polypeptide of the invention has excellent hypoglycemic and hypolipidemic activities, and when combined with an amino acid, it not only improves the stability, but also increases the hypoglycemic and hypolipidemic activities. The polypeptide of the invention and the composition thereof with an amino acid are resistant to enzymatic hydrolysis by pepsin and trypsinase, so that they can be administered orally, intravenously, intramuscularly or subcutaneously, making them rare agents that can lower blood glucose and blood lipid level by four administration modes. They have flexible administration modes, also have the activity of protecting and repairing the function of pancreatic β cells, do not cause hypoglycemic reaction and insulin resistance in patients, have no toxic side-effects, are convenient and safe to be administered, have long-term storage stability, can effectively prevent and treat type 2 diabetes and hyperlipidemia, reduce glycosylated hemoglobin (HbA1c) level in diabetic patients more effectively compared with the existing hypoglycemic agents, have additional cardiovascular benefits, and reduce complications of diabetes. In sum, they have obvious advantages, and can achieve effective control of blood glucose and glycosylated haemoglobin especially in those patients who cannot effectively control blood glucose level with metformin, sulfonylurea secretion enhancers, thiazolidinediones, α-glucodidase inhibitors, insulin or its derivatives, insulin or its derivatives or combinations, the polypeptide and the composition thereof.
Hereinafter, the invention is further described in detail with reference to the specific examples. It should be understood that the examples are not intended to limit the scope of the invention. In addition, it should be understood that after reading the contents of the invention, a person skilled in the art can make various changes and modifications to the invention, and these equivalents are also deemed to fall within the scope of the invention.
The polypeptides and the mixture thereof of the invention can be extracted from seeds of a leguminous plant or the by-product of the seeds after processing—bean meal. The specific extraction process was performed as follows:
10 kg of commercial pea meal was pulverized by a pulverizer, sieved to give particles with an average diameter of 100 mesh. The particles were then mixed with 50 L of chloroform, stirred for 1 hour, centrifuged and filtered. Subsequently, the filter cake was washed with chloroform, and dried to give the decolorized and degreased bean meal.
The above decolorized and degreased bean meal was mixed with 100 L of n-butanol, homogenized in a homogenizer for 30 minutes, connected to a freezer to control the working temperature at 10° C. Then the mixture was transferred to a jacket extraction tank, stirred at 10° C. for 24 hours, centrifuged and filtered to give the supernatant. The filter cake was washed with n-butanol, and the supernatant was collected and combined.
The supernatant was then concentrated 10-fold at 50° C. by vacuum distillation, and the concentrated solution was freeze dried to yield 95.6 g of crude polypeptides.
Purification and Identification of the Polypetides:
The above crude polypeptides were separated and purified by reversed-phase liquid chromatography. A appropriate amount of the crude polypeptides was dissolved in chromatographic solution A (water+0.1% trifluoroacetic acid), filtered through a 0.22 μm membrane filter, and the filtrate was loaded to the liquid chromatograph. Agilent 1260 high-performance liquid chromatography was used under the following conditions: C18 reversed-phase column (Wateres Corporation, 4.6×250 mm, 300SB, 5 μm), mobile phase: water (containing 0.1% trifluoroacetic acid)+acetonitrile (containing 0.1% trifluoroacetic acid), gradient elution with 15% to 50% acetonitrile, over 25 min, at a flow rate of 1 ml/min, detection at 214 nm. 13 peaks were arised from 16 to 25 min (see
The polypeptides of the invention can also be synthesized by the solid-phase polypeptide synthesis method. The specific process was performed as follows:
An ABI 433A polypeptide synthesizer from Applied Biosystems was used, a Fmoc/tBu method and a NMP solvent system was adopted, and HBTU/HOBt was utilized as condensing agents. The following protecting groups was used for protecting the amino acid side-chain respectively: tert-butyl (tBu) group for Ser, Thr and Tyr, tert-butyl ester group for Asp and Glu, triphenylmethyl (Trt) group for Asn, Gln and Cys, 2,2,4,6,7-pentamethyl-dihydrobenzofuran-5-sulfonyl (Pbf) group for Arg, and 2-chlorobenzyl-oxycarbonyl for Lys. The synthesis scale was 0.5 mmol. The amounts of amino acids with protective groups and condensation agents were 10 times excess. The program was automatically completed after setting. After the reaction was completed, the resin was washed three times with DCM and dried under vacuum. Then, a mixture of TFA/TIS/H2O/Phenol (the addition of phenol prevented the formation of disulfide bond via the oxidation of cysteine) was added to the polypeptide solid-phase reactor to react sufficiently with the resin for 2 hours. Subsequently, most of the solvent was removed with nitrogen, frozen methyl tert-butyl ether was added to allow precipitation, the supernatant was removed by centrifugation, and the precipitate was washed with frozen methyl tert-butyl ether and freeze dried to yield crude polypeptides in reduced form.
In 100 ml of 50% isopropanol solution, 10 mg of the crude reduced polypeptides, EDTA, Tris-HCl, GSH and GSSG at concentrations of 2 mM, 200 mM, 1 mM and 100 μM, respectively, were added, at pH 8.6, and reacted at 4° C. for 48 hours. The reaction was terminated by adding TFA to pH 4. Isopropanol was removed by vacuum concentration, and the concentrated solution was freeze dried to yield crude polypeptides. The crude products were dissolved in 60% methanol, separated and purified by semi-preparative HPLC, with a gradient elution of 30-45% acetonitrile, and then freeze dried to yield the product, about 60% yield, ≥98% HPLC purity.
The polypeptides with the following amino acid sequences were synthesized respectively by the solid-phase polypeptide synthesis method:
Polypeptide: the polypeptide with an amino acid sequence of SEQ ID No.7 in Example 1, with an average molecular weight of 3789, an amino acid sequence of ASCNGVCSPFEMPPCGTSACRCIPVGLFIGYCRNPSG (see
Kunming white mice: Hubei Epidemic Prevention Station, 40 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into four groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the blank control group were intravenously injected once with normal saline at a dose of 0.05 ml/10 g into the tail vein, mice in Group A (high-dose polypeptide hypoglycemic group) were intravenously injected once with 1 mg/mL polypeptide at a dose of 0.10 ml/10 g into the tail vein, mice in Group B (medium-dose polypeptide hypoglycemic group) were intravenously injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g into the tail vein, and mice in Group C (low-dose polypeptide hypoglycemic group) were intravenously injected once with 1 mg/mL polypeptide at a dose of 0.025 ml/10 g into the tail vein. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that 15 minutes after normal mice were tail vein injected with the polypeptide with an amino acid sequence of SEQ ID No.7 of the invention, the blood glucose level began to drop, and the hypoglycemic effect was in the following order: high-dose Group A>medium-dose Group B>low-dose Group C, showing an obvious dose-effect relationship. The results indicated that the polypeptide with an amino acid sequence of SEQ ID No.7 of the invention could lower blood glucose level of normal mice by intravenous injection, and thus demonstrated that the polypeptide had explicit hypoglycemic activity.
Polypeptide: the polypeptides with an amino acid sequences of SEQ ID No.2, 4, 5 and 6 in Example 1, totaling 4 polypeptides, HPLC purity of ≥98%, were prepared into 1 mg/mL solution with normal saline for use, respectively.
Kunming white mice: Hubei Epidemic Prevention Station, 50 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into five groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the blank control group were intravenously injected once with normal saline at a dose of 0.05 ml/10 g into the tail vein, mice in other groups were intravenously injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g into the tail vein, respectively. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptides in Example 1 shared a common property and all had significant hypoglycemic activity.
Polypeptide: the polypeptide with an amino acid sequence of SEQ ID No.8 in Example 1, with an average molecular weight of 3805, an amino acid sequence of ASCNGVCSPFEMoxPPCGTSACRCIPVGLFIGYCRNPSG (see
Kunming white mice: Hubei Epidemic Prevention Station, 50 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into four groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected blood glucose level by collecting tail vein blood. The mice in the blank control group were subcutaneously injected once with normal saline at a dose of 0.05 ml/10 g on the back, mice in Group A (high-dose polypeptide hypoglycemic group) were subcutaneously injected once with 1 mg/mL polypeptide at a dose of 0.10 ml/10 g on the back, mice in Group B (medium-dose polypeptide hypoglycemic group) were subcutaneously injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g on the back, and mice in Group C (low-dose polypeptide hypoglycemic group) were subcutaneously injected once with 1 mg/mL polypeptide at a dose of 0.025 ml/10 g on the back. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that 15 minutes after normal mice were subcutaneously injected with the polypeptide with an amino acid sequence of SEQ ID No.7 of the invention on the back, the blood glucose level began to drop, and the hypoglycemic effect was in the following order: high-dose Group A>medium-dose Group B>low-dose Group C, showing an obvious dose-effect relationship. The results indicated that the polypeptide with an amino acid sequence of SEQ ID No.8 of the invention could also lower blood glucose level of normal mice, and thus demonstrated that the polypeptide had explicit hypoglycemic activity. Moreover, as compared with the polypeptide with an amino acid sequence of SEQ ID No.7, the oxidation methionine of into methionine sulfoxide did not affect the hypoglycemic activity
Polypeptide: the polypeptide with an amino acid sequence of SEQ ID No.72 in Example 1, with an average molecular weight of 3736, an amino acid sequence of ASCNGVCSPFEMPPCGSSACRCIPVGLVVGYCRHPSG, HPLC purity of ≥98%, was prepared into 1 mg/mL solution with normal saline for use.
The polypeptide with an amino acid sequence of SEQ ID No.26 in Example 2, with an average molecular weight of 3716, an amino acid sequence of ASCNGVCSPFEMPPCGSSACRCIPVGLVVGYCRNPSG, HPLC purity of ≥98%, was prepared into 1 mg/mL solution with normal saline for use.
Kunming white mice: Hubei Epidemic Prevention Station, 30 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into three groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the blank control group were subcutaneously injected once with normal saline at a dose of 0.05 ml/10 g on the back, mice in Group A (polypeptide of SEQ ID No.72) were subcutaneously injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g on the back, and mice in Group B (polypeptide of SEQ ID No.26) were subcutaneously injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g on the back. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
The polypeptide with an amino acid sequence of ASCNGVCSPFEMPPCGSSACRCIPVGLVGYCRNPSG could lower blood glucose level of mice by subcutaneous injection and had hypoglycemic activity. However, the polypeptide with an amino aicd sequence of ASCNGVCSPFEMPPCGSSACRCIPVGLVGYCRHPSG raised blood glucose level of mice by subcutaneous injection, and had an opposite effect to the former. The two merely differed in the structure of the amino acid at position 34, with the former having a neutral amino acid-asparagine (Asn) and the latter having a basic amino acid-histidine (His). The possible reason for the different bioactivity between the two might be that the latter had strong hydrophilicity, which could be confirmed by the shortest retention time in the C18 reversed-phase chromatography. More particularly, the polypeptide of amino acid sequence of SEQ ID No.72 was assigned to peak No. 1 in
It could also be seen from the current example that the amino acid at position 34 of the polypeptide was the key site to the hypoglycemic activity, and if it was H (histidine), the corresponding polypeptide had no hypoglycemic activity.
Polypeptide A: the polypeptide with an amino acid sequence of SEQ ID No.1 in Example 1, with an average molecular weight of 3727, an amino acid sequence of ASCNGVCSPFEMPPCGTSACRCIPVGLVVGYCRNPSG, HPLC purity of ≥98%, was prepared into 1 mg/mL solution with normal saline for use.
Polypeptide B: the polypeptide with an amino acid sequence of SEQ ID No.1 in Example 2, with an average molecular weight of 3727, an amino acid sequence of ASCNGVCSPFEMPPCGTSACRCIPVGLVVGYCRNPSG, HPLC purity of ≥98%, was prepared into 1 mg/mL solution with normal saline for use.
Kunming white mice: Hubei Epidemic Prevention Station, 30 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into three groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the blank control group were subcutaneously injected once with normal saline at a dose of 0.05 ml/10 g on the back, mice in Group A (polypeptide A) were subcutaneously injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g on the back, mice in Group B (polypeptide B) were subcutaneously injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g on the back. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that there was no significant difference between the two polypeptides in hypoglycemic activity. It was thus clear that the polypeptides of the invention derived from different sources but with the same structures had the same hypoglycemic activity.
Polypeptide: the polypeptide with an amino acid sequence of SEQ ID No.3 in Example 1, with an average molecular weight of 3741, an amino acid sequence of ASCNGVCSPFEMPPCGTSACRCIPVGLVIGYCRNPSG (see
Kunming white mice: Hubei Epidemic Prevention Station, 40 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into four groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the blank control group were subcutaneously injected once with normal saline at a dose of 0.05 ml/10 g on the back, mice in Group A were injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g into the tail vein of the mice, mice in Group B were subcutaneously injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g on the back, and mice in Group C were intramuscularly injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g in the lateral thigh. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptide administered in three ways (intravenous, subcutaneous and intramuscular injections) all had significant hypoglycemic effects, with no significant difference in hypoglycemic effect. As the subcutaneous injection was relatively convenient to operate, it could be adopted in the screening method of the polypeptide and the composition thereof of the invention for the hypoglycemic activity.
Polypeptides: the polypeptides with amino acid sequences of SEQ ID No.13, 17, 21, 26, 36, 38, 44, 50, 52, 61, 63, and 68 in Example 2, totaling 12 polypeptides, with HPLC purity of ≥98%, were prepared into 1 mg/mL solutions with normal saline for use.
Kunming white mice: Hubei Epidemic Prevention Station, 130 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into 13 groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the blank control group were subcutaneously injected once with normal saline at a dose of 0.05 ml/10 g on the back, and mice in the other groups were subcutaneously injected once with 1 mg/mL polypeptide at a dose of 0.05 ml/10 g on the back, respectively. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
In the polypeptides with amino acid sequences X1SCNGVCSPFX2X3PPCGX4X5X6CRCIPX7GLX8X9GX10CRNPX11G, X1 is A, V, I; X2X3 is EI, EM, DI, DM; X4X5X6X6 is SPA, SPL, SSA, SSL, TPA, TPL, TSA, TSL; X7 is A, V, Y; X8X9 is FI, LI, VI, FV, LV, VV; X10 is K, N, Y; and X11 is S,Y. All the polypeptides formed by the combination of the above candidates have explicit hypoglycemic activity. Therefore, all the polypeptides having the above general structure have hypoglycemic activity.
Insulin: Jiangsu Wanbang Biochemical Pharmaceutical Co., Ltd;
Polypeptide: the polypeptide with an amino acid sequence of SEQ ID No.11 in Example 1, with an average molecular weight of 3788, amino acid sequence ISCNGVCSPFDIPPCGSPLCRCIPAGLVIGNCRNPYG, HPLC purity of ≥98%, was prepared into 2 mg/mL solution with normal saline for use;
Kunming white mice: Hubei Epidemic Prevention Station, 30 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into three groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the blank control group were intravenously injected once with normal saline at a dose of 0.05 ml/10 g into the tail vein, mice in Group A (high-dose polypeptide hypoglycemic group) were intravenously injected once with 2 mg/mL polypeptide at a dose of 0.05 ml/10 g into the tail vein, mice in Group B (insulin hypoglycemic control group) were intravenously injected once with 0.5 U/mL polypeptide at a dose of 0.05 U/10 g into the tail vein. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptide with an amino acid sequence of SEQ ID No.11 had the same hypoglycemic effect on normal mice as insulin after tail vein injection. The polypeptide injected at a dose of 10 mg/kg body weight produced the same hypoglycemic effect on mice as that of insulin injected at a dose of 2.5 U/kg body weight. Therefore, the polypeptide had explicit hypoglycemic activity.
Polypeptide: the polypeptide with an amino acid sequence of SEQ ID No.10 in Example 1, with an average molecular weight of 3788, an amino acid sequence of ASCNGVCSPFDIPPCGSPLCRCIPVGLVIGKCRNPYG (see
Kunming white mice: Hubei Epidemic Prevention Station, 30 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into three groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. Mice in Group A were administered by gavage with 10% glucose solution at a dose of 0.10 ml/10 g, mice in Group B (polypeptide group) were administered by gavage with lmg/mL polypeptide in saline solution at a dose of 0.10 ml/10 g, and mice in group C (polypeptide+glucose group) were administered by gavage with lmg/mL polypeptide in glucose solution (10%) at a dose of 0.10 ml/10 g. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptides of the invention after administration by gavage to normal mice would not cause hypoglycemic reaction in the normal mice, and when the normal mice were administered with glucose and the polypeptides of the invention at the same time by gavage, the blood glucoseglucose level of mice was not elevated. It indicated that the polypeptides of the invention could inhibit the increase of blood glucose level caused by glucose uptake in mice. Therefore, the polypeptides of the invention by oral administration before meal could stabilize postprandial blood glucose level in normal range, indirectly proving the hypoglycemic activity thereof.
Polypeptide mixture A: the polypeptide with an amino acid sequence of SEQ ID No.3 and the polypeptide with an amino acid sequence of SEQ ID No.12 in Example 1 were homogeneously mixed at 1:1 mass ratio to give polypeptide mixture A.
Polypeptide mixture B: the polypeptide with an amino acid sequence of SEQ ID No.1 and the polypeptide with an amino acid sequence of SEQ ID No.9 in Example 1 were homogeneously mixed at 8:1 mass ratio to give polypeptide mixture B.
Polypeptide mixture C: the polypeptide with an amino acid sequence of SEQ ID No.36 and the polypeptide with an amino acid sequence of SEQ ID No.68 in Example 2 were homogeneously mixed at mass ratio of 1:6 to give polypeptide mixture C.
Polypeptide mixture D: the fractions between 17.5 and 25 min in Example 1 were collected and freeze dried to give polypeptide mixture D, in which the total content of the 12 polypeptides with amino acid sequences of SEQ ID No.1 to SEQ ID No.12 was ≥98%.
Each of the above mixture was prepared into 1 mg/mL solution with normal saline for use, respectively.
Kunming white mice: Hubei Epidemic Prevention Station, 50 mice, weighing 20±2 g, male.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned white mice were randomly divided into five groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the blank control group were subcutaneously injected once with normal saline at a dose of 0.05 ml/10 g on the back, mice in Group A (polypeptide mixture A) were subcutaneously injected once with 1 mg/mL of polypeptide mixture A at a dose of 0.05 ml/10 g, mice in Group B (polypeptide mixture B) were subcutaneously injected once with 1 mg/mL of polypeptide mixture B at a dose of 0.05 ml/10 g, mice in Group C (polypeptide mixture C) were subcutaneously injected once with 1 mg/mL of polypeptide mixture C at a dose of 0.05 ml/10 g, and mice in Group D (polypeptide mixture D) were subcutaneously injected once with 1 mg/mL of polypeptide mixture D at a dose of 0.05 ml/10 g. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptides of the invention and the compositions comprising the polypeptides in any proportion also had excellent hypoglycemic activity, and the combination of the polypeptides did not affect the hypoglycemic activity. Especially the polypeptide mixture (polypeptide mixture D) derived from natural extract had significant hypoglycemic activity, meaning that the polypeptide mixture extracted from a leguminous plant (the collection of fractions between 17.5 and 25 min from HPLC) could be directly used as hypoglycemic agents without further purification, which would greatly increase yield and reduce production costs.
Insulin: Jiangsu Wanbang Biochemical Pharmaceutical Co., Ltd, 400 U/10 mL.
Polypeptide: the fractions between 17.5 and 25 min in Example 1 were collected and freeze dried to give a polypeptide mixture, and the mixture was then prepared into 2 mg/mL solution with normal saline for use.
Mouse models of type 2 diabetes: KK mice, Beijing Huafukang Biological Technology Co., Ltd., 30 mice, weighing 25±2.7 g, male, had been fed with a high-fat and high-sugar diet for one month.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned mouse models of type 2 diabetes were randomly divided into three groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the model control group were intravenously injected once with normal saline at a dose of 0.05 ml/10 g into the tail vein, mice in Group A (polypeptide hypoglycemic group) were intravenously injected once with 2 mg/mL polypeptide at a dose of 0.05 ml/10 g into the tail vein, and mice in Group B (insulin hypoglycemic control group) were intravenously injected once with 0.5 U/mL insulin at a dose of 0.05 ml/10 g into the tail vein. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptide mixture could lower the blood glucose level of the mouse models of type 2 diabetes after intravenous injection, exhibiting significant hypoglycemic activity—an effect similar to that of insulin, but it would not cause hypoglycemia in the mouse models of type 2 diabetes.
Insulin: Jiangsu Wanbang Biochemical Pharmaceutical Co., Ltd, 400 U/10 mL.
Polypeptide: the fractions between 17.5 and 25 min in Example 1 were collected and freeze dried to give a polypeptide mixture, and the mixture was then prepared into 2 mg/mL solution with normal saline for use.
Mouse models of type 2 diabetes: KK mice, Beijing Huafukang Biological Technology Co., Ltd., 30 mice, weighing 25±2.7 g, male, had been fed with a high-fat and high-sugar diet for one month.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
After being fasted for 4 hours (free access to water), the above mentioned mouse models of type 2 diabetes were randomly divided into three groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the model control group were subcutaneously injected once with normal saline at a dose of 0.05 ml/10 g on the back, mice in Group A (polypeptide hypoglycemic group) were subcutaneously injected once with 2 mg/mL polypeptide at a dose of 0.05 ml/10 g on the back, and mice in Group B (insulin hypoglycemic control group) were subcutaneously injected once with 0.5 U/mL insulin at a dose of 0.05 ml/10 g on the back. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptide mixture could lower the blood glucose level of the mouse models of type 2 diabetes after subcutaneous injection, exhibiting significant hypoglycemic activity—an effect similar to that of insulin, but it would not cause hypoglycemia in the mouse models of type 2 diabetes.
Insulin: Jiangsu Wanbang Biochemical Pharmaceutical Co., Ltd, 400 U/10 mL.
Polypeptide: the fractions between 17.5 and 25 min in Example 1 were collected and freeze dried to give a polypeptide mixture, and the mixture was then prepared into 2 mg/mL solution with normal saline for use.
Mouse models of type 2 diabetes: KK mice, Beijing Huafukang Biological Technology Co., Ltd., 30 mice, weighing 25±2.7 g, male, had been fed with a high-fat and high-sugar diet for one month.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
The above mentioned white mice were randomly divided into three groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the model control group were intramuscularly injected once with normal saline at a dose of 0.05 ml/10 g in the lateral thigh, mice in Group A (polypeptide hypoglycemic group) were intramuscularly injected once with 2 mg/mL polypeptide at a dose of 0.05 ml/10 g in the lateral thigh, and mice in Group B (insulin hypoglycemic control group) were intramuscularly injected once with 0.5 U/mL insulin at a dose of 0.05 ml/10 g in the lateral thigh. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptide mixtures of the invention could lower the blood glucose level of the mouse models of type 2 diabetes after intramuscular injection, exhibiting significant hypoglycemic activity—an effect was similar to that of insulin, but it would not cause hypoglycemia in the mouse models of type 2 diabetes.
Polypeptide: the fractions between 15 and 25 min in Example 1 were collected and freeze dried to give a polypeptide composition;
Pepsin: Sigma-Aldrich Company Ltd.;
Trypsin: Sigma-Aldrich Company Ltd.;
Albumin: Serum albumin (bovine) standard;
High-performance liquid chromatography: Agilent 1260 high-performance liquid chromatography, Waters Corporation C18 reversed-phase column (4.6×250 mm, 300SB, 5 μm).
Polypeptides were subject to enzymatic hydrolysis in simulated gastric and simulated intestinal fluids, respectively, to verify whether the polypeptides were resistance to the enzymatic hydrolysis of digestive enzymes. Control experiments were performed with albumin.
Preparation of simulated gastric fluid: water was added to diluted hydrochloric acid with a concentration of 1 mol/L, to adjust the pH to 1.5. 1 g pepsin per 100 mL solution was added, and after homogeneously mixing, the solution was filtered through a 0.22 μm sterile filter for use.
Preparation of simulated intestinal fluid: 6.8 g of potassium dihydrogen phosphate was dissolved in 500 mL water, 0.4% (w/w) NaOH was added to adjust the pH to 6.8, and water was added to make up 1 L. 1 g trypsin per 100 mL solution was added, and after homogeneously mixing, the solution was filtered through a 0.22 μm sterile filter for use.
10 μL of the polypeptide solution (10 mg/mL) was added to the simulated gastric fluid (1 mL) and simulated intestinal fluid (1 mL), respectively, and after homogeneously mixing, the mixtures were incubated in a water bath at 37° C. for 2 hours.
1 mg of dried albumin powder was added to the simulated gastric fluid (1 mL) and simulated intestinal fluid (1 mL), respectively, and after homogeneously mixing, the mixtures were incubateed in a water bath at 37° C. for 2 hours.
The above enzymatic mixtures were detected by using HPLC.
Chromatographic conditions: mobile phase, water (containing 0.1% TFA)+acetonitrile (containing 0.1% TFA), gradient elution from 15% to 50% acetonitrile for 25 min, flow rate of 1 mL/min, detection wavelength of 214 nm, injection volume of 20 ul.
The HPLC chromatograms of enzymatic hydrolysis of the polypeptides and albumin were shown in the attached figures.
In the HPLC chromatograms of enzymatic hydrolysis of the polypeptides (see
In the HPLC chromatograms of enzymatic hydrolysis of albumin (see
As shown in the figure, the polypeptides of the invention could resist the enzymatic hydrolysis of both simulated gastric fluid and intestinal fluid, but albumin was completely enzymatically hydrolyzed in the gastric fluid and intestinal fluid, indicating that the polypeptides of the invention were resistant to enzymatic hydrolysis of digestive enzymes in gastrointestinal tract and could be administered orally.
Polypeptide: the fractions between 17.5 and 25 min in Example 1 were collected and freeze dried to give a polypeptide mixture, and the mixture was then prepared into 2 mg/mL solution with normal saline for use.
Metformin hydrochloride: GLUMETZA metformin hydrochloride tablets, 0.5 g/Tablet, Sino-American Shanghai Squibb Pharmaceutical Co., Ltd., was prepared into 20 mg/mL solution with normal saline for use.
Mouse models of type 2 diabetes: KK mice, Beijing Huafukang Biological Technology Co., Ltd., 30 mice, weighing 25±2.7 g, male, had been fed with a high-fat and high-sugar diet for one month.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
The above mentioned white mice were randomly divided into three groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the model control group were administered once by gavage with normal saline at a dose of 0.05 ml/10 g, mice in Group A (polypeptide hypoglycemic group) were administered once by gavage with polypeptide at a dose of 0.05 ml/10 g, and mice in Group B (metformin control group) were administered once by gavage with metformin at a dose of 0.05 ml/10 g. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptide mixtures of the invention could lower the blood glucose level of the mouse models of type 2 diabetes after administration by gavage, exhibiting significant hypoglycemic activity, without causing hypoglycemia in the mouse models of type 2 diabetes. Moreover, the effect of the polypeptide mixtures of the invention was better than that of metformin.
Polypeptide: the fractions between 15 and 25 min in Example 1 were collected and freeze dried to give a polypeptide composition.
High-performance liquid chromatography: Agilent 1260 high-performance liquid chromatography, Waters Corporation C18 reversed-phase column (4.6×250 mm, 300SB, 5 μm).
2. Experiment Method: the polypeptides were distributed into cillin bottles, and then the cillin bottles were placed in a chamber at constant temperature of 60° C. and constant humidity of 70% RH to carry out accelerated tests. The polypeptides were weekly sampled and detected by high performance liquid chromatography (HPLC) to determine the stability of the polypeptides.
The HPLC chromatograms for the stability studies of the polypeptides were shown in the attached figures.
The HPLC chromatograms for the stability studies of the polypeptides (see
Polypeptide: the fractions between 17.5 and 25 min were collected and freeze dried to give a polypeptide mixture, and the mixture was then prepared into 1 mg/mL solution with normal saline to obtain an injection solution of the polypeptide mixture.
Mouse models of type 2 diabetes: KK mice, Beijing Huafukang Biological Technology Co., Ltd., 40 mice, weighing 25±2.7 g, male, had been fed with a high-fat and high-sugar diet for one month.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
The above mentioned white mice were randomly divided into four groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the model control group were intravenously injected with normal saline at a dose of 0.05 ml/10 g into the tail vein, mice in Group A (intravenous injection group) were intravenously injected with an injection containing 1 mg/mL polypeptide at a dose of 0.05 ml/10 g into the tail vein, mice in Group B (subcutaneous injection group) were subcutaneously injected with an injection containing 1 mg/mL polypeptide at a dose of 0.05 ml/10 g on the back, and mice in Group C (intramuscular injection group) were intramuscularly injected with an injection containing 1 mg/mL polypeptide at a dose of 0.05 ml/10 g in the lateral thigh. The mice were administered every other day for 4 consecutive weeks, blood samples were collected from the tail vein weekly at regular intervals, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that the polypeptides of the invention had explicit therapeutic effects on mouse models of type 2 diabetes after intravenous, subcutaneous and intramuscular injection, and the hypoglycemic effects following the three administration ways had no significant difference.
Polypeptide: the fractions between 17.5 and 25 min in Example 1 were collected and freeze dried to give a polypeptide mixture.
Metformin hydrochloride: GLUMETZA metformin hydrochloride tablets, 0.5 g/Tablet, Sino-American Shanghai Squibb Pharmaceutical Co., Ltd.
Insulin: Jiangsu Wanbang Biochemical Pharmaceutical Co., Ltd, 400 U/10 mL.
Mouse models of type 2 diabetes: KK mice, Beijing Huafukang Biological Technology Co., Ltd., 60 mice, weighing 25±2.7 g, male, had been fed with a high-fat and high-sugar diet for one month.
Normal control mice: Kunming white mice, from Hubei Epidemic Prevention Station, 20 mice, weighing 20±2 g, male, had been fed with normal diet.
Blood glucose meter and test strips: Beijing Yicheng Bioelectronics Technology Co., Ltd.
2.1 Preparation of oral polypeptide hypoglycemic agents: the above polypeptide mixture was mixed with hydroxypropyl methylcellulose at ratio of 8:2 homogeneously, and then was compressed into tablets. Each tablet weighed 0.5 g and contained 392 mg of the total effective polypeptides. Before the administration by gavage, the tablets were prepared into a suspension containing 2 mg/ml of the polypeptides with normal saline.
Metformin hydrochloride was prepared into 20 mg/mL solution with normal saline for use.
2.2 The above mentioned mouse models of type 2 diabetes were randomly divided into three groups, 20 mice in each group. The 20 normal control mice were assigned as one group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the model control group and normal control group were administered by gavage with normal saline at a dose of 0.10 ml/10 g once a day for 4 consecutive weeks; mice in Group A (metformin treatment group) were administered by gavage with metformin at a dose of 0.05 ml/10 g once a day for 4 consecutive weeks; and mice in Group B (polypeptide treatment group) were administered by gavage with the polypeptides at a dose of 0.05 ml/10 g once a day for 4 consecutive weeks. Blood samples were collected weekly from the tail vein, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
2.3 Insulin tolerance test: one hour after the last administration, 10 mice in each of the diabetic model control group, metformin treatment group, polypeptide treatment group and normal control group were randomly selected and subcutaneously injected once with 0.5 U/mL insulin at a dose of 0.05 ml/10 g. Blood samples were collected from the tail vein at 0 h, 0.5 h, 1 h, 1.5 h and 2 h, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
2.4 Oral glucose tolerance test: one hour after the last administration, the remaining mice in the diabetic model control group, metformin treatment group, polypeptide treatment group and normal control group (10 mice in each group) after the selection in experiment 2.3 were administered by gavage with glucose at a dose of 2.5 g/kg. Blood samples were collected from the tail vein at 0 h, 0.5 h, 1 h, 1.5 h and 2 h, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
2.5 All mice were sacrificed after treatment for four weeks, and the pancreatic tissues were weighed, stained with H&E and detected by immunohistochemistry.
The experimental data was expressed in
The hypoglycemic agent prepared from the polypeptide mixture could lower the blood glucose level of the mouse models of type 2 diabetes after oral administration and restore the blood glucose to normal level, indicating that the hypoglycemic agent could treat type 2 diabetes by oral administration. Moreover, the polypeptide mixtures could improve insulin tolerance and glucose tolerance of the mouse models of type 2 diabetes after administration by gavage. Meanwhile, the pancreas weights were increased in the mouse models of type 2 diabetes treated with the hypoglycemic agent.
The fractions between 17.5 and 25 min in Example 1 were collected and freeze dried to give a polypeptide mixture, in which the total content of the 12 polypeptides with amino acid sequence of SEQ ID No.1 to SEQ ID No.12 was ≥98%, abbreviated as polypeptide O.
A liquid composition comprising polypeptide O was prepared according to formulation {circle around (1)} as shown in Table 20 below.
A liquid composition comprising polypeptide O was prepared according to formulation {circle around (2)} as shown in Table 21 below.
The liquid composition as prepared according to formulations {circle around (1)} and {circle around (2)} were sealed in cillin bottles and stored at 40±2° C./75±5% RH, respectively.
Polypeptide composition A: a liquid composition, which was prepared according to formulation {circle around (1)} in Example 21 and stored at 40±2° C./75±5% RH for 6 months.
Polypeptide composition B: a liquid composition, which was prepared according to formulation {circle around (2)} in Example 21 and stored at 40±2° C./75±5% RH for 6 months.
Polypeptide composition C: a liquid composition, which was currently prepared according to formulation {circle around (1)} in Example 21.
Experimental animals: Kunming white mice, male, weighing 20±2 g, 40 mice, were purchased from Hubei Epidemic Prevention Station.
Blood glucose meter and test strips: Roche Accu-Chek® Active Blood Glucose Meter and test stripes.
After being fasted, the above mentioned white mice were randomly divided into four groups, 10 mice in each group. Each of the mice was stained with picric acid as a marker and detected the blood glucose level by collecting tail vein blood. The mice in the blank control group were intravenously injected once with normal saline at a dose of 0.1 ml/10 g into the tail vein, and mice in the other groups were intravenously injected once with compositions A, B, and C at a dose of 0.10 ml/10 g into the tail vein, respectively. Blood samples were collected from the tail vein at 15 min, 30 min, 45 min and 60 min after injection, respectively, and blood glucose level in mmol/L was determined with the blood glucose meter.
The experimental data was expressed in
From the above experimental results, it could be seen that 15 minutes after the tail vein injection with composition A, B or C, respectively, the blood glucose level of all the normal mice began to drop. Mice in both Composition B group and Composition C group had especially significant decrease in blood glucose level, and showed hypoglycemia at 45 min. Mice in Composition A group did not show hypoglycemia, but showed a rebound of the blood glucose level at 60 min. The results demonstrated that the hypoglycemic activity of composition A without L-methionine decreased with the increasing storage duration, while that of composition B with L-methionine did not decrease with the increasing storage duration; moreover, the hypoglycemic activity of composition B was better than that of freshly prepared composition C, suggesting a synergistic effect of the components.
The above experiments demonstrated that the addition of L-methionine could improve the stability and hypoglycemic activity of polypeptide O.
A solution comprising polypeptide O was prepared according to formulation {circle around (3)} in Table 23 below, distributed in cillin bottles, vacuum freeze dried, and stored at 40±2° C./75±5% RH after being sealed:
A solution comprising polypeptide O and amino acide was prepared according to formulation {circle around (4)} in Table 24 below, distributed in cillin bottles, vacuum freeze dried, and stored at 40±2° C./75±5% RH after being sealed:
Polypeptide composition D: a solid composition was prepared according to formulation {circle around (3)} in Example 23, stored at 40±2° C./75±5% RH for 6 months, and was then prepared into a solution containing 2 mg/mL polypeptide O with normal saline for use.
Polypeptide composition E: a solid composition was prepared according to formulation {circle around (4)} in Example 23, stored at 40±2° C./75±5% RH for 6 months, and was then prepared into a solution containing 2 mg/mL polypeptide O with normal saline for use.
Polypeptide composition F: a solid composition was currently prepared according to formulation {circle around (3)} in Example 23, and then prepared into a solution containing 2 mg/mL polypeptide O with normal saline for use.
Metformin: GLUMETZA metformin hydrochloride tablets, 0.5 g/Tablet, Sino-American Shanghai Squibb Pharmaceutical Co., Ltd., was prepared into 20 mg/mL suspension with normal saline for use.
High-fat diet: 30% fat, 20% protein, and 50% carbohydrate.
Experimental animals: C57BL/6, male, weighing 20±2 g, 100 mice, were purchased from Hubei Epidemic Prevention Station.
Blood glucose meter and test strips: Roche Accu-Chek® Active Blood Glucose Meter and test stripes.
Male C57BL/6 mice at 4 weeks of age, after adapting to the environment for 5 days, were randomly divided into normal control group (10 mice) and model-to-be established groups (90 mice). The mice in the normal control group were fed with normal diet. The mice in the model-to-be established groups were fed with high-fat diet and intraperitoneally injected with streptozotocin (STZ) in citrate buffer at a dose of 45 mg/kg. After injection, the mice were fasted for 1.5 hours and injected for 5 consecutive days, and then the diabetic mouse model was established. After intraperitoneal injection of streptozotocin for four weeks, the mice were fasted from 8 pm the day before, blood samples were collected from the tail vein at 8 am in the morning of the day, and then the fasting blood glucose level was measured. The mice with the fasting blood glucouse level between 10.0 and 20.0 mmol/L and at the same time having polydipsia and polyuria were selected out as the diabetic mice. Then, the selected diabetic mice were randomly divided into five groups: model control group, metformin group, Composition D group, Composition E group, and Composition E group, 10 mice in each group. The mice were administered by gavage with the corresponding drug: normal saline (100 μL for each mouse), metformin (0.05 ml/10 g), composition D (0.05 ml/10 g), composition E (0.05 ml/10 g) and composition F (0.05 ml/10 g), respectively, once a day for 4 weeks. The mice in normal control group were administered with normal saline (100 μL for each mouse). The diabetic mice were fed with high-fat diet continuously and drank water freely, and the mice in normal control group were fed with normal diet and drank water freely.
Blood samples of mice in each group were collected from the tail vein weekly at regular intervals, respectively, and fasting blood glucose level in mmol/L was determined with the blood glucose meter once.
The experimental data was expressed in
The above experimental results showed that, the hypoglycemic activity of the solid composition comprising polypeptide O (composition D) after storage for 6 months decreased as compared with that of Composition F as freshly prepared, but was better than that of metformin (100 mg/Kg) at a conventional dose. The solid composition comprising polypeptide O and an amino acid (Composition E) of the invention could effectively control blood glucose in type 2 diabetic mice fed with STZ in combination with high-fat and high-sugar diet. After four weeks of treatment, there was no significant difference in the blood glucose levels between the mice treated with Composition E and those in normal control group. The therapeutic effect of Composition E was remarkable, better than that of Composition F without an amino acid, and much better than that of metformin. Therefore, DL-methionine not only improved the stability of polypeptide O, but also had a synergistic effect on the hypoglycemic effect.
Polypeptide composition F: a solid composition was currently prepared according to formulation {circle around (3)} in Example 23, and then prepared into a solution containing 2 mg/mL polypeptide O with normal saline for use.
Polypeptide composition E: a solid composition was prepared according to formulation {circle around (4)} in Example 23, stored at 40±2° C./75±5% RH for 6 months, and then prepared into a solution containing 2 mg/mL polypeptide O with normal saline for use.
High-fat diet: 30% fat, 20% protein, and 50% carbohydrate.
Experimental animals: BALB/c, male, weighing 20±2 g, 80 mice, were purchased from Hubei Epidemic Prevention Station.
Metformin: GLUMETZA metformin hydrochloride tablets, 0.5 g/Tablet, Sino-American Shanghai Squibb Pharmaceutical Co., Ltd., were prepared into 200 mg/mL suspension with normal saline for use.
Blood glucose meter and test strips: Roche Accu-Chek® Active Blood Glucose Meter and test stripes.
Biochemical analyzer and assay kits: cholesterol (TC) assay kits, triglyceride (TG) assay kits and high-density lipoprotein cholesterol (HDL-C) assay kits were purchased from Mindray Bio-medical Electronics Co., Ltd. and tested with Mindray BS-220 Automatic Biochemical Analyzer.
Male BALB/c mice at 7 weeks of age, after adapting to the environment for 2 days, were randomly divided into normal control group (10 mice) and model-to-be established groups (70 mice). The mice in the normal control group were fed with normal diet. The mice in the model-to-be established groups were fed with high-fat diet, intraperitoneally injected with streptozotocin (STZ) in citrate buffer at a dose of 100 mg/kg, and then the diabetic mouse model was established. Three days later, the mice were fasted for 4 hours (free access to water), blood samples were collected from the tail vein and the blood glucose level were measured. The mice with the blood glucouse level higher than 11.0 mmol/L and at the same time having polydipsia and polyuria were selected out as the diabetic mice. Then the selected diabetic mice were randomly divided into four groups: model control group, metformin group, Composition E group and Composition F group, 10 mice in each group. The mice were intragastric administered with the corresponding drugs: normal saline (100 μL for each mouse), metformin (0.05 ml/10 g), Composition E (0.05 ml/10 g) and Composition F (0.05 ml/10 g), respectively, once a day for 4 weeks. The mice in normal control group were administered with normal saline (100 μL for each mouse). The diabetic mice were fed with high-fat diet continuously and drank water freely, and the mice in normal control group were fed with normal diet and drank water freely.
Blood samples of the mice in each group were collected from the tail vein weekly at regular intervals, respectively, and fasting blood glucose level in mmol/L was determined with the blood glucose meter once.
After the end of experiment, blood samples were collected from the eyeballs of the mice, serum was separated and the serum levels of TC and TG were detected.
The experimental data was expressed in
The above results showed that for the diabetic mouse models with pancreatic damage induced by STZ, metformin at ultra-high-dose (1000 mg/kg, a dose 10 times of the commonly used dose) could not control blood glucose effectively, but the polypeptides of the invention when used alone had better effect than that of metformin. Moreover, the compositions comprising the polypeptides of the invention and amino acids enabled the mice to reach normal blood glucose level after being treated for four weeks. The compositions comprising the polypeptides of the invention and amino acids exhibited synergistic effect, and could control blood glucose in diabetic mice with impaired pancreases more effectively than the polypeptides of the invention alone.
Meanwhile, the polypeptides of the invention could significantly lower blood lipid level in the diabetic mouse models with pancreatic damage. Furthermore, the compositions comprising the polypeptides of the invention and amino acid had a better effect of lowering blood lipid level in the diabetic mouse models with pancreatic damage than the polypeptides alone, indicating a synergistic effect of the combination of the polypeptides of the invention and amino acid.
Polypeptide composition E: a solid composition was prepared according to formulation {circle around (4)} in Example 23, stored at 40±2° C./75±5% RH for 6 months, and then prepared into a solution containing 2 mg/mL polypeptide O with normal saline for use.
High-fat diet: 78.8% basic diet, 1% cholesterol, 10% egg yolk powder, 10% lard, and 0.2% bile salt.
Experimental animals: male SD rats, 50 rats, weighing 200±2 g, were purchased from Hubei Epidemic Prevention Station.
Biochemical analyzer and assay kits: cholesterol (TC) assay kits, triglyceride (TG) assay kits and high-density lipoprotein cholesterol (HDL-C) assay kits were purchased from Mindray Bio-medical Electronics Co., Ltd. and tested with Mindray BS-220 Automatic Biochemical Analyzer.
After adapting to the environment for 3 days, the rats were fed with normal diet for 5 days. After being fasted for 16 hours, blood samples were collected from the tail and centrifuged (3000 rpm) to give serum, and then TC, TG and HDL-C in serum were measured. According to the TC level, the rats were randomly divided into five groups, 10 rats in each group, i.e., three treatment groups (administered with 10, 20 and 30 mg/kg, respectively), one high-fat diet control group and one normal diet control group. During the experimental period, the rats of the three treatment groups were given high-fat diet and administered by gavage with the solid composition of the invention comprising the polypeptides and amino acid at different doses. The rats of the high-fat diet control group were given high-fat diet and water, and the rats of the normal diet control group were given normal diet and water. On day 30 of the experiment, after being fasted for 16 hours, blood samples were collected from the tail and centrifuged (3000 rpm) to give serum, and then TC, TG and HDL-C in serum were measured.
The experimental data was expressed in
From the above results, it could be seen that the rats of the three treatment groups were fed with high-fat diet and at the same time administered with the composition comprising the polypeptides of the invention and amino acid at different doses. As compared with the rats of the high-fat diet group, the SD rats of the high, medium and low dose groups had significantly lower total serum cholesterol (TC) and triglyceride (TG) level, and had significantly higher high density lipoprotein cholesterol (HDL-C) level. The above results indicated that the compositions comprising the polypeptides of the invention and amino acid had explicit improving effect on the blood lipids in hyperlipidemia rats.
A female patient, Ms. Jiang, 58 years old, was diagnosed with diabetes in hospital on Jan. 19, 2018, with a fasting blood glucose level up to 15.32 mmol/L and glycosylated hemoglobin of 9.7%. From Jan. 25, 2018, she started orally taking the single solid composition as prepared according to formulation {circle around (4)} in Example 22, before meal, once a day, 100 mg every time, not taking other hypoglycemic agents. On Feb. 25, 2018, she went to the hospital for a check, and the fasting blood glucose decreased to 7.3 mmol/L and the glycosylated hemoglobin decreased to 6.7%. In only one month, the blood glucose level was effectively controlled and the glycosylated hemoglobin level was essentially returned to normal.
The example showed that for patients with early diabetes, blood glucose level could be effectively controlled, and glycosylated hemoglobin levels could be returned to normal by orally taking the single composition comprising the polypeptides of the invention and amino acid.
A male patient, Mr. Wang, 40 years old, with a family history of diabetes, was diagnosed with diabetes in hospital two years ago, and took a tablet of 0.5 g metformin orally every day. His fasting blood glucose level remained between 8.0 and 10.0 for a long time, but the blood glucose level was not effectively controlled. On Jan. 7, 2018, his glycosylated hemoglobin level was 7.5% as shown in a test in the hospital. From Jan. 8, 2018, he started orally taking the solid composition as prepared according to formulation {circle around (4)} in Example 22, before meal, three times a day, 100 mg every time, without changing the dosage regimen of metformin. On Mar. 1, 2018, he went to the hospital for a check, and the glycosylated hemoglobin level was 6.9%, which was essentially normal.
The example showed that when the composition comprising the polypeptides of the invention and amino acid was used in combination with metformin, the glycosylated hemoglobin level of the patient was obviously improved and tended to be normal and the effect was better than that of metformin when used alone.
A male patient, Mr. Yuan, 66 years old, with a history of diabetes for 20 years, had been injected with insulin from year to year, 50 units of short-acting insulin per day, and took a tablet of 0.5 g metformin orally every night. However, his blood glucose level could not be effectively controlled, and the fasting blood glucose level remained between 12.0 and 15.0 for a long time. On Nov. 22, 2017, his glycosylated hemoglobin level was 12.9% as shown in a test in the hospital. From Nov. 22, 2017, he started orally taking the solid composition as prepared according to formulation {circle around (4)} in Example 22, before meal, three times a day, 100 mg every time, without changing the dosage regimen of metformin and insulin. After continuous administration for two months, the fasting blood glucose level fluctuated between 5.0 and 7.0. Then he stopped taking the above composition comprising the polypeptides and amino acid and changed the injection dose of insulin to 25 units, and the fasting blood glucose level remained stable between 5.0 and 7.0. On Mar. 3, 2018, he went to the hospital for a check, and the glycosylated hemoglobin level was 7.0%, which was essentially normal.
The example showed that for patients whose blood glucose level could still not be effectively controlled by using metformin and insulin, the composition comprising the polypeptides of the invention and amino acid in combination with metformin and insulin could effectively improve the blood glucose level, return the glycosylated hemoglobin level to normal, reduce the dosage of insulin, and achieve an effect better than that of the use of metformin and insulin alone.
After taking the composition comprising the polypeptides of the invention and amino acid for some time, even if the patient stopped it and reduced the insulin dose by half, his fasting blood glucose and glycosylated hemoglobin level could still be controlled within a normal range. It indicated that the composition comprising the polypeptides of the invention and amino acid had the function of repairing the damaged pancreases of diabetic patients and promoting the recovery of insulin-secretion, and thus could reverse type 2 diabetes.
A male patient, Mr. Xu, 49 years old, was diagnosed with diabetes in hospital on Apr. 1, 2018, with a fasting blood glucose level up to 14.61 mmol/L and glycosylated hemoglobin of 10.5%. From Jan. 5, 2018, he started orally taking the single solid composition as prepared according to formulation {circle around (4)} in Example 22, before meal, three times a day, 100 mg every time, not taking other hypoglycemic agents. On Mar. 17, 2018, he went to the hospital for a check, the fasting blood glucose decreased to 8.32 mmol/L, the glycosylated hemoglobin decreased to 7.7%, and the triglyceride (TG) decreased to 2.6 mmol/L. In two months, the fasting blood glucose level, glycosylated hemoglobin level and triglyceride (TG) level were reduced by 43%, 27% and 42%, respectively, which changed significantly.
The example showed that the composition comprising the polypeptides and amino acid could significantly improve glycolipid metabolism in type 2 diabetic patients.
The embodiments of the invention are described above. However, the invention is not limited to the above embodiments. Any modification, equivalent alternative, improvement, etc., falling within the spirit and scope of the invention, are intended to be included within the scope of the invention.
| Number | Date | Country | Kind |
|---|---|---|---|
| 201710230019.9 | Apr 2017 | CN | national |
| Number | Date | Country | |
|---|---|---|---|
| Parent | PCT/CN2018/082401 | Apr 2018 | US |
| Child | 16598713 | US |