POLYPEPTIDE LIBRARIES WITH A PREDETERMINED SCAFFOLD

Abstract
Populations of polypeptide variants based on a common scaffold, each polypeptide in the population comprising the scaffold amino acid sequence EXXXAXXEIX XLPNLTXXQX XAFIXKLXDD PSQSSELLSE AKKLNDSQ or AKYAKEXXXAXX EIXXLPNLTX XQXXAFIXKL XDDPSQSSEL LSEAKKLNDS Q, wherein each X individually corresponds to an amino acid residue which is varied in the population are disclosed. Also populations of polynucleotides, wherein each member encodes a member of a polypeptide population are disclosed. Furthermore, combinations of such polypeptide populations and such polynucleotide populations are disclosed, wherein each member of polypeptide population is physically or spatially associated with the polynucleotide encoding that member via means for genotype-phenotype coupling. Furthermore, methods for selecting a desired polypeptide having an affinity for a predetermined target from a population of polypeptides, isolation of a polynucleotide encoding a desired polypeptide having an affinity for a predetermined target, identifying a desired polypeptide having an affinity for a predetermined target, selecting and identifying a desired polypeptide having affinity for a predetermined target, and production of a desired polypeptide having an affinity for a predetermined target are disclosed.
Description
FIELD OF THE INVENTION

The present invention relates to novel populations of polypeptide variants based on a common scaffold. These populations can i.a. be used to provide novel binding proteins and polypeptides.


BACKGROUND

Different methods for construction of novel binding proteins have been described (Nygren P A and Uhlén M (1997) Curr Opin Struct Biol 7:463-469). One strategy has been to combine library generation and screening or selection for desired properties.


Original Affibody® molecules, populations of such molecules and scaffolds of such molecules have been described i.a. in WO 95/19374, the teaching of which is incorporated herein by reference.


For some applications proteins, polypeptides or Affibody® molecules, populations of such molecules and scaffolds with improved properties, such as alkali stability, low antigenicity, structural stability, amenability to chemical synthesis and hydrophilicity, are desired.


Alkali Stability

Production of protein pharmaceuticals and biotechnology reagents requires several purification steps to enrich for specific product while removing unwanted contaminants. Affinity purification mediated by proteinaceous affinity matrices such as monoclonal antibodies and Staphylococcal protein A (SpA) enables efficient purification in one step. However, to make this cost-efficient it is desirable to be able to properly regenerate the affinity matrices. This usually involves a procedure known as cleaning-in-place (CIP), wherein agents—often alkaline solutions—are used to elute contaminants.


Alkali stability is also required with molecular imaging tracers to be labeled with the most common SPECT nuclide technetium-99m, and to enable some other types of chemical modifications to be performed.


Low Antigenicity

Protein based pharmaceuticals, such as therapeutic monoclonal antibodies and Affibody® molecules, have the potential to elicit undesired immune responses in humans. The main factors contributing to immunogenicity are presence of impurities, protein aggregates, foreign epitopes e.g. new idiotopes, different Ig allotypes or non-self sequences. In addition, cross-reacting immunoglobulin (Ig) interactions will most likely increase the probability of generating a specific T-cell mediated memory immune response against the protein pharmaceutical. To minimize the risk of unwanted interaction with the immune system it is desirable to eliminate existing immune epitopes by protein engineering of the pharmaceutical.


Affibody® molecules are derived from staphylococcal protein A (SpA), which is a cell wall associated receptor on the surface of the Gram positive bacterium Staphylococcal aureus. More precisely, SpA is composed of five highly homologous domains all binding to immunoglobulins of many mammalian species including human. Each SpA domain interacts with human Igs in two different ways; either by direct binding to Fcγ including IgG1, IgG2 and IgG4 (Langone J J (1982) Adv Immunol 32:157-252), or by binding to members of the VH3 family (Silverman G J et al (1992) Int Rev Immunol 9:57-78). The common scaffold of original Affibody® molecules is identical to domain B of SpA with the exception of the G29A mutation, which was included to increase protein stability and to eliminate a hydroxylamine cleavage site, and the A1V mutation, introduced in a spacer region between domains (Nilsson B et al (1987), Prot Eng 1:107-113). The amino acid residues in SpA that are involved in the interaction with Fcγ and VH3 are well known and have been described in the literature (Graille M et al (2000) Proc Natl Acad Sci USA. 97:5399-5404). A molecular library of different Affibody® molecules was constructed by randomizing surface residues at one face of the molecule, including residues known to be involved in the interaction with Fcγ, thereby eliminating the affinity for Fcγ.


Structural Stability

One of the key factors to success for peptide and protein pharmaceuticals is the stability of the protein. Proteins showing high structural stability will most likely functionally withstand chemical modifications and proteolysis both during production as well as within the human body. Moreover, stability will influence the active shelf-life of the peptide or protein pharmaceuticals as well as the active life of the peptide or protein pharmaceutical within the human body.


Amenability to Chemical Synthesis

Researchers have traditionally obtained proteins by biological methods but chemical synthesis of peptides and small proteins is a powerful complementary strategy and is commonly used in structural biology, protein engineering and biomedical research. Chemical synthesis of proteins offers a rapid and efficient way of producing homogenous proteins free of biological contaminants such as DNA impurities and host cell proteins. Furthermore, flexibility is increased since chemical synthesis allows incorporation of unnatural amino acids, chemical modifications and introduction of biochemical and biophysical probes. The success of chemical synthesis of peptides and proteins is dependent on the amino acid sequence of the molecule in question. Certain amino acid residues show low coupling efficiency, meaning that several steps during synthesis need to be optimized which is a time-consuming process with no guaranteed success. In addition, amino acids difficult to efficiently introduce during chemical synthesis will have greater negative impact on protein yield the longer the protein sequence.


Increased Hydrophilicity

For most applications it is desirable that peptides and proteins are highly soluble showing a low tendency to aggregate. Such protein characteristics are especially important when it comes to protein pharmaceuticals. There is a strong positive correlation between protein surface hydrophobicity and low solubility and increased tendency to aggregate.


DESCRIPTION OF THE INVENTION

It is an object of the present invention to provide a population of polypeptide variants based on novel scaffolds.


These novel scaffolds have several advantages compared to known, similar scaffolds, so called original scaffolds. The advantages also apply to polypeptides obtained with the use of these novel scaffolds. These advantages will be discussed in more detail below, but some examples are given here. For example, extensive research has been performed to develop the novel polypeptide scaffolds showing high stability in an alkaline environment. One aspect of alkaline stability is stability towards deamidation of asparagines. Avoiding this reaction by increased structural rigidity or by replacing this residue also provides chemical stability that contributes to obtaining a homogeneous product, for example following production in a fermentation process or storage, where deamidation of asparagines strongly contributes to a heterogeneous mixture which is difficult to separate.


Moreover, an improved profile with regard to low antigenicity (little IgG binding) was obtained by elimination in the new scaffold sequence of the remaining affinity for immunoglobulins, mainly VH3 mediated.


Furthermore, the novel scaffolds have been engineered in such a way to show high structural stability with regard to an easily folded alpha helical structure, high melting temperature and abolishment of sites known to target proteolysis.


The original Affibody® molecule scaffolds contain several amino acids that have been shown to reduce the rate and success of chemical synthesis. To have an efficient, i.e. high-throughput and high yield Affibody® protein production process, numerous amino acids were exchanged for residues with properties more compatible with chemical synthesis.


In order to improve hydrophilicity and solubility, hydrophobic residues on the surface of the Affibody® molecule scaffold have be exchanged for more hydrophilic amino acids.


Another object of the present invention is to provide a population of polynucleotides.


Another object of the present invention is to provide a combination of a polypeptide population and a polynucleotide population.


A further object of the present invention is to provide a method for selecting a desired polypeptide having an affinity for a predetermined target from a population of polypeptides.


Another object is to provide a method for isolating a polynucleotide encoding a desired polypeptide having an affinity for a predetermined target.


Another object is to provide a method for identifying a desired polypeptide having an affinity for a predetermined target.


A further object is to provide a method for selecting and identifying a desired polypeptide having an affinity for a predetermined target.


A related object is to provide a method for production of a desired polypeptide having an affinity for a predetermined target.


The populations and methods according to the invention enables the provision (including production and evaluation) of agents with an affinity for a predetermined target, through the provision of a polypeptide that is characterized by specific binding to the predetermined target.


It is also possible to provide polypeptides binding to a predetermined target that exhibit little or no non-specific binding.


It is also possible to provide polypeptides binding to a predetermined target that can readily be used as a moiety in a fusion polypeptide.


Furthermore, it is possible to provide polypeptides binding to a predetermined target that solve one or more of the known problems experienced with existing antibody reagents.


Moreover, it is possible to provide polypeptides binding to a predetermined target that are amenable to use in therapeutic and/or diagnostic applications.


It is also possible to provide polypeptides binding to a predetermined target that are easily made by chemical peptide synthesis.


Furthermore, the invention enables the identification of polypeptides binding to a predetermined target that exhibit an improved stability vis-à-vis known agents binding to the same target.


It is also possible to provide polypeptides binding to a predetermined target that exhibit low antigenicity when used in vivo in a mammal and/or that exhibit an improved biodistribution upon administration to a mammal.


These and other objects are met by the different aspects of the invention as claimed in the appended claims.


In a first aspect the invention provides a population of polypeptide variants based on a common scaffold, each polypeptide in the population comprising the scaffold amino acid sequence









(SEQ. ID. No. 1)









EXXXAXXEIX XLPNLTXXQX XAFIXKLXDD PSQSSELLSE



AKKLNDSQ,.







or in some cases more preferably









(SEQ. ID. No. 2)









AKYAKEXXXAXX EIXXLPNLTX XQXXAFIXKL XDDPSQSSEL



LSEAKKLNDS Q,.






In the sequences above each X individually corresponds to an amino acid residue which is varied in the population.


The population consists of a large number of variants of such polypeptide molecules. In this context a large number means a population comprising at least 1×104 unique polypeptide molecules, or at least 1×106 or at least 1×108 or at least 1×1010, or at least 1×1012, or at least 1×1014 unique polypeptide molecules. However, it is necessary to use a group that is large enough to provide the desired size of the population. The “population” described herein may also be denoted “library”.


It is stated above that each X individually corresponds to an amino acid residue which is varied. This means that each X may be any amino acid residue independent of the identity of any other residue denoted X in the sequence. In the scaffold amino acid sequence the different varied amino acids X may be chosen from all 20 naturally occurring amino acid residues in such a way that any of these 20 naturally occurring amino acid residues may be present at the corresponding X position in any given variant. The selection of amino acid residue in each position is more or less randomized. It is also possible to limit the group from which the different varied amino acid residues are selected to 19, 18, 17, 16 or less of the 20 naturally occurring amino acid residues. The variability in different positions may be adjusted individually, between one, meaning no randomization, up to all 20 amino acids. Random introduction of a smaller subset of amino acids may be obtained by careful selection of the deoxyribonucleotide bases introduced, for example the codons T(A/C)C may be introduced to obtain a random introduction of either serine or tyrosine at a given position in the polypeptide chain. Likewise, the codons (T/C/A/G)CC may be introduced to obtain a random introduction of phenylalanine, leucine, alanine and valine at a given position in the polypeptide chain. The skilled person is aware of many alternatives of deoxyribonucleotide base combinations that may be used to obtain different combinations of amino acids at a given position in the polypeptide chain. The set of amino acids that may appear at a given position in the polypeptide chain may also be determined by the introduction of trinucleotides during the oligonucleotide synthesis, instead of one deoxyribonucleotide base at a time.


The polypeptides comprising the scaffold amino acid sequences given above are novel Affibody® molecules. As such, they are derived from Staphylococcal protein A (SpA). In this context “derived” does not mean that the polypeptides themselves in any way necessarily directly originates from SpA. Instead it means that the scaffold has a sequence and structural resemblance to one SpA domain, where amino acids in the hydrophobic core of the three helical bundle protein are conserved.


Different modifications of, and/or additions to, the polypeptides constituting the population according to the invention may be performed in order to tailor the polypeptides to the specific use intended, without departing from the scope of the present invention. Such modifications and additions are described in more detail below, and may comprise additional amino acids comprised in the same polypeptide chain, or labels and/or therapeutic agents that are chemically conjugated or otherwise bound to the polypeptides constituting the population. In some embodiments additional amino acid residues on the C-terminal end may be preferred. These additional amino acid residues may play a role in the binding of the polypeptide, but may equally well serve other purposes, related for example to one or more of the production, purification, stabilization, coupling or detection of the polypeptide. Such additional amino acid residues may comprise one or more amino acid residues added for purposes of chemical coupling. An example of this is the addition of a cysteine residue at the very first or very last position in the polypeptide chain, i.e. at the N- or C-terminus. A cysteine residue to be used for chemical coupling may also be introduced by replacement of another amino acid on the surface of the protein domain, preferably on a portion of the surface that is not involved in target binding. Such additional amino acid residues may also comprise a “tag” for purification or detection of the polypeptide, such as a hexahistidyl (His6) tag, or a “myc” tag or a “FLAG” tag for interaction with antibodies specific to the tag. The skilled person is aware of other alternatives.


The “additional amino acid residues” discussed above may also constitute one or more polypeptide domain(s) with any desired function, such as another binding function, or an enzymatic function, or a metal ion chelating function, or a fluorescent function, or mixtures thereof.


In a second aspect the invention provides a population of polynucleotides. Each polynucleotide in this population encodes a member of a population of polypeptides described above.


In a third aspect the invention provides a combination of a polypeptide population according to the invention and a polynucleotide population according to the invention wherein each member of the polypeptide population is physically or spatially associated with the polynucleotide encoding that member via means for genotype-phenotype coupling. This physical or spatial association will be more or less strict, depending on the system used.


The means for genotype-phenotype coupling may comprise a phage display system. Phage display systems are well-known to the skilled person, and is, for example, described in Smith G P (1985) Science 228:1315-1317 and Barbas C F et al (1991) Proc Natl Acad Sci USA 88:7978-7982.


Furthermore, the means for genotype-phenotype coupling may comprise a cell surface display system. The cell surface display system may comprise prokaryotic cells, such as Gram+ cells, or eukaryotic cells, such as yeast cells. Cell surface display systems are well-known to the skilled person.


Prokaryotic systems are, for example, described in Francisco J A et al (1993) Proc Natl Acad Sci USA 90:10444-10448 and Lee S Y et al (2003) Trends Biotechnol 21:45-52. Eukaryotic systems are, for example, described in Boder E T et al (1997) Nat Biotechnol 15:553-557 and Gai S A et al (2007) Curr Opin Struct Biol 17:467-473.


Furthermore, the means for genotype-phenotype coupling may comprise a cell free display system. The cell free display system may comprise a ribosome display system, or an in vitro compartmentalization display system, or a system for cis display, or a microbead display system. Ribosome display systems are well-known to the skilled person, and are, for example, described in Mattheakis L C et al (1994) Proc Natl Acad Sci USA 91:9022-9026 and Zahnd C et al (2007) Nat Methods 4:269-279. In vitro compartmentalization systems are well-known to the skilled person, and are, for example, described in Sepp A et al (2002) FEBS Lett 532:455-458. Cis display systems are well-known to the skilled person, and are, for example, described in Odegrip R et al (2004) Proc Natl Acad Sci USA 101:2806-2810. Microbead display systems are well-known to the skilled person, and are, for example, described in Nord O et al (2003) J Biotechnol 106:1-13.


Furthermore, the means for genotype-phenotype coupling may comprise a non-display system such as the protein-fragment complementation assay (PCA). PCA systems are well-known to the skilled person, and are, for example, described in Koch H et al (2006) J Mol Biol 357:427-441.


In a fourth aspect the invention provides a method for selecting a desired polypeptide having an affinity for a predetermined target from a population of polypeptides, comprising the steps:


(a) providing a population of polypeptides as described above;


(b) bringing the population of polypeptides into contact with the predetermined target under conditions that enable specific interaction between the target and at least one desired polypeptide having an affinity for the target; and


(c) selecting, on the basis of said specific interaction, the at least one desired polypeptide from the remaining population of polypeptides.


This method is below called the selection method according to the invention.


Step (a) may comprise the preparatory steps of providing a population of polynucleotides and expressing said population of polynucleotides to yield said population of polypeptides. The means for yielding a population of polypeptides varies depending on the display system used and examples of such means may be found in the genotype-phenotype references above. Each member of said population of polypeptides used in the selection method according to the invention may physically be associated with the polynucleotide encoding that member via means for genotype-phenotype coupling. The means for genotype-phenotype coupling may be one of those discussed above.


Step (b) comprises the steps of bringing the population of polypeptides into contact with the predetermined target under conditions that enable specific interaction between the target and at least one desired polypeptide having an affinity for the target. The range of conditions applicable is determined by the robustness of the target, the robustness of the display system, and by the desired properties of the interaction with the target. For example a specific method of separating the interaction such as acidification to a predetermined pH may be desired. The skilled person knows what experiments are required to determine suitable conditions.


Step (c) comprises the selection of at least one polypeptide. The means for selection of desired polypeptide from the remaining population, based on the specific interaction between the predetermined target and at least one desired polypeptide having affinity for the target varies depending on the display system used and may be found in the genotype-phenotype references above. For example, the in vitro display selection systems are cell free in contrast to systems such as phage display and the protein fragment compartmentalization assay.


In a fifth aspect the invention provides a method for isolating a polynucleotide encoding a desired polypeptide having an affinity for a predetermined target, comprising the steps:

    • selecting said desired polypeptide and the polynucleotide encoding it from a population of polypeptides using the selection method according to the invention; and
    • isolating the thus separated polynucleotide encoding the desired polypeptide.


This method is below called the isolation method according to the invention.


The separation of the polynucleotide from the polypeptide may be done differently depending on the display system used for selection. For example, in the cell free display systems such as cis display and ribosome display the polynucleotide or the corresponding mRNA is retrieved through efficient elution from the polypeptide using means described in the genotype-phenotype references above.


The isolation of the polynucleotide may be done by different methods depending on the display system used for selection. In most of the above described selection systems, for example the protein fragment complementation assay, the polynucleotide can be directly isolated by specific PCR amplification using appropriate oligonucleotides. Exceptionally, as in ribosome display, the polynucleotide can be isolated from the corresponding mRNA using reverse transcription. The various means for isolation of the polynucleotide may be found in the genotype-phenotype references above.


In a sixth aspect the invention provides a method for identifying a desired polypeptide having an affinity for a predetermined target, comprising the steps:

    • isolating a polynucleotide encoding said desired polypeptide using the isolation method according to the invention; and
    • sequencing the polynucleotide to establish by deduction the amino acid sequence of said desired polypeptide.


The sequencing of the polynucleotide may be done according to standard procedures well-known to the skilled person.


In a seventh aspect the invention provides a method for selecting and identifying a desired polypeptide having an affinity for a predetermined target from a population of polypeptides, comprising the steps:


(a) synthesizing each member of the population of polypeptides on a separate carrier or bead;


(b) selecting or enriching the carriers or beads based on the interaction of the polypeptide with the predetermined target; and


(c) identifying the polypeptide by protein characterization methodology. In step (c), it is for example possible to use mass spectrometric analysis.


This method is below called the selection and identification method according to the invention.


In an eighth aspect the invention provides a method for production of a desired polypeptide having an affinity for a predetermined target, comprising the steps:

    • selecting and identifying a desired polypeptide using the selection method according to the invention or the selection and identification method according to the invention; and
    • producing said desired polypeptide.


This method is below called the production method according to the invention.


In the production method according to the invention the production may be carried out using recombinant expression of a polynucleotide encoding the desired polypeptide. The production may also be carried out using chemical synthesis of the desired polypeptide de novo.


In a ninth aspect the invention provides a method for production of a desired polypeptide having an affinity for a predetermined target, comprising the steps:


(a1) isolating a polynucleotide encoding said desired polypeptide using the isolation method according to the invention; or


(a2) backtranslating a polypeptide identified using the selection and identification method according to the invention; and


(b) expressing the thus isolated polynucleotide to produce said desired polypeptide,


wherein step (b) is performed either after step (a1) or step (a2).


The expression of the polynucleotide may be done in any suitable expression host known to the skilled person such as but not limited to bacterial cells, yeast cells, insect cells or mammalian cells.


Expressions like “binding affinity for a predetermined target”, “binding to a predetermined target” and the like refer to a property of a polypeptide which may be directly measured through the determination of the affinity constants i.e. the amount of polypeptide that associates and dissociates at a given antigen concentration. Different methods can be used to characterize the molecular interaction, such as, but not limited to, competition analysis, equilibrium analysis and microcalorimetric analysis, and real-time interaction analysis based on surface plasmon resonance interaction (for example using a Biacore® instrument). These methods are well-known to the skilled person and are described, for example, in Neri D et al (1996) Tibtech 14:465-470 and Jansson M et al (1997) J Biol Chem 272:8189-8197.


The inventors of the present invention have found that a polypeptide binding to a predetermined target, obtained by any of the above mentioned methods may exhibit one or more surprising advantage(s), in comparison with known polypeptides that bind to the same target, while retaining the capacity of those previously known polypeptides to bind the target. Non-limiting examples of such advantages are as follows:

    • A polypeptide, binding to a predetermined target and obtained by any of the above mentioned methods, comprises fewer amino acid residues that could cause problems, such as low yield and success rate, in chemical synthesis of the polypeptide sequence, such as asparagine, arginine, aspartic acid and methionine.
    • A polypeptide, binding to a predetermined target and obtained by any of the above mentioned methods, comprises fewer amino acid residues that confer surface hydrophobicity. This implies fewer problems with low solubility and aggregation. Without wishing to be bound by theory, it is also currently believed that the more hydrophilic characteristics act to shift the biodistribution of the polypeptide upon administration to a host, from a hepatobiliary pathway (excretion through the liver) towards a more desired renal pathway (excretion through the kidneys).
    • A polypeptide, binding to a predetermined target and obtained by any of the above mentioned methods, comprises fewer amino acid residues that are associated with polypeptide stability problems, such as methionine, asparagine and the dipeptide asparagine-proline. Methionine is susceptible to oxidation, asparagine is susceptible to deamidation and the asparagine-proline bond is susceptible to acid cleavage, and they therefore contribute to non-homogeneity of the final product.
    • A polypeptide, binding to a predetermined target and obtained by any of the above mentioned methods, lacks amino acid residues that, in a similar sequence context, have been found to increase the interaction with immunoglobulins containing a heavy chain variable domain from VH3 (Silverman G J (1992) supra). Without wishing to be bound by theory, it is currently believed that the replacement of such amino acid residues in a polypeptide, binding to a predetermined target and obtained by any of the above mentioned methods, reduces the antigenicity of the polypeptide upon administration of the same to a host.


Among the advantages of the inventive scaffold, alkaline stability, low antigenicity, structural stability, improved properties for chemical synthesis and/or increased hydrophilicity are among the most important.


Polypeptides, binding to a predetermined target and obtained by any of the above mentioned methods, may be used as detection reagents, capture reagents, separation reagents, diagnostic agents for diagnostics in vivo or in vitro, as therapeutic agents in their own right or as means for targeting other therapeutic and/or diagnostic agents to the predetermined target. Methods that employ the polypeptides according to the invention in vitro may be performed in different formats, such as in microtiter plates, in protein arrays, on biosensor surfaces, on tissue sections, and so on.


The modifications discussed above for the polypeptides constituting the population according to the invention are also applicable to the polypeptides obtained by any of the above mentioned methods.


Polypeptides according to the invention may be produced by any known means, including chemical synthesis or expression in different prokaryotic or eukaryotic hosts, including plants and transgenic animals.


The invention will now be illustrated in detail through the description of experiments conducted in accordance therewith. The examples which follow are not to be interpreted as limiting. In the examples, reference is made to the appended figures.





BRIEF DESCRIPTION OF THE FIGURES


FIG. 1 shows result obtained from CD measurements, using Jasco J-810 spectro polarimeter. The variable temperature measurement of His6-ZTNF-α:3230 was performed at 0.5 mg/ml in PBS buffer. The absorbance was measured at 221 nm from 20 to 80° C., with a temperature slope of 5° C./min. A cell with an optical path-length of 1 mm was used. The melting temperature (Tm) of His6-ZTNF-α:3230 was determined from the variable temperature measurement.



FIG. 2 shows an overview of the selection described in Example 4. Selection was performed in two different tracks, one with a high target concentration (track 1) and one with a low target concentration (track 2). Target concentrations are given for each track and cycle as well as the number of washes (within parentheses).



FIG. 3 is an overlay plot of two CD spectra before (full line) and after (dashed line) heating of His6-Z04674 to 96° C.



FIG. 4 shows the result of a Biacore analysis of polypeptide variants; sensorgrams obtained after sequential injection of His6-Z04777 (filled rectangles), His6-Z04687 (filled triangles), His6-Z04665 (open triangles), His6-Z04674 (black line), His6-Z04781 (grey line) and running buffer (open rectangles) over immobilized Dynazyme. Response (in RU) was plotted against time (s).



FIG. 5 shows analytical HPLC elution profiles for polypeptides with the sequence maESEKYAKEMR NAYWEIALLP NLTNQQKRAF IRKLYDDPSQ SSELLSEAKK LNDSQAPK at the synthesis stage of amino acid residues 18 to 58. A) Synthesis performed on polystyrene resin using pseudoprolines in positions 22-23, 41-42, 45-46 and 53-54. B) Standard peptide synthesis on polystyrene resin without pseudoprolines.



FIG. 6 shows analytical HPLC elution profiles for polypeptides with the sequence maESEKYAKEMR NAYWEIALLP NLTNQQKRAF IRKLYDDPSQ SSELLSEAKK LNDSQAPK at the synthesis stage of amino acid residues 1 to 58 (A) and 10 to 58 (B). A) Synthesis performed on polystyrene resin using pseudoprolines in positions 22-23, 41-42, 45-46 and 53-54. B) Standard peptide synthesis on polystyrene resin without pseudoprolines.



FIG. 7 shows analytical HPLC elution profiles for polypeptides with the sequence A) AEAKYAKEMW IAWEEIRNLP NLNGWQMTAF IAKLLDDPSQ SSELLSEAKK LNDSQAPKC (according to the invention) and B) AENKFNKEMW IAWEEIRNLP NLTGWQMTAF IASLLDDPSQ SANLLAEAKK LNDAQAPK (for comparison).





EXAMPLES
Example 1
Construction of a Combinatorial Polypeptide Library

A combinatorial library of polypeptides was constructed essentially as described in Grönwall C et al (2007) J Biotechnol 128:162-183, by PCR amplification of a 123-nucleotide template oligonucleotide with certain degenerate codons (5′-GTA GAT GCC AAA TAC GCC AAA GAA NNN NNN NNN GCG NNN NNN GAG ATC NNN NNN TTA CCT AAC TTA ACC NNN NNN CAA NNN NNN GCC TTC ATC NNN AAA TTA NNN GAT GAC CCA AGC CAG AGC-3′) encoding helices 1 and 2 of the Staphylococcus aureus protein A-derived protein Z (Nilsson et al (1987), supra), with point mutations N3A, F5Y, N6A, N23T and S33K. The PCR amplification was performed using the primers AFFI-1364 and AFFI-1365 with an Xho I site and a Sac I site, respectively, underlined in Table 1.


The resulting gene fragment encoding the library was restricted with Xho I and Sac I. Subsequently, the library-encoding gene fragment was ligated into an Xho I- and Sac I-restricted phagemid vector adopted for phage display denoted pAY2016, essentially based on the phagemid vector pAffi1 (Grönwall C et al (2007), supra), in frame with amino acid residues 41-58 of protein Z, encoding helix 3 with point mutations A42S, N43E, A46S and A54S. Helix 3 was constructed by annealing of the two complementary oligonucleotides AFFI-1333 and AFFI-1334 (Table 1).


The resulting library vector was electroporated into Escherichia coli strain RR1ΔM15 (Ruther U (1982) Nucl Acids Res 10:5765-5772), yielding a library of 2.4×1010 members.


Preparation of Phage Stocks from the Library was Performed Using standard procedures involving M13K07 helper phage (New England Biolabs, Beverly, Mass., USA), routinely yielding phage titers of approximately 1011 cfu per ml cultivation.









TABLE 1







List of oligonucleotides








Name
Sequence 5′-3′





AFFI-1333
AGCTCTGAATTACTGAGCGAAGCTAAAAAGCTAAATGATAG



CCAGGCGCCGAAAGTAGACTAC





AFFI-1334
GTAGTCTACTTTCGGCGCCTGGCTATCATTTAGCTTTTTAG



CTTCGCTCAGTAATTCAGAGCT





AFFI-1364
AAATAAATCTCGAGGTAGATGCCAAATACGCCAAAG





AFFI-1365
TAAATAATGAGCTCTGGCTTGGGTCATC









Example 2
Phage Display Selection and Characterization of Human HER2 Binding Polypeptide Variants
Summary

Biotinylated HER2 protein is used as target in phage display selections using the library constructed in Example 1. Selections are carried out using a variety of conditions in order to maximize the likelihood of obtaining molecules having a high affinity for HER2. After elution of selected phages, the corresponding expressed proteins are tested for affinity to HER2 in an ELISA setup. Positive clones are identified and sequenced, and the predicted amino acid sequences of the corresponding polypeptides and their HER2 binding motifs are deduced, which yields a large number of sequences of HER2 binding molecules.


Biotinylation of HER2

Lyophilized human HER2 protein (R&D Systems, #1129-ER) is dissolved in PBS (2.68 mM KCl, 1.47 mM KH2PO4, 137 mM NaCl, 8.1 mM Na2HPO4, pH 7.4) to a final concentration of 10 mg/ml. EZ-link Sulfo-NHS-LC-Biotin (Pierce, #21335) is dissolved in water to a final concentration of 1 mg/ml and a 5 and 30 fold molar excess is added to 500 μg HER2 in a total volume of 0.5 ml. The mixtures are incubated at room temperature (RT) for 30 min. Unbound biotin is removed by dialyzing against PBS using a dialysis cassette (Slide-A-Lyser, 10 kDa; Pierce).


Phage Display Selection

In total, five rounds of selection are carried out, using increasingly stringent conditions, such as decreasing HER2 concentration and increasing numbers of washes. Three initial rounds are performed, chiefly with a view to establish a suitable selection protocol. Selection is then carried out for two more cycles using the combinations of selection buffer, target concentration and solid support that are listed in Table 2.









TABLE 2







Selection conditions for HER2 selection












Sample
Selection buffer

Streptavidin



name
supplement
Target conc. (nM)
beads (μg)















Cycle 4
A
Gelatin
20
100



B
Gelatin
10
100



C
BSA
5
100



D
BSA
2.5
100


Cycle 5
A
Gelatin
10
50



B
Gelatin
5
50



C
BSA
1
50



D
BSA
0.5
50









All tubes and beads (Dynabeads® M-280 Streptavidin, #112.06; Dynal) used in the selection procedure are pre-blocked in TPBSB (5%) (0.05% Tween20, 5% bovine serum albumin (BSA), 0.02% Na azide in PBS) or gelatin (0.5%) for at least 30 min at RT.


Selection solutions (1 ml) contained biotinylated human HER2, phages, Na azide (0.02%), Tween 20 (0.05%) and either BSA (3%) or gelatin (0.1%) according to Table 2, and are prepared in PBS. The phages are incubated with biotinylated human HER2 target at 4° C. during three days for Cycle 4 and during one day for Cycle 5, followed by 1 h incubation under agitation at RT. The selection samples are transferred to blocked streptavidin beads for 15 min under agitation at RT. The beads are washed 10 times with 1 ml of selection buffer (i.e. TPBSB (3%) (0.05% Tween20, 3% bovine serum albumin (BSA), 0.02% Na azide in PBS) or GT 0.1 (0.1% gelatin, 0.1% Tween 20 and 0.02% Na azide in PBS)), followed by 10 washes with PBS where the second last wash is performed for 5 min. Phages are either eluted with 1000 μl 50 mM glycine-HCl, pH 2.2, for 10 min at RT, followed by immediate neutralization with 900 μl PBS supplemented with 100 μl 1 M Tris-HCl, pH 8.0, or eluted with 1000 μl trypsin (2 mg/ml) for 30 min at RT followed by addition of 1000 μl aprotinin (0.4 mg/ml). The eluted phages (¾ of the volume) are used to infect 50 ml log phase E. coli RR1ΔM15 cells (Rüther, 1982, supra) after each cycle of selection. After 30 min incubation with gentle agitation and 30 min with vigorous agitation at 37° C., the cells are centrifuged and the pellet is dissolved in a smaller volume and spread on TYE plates (15 g/l agar, 10 g/l tryptone water (Merck), 5 g/l yeast extract, 3 g/l NaCl supplemented with 2% glucose and 100 μg/ml ampicillin) and finally incubated over night at 37° C.


Phage Stock Preparation

Cells from plates are re-suspended in TSB medium (30 g/l tryptic soy broth) and the cell concentration is determined by measuring the optical density at 600 nm assuming that OD600=1 corresponds to 5×108 cells/ml. Cells are inoculated (approximately 100 times excess of cells compared to eluted phages) in 100 ml TSB+YE medium supplemented with 2% glucose and 100 μg/ml ampicillin and grown at 37° C. to approximately OD600=0.5-0.7. Thereafter, 10 ml are transferred to a new flask and infected by 10 times molar excess of M13K07 helper phage (New England Biolabs, #NO315S) and incubated for 30 min with low agitation. Cells are pelleted at 2000 g for 10 min and resuspended in 100 ml TSB+YE medium supplemented with 100 μM isopropyl β-D-1-thiogalactopyranoside (IPTG), 50 μg/ml kanamycin and 100 μg/ml ampicillin and grown over night at 100 rpm and 25° C. A portion of the resuspended cells is stored at −80° C. as a glycerol stock.


The overnight culture is centrifuged at 2500 g for 10 min and phages in the supernatant are precipitated by adding ¼ of the volume of precipitation buffer (20% PEG/2.5 M NaCl) and incubated on ice for 1 hour. Precipitated phages are pelleted by centrifugation at 10000 g at 4° C. for 30 min, resuspended in 20 ml PBS and thereafter the precipitation procedure is repeated. The phages are finally resuspended in 1 ml PBS and filtered through a 0.45 μm filter.


Selection, wash and elution solutions are titrated after each round of selection. Phage solutions are diluted in sterile water in a microtiter plate and 100 μl log phase E. coli RR1ΔM15 cells are added to each phage dilution. After 20 min incubation at RT, 5 μl from each titration are transferred to a TYE plate and incubated over night at 37° C. The resulting colonies are counted and the titers (cfu/ml) calculated.


ELISA Analysis of HER2 Binding

Clones from the final selection cycles are expressed and screened for HER2 binding activity using an ELISA setup as described in Example 4 below (but using HER2 as target protein), or as described below. Randomly picked colonies are expressed in 96 deep-well plates by inoculating each colony into 1 ml TSB+YE medium supplemented with 100 μg/ml ampicillin and 1 mM IPTG and grown for 18-24 hours at 37° C. After incubation, replicate plates are made by transferring a small fraction of each culture to 96-well plates with 15% glycerol for storage at −20° C.


Remaining cells are pelleted by centrifugation at 3000 g for 10 min, re-suspended in 400 μl PBS-T 0.05 (PBS supplemented with 0.05% Tween 20) and frozen at −80° C. Frozen samples are thawed in a water bath and cells are pelleted at 3700 g for at least 20 min. Supernatants containing expressed molecules are collected and used in ELISA.


Half area microtiter wells (Costar, #3690) are coated over night at 4° C. with 50 μl of HSA at a concentration of 6 μg/ml in ELISA coating buffer (Sigma, #3041). The wells are blocked with 100 μl blocking buffer (2% non fat dry milk in PBS) for 2 h at RT. After removal of the blocking buffer, 50 μl of the prepared proteins are added to the wells, and plates are incubated for 1.5 h at RT. Supernatants are discarded, and biotinylated HER2 at a concentration of 0.5-10 μg/ml in PBS-T 0.05 is added to the wells and incubated for 1.5 h. Bound complexes are detected with horse radish peroxidase conjugated streptavidin (HRP, Dako, #P0397) diluted 1:5000 in PBS-T 0.05, incubated for 1 h at RT. 50 μl ImmunoPure® TMB substrate (Pierce, #34021) are added to the wells and the plates are treated according to the manufacturer's recommendations. Absorbance of the wells is read at 450 nm in a Tecan Ultra 384 ELISA reader (Tecan) and evaluated using Magellan v. 5.0 software (Tecan). Prior to addition of each new reagent, four washes are done with PBS-T 0.05.


Based on the result of this experiment, clones are picked for sequencing as described next.


Sequencing of ELISA Positive Clones

PCR fragments from selected colonies are amplified using appropriate oligonucleotides. Sequencing of amplified fragments is performed using a BigDye® Terminator v3.1 Cycle Sequencing Kit (Applied Biosystems) according to the manufacturer's recommendations and with the appropriate biotinylated oligonucleotide. The sequencing reactions are purified by binding to Dynabeads® REGEN™ streptavidin-coated paramagnetic beads using a Magnatrix 8000 instrument (Magnetic Biosolutions), and finally analyzed on ABI PRISM® 3100 Genetic Analyser (Applied Biosystems).


Sub-Cloning into Plasmid pAY1448


DNA encoding selected and HER2-specific molecules is sub-cloned into the expression vector pAY1448 to create His6-tagged monomeric molecules expressed as MGSSHHHHHHLQ-[Z#####]-VD (His6-Z#####), wherein Z##### denotes an identified member of the starting population of variant molecules. Plasmids containing inserts are purified from 2 ml overnight cultures of E. coli RR1ΔM15 cells in TSB supplemented with 100 μg/ml ampicillin using Qiagen Mini Kit (Qiagen) according to manufacturer's recommendations.


DNA of selected molecules is sub-cloned into the expression vector pAY1448 by AccI-NotI PCR sticky end cloning using the appropriate PCR primer pairs.


The expression vector pAY1448 is digested in two steps at 37° C. for 4 h using AccI and NotI in NEB4 and NEB3 buffer (New England Biolabs), respectively, and dephosphorylated with calf intestinal alkaline phosphatase (CIAP; Fermentas) for 1 h at 37° C. The cleaved plasmid and fragments are purified by QIAquick PCR purification kit (Qiagen) according to the manufacturer's recommendations.


The PCR products are hybridized and ligated into AccI-NotI digested and dephosphorylated pAY1448 for 1 h at RT using T4 DNA ligase (5 units/μl; Fermentas). Aliquots of the ligations are electroporated into E. coli BL21(DE3) cells. The cells are plated on tryptose blood agar base (TBAB) plates supplemented with 50 μg/ml kanamycin and incubated over night at 37° C. Positive clones are first verified for inserts with PCR screening and then analyzed for correct sequences as described above.


Expression and Purification of His6-Tagged Polypeptides

Selected molecules, all sub-cloned into pAY1448 as described above, are expressed in E. coli BL21(DE3) as fusions to an N-terminal His6-tag and purified by IMAC. A colony of each molecule is used to inoculate 5 ml TSB medium supplemented with 50 μg/ml kanamycin. The cultures are grown over night at 37° C. The following day, 50 μl of each culture are inoculated separately to 100 ml TSB+YE medium supplemented with 50 μg/ml kanamycin in a 1 liter flask. The cultures are grown at 100 rpm at 37° C. to an OD600 of 0.7-1, after which IPTG is added to a final concentration of 0.5 mM and cells are incubated at RT over night at 100 rpm. Cultures are harvested by centrifugation at 8000 g for 5 minutes and pellets are stored in a freezer until protein preparation.


The His6-tagged proteins are IMAC purified under denatured conditions using 1.5 ml Ni-NTA Superflow columns (Qiagen). The buffer is exchanged to PBS using PD-10 columns (GE Healthcare).


Protein concentration is determined using A280 and the BCA Protein Assay Reagent Kit (Pierce) as recommended by the manufacturer. The purity of the proteins is analyzed by SDS-PAGE stained with Coomassie Blue R.


Biosensor Analysis of Selected Molecules' Affinity for Human HER2

Biosensor analysis on a Biacore2000 instrument (GE Healthcare) is performed with human HER2 immobilized by amine coupling onto the carboxylated dextran layer on the surface of a CM-5 chip (research grade; GE Healthcare) according to the manufacturer's recommendations. Surface 1 on the chip is activated and deactivated and used as reference cell during injections. The selected molecules, expressed and purified as described above, are diluted in HBS-EP (GE Healthcare) to 25 nM and injected at a constant flow-rate of 25 μl/min for 10 minutes, followed by dissociation in HBS-EP for 30 minutes. The surfaces are regenerated with two injections of 25 mM HCl.


Example 3
Cloning, Production and Evaluation of Melting Temperature and In Vitro Antigenicity of Original and Inventive Scaffold Variants
Summary

This example describes the cloning, production and evaluation of original and inventive scaffold variants. The introduced scaffold mutations are believed to improve several properties of the polypeptide molecules, such as antigenicity, hydrophilicity and alkaline and structural stability. Thus, different molecules were evaluated for melting temperature and in vitro antigenicity and the results showed that inventive molecules had increased melting temperatures and displayed lower in vitro antigenicities (lower IgG binding) as compared to original molecules.


Cloning of Polypeptides

For original constructs, DNA sequences encoding molecules specific for Tumor Necrosis Factor-alpha (TNF-α), HER2, insulin, Taq polymerase and Platelet Derived Growth Factor-Receptor beta (PDGF-Rβ) (Table 3) were amplified by PCR in two individual reactions each (PCR1 and PCR2). Primer pairs AFFI-267/AFFI-1014 and AFFI-1015/AFFI-270 (Table 4), encoding parts of the AccI restriction site in the 5′-ends, were applied in PCR1 and PCR2 respectively. To prepare the plasmid templates, bacteria harboring the plasmid DNA were grown overnight in TSB medium, supplemented with 50 μg/ml of kanamycin. The cells were pelleted by centrifugation and plasmids were prepared using QIAprep Spin Miniprep Kit (Qiagen).


For inventive constructs, PCR amplification (PCR1 and PCR2) of nucleotide sequences encoding modified, inventive molecules was performed using partially overlapping oligonucleotides as templates (AFFI-1320-AFFI-1323, AFFI-1326 and AFFI-1327) or using vector with original construct and oligonucleotides containing relevant mutations (AFFI-69, AFFI-70, AFFI-1151 and AFFI-1152) (Table 4). Primer pairs AFFI-1328/AFFI-1331 and AFFI-1329/AFFI-1330, encoding parts of the AccI restriction site in the 5′-ends, were included in the PCR reactions.


The PCR reactions were amplified using Pfu Turbo DNA polymerase (Stratagene, #600854-52) according to a standard PCR protocol and the PCR products were analyzed by 1% agarose gel electrophoresis.


The PDGF-Rβ binding Z variants were generated using oligonucleotides with varied codons and a PCR based mutagenesis technique. Obtained PCR fragments were ligated into a cleaved expression vector using In-Fusion technology (Clontech, #639607).


To generate DNA fragments containing upstream and downstream AccI sticky-ends for all constructs, forward and reverse nucleotide strands of the PCR1 and PCR2 products were separated using magnetic streptavidin beads. After 30 min incubation at RT under continuous rotation, the beads were washed with wash buffer (50 mM Tris-HCl pH 7.5, 10 mM MgCl2, 10 mM DTT) and heated to 95° C. for 5 min. The supernatant containing the non-biotinylated fragments was collected and heated to 95° C., followed by stepwise cooling to 25° C. during 30 min to hybridize the DNA strands.


The DNA fragments encoding binding molecules were subsequently ligated at RT, either for 2 h or overnight, into a CIP-treated (calf intestinal alkaline phosphate) and purified expression vector, previously digested with AccI restriction enzyme. The achieved constructs were MGSSHHHHHHLQ-[Z#####]-VD, MGSSLQ-[Z#####]-VDC (for ZPDGF-Rβ:2465) or M-[Z#####]-C (for ZPDGF-Rβ:3358).


The ligations were transformed into electrocompetent E. coli TOP10 cells and cultivated on plates as described in Example 2. Bacterial colonies harboring the newly constructed plasmids were PCR screened, and the insert DNA sequences were verified as described in Example 2.


Verified plasmids were prepared as described earlier.


Expression of Polypeptides


E. coli BL21(DE3) cultures transformed with relevant plasmids were inoculated into 800 ml TSB-YE medium supplemented with 50 μg/ml kanamycin and 0.3 ml/l anti-foam agent (Breox FMT 30) and grown at 37° C. to an OD600 of approximately 2. Protein expression was then induced by addition of 1 M IPTG to a final concentration of 0.5 mM. The cultivations were performed using the multifermenter system Greta (Belach). The cultures were harvested 5 h after induction by centrifugation at 15 900×g for 20 min. Supernatants were discarded and the cell pellets collected and stored at −20° C. The protein expression level was determined using SDS-PAGE and ocular inspection of stained gels.


Purification of Expressed Polypeptides

Proteins with His6 tag were purified as follows: Pelleted bacterial cells harboring soluble His6 tagged polypeptides were suspended in His GraviTrap binding buffer (20 mM sodium phosphate, 0.5 M NaCl, 20 mM imidazole and 40 U/ml Benzonase®) and disrupted by ultrasonication. After clarification, the supernatants were loaded on His GraviTrap columns (GE Healthcare) previously equilibrated with His GraviTrap binding buffer. After washing the columns with 10 column volumes (CV) of His GraviTrap washing buffer (20 mM sodium phosphate, 0.5 M NaCl, 60 mM imidazole), the polypeptides were eluted with 3 CV His GraviTrap elution buffer (20 mM sodium phosphate, 0.5 M NaCl, 500 mM imidazole).


Proteins without His6 tag were purified as follows: Pelleted bacterial cells harboring soluble ZPDGF-Rβ-2465-Cys or ZPDGF-Rβ:3358-Cys were suspended in 20 mM Tris-HCl, pH 7.1. To disrupt the cells and release the intracellular content, the cell suspensions were heated to 85° C. for 3 minutes. The lysates were clarified by centrifugation followed by filtration, and loaded on 25 ml Q Sepharose FF (GE Healthcare) packed in an XK26 column (GE Healthcare), previously equilibrated with 20 mM Tris-HCl, pH 7.1. After column wash with 5 CV 20 mM Tris-HCl, pH 7.1, bound proteins were eluted with a linear gradient of 0-0.5 M NaCl in 20 mM Tris-HCl, pH 7.1, during 10 CV. The flow rate was 5 ml/min and the 280 nm signal was monitored. Fractions containing ZPDGF-Rβ:2465-Cys or ZPDGF-Rβ:3358-Cys were identified by SDS-PAGE analysis. Relevant fractions were pooled and pH was adjusted to 8.0 by addition of 1 M Tris-HCl, pH 8.0, to a final concentration of 50 mM. The C-terminal cysteine on the constructs was reduced by addition of DTT to 20 mM, followed by incubation at 40° C. for 3 minutes. After reduction, acetonitrile (ACN) was added to a final concentration of 5% and reduced ZPDGF-Rβ:2465-Cys or ZPDGF-Rβ:3358-Cys was loaded on 1 ml Resource 15 RPC columns (GE Healthcare), previously equilibrated with RPC A Buffer (0.1% TFA, 5% ACN, 95% water). After column wash with 10 CV RPC A Buffer, bound proteins were eluted with a linear gradient of 0-40% RPC B Buffer (0.1% TFA, 80% ACN, 20° A) water). The flow rate was 1 ml/min and the 280 nm signal was monitored. Fractions containing pure ZPDGF-Rβ:2465-Cys or ZPDGF-Rβ:3358-Cys were identified by SDS-PAGE analysis and pooled.


To enable lyophilization of the proteins, the buffer was exchanged to either 10 mM ammonium hydrogen carbonate buffer, pH 8.0, or 10 mM ammonium acetate buffer, pH 6.0, using disposable PD-10 desalting columns (GE Healthcare). The lyophilization buffer was chosen in regard to the isoelectric point of relevant proteins. Finally, the binding polypeptides His6-ZTNF-α:185, His6-ZHER2:342, His6-ZInsulin:810, His6-ZTaq:1154, ZPDGF-Rβ:2465-Cys, His6-ZHER2:2628, His6-ZTaq:3229, His6-ZTNF-α:3230, His6-ZInsulin:3232 and ZPDGF-Rβ:3358-Cys were lyophilized using a Christ Alpha 2-4 LSC instrument and stored at 4° C. until use (Table 5). The free C-terminal cysteine was blocked using N-ethylmalemide (NEM) according to the manufacturer's recommendations (Pierce).


Analysis of Purified Polypeptides

Determination of the concentration of polypeptide solutions was performed by measuring the absorbance at 280 nm using a NanoDrop® ND-1000 Spectrophotometer. The proteins were further analyzed with SDS-PAGE and LC-MS.


For the SDS-PAGE analysis, approximately 10 μg polypeptide was mixed with LDS Sample Buffer and DTT (45 mM final concentration), incubated at 70° C. for 15 min and loaded onto NuPAGE® 4-12% Bis-Tris Gels. The gels were run with MES SDS Running Buffer in a Novex Mini-Cell employing the SeeBlue® Plus2 Prestained Standard as molecular weight marker and PageBlue™ Protein Staining Solution for staining.


To verify the identity of the polypeptides, LC/MS analyses were performed using an Agilent 1100 LC/MSD system, equipped with API-ESI and a single quadruple mass analyzer. After buffer exchange, protein samples were diluted in lyophilization buffer to a final concentration of 0.5 mg/ml and 10 μl were loaded on a Zorbax 300SB-C8 Narrow-Bore column (2.1×150 mm, 3.5 μm) at a flow-rate of 0.5 ml/min. Proteins were eluted using a linear gradient of 10-70% solution B for 30 min at 0.5 ml/min. The separation was performed at 30° C. The ion signal and the absorbance at 280 and 220 nm were monitored. The molecular weights of the purified proteins were determined by analysis of the ion signal.


Determination of Melting Temperature (Tm)

Lyophilized polypeptides were dissolved in PBS to a final concentration of approximately 0.5 mg/ml and stored on ice. CD analysis was performed on a Jasco J-810 spectropolarimeter in a cell with an optical path-length of 1 mm. In variable temperature measurements, the absorbance was measured at 221 nm from 20 to 80° C., with a temperature slope of 5° C./min. Melting temperatures (Tm) for the tested polypeptides were calculated by determining the midpoint of the transition in the CD vs temperature plot.


The polypeptide molecules modified in accordance with the invention had increased melting temperatures as compared to the original molecules (Table 6). In FIG. 1, the obtained melting curve for His6-ZTNF-α:3230 (inventive TNF-α specific polypeptide) is shown.


In Vitro Antigenicity ELISA (Analysis of IgG Binding in Serum)

The general conditions for the ELISA were as follows: the ELISA assays were performed in half area, 96-well plates. Volumes used were 50 μl per well for all incubations except for blocking where 100 μl was used. Coating was done over night at 4° C. in coating buffer (15 mM Na2CO3 and 35 mM NaHCO3), and all other incubations were performed at room temperature. Dilution of primate serum and detection antibodies was made in PBS+0.5% casein. All washes were done using an automatic ELISA Scan Washer 300, where each well was washed four times with 175 μl washing buffer (PBS-T; 0.05% Tween 20 in 1×PBS) per wash.


The wells of the ELISA plate were coated with 2 μg/ml of the binding polypeptides His6-ZTNF-α:185, His6-ZHER2:342, His6-ZInsulin:810, His6-ZTaq:1154, ZPDGF-Rβ:2465-Cys-NEM, His6-ZHER2:2628, His6-ZTaq:3229, His6-ZTNF-α:3230, His6-ZInsulin:3232 and ZPDGF-Rβ:3358-Cys-NEM. ZHER2:342 was used as standard. After coating, the wells were washed twice with tap water and blocked with PBS+0.5% casein. The plate was emptied and a 2-fold dilution series of a primate serum pool from cynomolgus monkey (MAccaca fascicularis; obtained from Swedish Institute for Infectious Disease Control) was added to the wells. The titration series started with a 1/100 dilution and ended at 1/102400. The dilution was done directly in the 96-well plate. After incubating one hour with the primate serum pool, the plate was washed and a goat anti-human Ig-HRP antibody was added in dilution 1/5000 for detection. After 50 minutes incubation with the detection antibody, the plate was washed and the substrate added. Equal volumes of the two components in the ImmunoPure® TMB kit were mixed, and 50 μl was added per well. Subsequently, the plate was incubated in the dark for 12 minutes, and the reaction was stopped by addition of 50 μl stop solution (2 M H2SO4). The absorbance at 450 nm was recorded using an ELISA reader. As negative control, PBS+0.5% casein was used instead of the primate serum pool.


To evaluate the results and to obtain an IVA value that represents the level of primate Ig-molecules binding to the polypeptide, the program GraphPad Prism 5 was used. Sample values, with background OD values subtracted, were added to a template based on a XY-non-linear regression (sigmoidal dose response) formula. A dilution value for OD 0.3 was obtained from the formula and the IVA values were calculated by setting standard dilution value to 100 and by relating all samples to 100. A value below 100 indicates a decreased ability of the tested polypeptide to bind to immunoglobulins as compared to the ZHER2:342 molecule used as a positive control.


The inventive molecules showed less potential to bind immunoglobulins as compared with original molecules (Table 7). The results are shown as in vitro antigenicity (IVA) values, and a reduced in vitro antigenicity (IgG binding) is read as a decrease in the IVA value.









TABLE 3







List of binding polypeptide sequences








Name
Amino acid sequence





ZTNF-α:185
VDNKFNKELGWAIGEIGTLPNLNHQQFRAFILSLWDD



PSQSANLLAEAKKLNDAQAPK





ZHER2:342
VDNKFNKEMRNAYWEIALLPNLNNQQKRAFIRSLYDD



PSQSANLLAEAKKLNDAQAPK





ZInsulin:810
VDNKFNKEKYMAYGEIRLLPNLNHQQVMAFIDSLVDD



PSQSANLLAEAKKLNDAQAPK





ZTaq:1154
VDNKFNKEKGEAVVEIFRLPNLNGRQVKAFIASLYDD



PSQSANLLAEAKKLNDAQAPK





ZPDGF-Rβ:2465
VDNKFNKELIEAAAEIDALPNLNRRQWNAFIKSLVDD



PSQSANLLAEAKKLNDAQAPK
















TABLE 4







List of oligonucleotides








Name
Sequence 5′-3′





AFFI-069
GTGAGCGGATAACAATTCCCCTC





AFFI-070
CAGCAAAAAACCCCTCAAGACCC





AFFI-115
CAGCAAAAAACCCCTCAAGACCC





AFFI-267
AGATAACAAATTCAACAAAG





AFFI-270
CTACTTTCGGCGCCTGAGCATCATTTAG





AFFI-1014
ACTTTCGGCGCCTGAGCATCATTTAG





AFFI-1015
ATAACAAATTCAACAAAGAA





AFFI-1043
ACTTTCGGCGCCTGAGAATCATTTAGCTTTTTA





AFFI-1044
CTACTTTCGGCGCCTGAGAATCATTTAGCTTTTTA





AFFI-1143
AGATGCCAAATACGCCAAAGAAATGCGAA





AFFI-1144
ATGCCAAATACGCCAAAGAAATGCGAA





AFFI-1151
CCCAAGCCAAAGCTCTGAATTGCTATCAGAAGCTAAAAAGC





AFFI-1152
GCTTTTTAGCTTCTGATAGCAATTCAGAGCTTTGGCTTGGG





AFFI-1320
AGATGCCAAATACGCCAAAGAAAAGGGGGAGGCGGTGGTT



GAGATCTTTAGGTTACCTAACTTAACCGGGAGGCAAGTGAA



GGCCTTCATCGCGAAATTATA





AFFI-1323
CTACTTTCGGCGCCTGGCTATCATTTAGCTTTTTAGCTTCG



CTCAGTAATTCAGAGCTCTGGCTTGGGTCATCCCATAATTT



AAGGATGAAGGCCCGAAATT





AFFI-1326
AGATGCCAAATACGCCAAAGAAAAGTATATGGCGTATGGTG



AGATCCGGTTGTTACCTAACTTAACCCATCAGCAAGTTATG



GCCTTCATCGATAAATTAGT





AFFI-1327
CTACTTTCGGCGCCTGGCTATCATTTAGCTTTTTAGCTTCG



CTCAGTAATTCAGAGCTCTGGCTTGGGTCATCCACTAATTT



ATCGATGAAGGCCATAACTT





AFFI-1328
AGATGCCAAATACGCCAAAG





AFFI-1329
ATGCCAAATACGCCAAAGAA





AFFI-1330
CTACTTTCGGCGCCTGGCTATCATTTAG





AFFI-1331
ACTTTCGGCGCCTGGCTATCATTTAG
















TABLE 5







List of tested polypeptides











Target
Designation
Variant







TNF-alpha
His6-ZTNF-α:185
Original



TNF-alpha
His6-ZTNF-α:3230
Inventive



HER2
ZHER2:342
Original



HER2
His6-ZHER2:342
Original



HER2
His6-ZHER2:2628
Inventive



Insulin
His6-ZInsulin:810
Original



Insulin
His6-ZInsulin:3232
Inventive



Taq polymerase
His6-ZTaq:1154
Original



Taq polymerase
His6-ZTaq:3229
Inventive



PDGF-Rβ
ZPDGF-Rβ:2465-Cys
Original



PDGF-Rβ
ZPDGF-Rβ:3558-Cys
Inventive

















TABLE 6







Determined Tm values of tested polypeptides










Target
Designation
Variant
Tm (° C.)





TNF-alpha
His6-ZTNF-α:185
Original
53


TNF-alpha
His6-ZTNF-α:3230
Inventive
60


HER2
His6-ZHER2:342
Original
63


HER2
His6-ZHER2:2628
Inventive
69


Insulin
His6-ZInsulin:810
Original
42


Insulin
His6-ZInsulin:3232
Inventive
48


Taq polymerase
His6-ZTaq:1154
Original
46


Taq polymerase
His6-ZTaq:3229
Inventive
50


PDGF-Rβ
ZPDGF-Rβ:2465-Cys-NEM
Original
42


PDGF-Rβ
ZPDGF-Rβ:3558-Cys-NEM
Inventive
42
















TABLE 7







IVA values of tested polypeptides










Target
Designation
Variant
IVA-value













TNF-alpha
His6-ZTNF-α:185
Original
38


TNF-alpha
His6-ZTNF-α:3230
Inventive
21


HER2
His6-ZHER2:342
Original
99


HER2
His6-ZHER2:2628
Inventive
14


Insulin
His6-ZInsulin:810
Original
43


Insulin
His6-ZInsulin:3232
Inventive
16


Taq polymerase
His6-ZTaq:1154
Original
26


Taq polymerase
His6-ZTaq:3229
Inventive
18


PDGF-Rβ
ZPDGF-Rβ:2465-Cys-NEM
Original
35


PDGF-Rβ
ZPDGF-Rβ:3558-Cys-NEM
Inventive
3









Example 4
Phage Display Selection and Characterization of Dynazyme Binding Polypeptide Variants
Biotinylation of Dynazyme

The target protein Dynazyme II DNA polymerase (Dynazyme) from species Thermus brockianus (Finnzymes, #F-501L) was biotinylated using a 10× molar excess of No-weight™ Sulfo-NHS-LC-biotin (Pierce, #21327) according to the manufacturer's protocol. Buffer was changed by dialysis using Slide-a-lyzer dialysis cassette (Pierce, 10K, 0.5-3 ml) to PBS prior to biotinylation and to TKMT (10 mM Tris-HCl, 50 mM KCl, 1.5 mM MgCl2, 0.1% Triton X-100, pH 8.8) after biotinylation to remove unbound biotin.


Phage Display Selection

Selection was performed against biotinylated Dynazyme using the inventive population of polypeptides (Example 1). Two approaches for selection were utilized; one with a high target concentration (track 1) and one with a low target concentration (track 2). Four selection cycles were performed. New phage stocks were prepared between each cycle. For selection overview and details, see FIG. 2.


Phage library stock was PEG/NaCl precipitated twice as described in Example 2 and dissolved in TKMT supplemented with 0.1% gelatin (TKMTg). Phages were pre-incubated with streptavidin-coated beads (SA beads, Dynabeads® M-280) for 30 minutes at RT. Beads used in the selection procedure and all tubes were pre-blocked in TKMTg.


The target concentrations and the number of washes in each cycle are presented in FIG. 2. Buffer used for selection and washes was TKMTg. Pre-selected phages were incubated with the biotinylated target for 17 hours at 4° C. followed by 3 hours at RT during the first cycle and 3 hours or 1 hour, respectively, during the following cycles. Subsequently, the phage particles were transferred to pre-blocked SA beads, 5 mg (first cycle track 1), 3.5 mg (first cycle track 2) or 0.5 mg (all other cycles), and incubated for 10 min with agitation. Thereafter, the beads were washed and phage particles were eluted with a low pH buffer as described in Example 2. The eluted phages were used to infect log phase E. coli RR1ΔM15 cells after each round of selection. After 20 min incubation at 37° C., the cells were harvested by centrifugation. The pellet was dissolved in a small volume of TSB-YE, spread onto TYE plates and incubated overnight at 37° C. Phage stocks were prepared between each cycle essentially as described in Example 2. The phage particle titers and yields were calculated after each selection cycle. The phage particle yield (phage particles out/phage particles in) increased for each cycle (except the second one), indicating an enrichment in target binding clones.


ELISA Analysis of Dynazyme Binding Polypeptides

Clones obtained after the last round of selection were randomly picked and used for periplasmic protein expression in a 96-well plate format as described in Example 2. Supernatants containing soluble polypeptide variants fused to ABD were assayed for target binding in an ELISA as follows. The putative binding polypeptides were expressed as AQLE-[Z#####]-VDYV-[ABD]-SQKA (ABD=the albumin binding domain GA3 from Streptococcus sp. G148, Kraulis et al (1996) FEBS Lett. 378(2):190-194), wherein Z##### denotes individual variants of the inventive polypeptide population.


Half area microtiter wells (Costar, #3690) were coated with 50 μl of 2-3 μg/ml Dynazyme in ELISA coating buffer. The wells were blocked with 100 μl TKMT complemented with 0.5% casein (Sigma) (TKMT-casein) for 1 h at RT. After removal of blocking solution, 50 μl of supernatants were added to the wells and the plates were incubated for 1.5 h at RT. Captured polypeptide variants were detected by adding a primary and then a secondary antibody. The primary antibody, an affinity purified polyclonal rabbit Ig against Z variants, was diluted 1:5000 in TKMT-casein and incubated for 1.5 h at RT. The secondary antibody, a goat α-rabbit-HRP Ig (DakoCytomation, #P0448), was diluted 1:5000 in TKMT-casein and incubated for 1 h at RT. The plates were washed four times with TKMT before incubation with the antibodies and the developing solution.


Plates were developed as described in Example 2 and read at 450 nm in an ELISA spectrophotometer. All plates were prepared with relevant negative and positive controls as well as a blank where TKMT was used instead of periplasmic supernatant. In total, 1080 randomly picked clones were screened in ELISA for their binding to Dynazyme. Positive clones and some clones with low absorbance values were selected for sequencing.


Sequencing of ELISA Positive Polypeptides

Individual clones were subjected to sequencing according to Example 2. Eleven unique binding polypeptides regarded as positive in ELISA screening were found. Some of the clones occurred in several copies. In addition, several sequences from clones with lower ELISA values were identified.


Sub-Cloning of Polypeptides into Plasmid pAY1448


Fifteen unique polypeptides were subjected to subcloning as monomers into the expression vector pAY1448 providing an N-terminal His6-tag (as described in Example 2) using prepared plasmids as templates for the sticky-end PCR. The subcloning was performed as described in Example 3.


Purification of Polypeptides

The following text describes the purification of fifteen monomeric His6-tagged polypeptides, namely His6-Z04665, His6-Z04672, His6-Z04674, His6-Z04678, His6-Z04687, His6-Z04767, His6-Z04770, His6-Z04775, His6-Z04776, His6-Z04777, His6-Z04778, His6-Z04779, His6-Z04780, His6-Z04781 and His6-Z04899. Pelleted bacterial cells harboring the soluble His6-tagged molecules were suspended in His GraviTrap™ binding buffer (20 mM sodium phosphate, 0.5 M NaCl, 20 mM imidazole and 25 U/ml Benzonase®) and disrupted by ultrasonication. The sonicated cell suspensions were heated using hot water (95° C.) until the temperature of the suspensions stabilized at around 90° C. during five minutes. After clarification by centrifugation, the supernatants were loaded on His GraviTrap columns (GE Healthcare) previously equilibrated with His GraviTrap binding buffer. After washing the columns with 5 CV His GraviTrap binding buffer and 5 CV His GraviTrap washing buffer (20 mM sodium phosphate, 0.5 M NaCl, 60 mM imidazole), the polypeptides were eluted with 3 CV His GraviTrap elution buffer (20 mM sodium phosphate, 0.5 M NaCl, 500 mM imidazole).


The polypeptide variants were further purified by reversed phase chromatography (RPC). Acetonitrile (ACN) was added to a final concentration of 2% in the eluted fractions from His GraviTrap. Samples were loaded on a RESOURCE™ RPC 3 ml column (GE Healthcare), previously equilibrated with RPC A buffer (0.1% trifluoroacetic acid (TFA), 2% ACN, 98% water). After column wash with 5 CV RPC A buffer, bound protein were eluted with a 20 CV linear gradient of 0-50% RPC B buffer (0.1% TFA, 80% ACN, 20% water). The flow rate was 5 ml/min and the 280 nm signal was monitored. Fractions containing pure polypeptides were identified by SDS-PAGE analysis and pooled.


The buffer of the purified polypeptides was replaced to 50 mM Tris-HCl, pH 8.8, by size exclusion chromatography on disposable PD-10 Desalting Columns (GE Healthcare).


Twelve of the fifteen polypeptide variants were successfully purified: His6-Z04665, His6-Z04672, His6-Z04674, His6-Z04687, His6-Z04770, His6-Z04775, His6-Z04776, His6-Z04777, His6-Z04778, His6-Z04780, His6-Z04781 and His6-Z04899.


Analysis of Purified Polypeptides

Determination of the concentration of polypeptide solutions was performed by measuring the absorbance at 280 nm using a NanoDrop™ ND-1000 Spectrophotometer. The proteins were further analyzed with SDS-PAGE and LC-MS.


For the SDS-PAGE analysis, polypeptide solution was mixed with LDS Sample Buffer (Invitrogen) and incubated at 74° C. for 10 min. 10 μg of each polypeptide variant were loaded on NuPAGE® 4-12% Bis-Tris Gels (Invitrogen). The gels were run with MES SDS Running Buffer (Invitrogen) in an XCell SureLock™ Mini-Cell (Invitrogen) employing Novex® Sharp Pre-stained Protein Standard (Invitrogen) as molecular weight marker and PhastGel™ Blue R (GE Healthcare) protein staining solution for staining.


To verify the identity of the polypeptide variants, LC/MS-analyses were performed using an Agilent 1100 LC/MSD system equipped with API-ESI and single quadruple mass analyzer. The protein samples were diluted in 50 mM Tris-HCl, pH 8.8, to a final concentration of 0.5 mg/ml and 10 μl were loaded on a Zorbax 300SB-C18 column (4.6×150, 3.5 μm) (Agilent) at a flow-rate of 1 ml/min. Solution A contained 0.1% TFA in water and solution B contained 0.1% TFA in ACN. Proteins were eluted using a 22 minutes linear gradient of 15% to 65% solution B at 1 ml/min. The separation was performed at 30° C. The ion signal and the absorbance at 280 and 220 nm were monitored. The molecular weights of the purified proteins were verified by analysis of the ion signal.


Purity of the polypeptide variants was determined to be greater than 95% according to the SDS-PAGE and LC/MS-analyses.


Determination of Melting Temperature (Tm)

Purified polypeptide variants were diluted in 50 mM Tris-HCl, pH 8.8, to a final concentration of 0.5 mg/ml. Circular dichroism (CD) analysis was performed on a Jasco J-810 spectropolarimeter in a cell with an optical path-length of 1 mm. In the variable temperature measurements, the absorbance was measured at 221 nm from 20° to 90° C., with a temperature slope of 5° C./min. Polypeptide melting temperatures (Tm) were calculated by determining the midpoint of the transition in the CD vs. temperature plot. For results, see Table 8.









TABLE 8







Tm of Dynazyme binding polypeptide variants










Designation
Tm (° C.)







His6-Z04665
38



His6-Z04672
33



His6-Z04674
35



His6-Z04687
60



His6-Z04770
44



His6-Z04775
45



His6-Z04776
55



His6-Z04777
58



His6-Z04778
43



His6-Z04780
65



His6-Z04781
66



His6-Z04899
39










Analysis of Heat Stability

The ability to refold to the original alpha helical structure after being subjected to heat was a requested property of the above described polypeptide variants. To investigate structural reversibility, two CD spectra per sample were obtained at 20° C. Between the two measurements, the samples were heated to 96° C. The samples were kept at 96° C. for two minutes, and then cooled to 20° C. Similar CD spectra before and after heating would prove a sample to be structurally reversible. Three of twelve analyzed polypeptide variants were negatively affected by the heat treatment, whereas nine polypeptide variants were shown to regain their alpha helical structure completely. A typical overlay of two CD spectra before and after heating is shown in FIG. 3.


Biacore Binding Analysis

The interactions between 12 His6-tagged monomeric Z variants selected according to the invention and Dynazyme were analyzed in a Biacore instrument (GE Healthcare). The target protein was immobilized in a flow cell on the carboxylated dextran layer of a CM5 chip surface (GE Healthcare). The immobilization was performed using amine coupling chemistry according to the manufacturer's protocol and using acetate pH 5.5. One flow cell surface on the chip was activated and deactivated for use as blank during analyte injections. The analytes, i.e. polypeptide variants diluted in HBS-EP running buffer (GE Healthcare) to a final concentration of 10 μM, were injected in random order in duplicates at a flow-rate of 10 μl/minute for 5 minutes. After 10 minutes of dissociation, the surfaces were regenerated with one injection of 0.05% SDS. The results were analyzed in BiaEvaluation software (GE Healthcare). Curves of the blank surface were subtracted from the curves from the ligand surfaces. The analysis showed an interaction for 5 of the polypeptide variants to the immobilized Dynazyme, as outlined in FIG. 4.


Example 5
Comparative Study of Chemical Synthesis of a Polypeptide of a Population According to the Invention
Summary

In the experiments making up this example, solid phase peptide synthesis (SPPS) of polypeptides of the populations according to the invention is described, and compared to synthesis of a polypeptide based on the original scaffold. The mutations introduced at four positions, i.e. [N23T], [A42S], [A46S] and [A54S], allowed for using an alternative synthesis strategy with pseudoproline precursors with the simplified abbreviation Fmoc-Xxx-Yyy-OH. Using pseudoprolines in three or four of the positions described above, it is possible to synthesize full length molecules with the sequences:











SEQ A: maESEKYAKEMR NAYWEIALLP NLTNQQKRAF



IRKLYDDPSQ SSELLSEAKK LNDSQAPK







(wherein ma designates mercaptoacetyl coupled to the N-terminus of the polypeptide); and









SEQ B: AEAKYAKEMW IAWEEIRNLP NLNGWQMTAF IAKLLDDPSQ


SSELLSEAKK LNDSQAPKC;







whereas standard synthesis failed to produce the peptide with SEQ A.


Standard synthesis of SEQ C: AENKFNKEMW IAWEEIRNLP NLTGWQMTAF IASLLDDPSQ SANLLAEAKK LNDAQAPK, which is similar to SEQ B but contains the original scaffold amino acids, resulted in a very impure preparation and in a low peptide yield.


The introduction of novel serine or threonine residues also enables the use of isoacyl dipeptides, which is an alternative to pseudoprolines for increasing the synthetic efficiency by reducing aggregation during peptide synthesis (Sohma et al, Tetrahedron Lett. 47:3013, 2006). Several such building blocks are available from Novabiochem of Merck Biosciences AG.


Rationale

Peptide synthesis of the HER2 binding molecule ZHER2:342 (disclosed in WO 2005/003156 as ZHER2:107, and sometimes also called Z00342), as well as coupling of DOTA to the N-terminus for this molecule is possible and described in the literature (Orlova A et al (2006) Cancer Research 67:2178-2186). However, a huge variation in peptide yield after synthesis was observed. The difficulties to reproducibly synthesize the peptide can be related both to the length of the peptide as well as the primary amino acid sequence. In addition, long peptides with the reactive groups of the amino acid side chains still protected may generate unfavorable secondary structures, e.g. beta sheets, which can disturb solid phase peptide synthesis (Quibell M and Johnson T in Fmoc Solid Phase Peptide Synthesis-A Practical Approach, W. C. Chan, P. D. White Eds, Oxford University Press 2000:115-135). One way to prevent secondary structure formation during peptide synthesis is the use of pseudoprolines. Pseudoprolines, with the simplified abbreviation Fmoc-Xxx-Yyy-OH, can be used if the amino acid Yyy is serine, threonine or cysteine. These pseudoprolines display a closed proline-like structure with the side chain linked to the backbone, and can be converted into the normal amino acid structure by acid treatment (Haack T and Mutter M (1992) Tetrahedron Lett 33:1589-1592). Pseudoprolines are commercially available for 14 amino acids in position Xxx (all naturally occurring amino acids except Arg, Cys, His, Met, Pro, Thr) together with serine or threonine in position Yyy.


The parent molecule ZHER2:342 has no threonine and cysteine in the primary sequence. Serine is only found in positions 33, 39 and 41. A pseudoproline precursor is only available for serine 41 (Q40-S41). For the two other serines, the amino acid in position Xxx prevents the use of pseudoproline, since there are no precursors available (R32—S33 and P38—S39).


The mutations introduced in the polypeptides comprised in the population according to the invention are aimed to, but not restricted to, facilitate peptide synthesis. Especially the mutations in position 23, 42, 46 and 54, i.e. [N23T], [A42S], [A46S] and [A54S] may have the capacity to solve two of the identified problems in SPPS: they allow the use of pseudoprolines and the critical region around amino acid positions 21 to 26 is changed in position 23 by replacing asparagine with threonine.


Synthesis Strategy 1

The amino acid sequence SEQ A was assembled on an Fmoc-Lys(Boc)-Wang polystyrene resin in a fully automated peptide synthesizer. This resin is highly suitable for the formation of peptides with the Fmoc-strategy. 57 amino acids (with appropriate side-chain protection) were coupled onto the resin. In the last step, coupling of S-trityl-protected mercaptoacetic acid was performed manually.


Step 1: Solid Phase Peptide Synthesis

The Fmoc-Lys(Boc)-Wang polystyrene resin was transferred into an SPPS reactor with a stirrer. Synthesis was then started with Fmoc deprotection of the resin, followed by a coupling procedure with Fmoc-Pro-OH according to the general description given below. This step was again followed by an Fmoc deprotection and subsequent coupling of the amino acid derivatives according to the sequence. After final washings of the resin with isopropylether (IPE), the peptide resin was dried in a desiccator under reduced pressure.


Both standard Fmoc peptide synthesis and synthesis using pseudoprolines in four positions were performed. For standard peptide synthesis, only Fmoc-amino acids were used. For the alternative peptide synthesis, apart from Fmoc-amino acids the following pseudoprolines were used: Fmoc-Leu-Thr-OH in position 22-23, Fmoc-Ser-Ser-OH in position 41-42, Fmoc-Leu-Ser-OH in position 45-46 and Fmoc-Asp-Ser-OH in position 53-54.


Fmoc Deprotecting Procedure

The resin was also treated with 20% piperidine in N-methyl-2-pyrrolidone (NMP) in order to achieve the cleavage of the N-α-Fmoc protecting group. The washing of the resin was then performed with NMP.


Coupling Procedure

Automated coupling of the amino acid derivates Pro57 to Glu1. Up to 3 eq of the Fmoc-AA derivative were dissolved in NMP. For the coupling, 2-(1H-benzotriazole-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate (TBTU) in dimethylformamide (DMF) and sym.-collidine (2,4,6-trimethylpyridine) in NMP were added. The resulting solution was mixed at room temperature before it was poured onto the resin. NMP was used as solvent. After a coupling time of at least 15 minutes at 60° C., the resin was washed with NMP.


After each coupling procedure, a repetition of the coupling with 2-(1H-7-azabenzotriazol-1-yl)-1,1,3,3-tetramethyluronium tetrafluoroborate (TATU) in DMF as coupling reagent and with dichloroethane as solvent takes place automatically, followed by acetic anhydride capping.


Step 2: Coupling of Mercaptoacetic Acid

Acylations were performed with 5 molar equivalents amino acid, 2-(1H-benzotriazol-1-yl)-1,1,3,3-tetramethyluronium hexafluorphosphate (HBTU) and 1-hydroxybenzotriazole (HOBt) and 10 equivalents N-ethyldiisopropylamine (DIEA, from Lancaster Synthesis, Morecambe, England). S-trityl-mercaptoacetic acid was from AnaSpec Inc (San Jose, Calif., USA).


Step 3: Cleavage from the Resin Including Cleavage of the Remaining Protection Groups


The peptide resin was treated with trifluoroacetic acid (TFA) in the presence of purified water, ethanedithiol (EDT), and triisopropylsilane (TIS). After approx. 2 hours of cleavage time at room temperature, the reaction mixture was cooled to approx. 0° C., and ammonium iodide and dimethyl sulfide are added to reduce oxidized methionine. After an additional 60 min cleavage time at approx. 0° C., the formed iodine was reduced with ascorbic acid. After filtering off the product, it was precipitated in IPE in the cold, filtered off again, washed with IPE, and dried under reduced pressure.


Purity Analysis by HPLC

The purity of the 58 amino acid long peptides and some intermediates was determined by reversed phase HPLC using a Vydac 218 TP54 (5 μm, 250×4.6 mm) column and 0.1% TFA, 1% acetonitrile in H2O and 0.1% TFA in acetonitrile as solvent A and B respectively. The column oven temperature was set to 35° C. The column was eluted either with a gradient of 15 to 45% solvent B in 30 minutes or with a gradient from 20 to 50% B in 30 minutes. UV detection was at 220 nm. The purity was calculated by area normalization.


Results

The yield and purity of the molecule with the sequence SEQ A, synthesized with or without the use of pseudoprolines, were analyzed by analytical reversed phase chromatography. In order to follow the progress of the synthesis, a small portion of synthesis resin was taken after several coupling steps and analyzed for the presence, purity and yield of the desired peptide intermediate. FIG. 5 shows the HPLC analysis of the 41 amino acid long peptide intermediate (amino acid 18-58). At this stage of the peptide synthesis, one clear and predominant peptide peak with the correct sequence (RT=15.33 min, yield 49%) was identified if the synthesis was performed using pseudoprolines (FIG. 5 A). Standard Fmoc synthesis, however, resulted in a huge number of small peptide peaks and two main peaks with similar size, but low yield. One of this two peaks (RT=20.82 min) was identified as the peptide intermediate with the correct sequence (aa 18-58) (FIG. 5 B). The full length peptide (amino acids 1-58) was obtained only if the synthesis was performed using pseudoprolines. FIG. 6 A shows a single product peak with a yield of the final peptide of 26%. Standard Fmoc-synthesis, however, failed to produce the final peptide product. Analysis of the 49 amino acid long intermediate (amino acid 10-58) from the standard synthesis revealed that the desired intermediate could not be detected and the synthesis was aborted (FIG. 6 B).


Synthesis Strategy 2

Two molecules were assembled using the Fmoc-strategy on a fully automated peptide synthesizer with an integrated microwave oven.


The 59 amino acid residues of SEQ B, based on the inventive scaffold sequence, were assembled (with appropriate side chain protection) on an Fmoc-Cys(Trt)-Wang LL polystyrene resin.


The 58 amino acid residues of SEQ C, based on the original Affibody® molecule scaffold, were assembled (with appropriate side chain protection) on an Fmoc-Lys(Boc)-Wang LL polystyrene resin.


The Wang resin LL is highly suitable for the formation of peptides with the Fmoc strategy.


Step 1: Solid Phase Peptide Synthesis

The polystyrene resin was automatically transferred into an SPPS reaction vessel by the synthesizer (Liberty, OEM Corporation, NC USA). Synthesis was then started with Fmoc deprotection of the resin, followed by a coupling procedure with the next Fmoc-protected amino acid (Fmoc-AA) according to the general description given below. This step was again followed by an Fmoc deprotection and subsequent coupling of the amino acid derivatives according to the sequence. After final washings of the resin with dichloromethane (DCM), the peptide resin was dried under reduced pressure. The entire peptide SEQ C was made by standard Fmoc peptide synthesis, whereas pseudoprolines were used at positions in SEQ B where this was enabled by the improvements done to the scaffold. The following pseudoprolines were used: Fmoc-Ser-Ser-OH at position 41-42, Fmoc-Leu-Ser-OH at position 45-46 and Fmoc-Asp-Ser-OH at position 53-54.


Fmoc Deprotecting Procedure

The resin was treated with 5% piperazine in NMP, with microwave irradiation, in order to achieve the cleavage of the N-α-Fmoc protecting group. The washing of the resin was then performed with NMP.


Coupling Procedure

Automated coupling of the amino acid derivatives Cys59 to Ala1 (for SEQ B) and Lys58 to Ala1 (for SEQ C). Up to 5 equivalents of the Fmoc-AA were dissolved in NMP. For the coupling, O-(benzotriazole-N,N,N′,N′-tetramethyluronium hexafluorophosphate (HBTU) and N-hydroxybenzotriazole (HOBt) in dimethylformamide (DMF), N,N′-diisopropylethylamine (DIPEA) in NMP were added to the resin at a molar ratio of 1:1:1:2 (AA/HBTU/HOBt/DIPEA). The mixture was agitated by bubbling nitrogen gas through the bottom of the reaction vessel. After a coupling time of at least 5 minutes at 75-80° C. with added energy using microwave irradiation, the resin was washed with NMP.


After each coupling procedure, an automatic acetic anhydride capping was performed.


Step 2: Cleavage from the Resin Including Cleavage of the Remaining Protection Groups


The peptide resin was treated with trifluoroacetic acid (TFA) in the presence of purified water, ethanedithiol (EDT), and triisopropylsilane (TIS). After approx. 2 hours of cleavage at room temperature, the cleavage mixture was filtered and the resin rinsed with neat 95% TFA/water. The filtrate was slowly added to cooled methyl tert-butyl ether (MTBE). The precipitate was centrifuged and the MTBE removed. The solid was resuspended in ether and the operation repeated a total of three times. After the last removal of ether, the solid was resuspended in 0.1% TFA/water, the remaining ether was left to evaporate, and the solution was frozen before lyophilisation.


Purity and Mass Analysis by HPLC-MS

The purity of the peptides was determined by high performance liquid chromatography and on line mass spectrometry (HPLC-MS) using an Agilent 1100 HPLC/MSD equipped with electro spray ionization (ESI) and a single quadropol. The HPLC was run using a Zorbax 300SB C18 (3.5 μm, 150×4.6 mm) column and 0.1% TFA/water and 0.1% TFA/acetonitrile (ACN) as solvent A and B respectively. The column oven temperature was set to 30° C. The column was eluted with a gradient of 15 to 55% solvent B in 40 minutes. UV detection was at 220 nm. The purity was calculated by area normalization. The software used for the mass analysis and evaluation was ChemStation Rev. B.02.01. (Agilent).


Results

The yield and purity of the molecules SEQ B and SEQ C was analyzed by analytical reversed phase chromatography. The full length peptides were obtained in both syntheses, however with a much larger yield for SEQ B. FIG. 7 A shows, for SEQ B, a main product peak (RT=41.48 min) with the expected mass and a yield of the final peptide of 15%. An additional peak (RT=41.21 min) with a yield of 8% was found to have a mass that was 72 Da higher than the expected mass of the full length product. This is believed to be due to a side reaction on the Cys59 amino acid residue. Depending of the type of side reaction, this can occur during the synthesis or during the cleavage of the peptide from the resin. By optimising the synthesis and/or the cleavage protocol, this side reaction could be minimized and the yield thereby increased, in this case up to a total yield of 23%.


Standard Fmoc-synthesis of SEQ C, however, resulted in a large number of small peptide peaks (FIG. 7 B). One of the main peaks (RT=43.60 min) was identified as the full length peptide with the expected mass. The yield of this product was 4%.


Example 6
Immunogenicity of Original and Inventive Polypeptide Variants
Summary

In this example, the immunogenicity of one original and one inventive polypeptide variant was compared in vivo. Dimeric molecules were administered to rats, and the specific antibody responses were determined in an Anti-Drug Antibody (ADA) assay. The molecule with the introduced scaffold mutations according to the invention displays a lower and delayed antibody response compared to the original Z variant.


Cloning and Production of Polypeptides

Two Taq-polymerase specific binding polypeptides fused to the albumin binding domain ABD035 (Jonsson et al (2008) Protein Eng Des Sel 8:515-27) were used in the study:


1. (Z01154)2-ABD035: original scaffold


2. (Z03229)2-ABD035: inventive scaffold


PCR amplified and hybridized fragments of Z01154 and Z03229 with AccI-overhangs were cloned as dimers in the AccI digested pET (Novagen) derived expression vectors pAY492 and pAY1450 respectively. The resulting vectors were digested with AccI-NotI and ligated with ABD035 fragments that had been PCR amplified with AccI and NotI overhangs, generating the constructs pAY1827 (encoding MGSSLQ-[Z01154]-[Z01154]-VD-[ABD035]) and pAY2292 (encoding MGSSLQ-[Z03229]-[Z03229]-VD-[ABD035]). The plasmids were transformed into competent E. coli BL21(DE3) cells and proteins were produced by fermentation, essentially as described in Example 3. Pelleted cells were suspended in [25 mM Tris-HCl, 200 mM NaCl, 1 mM EDTA, 25 U/ml Benzonase® (Merck, #1.01654.0001), pH 8.0] and disrupted by sonication on ice. The clarified supernatants were loaded onto a column packed with CNBr-activated Sepharose (GE Healthcare, #17-0981-03) coupled in-house with human serum albumin. The column was pre-equilibrated in 1×TST [25 mM Tris-HCl, 200 mM NaCl, 1 mM EDTA, 0.05% Tween 20, pH 8.0]. After sample application, washing was performed with 1×TST followed by 5 mM NH4Ac pH 5.5 until no reduction of the Abs280 signal was observed. Bound proteins were eluted with 0.5 M HAc, pH 2.8. The eluted samples were supplemented with acetonitrile to a final concentration of 2% and further purified by reverse phase chromatography on a Resource RPC column (GE Healthcare, #17-1182-01). [2% acetonitrile, 0.1% TFA in water] was used as running buffer and samples were eluted using a linear gradient of 0-50% of [80% acetonitrile, 0.1% TFA in water] over 25 column volumes. Buffer exchange to [5 mM sodium phosphate, 150 mM NaCl, pH 7.2] was performed using a HiPrep 26/10 Desalting column (GH Healthcare, #17-5087-01). Sample purity was verified by SDS-PAGE and LC/MS analysis as described in Example 3. Endotoxin traces were removed on an AffinityPak Detoxi-Gel endotoxin removing gel (Thermo, #20344) according to the manufacturer's instructions. No endotoxins were detected in gel-clot LAL tests performed by APL (Apoteket Produktion & Laboratorier AB, Sweden). The samples were free of soluble aggregates as verified by size-exclusion chromatography carried out on a Superdex 75 10/300 column (GE Healthcare, #17-5174-01) using 1×PBS as running buffer, a flow rate of 0.5 ml/min and a sample volume of 100 μl with a concentration of 1 mg/ml.


Administration and Sampling Schemes

The animal study was performed at Agrisera AB (Vannas, Sweden) with permission from the local animal ethics committee. Female Sprague Dawley rats divided into three groups were injected subcutaneously with (Z01154)2-ABD035, (Z03229)2-ABD035 or a buffer control as outlined in Table 9. Injections were given at days 0, 4, 7, 14, 21 and 28. 250 μl blood samples were collected from each animal on day -1 (pre-serum) and on days 6, 13, 20 and 35. All animals were sacrificed on day 35. Collected blood samples were left to coagulate over night at 4° C. and obtained sera were stored at −20° C. until analysis.









TABLE 9







Sample administration scheme













No. of

Means of
mg/animal/
ml/animal/


Group
animals
Molecule
administration
injection
injection





1
8
(Z01154)2-ABD035
s.c.
0.125
0.1


2
8
(Z03229)2-ABD035
s.c.
0.125
0.1


3
4
Buffer control: 5 mM
s.c.

0.1




sodium phosphate, 150 mM




NaCl, pH 7.2









Anti-Drug Antibody (ADA) Assay

To analyze the presence of anti-(Z01154)2-ABD035 and anti-(Z03229)2-ABD035 antibodies, three types of ELISA analyses were performed. All samples were initially screened for the presence of reacting antibodies followed by a confirmatory assay to verify specificity. Serum samples with specific antibodies against Z variants were subsequently titrated to quantify the titer of anti-(Z01154)2-ABD035 and anti-(Z03229)2-ABD035 antibodies.


For screening of serum samples, ELISA plates (96-well, half-area plates, Costar, #3690) were coated over night with (Z01154)2-ABD035 or (Z03229)2-ABD035 diluted in coating buffer (Sigma, #C3041) to a final concentration of 2 μg/ml. 50 μl of the coating solution was added per well and plates were incubated over night at 4° C. The plates were washed twice manually with deionized water and subsequently blocked for 2 hours with 100 μl/well of PBS-Casein (PBS with 0.5% Casein (Sigma, #8654)). The blocking solution was removed and serum samples (50 μl/well) diluted 1:50 in blocking buffer were added. After 1.5 hour of incubation at RT, plates were washed in an automated ELISA washer (Scanwasher 300, Scatron) with PBST (PBS with 0.05% Tween 20 (Acros Organics, #233362500)). To detect rat antibodies against Z variants, 50 μl per well of HRP-conjugated anti-rat IgG (Southern Biotech, #3050-05), diluted 1:6000 in PBS-Casein were added. After 1 hour of incubation, the plates were washed as described above and 50 μl/well of substrate solution (Immunopure® TMB, Pierce, #34021) were added. The plates were incubated at RT in the dark, and color development was stopped after 15 minutes with 50 μl/well of 2 M H2SO4 (VWR, #14374-1). Plates were read at 450 nm in an ELISA reader (Victor3, Perkin Elmer).


The ELISA method described above was also used for the confirmatory and titration ELISA assays, but with some alterations. For the confirmatory assay, serum samples were diluted 1:50 in PBS-Casein or in PBS-Casein including 1 μg/ml of respective polypeptide variant. Serum samples with a reduction of the OD signal of 45% or more were considered to contain specific antibodies against Z variants. For the titration assay, serum samples were diluted 1:50 in PBS-Casein and then in series of 2-fold or 5-fold dilutions until they crossed the plate-specific cut point to allow a titer value to be calculated for the sample.


During assay development the following key parameters were determined:

    • Minimum dilution: 1:50
    • Non specific background (NSB): OD450 of a pool of normal rat sera (Sprague Dawley rats, Scanbur) used as dilution matrix and included on each plate throughout the analysis
    • Assay cut point: mean OD450 of normal rat sera from 30 individuals plus 1.645 times standard deviations of the mean. A value of 0.11 was obtained for both (Z01154)2-ABD035 and (Z03229)2-ABD035.
    • Normalisation factor: Assay cut point divided by the mean OD450 of the NSB: 1.87 and 1.86 for (Z01154)2-ABD035 and (Z03229)2-ABD035, respectively


      During sample analysis, the plate specific cut point was then determined as: Mean OD450 of plate specific NSB, multiplied by the normalisation factor.


Rat serum (hyperimmunised Sprague Dawley rats, Agrisera) confirmed to contain antibodies against the two polypeptide variants were used for preparing positive control (PC) samples included on each plate throughout the analysis: HighPC: positive control serum diluted 1:4 in matrix before minimum dilution in PBS-Casein. This PC has OD values high above the assay/plate cut point. LowPC: Positive control serum diluted 1:300 in matrix before minimum dilution in PBS-Casein. This PC has OD values that fall just above the assay/plate cut point.


The LowPC and HighPC values were used to prepare the Titer quality controls LoQC1-5 and HiQC1-5). The LowPC and HighPC were diluted 1:50 in PBS-Casein to obtain LoQC1 and HiQC1 respectively. These were then further diluted in PBS-Casein to obtain LoQC2 (1:100), LoQC3 (1:200), LoQC4 (1:400) and LoQC5 (1:800), and HiQC2 (1:250), HiQC3 (1:1250), HiQC4 (1:6250) and HiQC5 (1:31250), respectively.


The titer values were calculated using GraphPad Prism 5 (GraphPad Software Inc). Briefly, OD450 values were plotted against log dilution and the titer of the sample was defined as the log dilution at the plate specific cut point.


Results

The in vivo comparison between original ((Z01154)2-ABD035) and inventive ((Z03229)2-ABD035) molecules showed that the inventive molecule was less immunogenic. The response varied considerably between individuals and increased over time. The titer could be determined in three individuals that received the original molecule compared to two individuals that received the inventive molecule. The actual titer was also lower in the group that received the inventive molecule (Table 10). The reason for seeing few animals develop an antibody response may be due to the fused ABD molecule, which previously has been shown to reduce immunogenicity of a fused polypeptide (see e.g. WO 2005/097202).









TABLE 10







Immune responses in rats given an original or an inventive


polypeptide variant











Group 1
Group 2
Group 3



(Z01154)2-ABD035
(Z03229)2-ABD035
Buffer control



n = 8
n = 8
n = 4














Specific

Specific

Specific




response

response

response


Time
(no. of
Titer
(no. of
Titer
(no. of
Titer


(days)
animals)
Mean ± SD
animals)
Mean ± SD
animals)
Mean ± SD
















−1
0

0

0



6
0

0

0



13
1
2.9
0

0



20
2
3.4 (±1.0)
1
2.1
0



27
3
2.7 (±1.0)
1
2.4
0



35
2
3.4 (±1.3)
2
2.8 (±0.1)
0









Claims
  • 1. A population of polypeptide variants based on a common scaffold, each polypeptide in the population comprising the scaffold amino acid sequence
  • 2. A population of polypeptide variants based on a common scaffold, each polypeptide in the population comprising the scaffold amino acid sequence
  • 3. A population according to claim 1, which comprises at least 1×104 unique polypeptide molecules.
  • 4. A population according to claim 3, which comprises at least 1×106 unique polypeptide molecules.
  • 5. A population according to claim 4, which comprises at least 1×108 unique polypeptide molecules.
  • 6. A population according to claim 5, which comprises at least 1×1010 unique polypeptide molecules.
  • 7. A population according to claim 6, which comprises at least 1×1012 unique polypeptide molecules.
  • 8. A population according to claim 7, which comprises at least 1×1014 unique polypeptide molecules.
  • 9. A population of polynucleotides, characterized in that each member thereof encodes a member of a population of polypeptides according to claim 1.
  • 10. A combination of a polypeptide population according to claim 1 with a polynucleotide population according to claim 9, wherein each member of said population of polypeptides is physically or spatially associated with the polynucleotide encoding that member via means for genotype-phenotype coupling.
  • 11. A combination according to claim 10, wherein said means for genotype-phenotype coupling comprises a phage display system.
  • 12. A combination according to claim 10, wherein said means for genotype-phenotype coupling comprises a cell surface selection display system.
  • 13. A combination according to claim 12, wherein said cell surface display system comprises prokaryotic cells.
  • 14. A combination according to claim 13, wherein said prokaryotic cells are Gram+ cells.
  • 15. A combination according to claim 12, wherein said cell surface display system comprises eukaryotic cells.
  • 16. A combination according to claim 15, wherein said eukaryotic cells are yeast cells.
  • 17. A combination according to claim 10, wherein said means for genotype-phenotype coupling comprises a cell free display system.
  • 18. A combination according to claim 17, wherein said cell free display system comprises a ribosome display system.
  • 19. A combination according to claim 17, wherein said cell free display system comprises an in vitro compartmentalization display system.
  • 20. A combination according to claim 17, wherein said cell free display system comprises a system for cis display.
  • 21. A combination according to claim 17, wherein cell free display system comprises a microbead display system.
  • 22. A combination according to claim 10, wherein said means for genotype-phenotype coupling comprises a non-display system.
  • 23. A combination according to claim 22, wherein said non-display system is protein-fragment complementation assay.
  • 24. A method for selecting a desired polypeptide having an affinity for a predetermined target from a population of polypeptides, comprising the steps: (a) providing a population of polypeptides according to claim 1;(b) bringing the population of polypeptides into contact with the predetermined target under conditions that enable specific interaction between the target and at least one desired polypeptide having an affinity for the target; and(c) selecting, on the basis of said specific interaction, the at least one desired polypeptide from the remaining population of polypeptides.
  • 25. A method according to claim 24, wherein step (a) comprises the preparatory steps of providing a population of polynucleotides according to claim 9 and expressing said population of polynucleotides to yield said population of polypeptides.
  • 26. A method according to claim 25, wherein each member of said population of polypeptides is physically or spatially associated with the polynucleotide encoding that member via means for genotype-phenotype coupling.
  • 27. A method according to claim 26, wherein said means for genotype-phenotype coupling is as defined in claim 11.
  • 28. A method for isolating a polynucleotide encoding a desired polypeptide having an affinity for a predetermined target, comprising the steps: selecting said desired polypeptide and the polynucleotide encoding it from a population of polypeptides using the method according to claim 26; andisolating the thus separated polynucleotide encoding the desired polypeptide.
  • 29. A method for identifying a desired polypeptide having an affinity for a predetermined target, comprising the steps: isolating a polynucleotide encoding said desired polypeptide using the method according to claim 28; andsequencing the polynucleotide to establish by deduction the amino acid sequence of said desired polypeptide.
  • 30. A method for selecting and identifying a desired polypeptide having an affinity for a predetermined target from a population of polypeptides, comprising the steps: (a) synthesizing each member of the population of polypeptides on a separate carrier or bead;(b) selecting or enriching the carriers or beads based on the interaction of the polypeptide with the predetermined target; and(c) identifying the polypeptide by protein characterization methodology.
  • 31. A method according to claim 30, wherein the protein characterization methodology used in step (c) is mass spectrometric analysis.
  • 32. A method for production of a desired polypeptide having an affinity for a predetermined target, comprising the steps: isolating and identifying a desired polypeptide using the method according to claim 29 or selecting and identifying a desired polypeptide using the method according to claim 30 or 31; andproducing said desired polypeptide.
  • 33. A method according to claim 32, wherein said production is carried out using chemical synthesis of the desired polypeptide de novo.
  • 34. A method according to claim 32, wherein said production is carried out using recombinant expression of a polynucleotide encoding the desired polypeptide.
  • 35. A method for production of a desired polypeptide having an affinity for a predetermined target, comprising the steps: (a1) isolating a polynucleotide encoding said desired polypeptide using the method according to claim 28; or(a2) backtranslating a polypeptide identified using the selection and identification method according to claim 30 or 31; and(b), following either (a1) or (a2), expressing the thus isolated polynucleotide to produce said desired polypeptide.
  • 36. A polypeptide having affinity for a predetermined target, comprising the first scaffold amino acid sequence
  • 37. A polypeptide having affinity for a predetermined target, comprising the first scaffold amino acid sequence
  • 38. A polypeptide according to claim 36, wherein said first scaffold amino acid sequence is derived from SpA.
  • 39. A polypeptide according to claim 36 comprising additional amino acid residues.
  • 40. A polypeptide according to claim 39 comprising additional amino acid residues at the C-terminus of said polypeptide.
  • 41. A polypeptide according to claim 39, wherein said additional amino acid residues are added for the purpose of binding, production, purification, stabilization, coupling or detection of the polypeptide.
  • 42. A polypeptide according to claim 39, wherein said additional amino acid residues constitute one or more polypeptide domain(s).
  • 43. A polypeptide according to claim 42, wherein said one or more polypeptide domain(s) has a function selected from the group of a binding function, an enzymatic function, a metal ion chelating function and a fluorescent function, or mixtures thereof.
  • 44. A polypeptide according to claim 36, further comprising a label.
  • 45. A polypeptide according to claim 36, further comprising a therapeutic agent.
  • 46.-48. (canceled)
  • 49. A polypeptide according to claim 36, wherein said target is TNF-α.
  • 50. A polypeptide according to claim 36, wherein said target is insulin.
  • 51. A polypeptide according to claim 36, wherein said target is taq-polymerase.
  • 52. A fusion polypeptide comprising a polypeptide according to claim 36 as a moiety.
  • 53. A method for production of a first polypeptide based on a scaffold, comprising the steps of providing a second polypeptide having affinity for a predetermined target wherein said second polypeptide is based on an original scaffold derived from SpA, and mutating original scaffold amino acids to generate the first polypeptide comprising the scaffold amino acid sequence
  • 54. A method for production of a first polypeptide based on a scaffold, comprising the steps of providing a second polypeptide having affinity for a predetermined target wherein said second polypeptide is based on an original scaffold derived from SpA, and mutating original scaffold amino acids to generate the first polypeptide comprising the scaffold amino acid sequence
  • 55. A method according to claim 53, wherein said original scaffold comprises a scaffold amino sequence selected from
  • 56. A method according to claim 53, wherein said first polypeptide comprises the amino acid sequence ELGWAIGEIG TLPNLTHQQF RAFILKLWDD PSQSSELLSE AKKLNDSQ, and wherein said predetermined target is TNF-α.
  • 57. A method according to claim 53, wherein said first polypeptide comprises the amino acid sequence EKYMAYGEIR LLPNLTHQQV MAFIDKLVDD PSQSSELLSE AKKLNDSQ, and wherein said predetermined target is insulin.
  • 58. A method according to claim 53, wherein said first polypeptide comprises the amino acid sequence EKGEAWEIF RLPNLTGRQV KAFIAKLYDD PSQSSELLSE AKKLNDSQ, and wherein said predetermined target is taq-polymerase.
  • 59. A method according to claim 53, wherein said original scaffold is derived from SpA domain B and comprises a G29A mutation, corresponding to A in position 22 in SEQ ID NO:1 and A in position 27 in SEQ ID NO:2.
  • 60. A method according to claim 54, wherein said original scaffold comprises a scaffold amino sequence selected from
  • 61. A method according to claim 54, wherein said first polypeptide comprises the amino acid sequence ELGWAIGEIG TLPNLTHQQF RAFILKLWDD PSQSSELLSE AKKLNDSQ, and wherein said predetermined target is TNF-α.
  • 62. A method according to claim 54, wherein said first polypeptide comprises the amino acid sequence EKYMAYGEIR LLPNLTHQQV MAFIDKLVDD PSQSSELLSE AKKLNDSQ, and wherein said predetermined target is insulin.
  • 63. A method according to claim 54, wherein said first polypeptide comprises the amino acid sequence EKGEAWEIF RLPNLTGRQV KAFIAKLYDD PSQSSELLSE AKKLNDSQ, and wherein said predetermined target is taq-polymerase.
  • 64. A method according to claim 54, wherein said original scaffold is derived from SpA domain B and comprises a G29A mutation, corresponding to A in position 22 in SEQ ID NO:1 and A in position 27 in SEQ ID NO:2.
Priority Claims (1)
Number Date Country Kind
07150394.0 Dec 2007 EP regional
PCT Information
Filing Document Filing Date Country Kind 371c Date
PCT/EP2008/068168 12/22/2008 WO 00 7/21/2010
Provisional Applications (1)
Number Date Country
61009171 Dec 2007 US