POLYPEPTIDES FOR USE IN SELF-ASSEMBLING PROTEIN NANOSTRUCTURES

Information

  • Patent Application
  • 20190284242
  • Publication Number
    20190284242
  • Date Filed
    May 31, 2019
    5 years ago
  • Date Published
    September 19, 2019
    5 years ago
Abstract
Synthetic nanostructures, polypeptides that are useful, for example, in making synthetic nanostructures, and methods for using such synthetic nanostructures are disclosed herein.
Description
BACKGROUND

Molecular self- and co-assembly of proteins into highly ordered, symmetric supramollecular complexes is an elegant and powerful means of patterning matter at the atomic scale. Recent years have seen advances in the development of self-assembling biomaterials, particularly those composed of nucleic acids. DNA has been used to create, for example, nanoscale shapes and patterns, molecular containers, and three-dimensional macroscopic crystals. Methods for designing self-assembling proteins have progressed more slowly, yet the functional and physical properties of proteins make them attractive as building blocks for the development of advanced functional materials.


SUMMARY OF THE INVENTION

In a first aspect, the invention provides isolated polypeptides comprising an amino acid sequence that is at least 75% identical over its length, and identical at least at one identified interface position, to the amino acid sequence of a polypeptide selected from the group consisting of SEQ ID NOS:1-34.


In a second aspect, the invention provides nanostructures, comprising:


(a) a plurality of first assemblies, each first assembly comprising a plurality of identical first polypeptides, wherein the first polypeptides comprise the polypeptide of any embodiment or combination of embodiments of the invention; and


(b) a plurality of second assemblies, each second assembly comprising a plurality of identical second polypeptides, wherein the second polypeptides comprise the polypeptide of any embodiment or combination of embodiments of the invention, and wherein the second polypeptide differs from the first polypeptide;


wherein the plurality of first assemblies non-covalently interact with the plurality of second assemblies to form a nanostructure.


In another aspect, the present invention provides isolated nucleic acids encoding the polypeptides of the invention. In a further aspect, the invention provides nucleic acid expression vectors comprising isolated nucleic acids of the invention. In another aspect, the present invention provides recombinant host cells, comprising a nucleic acid expression vector according to the invention.


In a further aspect, the present invention provides a kit, comprising one or more isolated nanostructures of the invention; one or more of the isolated proteins of the present invention or the assemblies of the present invention; one or more recombinant nucleic acids of the present invention; one or more recombinant expression vectors of the present invention; and/or one or more recombinant host cells of the present invention.





BRIEF DESCRIPTION OF THE DRAWINGS

The foregoing aspects and many of the attendant advantages of this invention will become more readily appreciated as the same become better understood by reference to the following detailed description, when taken in conjunction with the accompanying drawings.



FIG. 1. Overview of the design method utilized to produce the exemplary nanostructures and sequences, illustrated with the I53 icosahedral architecture. (A) A schematic illustration of icosahedral symmetry outlined with dashed lines, with the five-fold symmetry axes shown going through each vertex and three-fold symmetry axes going through each face of the icosahedron. (B) 12 pentamers (dark grey) and 20 trimers (light grey) are aligned along the 5-fold and 3-fold symmetry axes, respectively. Each oligomer possesses two rigid body degrees of freedom, one translational (r) and one rotational (co) that are systematically sampled to identify configurations with large interfaces and high densities of contacting residues suitable for protein-protein interface design. (C) Example of such a docked configuration with a large interface and high density of contacting residues suitable for protein-protein interface design. (D) Close-up of the docked interface between the pentameric and trimeric subunits, as outlined in panel C. Side chains atoms beyond the beta carbon are ignored at this stage of design. (E) New amino acid sequences are designed at the interface to stabilize the modeled configuration.



FIG. 2. Design models of exemplary nanostructures. Computational models of the 11 exemplary nanomaterials, (A) I53-34, (B) I53-40, (C) I53-47, (D) I53-50, (E)I53-51, (F) I52-03, (G) I52-32, (H) I52-33, (I) I32-06, (J) I32-19; and (K) I32-28, are shown to scale (relative to the 30 nm scale bar); viewed down one of the 5-fold icosahedral symmetry axes with ribbon-style rendering of the protein backbone. Each I53 material comprises 12 identical pentamers (dark grey) and 20 identical trimers (light grey), each I52 material comprises 12 identical pentamers (dark grey) and 30 identical dimers (light grey), and each I32 material comprises 20 identical trimers (dark grey) and 30 identical dimers (light grey), with the designed interface formed between these oligomeric building blocks. All renderings were generated using PyMOL® Schrodinger, LLC.



FIG. 3. Sodium dodecyl sulfate polyacrylamide electrophoresis (SDS-PAGE) and mass spectrometry analysis. Pairs of proteins encoding each material were co-expressed (as described in the Methods of Production) in E. coli, lysed, and purified via nickel-affinity chromatography followed by gel filtration with a Superose® 6 10/300 GL column (GE Life Sciences), (A) The resulting samples were subjected to SDS-PAGE followed by staining with GelCode® Blue Stain Reagent (Pierce Biotechnology, Inc.). The left lane in each panel contains protein molecular weight standards; the approximate molecular weights in kilodaltons are indicated directly to the left of each band. The right lanes in each panel contain the purified samples. For all of the materials except I52-03, clear bands, of similar staining intensity and near the expected molecular weights of each protein subunit, are present for each of the two proteins comprising the purified materials. (B) While only one band (near the expected molecular weight of 27 kDa for the dimer subunit) is clearly distinguishable for I52-03 via SDS-PAGE, mass spectrometry analysis shows that the other protein subunit is also present in the sample; the mass spectrometry peak at 21,029 Da matches closely with the expected molecular weight of 21,026 Da for the pentamer subunit with loss of the initiator methionine, a common post-translational modification,



FIG. 4. Negative stain averages. Averages have been obtained of the (A′ I53-40, (B) I53-50, (C) I52-03, and (D) I32-06 nanostructures and found to match well with the design models. Raw negative stain micrographs from which the averages were generated are shown on the left side of each panel. Averages (left), along with renderings from the design models (right), are shown on the right side of each panel. Views are shown corresponding approximately to the 5-fold, 3-fold, and 2-fold symmetry axes.



FIG. 5. X-ray crystallography. X-ray crystal structures (bottom) ranging from 3.5 to 5.0 Å resolution have been obtained for three of the designed materials, (A) I53-40, (B) I52-32, and (C) I32-28, and found to match closely with the design models (top). Each structure is shown using a ribbon-style rendering. Views of the I53 and I52 designs and crystal structures (panels A and B) are shown looking down one of the 5-fold symmetry axes, while the I32 design model and crystal structure (panel C) are shown looking down one of the 3-fold symmetry axes. Each crystal structure contains only a portion of the full icosahedron in the asymmetric unit. Crystal lattice symmetry was applied to generate the full icosahedra shown in the bottom panel. The I53-40 design model and crystal structure (panel A) comprise 12 pentamers (dark grey) and 20 trimers (light grey), while the I52-32 design model and crystal structure (panel B) comprise 12 pentamers (dark grey) and 30 dimers (light grey), and the I32-28 design model and crystal structure (panel C) comprise 20 trimers (dark grey) and 30 dimers (light grey). All renderings were generated using PyMOL® SchrÖdinger, TAX.



FIG. 6. In vitro assembly of I53-50A.1PosT1-I53-50B.4PosT1 in the presence of 400 nucleotide (nt) ssDNA leads to encapsulation and protection of the ssDNA.. Mixtures of 26 ng/μL ssDNA and various proteins were analyzed by agarose gel electrophoretic mobility shift assay (EMSA) after incubation for 16 hours to determine the ability of mixtures of I53-50A.1PosT1+I53-50B.4PosT1 to encapsulate the ssDNA (left; the upper image of the gel is after staining for DNA, while the lower image of the gel is after staining for protein). Mixtures of both components (lanes labeled “Components titration” are mixtures of I53-50A.1PosT1+I53-50B.4PosT1 at 2, 4, 6, 8, 10 and 12 μM) with the DNA shift the DNA such that it migrates similarly to SEC-purified I53-50A.1PosT1+I53-50B.4PosT1 nanoparticles (upper band), while mixtures of DNA with only one protein component or the other do not. The mixtures were then incubated with 25 μg/mL, DNase I for 1 hour at room temperature in order to evaluate the ability of the in vitro-assembled nanoparticles to protect the ssDNA cargo from degradation (right; the upper image of the gel is after staining for DNA, while the lower image of the gel is after staining for protein). The DNA that co-migrates with the protein in mixtures of both components (I53-50A.1PosT1+I53-50B.4PosT1; lanes labeled “Components titration” are mixtures at 2, 4, 6, 8, 10 and 12 μM) is largely protected from DNase challenge, while free ssDNA and the mixture of ssDNA+I53-50B.4PosT1 are not. The mixture of ssDNA+I53-50A.1PosT1 is weakly protected, but migrates as a diffuse smear on the gel. Overall, the data show that the ssDNA is encapsulated in nanoparticles formed by I53-50A.1PosT1+I53-50B.4PosT1, which forms a barrier that prevents degradation of the ssDNA by DNase.



FIG. 7. In vitro assembly of I53-50A.1PosT1.I53-50B.4PosT1 in the presence of 1600 nucleotide (nt) ssDNA leads to encapsulation and protection of the ssDNA. Mixtures of 35.2 ng/μL ssDNA and various proteins were analyzed by agarose electrophoretic mobility shift assay (EMSA) after incubation for 16 hours to determine the ability of mixtures of I53-50A.1PosT1+I53-50B.4PosT1 to encapsulate the ssDNA (left; the upper image of the gel is after staining for DNA, while the lower image of the gel is after staining for protein). Mixtures of both components (lanes labeled “Components titration” are mixtures of I53-50A.1PosT1+I53-50B.4PosT1 at 2, 4, 6, 8, 10 and 12 μM) with the DNA shift the DNA such that it migrates similarly to SEC-purified I53-50A.1PosT1+I53-50B.4PosT1 nanoparticles (upper band), while mixtures of DNA with only one protein component or the other do not. The mixtures were then incubated with 25 μg/mL DNase I for 1 hour at room temperature in order to evaluate the ability of the in vitro-assembled nanoparticles to protect the ssDNA cargo from degradation (right; the upper image of the gel is after staining for DNA, while the lower image of the gel is after staining for protein). The DNA that co-migrates with the protein in mixtures of both components (I53-50A.1PosT1+I53-50B.4.PosT1; lanes labeled “Components titration” are mixtures at 2, 4, 6, 8, 10 and 12 μM) is largely protected from DNase challenge, while free ssDNA and the mixture of ssDNA+I53-50B.4PosT1 are not. The mixture of ssDNA+I53-50A.1PosT1 is weakly protected, but migrates as a diffuse smear on the gel. Overall, the data show that the ssDNA is encapsulated in nanoparticles formed by I53-50A.1PosT1-I53-50B.4PosT1, which forms a barrier that prevents degradation of the ssDNA by DNase.





DETAILED DESCRIPTION

All references cited are herein incorporated by reference in their entirety. Within this application, unless otherwise stated, the techniques utilized may be found in any of several well-known references such as: Molecular Cloning: A Laboratory Manual (Sambrook, et 1989, Cold Spring Harbor Laboratory Press), Gene Expression Technology (Methods in Enzymology, Vol. 185, edited by a Goeddel, 1991. Academic Press, San Diego, Calif.), “Guide to Protein Purification” in Methods in Enzymology (M. P. Deutshcer, ed., (1990) Academic Press, Inc.); PCR Protocols: A Guide to Methods and Applications (Innis, et al. 1990. Academic Press, San Diego, Calif.), Culture of Animal Cells: A Manual of Basic Technique, 2nd Ed. (R. I. Freshney. 1987. Liss, Inc. New York, N.Y.), Gene Transfer and Expression Protocols, pp. 109-128, ed. E. J. Murray, The Humana Press Clifton, N.J.), and the Ambion 1998 Catalog (Ambion, Austin, Tex.). As used herein, the singular forms “a”, “an” and “the” include plural referents unless the context clearly dictates otherwise. “And” as used herein is interchangeably used with “or” unless expressly stated otherwise.


As used herein, the amino acid residues are abbreviated as follows: alanine (Ala; A), asparagine (Asn; N), aspartic acid (Asp; D), arginine (Arg; R), cysteine (Cys; C), glutamic acid (Glu; E), glutamine (Gln; Q), glycine (Gly; G), histidine (His; H), isoleucine (Ile; I), leucine (Leu; L), lysine (Lys; K), methionine (Met; M), phenylalanine (Phe; proline (Pro; P), serine (Ser; S), threonine (Thr; T), tryptophan (Trp; W), tyrosine (Tyr; Y), and valine (Val; V). As used herein, “about” means +/−5% of the recited parameter.


All embodiments of any aspect of the invention can be used in combination, unless the context clearly dictates otherwise.


Unless the context clearly requires otherwise, throughout the description and the claims, the words ‘comprise’, ‘comprising’, and the like are to be construed in an inclusive sense as opposed to an exclusive or exhaustive sense; that is to say, in the sense of “including, but not limited to”. Words using the singular or plural number also include the plural and singular number, respectively. Additionally, the words “herein,” “above,” and “below” and words of similar import, when used in this application, shall refer to this application as a whole and not to any particular portions of the application.


The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While the specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize.


In a first apsect, the invention provides isolated polypeptide comprising an amino acid sequence that is at least 75% identical over its length, and identical at least at one identified interface position, to the amino acid sequence of a polypeptide selected from the group consisting of SEQ ID NOS: 1-34. The isolated polypeptides of the invention can be used, for example, to prepare the nanostructures of the invention. As described in the examples that follow, the polypeptides of the invention were designed for their ability to self-assemble in pairs to form nanostructures, such as icosahedral nanostructures. The design involved design of suitable interface residues for each member of the polypeptide pair that can be assembled to form the nanostructure. The nanostructures of the invention include symmetrically repeated, non-natural, non-covalent polypeptide-polypeptide interfaces that orient a first assembly and a second assembly into a nanostructure, such as one with an icosahedral symmetry. Starting proteins were those derived from pentameric, trimeric, and dimeric crystal structures from the Protein Data Bank (PDB), along with a small number of crystal structures of de novo designed proteins not yet deposited in the PDB. Thus, each of the polypeptides of the present invention includes one or more modifications at “interface residues” compared to the starting proteins, permitting the polypeptides of the invention to, for example, form icosahedral nanostructures as described herein. Table 1 provides the amino acid sequence of exemplary polypeptides of the invention; the right hand column in Table 1 identifies the residue numbers in each exemplary polypeptide that were identified as present at the interface of resulting assembled nanostructures (i.e.: “identified interface residues”). As can be seen, the number of interface residues for the exemplary polypeptides of SEQ ID NO:1-34 range from 4-13. In various embodiments, the isolated polypeptides of the invention comprise an amino acid sequence that is at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical over its length, and identical at least at 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or 13 identified interface positions (depending on the number of interface residues for a given polypeptide), to the amino acid sequence of a polypeptide selected from the group consisting of SEQ ID NOS: 1-34. In other embodiments, the isolated polypeptides of the invention comprise an amino acid sequence that is at least 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical over its length, and identical at least at 20%, 25%, 33%, 40%, 50%, 60%, 70%, 75%, 80%, 90%, or 100% of the identified interface positions, to the amino acid sequence of a polypeptide selected from the group consisting of SEQ ID NOS: 1-34. In further embodiments, the polypeptides of the invention comprise or consist of a polypeptide having the amino acid sequence of a polypeptide selected from the group consisting of SEQ ID NOS:1-40.











TABLE 1







Name
Amino Acid Sequence
Identified interface residues





I53-34A
MEGMDPLAVLAESRLLPLLTVRGGEDLAGLATVLELMGVGALEITL
I53-34A:


SEQ ID
RTEKGLEALKALRKSGLLLGAGTVRSPKEAEAALEAGAAFLVSPGL
28, 32, 36, 37,


NO: 1
LEEVAALAQARGVPYLPGVLTPTEVERALALGLSALKFFPAEPFQG
186, 188, 191, 192,



VRVLRAYAEVFPEVRFLPTGGIKEEHLPHYAALPNLLAVGGSWLLQ
195



GDLAAVMKKVKAAKALLSPQAPG






I53-34B
MTKKVGIVDTTFARVDMAEAAIRTLKALSPNIKIIRKTVPGIKDLPV
I53-34B:


SEQ ID
ACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMT
19, 20, 23, 24,


NO: 2
NKHIIEVFVHEDEAKDDDELDILALVRAIEHAANVYYLLFKPEYLTR
27, 109, 113, 116,



MAGKGLRQGREDAGPARE
117, 120, 124, 148





I53-40A
MTKKVGIVDTTFARVDMASAAILTLKMESPKIKIIRKTVPGIKDLPV
I53-40A:


SEQ ID
ACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMT
20, 23, 24, 27,


NO: 3
NKHIIEVFVHEDEAKDDAHLKILAARRAIEHALNVYYLLFKPEYLTR
28, 109, 112, 113,



MAGKGLRQGFEDAGPARE
116, 120, 124





I53-40B
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAA
I53-40B: 


SEQ ID
VKAIMLLRSAQPEMLIGAGTILNGVQALAAKEAGATFVVSPGFNPN
47, 51, 54, 58,


NO: 4
TVRACQIIGIDIVPGVNNPSTVEAALEMGLTTLKFFPAEASGGISMV
74, 102



KSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGTWMVDKKLV




TNGEWDEIARLTREIVEQVNP






I53-47A
MPIFTLNTNIKATDVPSDFLSLTSRLVGLILSKPGSYVAVHINTDQQL
I53-47A:


SEQ ID
SFGGSTKPAAFGTLMSIGGIEPSKKRDHSAVLFDHLNAMLGIPKNR
22, 25, 29, 72,


NO: 5
MYIHFVNLNGDDVGWNGTTF
79, 86, 87





I53-47B
MNQHSHKDYETVRIAVVRARWHADIVDACVEAFEIAMAAIGGDRF
I53-47B:


SEQ ID
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHHFV
28, 31, 35, 36,


NO: 6
ASAVIDGMMNVQLSTGVPVLSAVLTPHRYRDSAEHHRFFAAHFAV
39, 131, 132, 135,



KGVEAARACIEILAAREKIAA
139, 146





I53-50A
MKMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVP
I53-50A:


SEQ ID
DADTVIKALSVLKEKGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLD
25, 29, 33, 54,


NO: 7
EEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQ
57



FVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGSALVK




GTPDEVREKAKAFVEKIRGCTE






I53-50B
MNQHSHKDYETVRIAVVRARWHAEIVDACVSAFEAAMADIGGDR
I53-50B:


SEQ ID
FAVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEF
24, 28, 36, 124,


NO: 8
VASAVIDGMMNVQLSTGVPVESAVLTPHRYRDSDAHTLLFLALFA
125, 127, 128, 129,



VKGMEAARACVEILAAREKIAA
131, 132, 133, 135, 139





I53-51A
MFTKSGDDGNTNVINKRVGKDSPLVNFLGDLDELNSFIGFAISKIPW
I53-51A:


SEQ ID
EDMKKDEERVQVELFEIGEDLSTQSSKKKIDESYVLWLLAATAIYRI
80, 83, 86, 87,


NO: 9
ESGPVKLFVIPGGSEEASVLHVTRSVARRVERNAVKYTKELPEINR
88, 90, 91, 94,



MIIVYLNRLSSLLFAMALVANKRRNQSEKIYEIGKSW
166, 172, 176





I53-51B
MNQHSHKDYETVRIAVVRARWHADIVDQCVRAFEEAMADAGGDR
I53-51B:


SEQ ID
FAVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEF
31, 35, 36, 40,


NO: 10
VASAVIDGMMNVQLSTGVPVLSAVLTPHRYRSSREHHEFFREHFM
122, 124, 128, 131,



VKGVEAAAACITILAAREKIAA
135, 139, 143, 146, 147





I52-03A
MGHTKGPTPQQHDGSALRIGIVHARWNKTIIMPLLIGTIAKLLECGV
I52-03A:


SEQ ID
KASNIVVQSVPGSWELPIAVQRLYSASQLQTPSSGPSLSAGDLLGSS
28, 32, 36, 39,


NO: 11
TTDLTALPTTTASSTGPFDALIAIGVLIKGETMHFEYIADSVSHGLMR
44, 49



VQLDTGVPVIFGVLTVLTDDQAKARAGVIEGSHNHGEDWGLAAVE




MGVRRRDWAAGKTE






I52-03B
MYEVDHADVYDLKYLGRGKDYAAEASDIADLVRSRTPEASSLLDV
I52-03B:


SEQ ID
ACGTGTHLEHFTKEFGDTAGLELSEDMLTHARKRLPDATLHQGDM
94, 115, 116, 206,


NO: 12
RDFQLGRKFSAVVSMFSSVGYLKTVAELGAAVASFAEHLEPGGVV
213



VVEPWWFPETFADGWVSADVVRRDGRTVARVSHSVREGNATRME




VHFTVADPGKGVRHFSDVHLITLFHQREYEAAFMAAGLRVKYLEG




GPSGRGLFVGVPA






I52-32A
MGMKEKFVLIITHGDFGKGLLSGAEVIIGKQENVHTVGLNLGDNIE
I52-32A:


SEQ ID
KVAKEVMRIIIAKLAEDKEIIIVVDLFGGSPFNIALEMMKTFDVKVIT
47, 49, 53, 54,


NO: 13
GINMPMLVELLTSINVYDTTELLENISKIGKDGIKVIEKSSLKM
57, 58, 61, 83,




87,88





I52-32B
MKYDGSKLRIGILHARWNLEIIAALVAGAIKRLQEFGVKAENIIIETV
I52-32B:


SEQ ID
PGSFELPYGSKLFVEKQKREGKPLDAIIPIGVLIKGSTMHFEYICDSTT
19, 20, 23, 30,


NO: 14
HQLMKLNFELGIPVIFGVLTCLTDEQAEARAGLIEGKMHNHGEDW
40



GAAAVEMATKFN






I52-33A
MAVKGLGKVDQKYDGSKLRIGILHARWNRKIILALVAGAVLRLLEF
I52-33A:


SEQ ID
GVKAKNIIIETVPGSFELPYGSKLFVEKQKRLGKPLDAIIPIGVLIKGS
33, 41, 44, 50


NO: 15
TMHFEYICDSTTHQLMKLNFELGIPVIFGVLTCLTDEQAEARAGLIE




GKMMNHGEDWGAAAVEMATKFN






I52-33B
MGANWYLDNESSRLSFTSTKNADIAEVHRFLVLHGKVDPKGLAEV
I52-33B:


SEQ ID
EVETESISTGIPLRDMLLRVLVFQVSKFPVAQINAQLDMRPINNLAP
61, 63, 66, 67,


NO: 16
GAQLELRLPLTVSLRGKSHSYNAELLATRLDERRFQVVTLEPLVIMA
72, 147, 148, 154,



QDFDMVRAFNALRLVAGLSAVSLSVPVGAVLIFTAR
155





I32-06A
MTDYIRDGSAIKALSFAIILAEADLRHIPQDLQRLAVRVIHACGMVD
I32-06A:


SEQ ID
VANDLAFSEGAGKAGRNALLAGAPILCDARMVAEGITRSRLPADN
9, 12, 13, 14,


NO: 17
RVIYTLSDPSVPHLAKKIGNTRSAAALDLWLPIIIEGSIVAIGNAPTAL
20, 30, 33, 34



FRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANSRGVPYVIVR




GRRGGSAMTAAAVNALASERE






I32-06B
MITVFGLKSKLAPRREKLAEVIYSSLHLGLDIPKGKHAIRFLCLEKED
I32-06B:


SEQ ID
FYYPFDRSDDYTVIEINLMAGRSEETKMLLIFLLFIALERKLGIRAHD
24, 71, 73, 76,


NO: 18
VEITIKEQPAHCWGFRGRTGDSARDLDYDIYV
77, 80, 81, 84,




85, 88, 111, 118





I32-19A
MGSDLQKLQRFSTCDISDGLLNVYNIPTGGYFPNLTAISPPQNSSIVG
I32-19A:


SEQ ID
TAYTVLFAPIDDPRPAVNYIDSVPPNSILVLALEPHLQSQFHPFIKITQ
208, 213, 218, 222,


NO: 19
AMYGGLMSTRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGS
225, 226, 229, 233



CAPKAVVKAVGTNVQLKILTSDGVTQTICPGDYIAGDNNGIVRIPVQ




ETDISKLVTYIEKSIEVDRLVSEAIKNGLPAKAAQTARRMVLKDYI






I32-19B
MSGMRVYLGADHAGYELKQAIIAFLKMTGHEPIDCGALRYDADDD
I32-19B:


SEQ ID
YPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAW
20, 23, 24, 27,


NO: 20
SVQTAALAREHNNAQLIGIGGRMHTLEEALRIVKAFVTTPWSKAQR
117, 118, 122, 125



HQRRIDILAEYERTHEAPPVPGAPA






I32-28A
MGDDARIAAIGDVDELNSQIGVLLAEPLPDDVRAALSAIQHDLFDL
I32-28A:


SEQ ID
GGELCIPGHAAITEDHLLRLALWLVHYNGQLPPLEEFILPGGARGAA
60, 61, 64, 67,


NO: 21
LAHVCRTVCRRAHRSIKALGASEPLNIAPAAYVNLLSDLLFVLARVL
68, 71, 110, 120,



NRAAGGADVLWDRTRAH
123, 124, 128





I32-28B
MILSAEQSFTLRHPHGQAAALAFVREPAAALAGVQRLRGLDSDGE
I32-28B:


SEQ ID
QVWGELLVRVPEEGEVDLPFRSEIVRTPQGAELRPLTLTGERAWVA
35, 36, 54, 122,


NO: 22
VSGQATAAEGGEMAFAFQFQAHLATPEAEGEGGAAFEVMVQAAA
129, 137, 140, 141,



GVTLLLVAMALPQGLAAGLPPA
144, 148





I53-40A.1
MIKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPV
I53-40A:


SEQ ID
ACKKLLEEEGCDIVMALGMPGKKEKDKVCAHEASLGLMLAQLMT
20, 23, 24, 27,


NO: 23
NKHIIEVFVIIEDEAKDDAELKILAARRAIEHALNVYYLLFKPEYLTR
28, 109, 112, 113,



MAGKGLRQGFEDAGPARE
116, 120, 124





I53-40B.1
MDDINNQLKRLKVIPVIAIDNAKDIIPLGKVLAENGLPAAEITFRSSA
I53-40B: 


SEQ ID
AVKAIMLLRSAQPEMLIGAGTILNGVQALAAKEAGADFVVSPGFNP
47, 51, 54, 58,


NO: 24
NTVRACQIIGIDIVPGVNNPSTVEQALEMGLTTLKFFPAEASGGISM
74, 102



VKSLVGPYGDIRLMPTGGITPDNIDNYLAIPQVLACGGTWMVDKKL




VRNGEWDEIARLTREIVEQVNP






I53-47A.1
MPIFTLNTNIKADDVPSDFLSLTSRLVGLILSKPGSYVAVHINTDQQL
I53-47A:


SEQ ID
SFGGSTNPAAFGTEMSIGGIEPDKNRDHSAVLFDHLNAMLGIPKNR
22, 25, 29, 72,


NO: 25
MYIHFVNLNGDDVGWNGTTF
79, 86, 87





I53-47A.1
MPIFTLNTNIKADDVPSDFLSLTSRLVGLILSEPGSYVAVHINTDQQL
I53-47A:


NegT2
SFGGSTNPAAFGTLMSIGGIEPDKNEDHSAVLFDIILNAMLGIPKNR
22, 25, 29, 72,


SEQ ID
MYIHFVDLDGDDVGWNGTTF
79, 86, 87


NO: 26







I53-47B.1
MMQHSHKDHETVRIAVVRARWHADIVDACVEAFEIAMAAIGGDRF
I53-47B:


SEQ ID
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEFV
28, 31, 35, 36,


NO: 27
ASAVIDGMMNVQLDTGVPVLSAVLTPHRYRDSDEHHRFFAAHFAV
39, 131, 132, 135,



KGVEAARACIEILNAREKIAA
139, 146





I53-47B.1
MNQHSHKDHETVRIAVVRARWMADIVDACVEAFEIAMAAIGGDRF
I53-47B:


NegT2
AVDVFDVPGAYEIPLIIARTLAETGRYGAVLGTAFVVDGGIYDHEFV
28, 31, 35, 36,


SEQ ID
ASAVIDGMMNVQLDTGVPVLSAVLTPHEYEDSDEDHEFFAAHFAV
39, 131, 132, 135,


NO: 28
KGVEAARACIEILNAREKIAA
139, 146





I53-50A.1
MKMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVP
I53-50A:


SEQ ID
DADTVIKALSVLKEKGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLD
25, 29, 33, 54,


NO: 29
EEISQFCKEKGVFYMPGVMTPTELVKAMKLGHDILKLFPGEVVGPQ
57



FVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGDALVK




GDPDEVREKAKKFVEKIRGCTE






153-50A.1
MKMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVP
I53-50A:


NegT2
DADTVIKALSVLKEKGAIIGAGTVTSVHQCRKAVESGAEFIVSPHLD
25, 29, 33, 54,


SEQ ID
EEISQFCKEKGVFYMPGVMTPTELVKAMKLGHDILKLFPGEVVGPE
57


NO: 30
FVEAMKGPFPNVKFVPTGGVDLDDVCEWFDAGVLAVGVGDALVE




GDPDEVRHDAKEFVEEIRGCTE






I53-50A.1
MKMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVP
I53-50A:


PosT1
DADTVIKALSVLKEKGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLD
25, 29, 33, 54,


SEQ ID
EEISQFCKEKGVFYMPGVMTPTELVKAMKLGHDILKLFPGEVVGPQ
57


NO: 31
FVKAMKGPFPNVKFVPTGGVNLDNVCKWFKAGVLAVGVGKALV




KGKPDEVREKAKKFVKKIRGCTE






I53-50B.1
MNQHSHKDHETVRIAVVRARWHAEIVDACVSAFEAAMRDIGGDRF
I53-50B:


SEQ ID
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEFV
24, 28, 36, 124,


NO: 32
ASAVIDGMMNVQLDTGVPVLSAVLTPHRYRDSDAHTLLFLALFAV
125, 127, 128, 129,



KGMEAARACVEILAAREKIAA
131, 132, 133, 135, 139





I53-50B.1
MNQHSHKDHETVRIAVVRARWHAEIVDACVSAFEAAMRDIGGDRF
I53-50B:


NegT2
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVDGGIYDHEFV
24, 28, 36, 124,


SEQ ID
ASAVIDGMMNVQLDTGVPVLSAVLTPHEYEDSDADTLLFLALFAV
125, 127, 128, 129,


NO: 33
KGMEAARACVEILAAREKIAA
131, 132, 133, 135, 139





I53-50B.4
MNQHSHKDHETVRIAWRARWHAEIVDACVSAFEAAMRDIGGDRF
I53-50B:


PosT1
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEFV
24, 28, 36, 124,


SEQ ID
ASAVINGMMNVQLNTGVPVLSAVLTPHNYDKSKAHTLLFLALFAV
125, 127, 128, 129,


NO: 34
KGMEAARACVEILAAREKIAA
131, 132, 133, 135, 139










I53-40A genus (SEQ ID NO: 35)


MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPVACKKLLEEEGCDIV


MALGMPGK(A/K)EKDKVCAHEASLGLMLAQLMTNKHIIEVFVHEDEAKDDAELKILAA


RRAIEHALNVYYLLFKPEYLTRMAGKGLRQGFEDAGPARE





I53-40B genus (SEQ ID NO: 36)


M(S/D)(T/D)INNQLK(A/R)LKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAAVKAIM


LLRSAQPEMLIGAGTILNGVQALAAKEAGA(T/D)FVVSPGFNPNTVRACQIIGIDIVPGVN


NPSTVE(A/Q)ALEMGLTTLKFFPAEASGGISMVKSLVGPYGDIREMPTGGITP(S/D)NIDNY


LAIPQVLACGGTWMVDKKLV(T/R)NGEWDEIARLTREIVEQVNP





I53-47A genus (SEQ ID NO: 37)


MPIFTLNTNIKA(T/D)DVPSDFLSLTSRLVGLILS(K/E)PGSYVAVHINTDQQLSFGGSTNPA


AFGTLMSIGGIEP(S/D)KN(R/E)DHSAVLFDHLNAMLGIPKNRMYIHFV(N/D)L(N/D)GDD


VGWNGTTF





I53-47B genus (SEQ ID NO: 38)


MNQHSHKD(Y/H)ETVRIAVVRARWHADIVDACVEAFEIAMAAIGGDRFAVDVFDVPGA


YEIPLHARTLAETGRYGAVLGTAFVV(N/D)GGIY(R/D)HEFVASAVIDGMMNVQL(S/D)T


GVPVLSAVLTPH(R/E)Y(R/E)DS(A/D)E(H/D)H(R/E)FFAAHFAVKGVEAARACIEIL(A/N)A


REKIAA





I53-50A genus (SEQ ID NO: 39)


MKMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVPDADTVIKALSVLKE


KGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEKGVFYMPGVMTPTELVKA


MKLGH(T/D)ILKLFPGEVVGP(Q/E)FV(K/E)AMKGPFPNVKFVPTGGV(N/D)LD(N/D)VC


(E/K)WF(K/D)AGVLAVGVG(S/K/D)ALV(K/E)G(T/D/K)PDEVRE(K/D)AK(A/E/K)FV(E/K)


(K/E)IRGCTE





I53-50B genus (SEQ ID NO: 40)


MNQHSIIKD(Y/H)ETVRIAVVRARWHAEIVDACVSAFEAAM(A/R)DIGGDRFAVDVFDVP


GAYEIPLHARTLAETGRYGAVLGTAFVV(N/D)GGIY(R/D)HEFVASAVI(D/N)GMMNVQL


(S/D/N)TGVPVLSAVLTPH(R/E/N)Y(R/D/E)(D/K)S(D/K)A(H/D)TLLFLALFAVKGMEARR


ACVEILAAREKIAA









As is the case with proteins in general, the polypeptides are expected to tolerate some variation in the designed sequences without disrupting subsequent assembly into nanostructures: particularly when such variation comprises conservative amino acid substitutions. As used here, “conservative amino acid substitution” means that: hydrophobic amino acids (Ala, Cys, Gly, Pro, Met, See, Sme, Val, Ile, Leu) can only he substituted with other hydrophobic amino acids; hydrophobic amino acids with bulky side chains (Phe, Tyr, Trp) can only be substituted with other hydrophobic amino acids with bulky side chains; amino acids with positively charged side chains (Arg, His, Lys) can only be substituted with other amino acids with positively charged side chains; amino acids with negatively charged side chains (Asp, Wu) can only be substituted with other amino acids with negatively charged side chains; and amino acids with polar uncharged side chains (Ser. Thr, Asn, Gin) can only be substituted with other amino acids with polar uncharged side chains.


As will be apparent to those of skill in the art, the ability to widely modify surface amino acid residues without disruption of the polypeptide structure permits many types of modifications to endow the resulting self-assembled nanostructures with a variety of fitnctions. In one non-limiting embodiment, the polypeptides of the invention can be modified to facilitate covalent linkage to a “cargo” of interest. In one non-limiting example, the polypeptides can be modified, such as by introduction of various cysteine residues at defined positions to facilitate linkage to one or more antigens of interest, such that a nanostructure of the polypeptides would provide a scaffold to provide a large number of antigens for delivery as a vaccine to generate an improved immune response. In some embodiments, some or all native cysteine residues that are present in the polypeptides but not intended to be used for conjugation may be mutated to other amino acids to facilitate conjugation at defined positions. In another non-limiting embodiment, the polypeptides of the invention may be modified by linkage (covalent or non-covalent) with a moiety to help facilitate “endosomal escape.” For applications that involve delivering molecules of interest to a target cell, such as targeted delivery, a critical step can be escape from the endosome—a membrane-bound organelle that is the entry point of the delivery vehicle into the cell. Endosomes mature into lysosomes, which degrade their contents. Thus, if the delivery vehicle does not somehow “escape” from the endosome before it becomes a lysosome, it will be degraded and will not perform its function. There are a variety of lipids or organic polymers that disrupt the endosome and allow escape into the cytosol. Thus, in this embodiment, the polypeptides can be modified, for example, by introducing cysteine residues that will allow chemical conjugation of such a lipid or organic polymer to the monomer or resulting assemly surface. In another non-limiting example, the polypeptides can be modified, for example, by introducing cysteine residues that will allow chemical conjugation of fluorophores or other imaging agents that allow visualization of the nanostructures of the invention in vitro or in vivo.


Surface amino acid residues on the polypeptides can be mutated in order to improve the stability or solubility of the protein subunits or the assembled nanostructures. As will be known to one of skill in the art, if the polypeptide has significant sequence homology to an existing protein family, a multiple sequence alignment of other proteins from that family can be used to guide the selection of amino acid mutations at non-conserved positions that can increase protein stability and/or solubility, a process referred to as consensus protein design (9).


Surface amino acid residues on the polypeptides can be mutated to positively charged (Arg, Lys) or negatively charged (Asp, Glu) amino acids in order to endow the protein surface with an overall positive or overall negative charge. In one non-limiting embodiment, surface amino acid residues on the polypeptides can be mutated to endow the interior surface of the self-assembling nanostructure with a high net charge. Such a nanostructure can then be used to package or encapsulate a cargo molecule with the opposite net charge due to the electrostatic interaction between the nanostructure interior surface and the cargo molecule. In one non-limiting embodiment, surface amino acid residues on the polypeptides can be mutated primarily to Arginine or Lysine residues in order to endow the interior surface of the self-assembling nanostructure with a net positive charge. Solutions containing the polypeptides can then be mixed in the presence of a nucleic acid cargo molecule such as a dsDNA, ssDNA, dsRNA, ssRNA, cDNA, miRNA., siRNA, shRNA, piRNA, or other nucleic acid in order to encapsulate the nucleic acid inside the self-assembling nanostructure. Such a nanostructure could be used, for example, to protect, deliver, or concentrate nucleic acids.


Table 2 lists surface amino acid residue numbers for each exemplary polypeptide of the invention denoted by SEQ ID NOS: 1-34. Thus, in various embodiments, 1 or more (at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, or more) of these surface residues may be modified in the polypeptides of the invention.











TABLE 2





Name
Amino Acid Sequence
Surface residues not near







I53-34A
MEGMDPLAVLAESRLLPLLTVRGGEDLAGLATVLELMGVGALEITL
I53-34A:


SEQ ID
RTEKGLEALKALRKSGLLLGAGTVRSPKEAEAAEEAGAAFLVSPGL
6, 8, 9, 12, 14, 22, 25, 48, 49,


NO: 1
LEEVAALAQARGVPYLPGVLTPTEVERALALGLSALKFFPAEPFQG
50, 52, 53, 56, 73, 74, 81, 94, 95,



VRVLRAYAEVFPEVRFLPTGGIKEEHLPHYAALPNLLAVGGSWLLQ
101, 102, 103, 104, 119, 122, 137,



GDLAAVMKKVKAAKALLSPQAPG
140, 143, 147, 150, 151, 153, 161,




162, 163, 164, 166, 167, 170, 172,




184, 193, 198, 199, 200, 202





I53-34B
MTKKVGIVDITFARVDMAEAAIRTLKALSPNIKIIRKTVPGIKDLPV
I53-34B:


SEQ ID
ACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMT
3, 12, 31, 33, 35, 36, 51, 54, 55, 56,


NO: 2
NKHIIEVFVHEDEAKDDDELDILALVRAIEHAANVYYLLFKPEYLTR
59, 69, 70, 71, 74, 93, 103, 106, 107,



MAGKGLRQGREDAGPARE
108, 131, 132, 133, 134, 138, 142, 153





I53-40A
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPV
I53-40A:


SEQ ID
ACKKLLEEEGCDIVMALGMPGKAEKDKVCAHEASLGLMLAQLMT
3, 4, 31, 33, 35, 36, 37, 51, 54, 55,


NO: 3
NKHIIEVFVHEDEAKDDAELKILAARRAIEHALNVYYLLFKPEYLTR
56, 57, 59, 69, 70, 71, 74, 93, 103,



MAGKGLRQGFEDAGPARE
106, 118, 127, 128, 131, 132, 133,




134, 135, 138, 139, 142, 150, 153





I53-40B
MSTINNQLKALKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSAA
I53-40B:


SEQ ID
VKAIMLLRSAQPEMUGAGTILNGVQALAAKEAGATFVVSPGFNPN
2, 3, 7, 9, 10, 12, 20, 21, 23, 26, 27, 


NO: 4
TVRACQIIGIDIVPGVNNPSTVEAALEMGLTTLKFFPAEASGGISMV
30, 34, 38, 45, 60, 62, 75, 85, 94,



KSLVGPYGDIRLMPTGGITPSNIDNYLAIPQVLACGGTWMVDKKLV
95, 122, 124, 126, 134, 139, 143, 151,



TNGEWDEIARLTREIVEQVNP
153, 161, 163, 166, 167, 170, 172,




180,184, 185, 186, 189, 190, 192, 193, 




194, 195, 198, 201, 202, 205, 208, 209





I53-47A
MPIFTLNTNIKATDVPSDFLSLTSRLVGLILSKPGSYVAVHINTDQQL
I53-47A:


SEQ ID
SFGGSTNPAAFGTLMSIGGIEPSKNRDHSAVLFDHENAMEGIPKNR
11, 13, 14, 17, 34, 36, 37, 45, 47, 54,


NO: 5
MYIHFVNLNGDDVGWNGTTF
55, 56, 65, 69, 70, 71, 74, 91, 92,




93, 101, 103, 105, 109, 110, 112, 114





I53-47B
MNQHSHKDYETVRIAVVRARWHADIVDACVEAFEIAMAAIGGDRF
I53-47B:


SEQ ID
AVDVFDVPGAYEIPLHARTFAETGRYGAVLGTAFVVNGGIYRHEFV
6, 7, 8, 9, 10, 11, 13, 18, 20, 21, 24,


NO: 6
ASAVIDGMMNVQLSTGVPVLSAVLTPHRYRDSAEHHRFFAAHFAV
43, 44, 51, 63, 67, 70, 85, 87, 101,



KGVEAARACIEILAAREKIAA
105, 122, 123, 124, 125, 126, 147,




152, 153, 154





I53-50A
MKMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVP
I53-50A:


SEQ ID
DADTVIKALSVLKEKGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLD
4, 5, 6, 8, 9, 11, 17, 19, 23, 37, 46,


NO: 7
EEISQFCKEKGVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQ
47, 59, 74, 77, 78, 81, 94, 95, 98,



FVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVEAVGVGSALVK
101, 102, 103, 106, 119, 122, 126,



GTPDEVREKAKAFVEKIRGCTE
139, 142, 145, 149, 150, 152, 160, 161,




162, 163, 166, 169, 179, 183, 185, 188,




191, 192, 194, 198, 199





I53-50B
MNQHSHKDYETVRIAVVRARWHAEIVDACVSAFEAAMADIGGDR
I53-50B:


SEQ ID
FAVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEF
6, 7, 8, 9, 10, 11, 13, 18, 20, 21, 34,


NO: 8
VASAVIDGMMNVQLSTGVPVLSAVLTPHRYRDSDAHTLLFLALFA
38, 39, 40, 43, 44, 48, 51, 63, 67, 70,



VKGMEAARACVEILAAREKIAA
87, 101, 105, 118, 143, 147, 152, 153,




154





I53-51A
MFTKSGDDGNTNVINKRVGKDSPLVNFLGDLDELNSFIGFAISKIPW
I53-51A:


SEQ ID
EDMKKDLERVQVELFEIGEDLSTQSSKKKIDESYVLWLLAATAIYRI
9, 20, 24, 28, 46, 47, 51, 70, 71,


NO: 9
ESGPVKLFVIPGGSEEASVLHVTRSVARRVERNAVKYTKEEPEINR
173, 74, 75, 76, 102, 122, 130, 133,



MIIVYLNRLSSLLFAMALVANKRRNQSEKIYEIGKSW
134, 135, 136, 137, 140, 162, 163, 164,




165, 169, 175, 177





I53-51B
MNQHSHKDYETVRIAVVRARWHADIVDQCVRAFEEAMADAGGDR
I53-51B:


SEQ ID
FAVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEF
6, 7, 8, 9, 10, 11, 13, 18, 21, 27, 34,


NO: 10
VASAVIDGMMNVQLSTGVPVLSAVLTPHRYRSSREHHEFFREHFM
38, 43, 48, 63, 67, 70, 85, 87, 101,



VKGVEAAAACITILAAREKIAA
118, 125, 126, 129, 152, 153, 154





I52-03A
MGHTKGPTPQQHDGSALRIGIVHARWNKTIIMPLLIGTIAKLLECGV
I52-03A:


SEQ ID
KASNIVVQSVPGSWELPIAVQRLYSASQLQTPSSGPSLSAGDLLGSS
6, 9, 10, 11, 13, 15, 16, 26, 48, 69,


NO: 11
TTDLTALPTTTASSTGPFDALIAIGVEIKGETMFHEYIADSVSHGLMR
75, 76, 78, 79, 111, 125, 127, 142,



VQLDTGVPVIFGVLTVLTDDQAKARAGVIEGSHNHGEDWGLAAVE
146, 159, 160, 161, 162, 171, 175,



MGVRRRDWAAGKTE
193, 194, 196, 197, 199, 200





I52-03B
MYEVDHADVYDLFYLGRGKDYAAEASDIADLVRSRTPEASSELDV
I52-03B:


SEQ ID
ACGTGTHLEMFTKEFGDTAGLELSEDMLTHARKRLPDATLHQGDM
2, 3, 5, 6, 8, 15, 17, 20, 22, 23, 26,


NO: 12
RDFQLGRKFSAVVSMFSSVGYEKTVAELGAAVASFAEHLEPGGVV
27, 30, 33, 34, 35, 37, 38, 40, 54, 55, 



VVEPWWFPETFADGWVSADVVRRDGRTVARVSHSVREGNATRME
57, 58, 59, 61, 62, 68, 70, 71, 74,



VHFTVADPGKGVRHFSDVHLITLFHQREYEAAFMAAGLRVEYLEG
77, 78, 79, 81, 82, 84, 86, 87, 91, 96,



GPSGRGLFVGVPA
97, 98, 111, 127, 130, 131, 132, 141,




144, 145, 148, 150, 154, 157, 158,




159, 160, 161, 171, 172, 173, 174,




177, 187, 189, 192, 198, 199, 222,




223, 224, 236





I52-32A
MGMKEKFVLIITHGDFGKGLLSGAEVIIGKQENVHTVGLNLGDNIE
I52-32A:


SEQ ID
KVAKEVMRIIIAKLAEDKEIIIVVDLFGGSPFNIALEMMKTFDVKVIT
3, 5, 15, 18, 30, 32, 35, 40, 41,


NO: 13
GINMPMLVELLTSINVYDTTELLENISKIGKDGIKVIEKSSLKM
42, 44, 45, 65, 73, 79, 91, 103, 106,




109, 110, 111, 112, 114, 115, 118,




122, 123, 125, 126, 129, 131





I52-32B
MKYDGSKLRIGILHARWNLEIIAALVAGAIKRLQEFGVKAENIIIETV
I52-32B:


SEQ ID
PGSFELPYGSKLFVEKQKRLGKPLDAIIPIGVLIKGSTMHFEYICDSTT
4, 6, 7, 9, 17, 32, 35, 42, 59, 63, 64, 


NO: 14
HQLMKLNFELGIPVIFGVLTCLTDEQAEARAGLIEGKMHNHGEDW
66, 67, 68, 69, 70, 71, 73, 83, 85,



GAAAVEMATKFN
90, 106, 119, 120, 121, 122, 125,




131, 133, 134, 135, 136, 154





I52-33A
MAVKGLGEVDQKYDGSKLRIGILHARWNRKIILALVAGAVLRLLEF
I52-33A:


SEQ ID
GVKAENIIIETVPGSFELPYGSKLFVEKQKRLGKPLDAIIPIGVLIKGS
12, 14, 16, 17, 19, 26, 27, 46, 69,


NO: 15
TMHFEYICDSTTHQLMKLNFELGIPVIFGVLTCLTDEQAEARAGLIE
73, 74, 76, 77, 78, 80, 81, 83, 93, 95,



GKMHNHGEDWGAAAVEMATKFN
100, 116, 129, 130, 131, 132, 145, 164





I52-33B
MGANWYLDNESSRLSFTSTKNADIAEVHRFLVLHGKVDPKGLAEV
I52-33B:


SEQ ID
EVETESISTGIPLRDMLLRVLVFQVSKFPVAQINAQEDMRPINNLAP
4, 6, 10, 20, 21, 23, 24, 31, 32, 34,


NO: 16
GAQLELRLPLTVSLRGKSHSYNAELLATRLDERRFQVVTLEPLVIHA
36, 39, 40, 42, 44, 46, 48, 56, 73,



QDFDMVRAFNALRLVAGLSAVSLSVPVGAVLIFTAR
77, 79, 81, 83, 85, 88, 89, 91, 92, 96,




97, 99, 101, 103, 109, 110, 111, 112,




114, 124, 125, 138, 140, 143, 158, 175





I32-06A
MTDYIRDGSAIKALSFAIILAEADLRHIPQDLQRLAVRVIHACGMVD
I32-06A:


SEQ ID
VANDLAFSEGAGKAGRNALLAGAPILCDARMVAEGITRSRLPADN
24, 26, 27, 41, 47, 50, 51, 56, 60, 63,


NO: 17
RVIYTLSDPSVPELAKKIGNTRSAAALDLWLPHIEGSIVAIGNAPTAL
64, 67, 68, 77, 84.85, 86, 91, 93, 98,



FRLFELLDAGAPKPALIIGMPVGFVGAAESKDELAANSRGVPYVIVR
99, 100, 101, 102, 105, 108, 109, 114, 



GRRGGSAMTAAAVNALASERE
123, 124, 125, 127, 135, 142, 145,




148, 149, 152, 153, 169, 172, 173,




176, 177, 180, 187, 189





I32-06B
MITVFGLKSKLAPRREKLAEVIYSSLHLGLDIPKGKHAIRFLCLEKED
I32-06B:


SEQ ID
FYYPFDRSDDYTVIEINLMAGRSEETKMLLIFLLFIALERKLGIRAHID
8, 9, 10, 13, 14, 15, 16, 17, 20, 34,


NO: 18
VEITIKEQPAHCWGFRGRTGDSARDLDYDIYV
36, 45, 46, 47, 50, 51, 53, 54, 57,




67, 70, 91, 93, 95, 105, 112





I32-19A
MGSDLQKLQRFSTCDISDGLLNVYNIPTGGYFPNLTAISPPQNSSIVG
I32-19A:


SEQ ID
TAYTVEFAPIDDPRPAVNYIDSVPPNSILVLALEPHLQSQFITPFIKITQ
3, 4, 6, 7, 9, 10, 25, 27, 36, 40, 42,


NO: 19
AMYGGLMSTRAQYLKSNGTVVFGRIRDVDEHRTLNHPVFAYGVGS
43, 44, 49, 58, 59, 61, 62, 63, 70, 72,



CAPKAVVKAVGTNVQLKILTSDGVTQTICPGDYIAGDNNGIVRIPVQ
73, 74, 82, 84, 88, 89, 109, 110, 112,



ETDISKLVTYIEKSIEVDRLVSEAIKNGLPAKAAQTARRMVLKDYI
126, 127, 129, 130, 132, 146, 155,




156, 157, 159, 166, 169, 172, 189, 190,




192, 194, 195, 198, 201, 204, 215, 232





I32-19B
MSGMRVYLGADHAGYELKQAIIAFLKMTGHEPIDCGALRYDADDD
I32-19B:


SEQ ID
YPAFCIAAATRTVADPGSLGIVLGGSGNGEQIAANKVPGARCALAW
4, 5, 31, 33, 38, 41, 42, 43, 55, 56,


NO: 20
SVQTAALAREHNNAQLIGIGGRMHTLEEALRIVKAFVTTPWSKAQR
59, 61, 62, 83, 93, 94, 101, 104, 113, 



HQRRIDILAEYERTHEAPPVPGAPA
119, 129, 131, 134, 136, 137, 139, 140,




143, 144, 146, 147, 150, 152, 153,




156, 158, 159





I32-28A
MGDDARIAAIGDVDELNSQIGVLLAEPLPDDVRAALSAIQHDLFDL
I32-28A:


SEQ ID
GGELCIPGHAAITEDHLLRLALWLVHYNGQLPPLEEFILPGGARGAA
4, 6, 7, 10, 14, 27, 30, 31, 33, 34,


NO: 21
LAHVCRTVCRRAERSIKALGASEPLNIAPAAYVNLLSDLLFVLARVL
41, 44, 45, 51, 52, 53, 54, 55, 56,



NRAAGGADVLWDRTRAH
59, 76, 78, 79, 80, 81, 82, 83, 90,




103, 111, 115, 116, 131, 134, 142, 145,




147, 150





I32-28B
MILSAEQSFTLRHPHGQAAALAFVREPAAALAGVQRLRGLDSDGE
I32-28B:


SEQ ID
QVWGELLVRVPLLGEVDLPFRSEIVRTPQGAELRPLTLTGERAWVA
3, 4, 6, 8, 12, 15, 17, 18, 22, 26, 28,


NO: 22
VSGQATAAEGGEMAFAFQFQAHLATPEAEGEGGAAFEVMVQAAA
32, 38, 39, 41, 43, 45, 46, 48, 50,



GVTLLLVAMALPQGLAAGLPPA
60, 66, 68, 71, 73, 74, 79, 81, 82,




83, 84, 86, 87, 95, 100, 103, 105, 109,




111, 113, 151, 152, 155, 156, 157





I53-40A.1
MTKKVGIVDTTFARVDMASAAILTLKMESPNIKIIRKTVPGIKDLPV
I53-40A:


SEQ ID
ACKKLLEEEGCDIVMALGMPGKKEKDKVCAHEASLGLMLAQLMT
3, 4, 31, 33, 35, 36, 37, 51, 54, 55,


NO: 23
NKHIIEVFVHEDEAKDDAELKILAARRAIEHALNVYYLLFKPEYLTR
56, 57, 59, 69, 70, 71, 74, 93, 103,



MAGKGLRQGFEDAGPARE
106, 118, 127, 128, 131, 132, 133,




134, 135, 138, 139, 142, 150, 153





I53-40B.1
MDDINNQLKRLKVIPVIAIDNAEDIIPLGKVLAENGLPAAEITFRSSA
I53-40B:


SEQ ID
AVKAIMLLRSAQPEMLIGAGTILNGVQALAAKEAGADFVVSPGFNP
2, 3, 7, 9, 10, 12, 20, 21, 23, 26, 27,


NO: 24
NTVRACQIIGIDIVPGVNNPSTVEQALEMGLTTLKFFPAEASGGISM
30, 34, 38, 45, 60, 62, 75, 85, 94, 95,



VKSLVGPYGDIRLMPTGGITPDNIDNYLAIPQVLACGGTWMVDKKL
122, 124, 126, 134, 139, 143, 151, 153,



VRNGEWDEIARLTREIVEQVNP
161, 163, 166, 167, 170, 172, 180,




184, 185, 186, 189, 190, 192, 193,




194, 195, 198, 201, 202, 205, 208, 209





I53-47A.1
MPIFTLNTNIKADDVPSDFLSLTSRLVGLILSKPGSYVAVHINTDQQL
I53-47A:


SEQ ID
SFGGSTNPAAFGTLMSIGGIEPDKNRDHSAVLFDHLNAMLGIPKNR
11, 13, 14, 17, 34, 36, 37, 45, 47,


NO: 25
MYIHFVNLNGDDVGWNGTTF
54, 55, 56, 65, 69, 70, 71, 74, 91, 92,




93, 101, 103, 105, 109, 110, 112, 114





I53-47A.1
MPIFTLNTNIKADDVPSDFESLTSREVGLILSEPGSYVAVHINTDQQL
I53-47A:


NegT2
SFGGSTNPAAFGTLMSIGGIEPDKNEDHSAVLFDHENAMLGIPKNR
11, 13, 14, 17, 34, 36, 37, 45, 47, 54, 


SEQ ID
MYIHFVDLDGDDVGWNGTTF
55, 56, 65, 69, 70, 71, 74, 91, 92, 93, 


NO: 26

101, 103, 105, 109, 110, 112, 114





I53-47B.1
MNQHSHKDHETVRIAVVRARWHADIVDACVEAFEIAMAAIGGDRF
I53-47B:


SEQ ID
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEFV
6, 7, 8, 9, 10, 11, 13, 18, 20, 21, 24,


NO: 27
ASAVIDGMMNVQLDTGVPVLSAVLTPMRYRDSDEHHRFFAAHAV
43, 44, 51, 63, 67, 70, 85, 87, 101,



KGVEAARACIEILNAREKIAA
105, 122, 123, 124, 125, 126, 147,




152, 153, 154





I53-47B.1
MNQHSHKDHETVRIAVVRARWHADIVDACVEAFEIAMAAIGGDRF
I53-47B:


NegT2
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVDGGIYDHEFV
6, 7, 8, 9, 10, 11, 13, 18, 20,21,


SEQ ID
ASAVIDGMMNVQLDTGVPVLSAVLTPHEYEDSDEDHEFFAAHFAV
24, 43, 44, 51, 63, 67, 70, 85, 87,


NO: 28
KGVEAARACIELNAREKIAA
101, 105, 122, 123, 124, 125, 126, 147,




152, 153, 154





I53-50A.1
MKMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVP
I53-50A:


SEQ ID
DADTVIKALSVLKEKGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLD
4, 5, 6, 8, 9, 11, 17, 19, 23, 37, 46,


NO: 29
EEISQFCKEKGVFYMPGVMTPTELVKAMKLGHDILKLFPGEVVGPQ
47, 59, 74, 77, 78, 81, 94, 95, 98, 101,



FVKAMKGPFPNVKFVPTGGVNLDNVCEWFKAGVLAVGVGDALVK
102, 103, 106, 119, 122, 126, 139,



GDPDEVREKAKKFVEKIRGCTE
142, 145, 149, 150, 152, 160, 161,




162, 163, 166, 169, 179, 183, 185,




 188, 191, 192, 194, 198, 199





I53-50A.1
MKMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVP
I53-50A:


NegT2
DADTVIKALSVLKEKGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLD
4, 5, 6, 8, 9, 11, 17, 19, 23, 37,


SEQ ID
EEISQFCKEKGVFYMPGVMTPTELVKAMKLGHDILKLFPGEVVGPE
46, 47, 59, 74, 77, 78, 81, 94, 95,


NO: 30
FVEAMKGPFPNVKFVPTGGVDLDDVCEWFDAGVLAVGVGDALVE
98, 101, 102, 103, 106, 119, 122,



GDPDEVREDAKEFVEEIRGCTE
126, 139, 142, 145, 149, 150, 152, 160,




161, 162, 163, 166, 169, 179, 183,




185, 188, 191, 192, 194, 198, 199





I53-50A.1
MKMEELFKKHKIVAVLRANSVEEAIEKAVAVFAGGVHLIEITFTVP
I53-50A:


PosT1
DADTVIKALSVLKEKGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLD
4, 5, 6, 8, 9, 11, 17, 19, 23, 37, 46,


SEQ ID
EEISQFCKEKGVFYMPGVMTPTELVKAMKLGHDILKLFPGEVVGPQ
47, 59, 74, 77, 78, 81, 94, 95, 98,


NO: 31
FVKAMKGPFPNVKFVPTGGVNLDNVCKWFKAGVLAVGVGKALV
101, 102, 103, 106, 119, 122, 126,



KGKPDEVREKAKKFVKKIRGCTE
139, 142, 145, 149, 150, 152, 160,




161, 162, 163, 166, 169, 179, 183, 185,




188, 191, 192, 194, 198, 199





I53-50B.1
MNQHSHKDHETVRIAVVRARWHAEIVDACVSAFEAAMRDIGGDRF
I53-50B:


SEQ ID
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEFV
6, 7, 8, 9, 10, 11, 13, 18, 20, 21,


NO: 32
ASAVIDGMMNVQLDTGVPVLSAVLTPHRYRDSDAHTLLFLALFAV
34, 38, 39, 40, 43, 44, 48, 51, 63,



KGMEAARACVEILAAREKIAA
67, 70, 87, 101, 105, 118, 143, 147,




152, 153, 154





I53-50B.1
MNQHSHKDHETVRIAVVRARWHAEIVDACVSAFEAAMRDIGGDRF
I53-50B:


NegT2
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVDGGIYDHEFV
6, 7, 8, 9, 10, 11, 13, 18, 20, 21,


SEQ ID
ASAVIDGMMNVQLDTGVPVLSAVLTPHEYEDSDADTLLFLALFAV
34, 38, 39, 40, 43, 44, 48, 51, 63, 67,


NO: 33
KGMEAARACVEILAAREKIAA
70, 87, 101, 105, 118, 143, 147, 152,




153, 154





I53-50B.4
MNQHSHKDHETVRIAVVRARWHAEIVDACVSAFEAAMRDIGGDRF
I53-50B:


PosT1
AVDVFDVPGAYEIPLHARTLAETGRYGAVLGTAFVVNGGIYRHEFV
6, 7, 8, 9, 10, 11, 13, 18, 20, 21, 34,


SEQ ID
ASAVINGMMNVQLNTGVPVLSAVLTPHNYDKSKAHTLLFLALFAV
38, 39, 40, 43, 44, 48, 51, 63, 67,


NO: 34
KGMEAARACVEILAAREKIAA
70, 87, 101, 105, 118, 143, 147, 152,




153, 154









In certain instances, the polypeptides of the present invention can also tolerate non-conservative substitutions. The isolated polypeptides may be produced recombinantly or synthetically, using standard techniques in the art. The isolated polypeptides of the invention can be modified in a number of ways, including but not limited to the ways described above, either before or after assembly of the nanostructures of the invention. As used throughout the present application, the term “polypeptide” is used in its broadest sense to refer to a sequence of subunit amino acids. The polypeptides of the invention may comprise L-amino acids, D-amino acids (which are resistant to L-amino acid-specific proteases in vivo), or a combination of D- and L-amino acids.


In another aspect, the invention provides nanostructures, comprising:


(a) a plurality of first assemblies, each first assembly comprising a plurality of identical first polypeptides, wherein the first polypeptides comprise the polypeptide of any embodiment or combination of embodiments of the first aspect of the invention; and


(b) a plurality of second assemblies, each second assembly comprising a plurality of identical second polypeptides, wherein the second polypeptides comprise the polypeptide of any embodiment or combination of embodiments of the first aspect of the invention, wherein the second polypeptide differs from the first polypeptide;


wherein the plurality of first assemblies non-covalently interact with the plurality of second assemblies to form a nanostructure.


As described in the examples that follow, a plurality (2, 3, 4, 5, 6, or more) of first polypeptides self-assemble to form a first assembly, and a plurality (2, 3, 4, 5, 6, or more) of second polypeptides self-assemble to form a second assembly. A plurality of these first and second assemblies then self-assemble non-covalently via the designed interfaces to produce the nanostructures of the invention. The designed interfaces on the polypeptides of the invention, resembling natural protein-protein interfaces with well-packed cores composed primarily of hydrophobic amino acid side chains surrounded by a periphery composed primarily of hydrophilic and charged side chains, rigidly orient the assemblies within the nanostructures formed by self-assembly. As will be understood by those of skill in the art, the interaction between the first assembly and the second assembly is a non-covalent protein-protein interaction. Any suitable non-covalent interaction(s) can drive self-interaction of the assemblies to form the nanostructure, including but not limited to one or more of electrostatic interactions, π-effects, van der Wools forces, hydrogen bonding, and hydrophobic effects. In various embodiments, pentamers, trimers, and dimers of the first or second assemblies assemble relative to each other such that their 5-fold, 3-fold, and 2-fold symmetry axes are aligned along icosahedral 5-fold, 3-fold, and 2-fold symmetry axes, respectively.


In various other embodiments, the nanostructures are between about 20 nanometers (nm) to about 40 nm in diameter, with interior lumens between about 15 nm to about 32 nm across and pore sizes in the protein shells between about 1 nm to about 14 nm in their longest dimensions (FIG. 2). The nanostructures of the invention can be used for any suitable purpose, including but not limited to delivery vehicles, as the nanostructures can encapsulate molecules of interest and/or the first and/or second proteins can be modified to bind to molecules of interest (diagnostics, therapeutics, detectable molecules for imaging and other applications, etc.), The nanostructures of the invention are well suited for several applications, including vaccine design, targeted delivery of therapeutics, and bioenergy.


In various embodiments of the nanostructure of the invention, the first polypeptides and the second polypeptides comprise polypeptides with the amino acid sequence selected from the following pairs, or modified versions thereof (i.e.: permissible modifications as disclosed for the polypeptides of the invention: isolated polypeptides comprising an amino acid sequence that is at least 75% identical over its length, and identical at least at one identified interface position, to the amino acid sequence indicated by the SEQ ID NO.):


(i) SEQ ID NO:1 and SEQ ID NO:2 (I53-34A and I53-34B);


(ii) SEQ ID NO:3 and SEQ ID NO:4 (I53-40A and I53-40B);


(iii) SEQ ID NO:3 and SEQ ID NO:24 (I53-40A and I53-40B.1);


(iv) SEQ ID NO:23 and SEQ ID NO:4 (I53-40A.1 and I53-40B);


(v) SEQ ID NO:35 and SEQ ID NO:36 (I53-40A genus and I53-40B genus);


(vi) SEQ ID NO:5 and SEQ ID NO:6 (I53-47A and I53-B);


(vii) SEQ ID NO:5 and SEQ ID NO:27 (I53-47A and I53-47B.1);


(viii) SEQ ID NO:5 and SEQ ID NO:28 (I53-47A and I53-47B.1NegT2);


(ix) SEQ ID NO:25 and SEQ ID NO:6 (I53-47A.1 and I53-47B);


(x) SEQ ID NO:25 and SEQ ID NO:27 (I53-47A.1 and I53-47B.1);


(xi) SEQ ID NO:25 and SEQ ID NO:28 (I53-47A.1 and I53-47B.1NegT2);


(xii) SEQ ID NO:26 and SEQ ID NO:6 (I53-47A.1NegT2 and I53-47B);


(xiii) SEQ ID NO:26 and SEQ ID NO:27 (I53-47A.1NegT2 and:I53-4713.1);


(xiv) SEQ ID NO:26 and SEQ ID NO:28 (I53-47A.1NegT2 and I53-47B.1NegT2);


(xv) SEQ ID NO:37 and SEQ ID NO:38 (I53-47A genus and I53-4713 genus);


(xvi) SEQ ID NO:7 and SEQ ID NO:8 (I53-50A and I53-50B);


(xxii) SEQ ID NO:7 and SEQ ID NO:32 (I53-50A and I53-50B.1);


(xix) SEQ ID NO:7 and SEQ ID NO:33 (I53-50A and I53-50B.


(xx) SEQ ID NO:7 and SEQ ID NO:34 (1.53-50A and I53-5013.4PosT1);


(xxi) SEQ ID NO:29 and SEQ ID NO:8 (I53-50A.1 and I53-50B);


(xxii) SEQ ID NO:29 and SEQ ID NO:32 (I53-50A.1 and I53-50B.1);


(xxiii) SEQ ID NO:29 and SEQ ID NO:33 (I53-50A.1 and I53-50B.1NegT2);


(xxiv) SEQ ID NO:29 and SEQ ID NO:34 (I53-50A.1 and I53-50B.4PosT1);


(xxv) SEQ ID NO:30 and SEQ ID NO:8 (I53-50A.1NegT2 and I53-50B);


(xxvi) SEQ ID NO:30 and SEQ ID NO:32 (I53-50A.1NegT2 and I53-50B.1);


(xxxii) SEQ ID NO:30 and SEQ ID NO:33 (I53-50A.1NegT2 and I53-50B.1NegT2);


(xxviii) SEQ ID NO:30 and SEQ ID NO:34 (I53-50A.1NegT2 and I53-50B.4PosT1);


(xxii) SEQ ID NO:31 and SEQ NO:8 (I53-50A. 1.PosT 1 and I53-50B);


(xxx) SEQ ID NO:31 and SEQ ID NO:32 (I53-50A.1PosT1 and I53-50B.1);


(xxii) SEQ ID NO:31 and SEQ ID NO:33 (I53-50A.1PosT1 and I53-50B.1NegT2);


(xxxii) SEQ ID NO:31 and SEQ ID NO:34 (I53-50A.1PosT1 and I53-50B.4PosT1);


(xxxiii) SEQ ID NO:39 and SEQ ID NO:40 (I53-50A genus and I53-50B genus);


(xxxiv) SEQ ID NO:9 and SEQ ID NO:10 (I53-51A and I53-51B);


(xxxv) SEQ ID NO:1 l and SEQ ID NO:12 (I52-03A and I52-03B);


(xxxvi) SEQ ID NO:13 and SEQ ID NO:14 (I52-32A and I52-32B);


(xxxv) SEQ ID NO:15 and SEQ ID NO:16 (I52-33A and I52-33B)


(xxxvi) SEQ ID NO:17 and SEQ ID No:18 (I32-06A and I32-06B);


(xxxvii) SEQ ID NO:19 and SEQ ID NO:20 (I32-19A and I32-19B);


(xxxviii) SEQ ID NO:21. and SEQ ID NO:22 (I32-28A and I32-2813); and


(xxxii) SEQ ID NO:23 and SEQ ID NO:24 (I53-40A.1 and I53-40B.1).


In one embodiment, the nanostructure has icosahedral symmetry. In this embodiment, the nanostructure may comprise 60 copies of the first polypeptide and 60 copies of the second polypeptide. In one such embodiment, the number of identical first polypeptides in each first assembly is different than the number of identical second polypeptides in each second assembly. For example, in one embodiment, the nanostructure comprises twelve first assemblies and twenty second assemblies; in this embodiment, each first assembly may; for example, comprise five copies of the identical first polypeptide, and each second assembly may, f©r example, comprise three copies of the identical second polypeptide. In another embodiment, the nanostructure comprises twelve first assemblies and thirty second assemblies; in this embodiment, each first assembly may, for example, comprise five copies of the identical first polypeptide, and each second assembly may, for example, comprise two copies of the identical second polypeptide. In a further embodiment, the nanostructure comprises twenty first assemblies and thirty second assemblies; in this embodiment, each first assembly may, for example, comprise three copies of the identical first polypeptide, and each second assembly may, for example, comprise two copies of the identical second polypeptide. All of these embodiments are capable of forming synthetic nanomaterials with regular icosahedral symmetry. In various further embodiments, oligomeric states of the first and second polypeptides are as follows:


I53-34A: trimer+I53-34B: pentamer;


I53-40A: pentamer+I53-40B: trimer;


I53-47A: trimer+I53-47B: pentamer;


I53-50A: trimer+I53-50B: pentamer;


I53-51A: trimer+I53-51B: pentamer;


I32-06A: dimer+I32-06B: trimer;


I32-19A: trimer+I32-19B: dimer;


I32-28A: trimer+I32-28B: dimer;


I52-03A: pentamer+I52-03B: dimer;


I52-32A: dimer+I52-32B: pentamer; and


I52-33A: pentamer+I52-33B: dimer.


As disclosed in the examples that follow, the nanostructures form spontaneously when appropriate polypeptide pairs are co-expressed in E. coli cells, yielding milligram quantities of purified material per liter of cell culture using standard methods of immobilized metal-affinity chromatography and gel filtration. When a poly-histidine purification tag is appended to just one of the two distinct polypeptide subunits (i.e.: the first and second polypeptides) comprising each nanostructure, the other subunit is found to co-purify with the tagged subunit.


In one embodiment, the nanostructure further comprises a cargo within the nanostructure. As used herein, a “cargo” is any compound or material that can be incorporated on and/or within the nanostructure. For example, polypeptide pairs suitable for nanostructure self-assembly can be expressed/purified independently; they can then be mixed in vitro in the presence of a cargo of interest to produce the nanostructure comprising a cargo. This feature, combined with the protein nanostructures' large lumens and relatively small pore sizes, makes them well suited for the encapsulation of a broad range of cargo including, but not limited to, small molecules, nucleic acids, polymers, and other proteins. In turn, the protein nanostructures of the present invention could be used for many applications in medicine and biotechnology, including targeted drug delivery and vaccine design. For targeted drug delivery, targeting moieties could be fused or conjugated to the protein nanostructure exterior to mediate binding and entry into specific cell populations and drug molecules could be encapsulated in the cage interior for release upon entry to the target cell or sub-cellular compartment. For vaccine design, antigenic epitopes from pathogens could be fused or conjugated to the cage exterior to stimulate development of adaptive immune responses to the displayed epitopes, with adjuvants and other immunomodulatory compounds attached to the exterior and/or encapsulated in the cage interior to help tailor the type of immune response generated for each pathogen. The polypeptide components may be modified as noted above. In one non-limiting example, the polypeptides can be modified, such as by introduction of various cysteine residues at defined positions to facilitate linkage to one or more antigens of interest as cargo, and the nanostructure could act as a scaffold to provide a large number of antigens for delivery as a vaccine to generate an improved immune response. Other modifications of the polypeptides as discussed above may also be useful for incorporating cargo into the nanostructure.


In certain embodiments, the nanostructures may comprise one or more peptides configured to bind or fuse with desired immunogens. In certain further embodiments, the nanostructure comprises one or more copies of variants designed to form a nanostructure of the trimeric proteins 1WOZ or 1WA3 (PDB ID codes), which have been demonstrated to be suitable for fusion with the trimeric HIV immunogen, BG505 SOSIP (4-6). Such nanostructures could be used as scaffolds for the design of an HIV vaccine capable of inducing protective immune responses against the virus. In another embodiment, the nanostructures of the present invention could be useful as scaffolds for the attachment of enzymes on the interior and/or exterior of the cages. Such enzymes confer on the nanostructure the ability to catalyze biochemical pathways or other reactions. Such patterning has been shown to be important in natural systems in order to increase local substrate concentrations, sequester toxic intermediates, and/or reduce the rates of undesirable side reactions (7, 8). In another embodiment, the cargo may comprise a detectable cargo. For example, the nanostructures of the present invention could also be useful as single-cell or single-molecule imaging agents. The materials are large enough to be identified in cells by electron microscopy, and when tagged with fluorophores they are readily detectable by light microscopy. This feature makes them well-suited to the task of correlating images of the same cells taken by light microscopy and electron microscopy.


In another aspect, the present invention provides isolated nucleic acids encoding a protein of the present invention. The isolated nucleic acid sequence may comprise RNA or DNA. As used herein, “isolated nucleic acids” are those that have been removed from their normal surrounding nucleic acid sequences in the genome or in cDNA sequences. Such isolated nucleic acid sequences may comprise additional sequences useful for promoting expression and/or purification of the encoded protein, including but not limited to polyA sequences, modified Kozak sequences, and sequences encoding epitope tags, export signals, and secretory signals, nuclear localization signals, and plasma membrane localization signals. It will be apparent to those of skill in the art, based on the teachings herein, what nucleic acid sequences will encode the proteins of the invention.


In a further aspect, the present invention provides recombinant expression vectors comprising the isolated nucleic acid of any embodiment or combination of embodiments of the invention operatively linked to a suitable control sequence. “Recombinant expression vector” includes vectors that operatively link a nucleic acid coding region or gene to any control sequences capable of effecting expression of the gene product. “Control sequences” operably linked to the nucleic acid sequences of the invention are nucleic acid sequences capable of effecting the expression of the nucleic acid molecules. The control sequences need not be contiguous with the nucleic acid sequences, so long as they function to direct the expression thereof. Thus, for example, intervening untranslated yet transcribed sequences can be present between a promoter sequence and the nucleic acid sequences and the promoter sequence can still be considered “operably linked” to the coding sequence. Other such control sequences include, but are not limited to, polyadenylation signals, termination signals, and ribosome binding sites. Such expression vectors can be of any type known in the art, including but not limited to plasmid and viral-based expression vectors. The control sequence used to drive expression of the disclosed nucleic acid sequences in a mammalian system may be constitutive (driven by any of a variety of promoters, including but not limited to, CMV, SV40, RSV, actin, EF) or inducible (driven by any of a number of inducible promoters including, but not limited to, tetracycline, ecdysone, steroid-responsive). The construction of expression vectors for use in transfecting prokaryotic cells is also well known in the art, and thus can be accomplished via standard techniques. (See, for example, Sambrook, Fritsch, and Maniatis, in: Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratoty Press, 1989; Gene Transfer and Expression Protocols, pp. 109-128, ed. E. J. Murray, The Humana Press Inc., Clifton, N.J.), and the Ambion 1998 Catalog (Ambion, Austin, Tex.). The expression vector must be replicable in the host organisms either as an episome or by integration into host chromosomal DNA. In a preferred embodiment, the expression vector comprises a plasmid. However, the invention is intended to include other expression vectors that serve equivalent functions, such as viral vectors.


In another aspect, the present invention provides host cells that have been transfected with the recombinant expression vectors disclosed herein, wherein the host cells can be either prokaryotic or eukaryotic. The cells can be transiently or stably transfected. Such transfection of expression vectors into prokaryotic and eukaryotic cells can be accomplished via any technique known in the art, including but not limited to standard bacterial transformations, calcium phosphate co-precipitation, electroporation, or liposome mediated-, DEAE dextran mediated-, polycationic mediated-, or viral mediated transfection. (See, for example, Molecular Cloning: A Laboratory Manual (Sambrook, et al., 1989, Cold Spring Harbor Laboratory Press; Culture of Animal Cells: A Manual of Basic Technique, 2nd Ed. (R I. Freshney. 1987. Liss, Inc. New York, N.Y.). A method of producing a polypeptide according to the invention is an additional part of the invention. The method comprises the steps of (a) culturing a host according to this aspect of the invention under conditions conducive to the expression of the polypeptide, and (b) optionally, recovering the expressed polypeptide.


In a further aspect, the present invention provides kits comprising:


(a) one or more of the isolated polypeptides, polypeptide assemblies, or nanostructures of the invention;


(b) one or more recombinant nucleic acids of the invention;


(c) one or more recombinant expression vectors comprising recombinant nucleic acids of the invention; and/or


(d) one or more recombinant host cell, comprising recombinant expression vectors of the invention.


In yet a further aspect, the present invention provides methods of using the nanostructures of the present invention. In cases where both polypeptides comprising an assembly are capable of independent expression and purification, this enables control over assembly through mixing of purified components in vitro. This feature, combined with the nanostructures' large lumens and relatively small pore sizes, makes them well suited for the encapsulation of a broad range of other materials including small molecules, nucleic acids, polymers, and other proteins, as discussed above. In turn, the nanostructures of the present invention could be used for many applications in medicine and biotechnology, including targeted drug delivery and vaccine design. For targeted drug delivery, targeting moieties could be fused or conjugated to the nanostructure exterior to mediate binding and entry into specific cell populations and drug molecules could be encapsulated in the cage interior for release upon entry to the target cell or sub-cellular compartment. For vaccine design, antigenic epitopes from pathogens could be fused or conjugated to the nanostructure exterior to stimulate development of adaptive immune responses to the displayed epitopes, with adjuvants and other immunomodulatory compounds attached to the exterior and/or encapsulated in the cage interior to help tailor the type of immune response generated for each pathogen. Other uses will be clear to those of skill in the art based on the disclosure relating to polypeptide modifications, nanostructure design, and cargo incorporation.


EXAMPLES

Methods of production: The icosahedral materials disclosed herein (amino acid sequences provided in Table 1), which comprise possible embodiments of the present invention, were produced as follows. The initial sequences and structures for the design process were derived from pentameric, trimeric, and dimeric crystal structures from the Protein Data Bank (PDB), along with a small number of crystal structures of de novo designed proteins not yet deposited in the PDB.


The PDB Accession numbers for the wild type scaffold proteins related to the exemplary polypeptides of the invention are as follows:

  • SEQ ID NO:1 (I53-34A): 2yw3;
  • SEQ ID NO:2 (I53-34B): 2b98;
  • SEQ ID NO:3 (I53-40A): 2b98;
  • SEQ ID NO:4 (I53-40B): 4e38;
  • SEQ ID NO:5 (I53-47A): 1hfo;
  • SEQ ID NO:6 (I53-47B): 2obx;
  • SEQ ID NO:7 (I53-50A): 1wa3;
  • SEQ ID NO:8 (I53-50B): 2obx;
  • SEQ ID NO:9 (I53-51A): 1woz;
  • SEQ ID NO:10 (I53-51B): 2obx;
  • SEQ ID NO:11 (I52-03A): 1c41;
  • SEQ ID NO:12 (I52-03B): 3bxo;
  • SEQ ID NO:13 (I52-32A): 3lfh;
  • SEQ ID NO:14 (I52-32B): 2jfb;
  • SEQ ID NO:15 (I52-33A): 2jfb;
  • SEQ ID NO:16 (I52-33B): 3q34;
  • SEQ ID NO:17 (I32-06A): 3e7d;
  • SEQ ID NO:18 (I32-06B): 1mww;
  • SEQ ID NO:19 (I32-19A): 2c5q;
  • SEQ ID NO:20 (I32-19B): 2vvp;
  • SEQ ID NO:21 (I32-28A): 2zhz; and
  • SEQ ID NO:22 (I32-28B): 3nqn.


15,552 pairs of pentamers and trimers, 50,400 pairs of pentamers and dimers, and 344,825 pairs of trimers and dimers were arranged in icosahedral symmetry with the 5-fold symmetry axes of the pentamers, 3-fold symmetry axes of the trimers, and 2-fold symmetry axes of the dimers aligned along the 5-fold, 3-fold, and 2-fold icosahedral symmetry axes, respectively. While maintaining perfect icosahedral symmetry, rotations and translations along these axes were sampled to identify configurations predicted to be suitable for protein-protein interface design. In total, 68,983 I53, 35,468 I52, and 177,252 I32 configurations were designed, yielding 71 pairs of I53 protein sequences, 44 pairs of I52 protein sequences, and 68 pairs of I32 protein sequences predicted to fold and assemble into the modeled icosahedral complexes.


Genes encoding the 71 pairs of I53 sequences were synthesized and cloned into a variant of the pET29b expression vector (Novagen, Inc.) between the NdeI and XhoI endonuclease restriction sites. Genes encoding the 44 pairs of I52 sequences and 68 pairs of I32 sequences were synthesized and cloned into a variant of the pET28b expression vector (Novagen, Inc.) between the NcoI and XhoI endonuclease restriction sites.


The two protein coding regions in each DNA construct are connected by an intergenic region. The intergenic region in the I53 designs was derived from the pETDuet-1 vector (Novagen, Inc.) and includes a stop codon, T7 promoter/lac operator, and ribosome binding site. The intergenic region in the I52 and I32 designs only includes a stop codon and ribosome binding site. The sequences of the I53, I52 and I32 intergenic regions are as follows:









I53 intergenic region DNA sequence:


(SEQ ID NO: 41)


5′-TAATGCTTAAGTCGAACAGAAAGTAATCGTATTGTACACGGCCGCAT


AATCGAAATTAATACGACTCACTATAGGGGAATTTGTGAGCGGATAACAA


TTCCCCATCTTAGTATATTAGTTAAGTATAAGAAGGAGATATACTT-3′





I52 intergenic region DNA sequence:


(SEQ ID NO: 42)


5′-TAAAGAAGGAGATATCAT-3′





I32 intergenic region DNA sequence:


(SEQ ID NO: 43)


5′-TGAGAAGGAGATATCAT-3′






The constructs for the I53 protein pairs thus possess the following set of elements from 5′ to 3′: NdeI restriction site, upstream gene, intergenic region, downstream gene, XhoI restriction site. The constructs for the I52 and I32 protein pairs possess the following set of elements from 5′ to 3′: NcoI restriction site, upstream gene, intergenic region, downstream gene, XhoI restriction site. In each case, the upstream genes encode components denoted with the suffix “A”; the downstream genes encode the “B” components (Table 1). This allows for co-expression of the designed protein pairs in which both the upstream and downstream genes have their own ribosome binding site, and in the case of the I53 designs, both genes also have their own T7 promoter/lac operator.


For purification purposes, each co-expression construct includes a 6×-histidine tag (HHHHHH) appended to the N- or C-terminus of one of the two protein coding regions.


Expression plasmids were transformed into BL21(DE3) E. coli cells. Cells were grown in LB medium supplemented with 50 mg L−1 of kanamycin (Sigma) at 37° C. until an OD600 of 0.8 was reached. Protein expression was induced by addition of 0.5 nM isopropyl-thio-β-D-galactopyranoside (Sigma) and allowed to proceed for either 5 h at 22° C. or 3 h at 37° C. before cells were harvested by centrifugation.


The designed proteins were first screened for soluble expression and co-purification at small scale from 2 to 4 mL cultures by nickel affinity chromatography using His MultiTrap® FF nickel-coated filter plates (GE Healthcare). Purification products were analyzed by SDS-PAGE to identify those containing species near the expected molecular weight of both protein subunits (indicating co-purification). Those found to contain both subunits were subsequently subjected to native (non-denaturing) PAGE to identify slow migrating species further indicating assembly to higher order materials. Those designs appearing to co-purify and yielding slowly migrating species by native PAGE were subsequently expressed at larger scale (1 to 12 liters of culture) and purified by nickel affinity chromatography via gravity columns with nickel-NTA resin (Qiagen) or HisTrap® HP columns (GE Healthcare). Fractions containing the designed proteins were pooled, concentrated using centrifugal filter devices (Sartorius Stedim Biotech), and further purified on a Superose® 6 10/300 gel filtration column (GE Healthcare).


The purified proteins were analyzed by size exclusion chromatography using a Superose® 6 10/300 column to assess their assembly states. For each of the exemplary proteins described here, major peaks were observed in the chromatograms near elution volumes of 8.5 to 12 mL, which correspond well with the expected elution volumes for the designed 120-subunit icosahedral nanostructures. Within this set of exemplary proteins, the relative elution volumes correspond with the physical dimensions of the computational design models of the nanostructures, that is, proteins designed to assemble into relatively larger nanostructures yielded peaks at earlier elution volumes while those designed to assemble into relatively smaller nanostructures yielded peaks at later elution volumes. In some cases, smaller secondary peaks were observed at slightly earlier elution volumes than the predominant peak, suggesting transient or low-affinity dimerization of the nanostructures.


Gel filtration fractions containing pure protein in the desired assembly state were analyzed by negative stain electron microscopy as described previously (2). Electron micrographs showing fields of particles of the expected size and shape have been obtained for 10 of the nanostructures. In one case (I32-19), the nanostructure appears to be unstable in the conditions encountered during grid preparation, precluding visualization by electron microscopy.


To further validate the structures of our materials, small angle X-ray scattering (SAXS) data was obtained for several of the designed nanostructures. Scattering measurements were performed at the SIBYLS® 12.3.1 hemline at the Advanced Light Source. LBNL, on 20 microliter samples loaded into a helium-purged sample chamber (10). Data were collected on gel filtration fractions and samples concentrated ˜2×-10× from individual fractions, with the gel filtration buffer and concentrator eluates used for buffer subtraction. Sequential exposures ranging from 0.5 to 5 seconds were taken at 12 keV to maximize signal to noise, with visual checks for radiation-induced damage to the protein. The FOXS® algorithm (11, 12) was then used to calculate scattering profiles from our design models and fit them to the experimental data. The major features of the I53-34, I53-47, I53-50, I52-03, I52-32, I52-33, I32-06, I32-I9, and I32-28 design models were all found to match well with the experimental data; supporting the conclusion that the nanostructures assemble to the intended assembly state and three-dimensional configuration in solution. Graphs of the log of the scattering intensity, I(q), as a function of scattering angle, q, show multiple large dips in the scattering intensity in the low q region between 0.015 Å−1 and 0.15 Å−1, each of which is closely recapitulated in the theoretical profiles calculated from the design models. Although the I53-51 design model was not found to match well with the SAXS data, this appears likely to be due to low stability of the designed material, which caused it to be primarily unassembled at the concentrations used for the SAXS measurements; this result is consistent with our findings from gel filtration of I53-51, in which significant peaks were observed corresponding to the unassembled pentamers and trimers in addition to the presumed 120-subunit assembly peak.


Using the Rosetta macromolecular modeling suite, the computational models of designed I53 materials were redesigned by allowing optimization of the identities of relatively exposed residues (defined as having a solvent accessible surface area of greater than 20 square Ångstroms), excepting polar residues (Aspartate, Glutamate, Histidine, Lysine, Asparagine, Glutamine, and Arginine) and residues near the designed protein-protein interfaces between the pentameric and trimeric components. Mutations that resulted in losses of significant atomic packing interactions or side chain-backbone hydrogen bonds were discarded. A position-specific scoring matrix (PSSM) based on homologous protein sequences was used to augment the Rosetta scorefunction to favor residues that appear frequently at a given position in homologous proteins, a design approach referred to as consensus protein design (9). Multiple design trajectories were performed with varying weights on the contribution of the PSSM, and mutations to polar residues that appeared favorable across all design trajectories were selected for inclusion in the variant protein. These variants were designated by the addition of “0.1” to the end of their names (e.g., I53-50A.1).


The Rosetta macromolecular modeling suite was used to mutate manually selected amino acid positions to charged amino acids in order to generate variant nanoparticles featuring highly positively or negatively charged interior surfaces. To generate negatively charged nanoparticles (denoted by the letters “Neg” in their names), mutations were limited to either Aspartate or Glutamate. To generate positively charged nanoparticles (denoted by the letters “Pos” in their names), mutations were limited to either Arginine or Lysine. Relevant score metrics for each mutation were independently assessed, and favorable mutations were sorted into two tiers based on their scores. Two new nanoparticle variants sequences were then designed for each individual protein for each type of charge, one including only the Tier 1 mutations (named “T1”) and the other including both the Tier 1 and Tier 2 mutations (named “T2”). In most cases, the charged mutations were incorporated into the consensus redesign variants described above.


Genes encoding the I53 “0.1” and charged variant proteins were synthesized and cloned into the pET29b expression vector (Novagen, Inc.) between the NdeI and XhoI endonuclease restriction sites. Constructs were produced in two formats. In the first, the two proteins were encoded in a bicistronic arrangement on a single expression plasmid as described above for co-expression in E. coli. In the second, each protein component (i.e., the pentameric component and the trimeric component) were cloned individually into pET29b for expression in the absence of the other component.


For purification purposes, each co-expression construct included a 6×-histidine tag (HHHHHH) appended to the N- or C-terminus of one of the two protein coding regions. Similarly, each individual expression construct included a 6×-histidine tag appended to the N- or C-terminus of the protein coding region.


The “0.1” and charged variant proteins were expressed and purified as described above with two differences. First, expression at 18° C. was evaluated in addition to expression at 37° C. at small scale for all variants, and, in some cases, expression at 18° C. was used to produce the proteins at multi-liter scale. Second, for some variants, the detergent 3-[(3-cholamidopropyl)dimethylammonio]-1-propanesulfonate (CHAPS) was included in all purification buffers at a concentration of 0.75% weightivolume to prevent protein aggregation.


After purification of individually expressed protein components, pairs of components designed to co-assemble into a nanoparticle (e g., I53-40.1A and I53-40.1B) were mixed in equimolar amounts in buffer and allowed to incubate at room temperature for 1-24 hours, a procedure we refer to as “in vitro assembly.” For assemblies including charged components, the buffer included 500 mM NaCl; in all other cases the buffer included 150 mM NaCl. The mixtures were fractionated and analyzed on a Superose® 6 10/300 gel filtration column (GE Healthcare), and fractions were analyzed by SDS-PAGE to determine the protein contents of each elution peak.


In one exemplary embodiment, the I53-40.1A and I53-40.1B protein variants, based off of I53-40A and I53-40B, respectively, were constructed by consensus protein design, in which multiple sequence alignments from protein families related to each protein subunit were used to guide the selection of amino acid residues at surface-exposed positions. The variant proteins were found -to be more stable and soluble when purified independently than the original proteins, a property that enabled the formation of the designed nanostructure by simply mixing solutions containing the purified components in physiological buffers in a 1:1 molar ratio. The addition of 0.75% CHAPS, a zwitterionic detergent, to the buffer was found to further increase the stability and solubility of I53-40.1A and was therefore included during the purification of the protein prior to in vitro assembly. Size exclusion chromatograms from a run analyzing the mixed solution containing both components on a Superose 6 column revealed a single major peak at the elution volume expected for the 120-subunit designed icosahedral nanostructure. Analysis of the peak fractions by SDS-PAGE revealed bands at the expected molecular weight for the first and second polypeptides of the nanostructure in an apparent 1:1 stoichiometric ratio. The data demonstrate that when mixed, the two components co-assemble to the 120-subunit designed icosahedral nanostructure.


In another exemplary embodiment, the I53-47A.1, I53-47B, I53-50A.1, and I53-50B.1 protein variants, based off of I53-47A, I53-47B, I53-50A, and I53-50B, respectively, were constructed by consensus protein design, in which multiple sequence alignments from protein families related to each protein subunit were used to guide the selection of amino acid residues at surface-exposed positions. The variant proteins were found to be more stable and soluble when purified independently than the original proteins, a property that enabled the formation of the designed nanostructure by simply mixing solutions containing the purified components in physiological buffers in a 1:1 molar ratio, a process referred to as in vitro assembly. The addition of 0.75% CHAPS, a zwitterionic detergent, to the buffer was found to further increase the stability and solubility of I53-47B.1 and I53-50B.1 and was therefore included during the purification of the proteins prior to in vitro assembly. Size exclusion chromatograms from a run analyzing the mixed solution containing both I53-47A.1 and I53-47B.1 on a Superose 6 column revealed a major peak at the elution volume expected for the 120-subunit designed icosahedral nanostructure as well as a smaller secondary peak at a later elution volume. Analysis of the peak fractions corresponding to the 120-subunit nanostructure by SUS-PAGE revealed bands at the expected molecular weight for the first and second polypeptides of the nanostructure in an apparent 1:1 stoichiometric ratio. Analysis of the secondary peak at the later elution volume revealed that this peak comprises only the trimeric subunit, suggesting that the in vitro assembly mixture actually contained an excess of this polypeptide. Similarly, size exclusion chromatograms from a run analyzing the mixed solution containing both I53-50AT and I53-50B.1 on a Superose 6 column revealed a peak at the elution volume expected for the 120-subunit designed icosahedral nanostructure as well as two secondary peaks at later elution volumes. Analysis of the peak fractions corresponding to the 120-subunit nanostructure by SDS-PAGE revealed bands at the expected molecular weight for the first and second polypeptides of the nanostructure in an apparent 1:1 stoichiometric ratio. Analysis of the secondary peaks at the later elution volumes revealed that the first of the two comprises only the pentameric subunit, while the second of the two comprises only the trimeric subunit, suggesting that for this pair of proteins, in vitro assembly is somewhat inefficient. Together, the data demonstrate that when mixed, the two components of each nanostructure I53-47A.1 and I53-47B.1 or I53-50A.1 and I53-50B.1) co-assemble to the 120-subunit designed icosahedral nanostructures.


In another exemplary embodiment, the protein variants I53-47A.1NegT2, I53-47B.1NegT2, I3-50A.1NegT2, and I53-50B.1NegT2, based off of I53-47A.1, I53-47B.1, I53-50A.1, and I53-50B.1, respectively, bear mutations that introduce additional negatively charged amino acid residues (i.e., Aspartate and Glutamate) on their surfaces such that the nanostructures formed through the assembly of these proteins have highly charged interior surfaces. After the two independently purified proteins I53-47A.1NegT2 and I53-47B.1NegT2 were mixed together in an in vitro assembly reaction in a buffer with a concentration of 150 mM NaCl, no assembly was observed when the mixture was analyzed on a Superose 6 size exclusion chromatography column; only unassembled I53-47A.1NegT2 and I53-47B.1NegT2 proteins eluted from the column. In contrast, if the in vitro assembly reaction was performed in the presence of 0.5 M NaCl, robust assembly to the designed nanostructure was observed, with some remaining unassembled proteins eluting later as smaller secondary elution peaks. Similarly, after the two independently purified proteins I53-50A.1NegT2 and I53-50B.1NegT2 were mixed together in an in vitro assembly reaction in a buffer with a concentration of 150 mM NaCl, no assembly was observed when the mixture was analyzed on a Superose® 6 size exclusion chromatography column; only unassembled I53-50A.1NegT2 and I53-50B.1NegT2 proteins eluted from the column. In contrast, if the in vitro assembly reaction was performed in the presence of 0.5 M NaCl, assembly to the designed nanostructure was observed, with some remaining unassembled proteins eluting later. Together, the data demonstrate that when mixed, the two components of each highly charged 120-subunit designed icosahedral nanostructure assemble to the target structure only in the presence of high ionic strength.


In order to package nucleic acids, pairs of individually purified protein components designed to co-assemble into a nanoparticle were combined with single-stranded DNA (ssDNA) in buffer and allowed to incubate overnight. ssDNA was present at a final concentration of 26 ng/μL (200 pM) for 400 nucleotide (nt) strands, and 35.2 ng/μL (66.7 pM) for 1600 nt strands. Individual protein components were added at final equimolar concentrations ranging from 2-12 μM, and the final NaCl concentration was 150 mM. After overnight incubation, samples were either analyzed by electrophoresis on a 1% agarose gel or DNase I was added to a final concentration of 25 μg/mL and incubated for one hour at room temperature before electrophoresis. Gels were stained with SybrGold® (ThermoFisher Scientific) and imaged to visualize nucleic acid, and were subsequently stained with GelCode® Blue (Pierce) and imaged again to visualize protein.


The above definitions and explanations are meant and intended to be controlling in any future construction unless clearly and unambiguously modified in the following examples or when application of the meaning renders any construction meaningless or essentially meaningless. In cases where the construction of the term would render it meaningless or essentially meaningless, the definition should be taken from Webster's Dictionary, 3rd Edition or a dictionary known to those of skill in the art, such as the Oxford Dictionary of Biochemistry and Molecular Biology (Ed. Anthony Smith, Oxford University Press, Oxford, 2004).


The above description provides specific details for a thorough understanding of, and enabling description for, embodiments of the disclosure. However, one skilled in the art will understand that the disclosure may be practiced without these details. In other instances, well-known structures and functions have not been shown or described in detail to avoid unnecessarily obscuring the description of the embodiments of the disclosure. The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize.


Aspects of the disclosure can be modified, if necessary, to employ the systems, functions and concepts of the above references and application to provide yet further embodiments of the disclosure. These and other changes can be made to the disclosure in light of the detailed description.


Specific elements of any of the foregoing embodiments can be combined or substituted for elements in other embodiments. Furthermore, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also exhibit such advantages, and not all embodiments need necessarily exhibit such advantages to fall within the scope of the disclosure.


The above detailed description describes various features and functions of the disclosed systems, devices, and methods with reference to the accompanying figures. In the figures, similar symbols typically identify similar components, unless context dictates otherwise. The illustrative embodiments described in the detailed description, figures, and claims are not meant to be limiting. Other embodiments can be utilized, and other changes can be made, without departing from the spirit or scope of the subject matter presented herein. It will be readily understood that the aspects of the present disclosure, as generally described herein, and illustrated in the figures, can be arranged, substituted, combined, separated, and designed in a wide variety of different configurations, all of which are explicitly contemplated herein.


Numerous modifications and variations of the present disclosure are possible in light of the above teachings. Unless otherwise indicated, all numbers expressing quantities of ingredients, properties such as molecular weight, reaction conditions, and so forth used in the specification and claims are to be understood as being modified in all instances by the term “about.” Notwithstanding that the numerical ranges and parameters setting forth the broad scope of the invention are approximations, the numerical values set forth in the specific examples are reported as precisely as possible. Any numerical value, however, inherently contains certain errors necessarily resulting from the standard deviation found in their respective testing measurements. Groupings of alternative elements or embodiments of the invention disclosed herein are not to be construed as limitations. Each group member may be referred to and claimed individually or in any combination with other members of the group or other elements found herein. It is anticipated that one or more members of a group may be included in, or deleted from, a group for reasons of convenience and/or patentability. When any such inclusion or deletion occurs, the specification is deemed to contain the group as modified thus fulfilling the written description of all Markush groups used in the appended claims.


Furthermore, numerous references have been made to patents and printed publications throughout this specification. Each of the above-cited references and printed publications are individually incorporated herein by reference in their entirety.


It is to be understood that the embodiments of the invention disclosed herein are illustrative of the principles of the present invention. Other modifications that may be employed are within the scope of the invention. Thus, by way of example, but not of limitation, alternative configurations of the present invention may be utilized in accordance with the teachings herein. Accordingly, the present invention is not limited to that precisely as shown and described. The particulars shown herein are by way of example and for purposes of illustrative discussion of the preferred embodiments of the present invention only and are presented in the cause of providing what is believed to be the most useful and readily understood description of the principles and conceptual aspects of various embodiments of the invention. In this regard, no attempt is made to show structural details of the invention in more detail than is necessary for the fundamental understanding of the invention, the description taken with the drawings and/or examples making apparent to those skilled in the art how the several forms of the invention may be embodied in practice.


REFERENCES



  • 1. N. P. King et al., Computational design of self-assembling protein nanomaterials with atomic level accuracy. Science 336, 1171 (Jun. 1, 2012).

  • 2. N. P. King et al., Accurate design of co-assembling multi-component protein nanomaterials. Nature 510, 103 (Jun. 5, 2014).

  • 3. S. Raman et al., Design of Peptide Nanoparticles Using Simple Protein Oligomerization Domains. The Open Nanomedicine Journal 2, 15 (2009).

  • 4. J. P. Julien et al., Crystal structure of a soluble cleaved HIV-1 envelope trimer. Science 342, 1477 (Dec. 20, 2013).

  • 5. D. Lyumkis et al., Cryo-EM structure of a fully glycosylated soluble cleaved HIV-1 envelope trimer. Science 342, 1484 (Dec. 20, 2013).

  • 6. M. Pancera et al., Structure and immune recognition of trimeric pre-fusion HIV-1 Env. Nature, (Oct. 8, 2014).

  • 7. T. O. Yeates, C. S. Crowley, S. Tanaka, Bacterial microcompartment organelles: protein shell structure and evolution. Arm Rev Biophys 39, 185 (2010).

  • 8. P. Kumar, M. Singh, S. Karthikeyan, Crystal structure analysis of icosahedral lumazine synthase from Salmonella typhimurium, an antibacterial drug target. Acta Crystallogr D Biol Crystallogr 67, 131 (February 2011).

  • 9. C. Jäckel, J. D. Bloom, P. Kast, F. H. Arnold, D. Hilvert. Consensus Protein Design without Phylogenetic Bias J. Mol. Biol., 399 (2010), pp. 541-546.

  • 10. Hura, G. L. et al. Robust, high-throughput solution structural analyses by small angle X-ray scattering (SAXS). Nat. Methods 6, 606-612 (2009).

  • 11. Schneidman-Duhovny, D., Hammel, M., Miner, J. A. & Sali. A. Accurate SAXS Profile Computation and its Assessment by Contrast Variation Experiments. Biophys. J. 105, 962-974 (2013).

  • 12. Schneidman-Duhovny, D., Hammel, M. & Sali, A. FoXS: a web server for rapid computation and fitting of SAXS profiles. Nucleic Acids Res. 38, W540-W544 (2010).


Claims
  • 1. An isolated polypeptide comprising an amino acid sequence that is at least 75% identical over its length, and identical at least at one identified interface position, to the amino acid sequence of a polypeptide selected from the group consisting of SEQ ID NOS:1-34:
  • 2. The isolated polypeptide of claim 1, wherein the polypeptide is identical at least at half of the identified interface positions to the amino acid sequence of a polypeptide selected from the group consisting of SEQ ID NO:1-34.
  • 3. The isolated polypeptide of claim 1, wherein the polypeptide is identical at all of the identified interface positions to the amino acid sequence of a polypeptide selected from the group consisting of SEQ ID NO:1-34.
  • 4. The isolated polypeptide of claim 1, wherein the polypeptide comprises an amino acid sequence that is at least 90% identical over its length to the sequence of a polypeptide selected from the group consisting of SEQ ID NO:1-34.
  • 5. The isolated polypeptide of claim 1, wherein the polypeptide comprises the amino acid sequence of a polypeptide selected from the group consisting of SEQ ID NOS: 1-40.
  • 6. A nanostructure, comprising: (a) a plurality of first assemblies, each first assembly comprising a plurality of identical first polypeptides, wherein the first polypeptides comprise the polypeptide of claim 1; and(b) a plurality of second assemblies, each second assembly comprising a plurality of identical second polypeptides, wherein the second polypeptides comprise the polypeptide of claim 1, and wherein the second polypeptide differs from the first polypeptide;wherein the plurality of first assemblies non-covalently interact with the plurality of second assemblies to form a nanostructure.
  • 7. The nanostructure of claim 6; wherein the nanostructure has icosahedral symmetry.
  • 8. The nanostructure of claim 6; wherein the first polypeptides and the second polypeptides comprise polypeptides with the amino acid sequences selected from the following pairs: (i) SEQ :ID NO:1 and SEQ ID NO:2 (I53-34A and I53-34B);(ii) SEQ :ID NO:3 and SEQ ID NO:4 (I53-40A and I53-40B);(iii) SEQ :ID NO:3 and SEQ ID NO:24 (I53-40A and I53-40B.1);(iv) SEQ :ID NO:23 and SEQ ID NO:4 (I53-40A.1 and I53-40B);(v) SEQ :ID NO:35 and SEQ ID NO:36 (I53-40A genus and I53-40B genus);(vi) SEQ :ID NO:5 and SEQ ID NO:6 (I53-47A and I53-47B);(vii) SEQ :ID NO:5 and SEQ ID NO:27 (I53-47A and I53-47B.1);(viii) SEQ :11) NO:5 and SEQ ID NO:28 (I53-47A and I53-47B.1NegT2);(ix) SEQ ID NO:25 and SEQ ID NO:6 (I53-47A.1 and I53-47B);(x) SEQ ID NO:25 and SEQ ID NO:27 (I53-47A.1 and I53-47B.1);(xi) SEQ ID NO:25 and SEQ ID NO:28 (I53-47A.1 and I53-47B.1NegT2);(xii) SEQ ID NO:26 and SEQ ID NO:6 (I53-47A.1NegT2 and I53-47B);(xiii) SEQ ID NO:26 and SEQ ID NO:27 (I53-47A.1NegT2 and I53-47B.1);(xiv) SEQ ID NO:26 and SEQ ID NO:28 (I53-47A.1NegT2 and I53-47B.1NegT2),(xv) SEQ ID NO:37 and SEQ ID NO:38 (I53-47A genus and I53-47B genus);(xvi) SEQ ID NO:7 and SEQ ID NO:8 (I53-50A and I53-50B);(xvii) SEQ ID NO:7 and SEQ ID NO:32 (I53-50A and I53-50B.1);(xix) SEQ ID NO:7 and SEQ ID NO:33 (I53-50A and I53-50B.1NegT2);(xx) SEQ ID NO:7 and SEQ ID NO:34 (I53-50A and I53-50B.4PosT1);(xxi) SEQ ID NO:29 and SEQ ID NO:8 (I53-50A.1 and I53-50B);(xxii) SEQ ID NO:29 and SEQ ID NO:32 (I53-50A.1 and I53-50B.1);(xxiii) SEQ ID NO:29 and SEQ ID NO:33 (I53-50A.1 and I53-50B.1NegT2);(xxiv) SEQ ID NO:29 and SEQ ID NO:34 (I53-50A.1 and I53-50B.4PosT1);(xxv) SEQ ID NO:30 and SEQ ID NO:8 (I53-50A.1NegT2 and I53-50B);(xxvi) SEQ ID NO:30 and SEQ ID NO:32 (I53-50A.1NegT2 and I53-50B.1);(xxvii) SEQ ID NO:30 and SEQ ID NO:33 (I53-50A.1NegT2 and I53-50B.1NegT2);(xxviii) SEQ ID NO:30 and SEQ ID NO:34 (I53-50A.1NegT2 and I53-50B4PosT1);(xxix) SEQ ID NO:31 and SEQ ID NO:8 (I53-50A.1PosT1 and I53-50B);(xxx) SEQ ID NO:31 and SEQ ID NO:32 (I53-50A.1PosT1 and I53-50B.1);(xxxi) SEQ ID NO:31 and SEQ ID NO:33 (I53-50A.1PosT1 and I53-50B.1NegT2);(xxxii) SEQ ID NO:31 and SEQ ID NO:34 (I53-50A.1PosT1 and I53-50B.4PosT1);(xxxiii) SEQ ID NO:39 and SEQ ID NO:40 (I53-50A genus and I53-50B genus);(xxxiv) SEQ ID NO:9 and SEQ ID NO:10 (I53-51A and I53-51B);(xxxv) SEQ ID NO:11 and SEQ ID NO:12 (I52-03A and I52-03B);(xxxvi) SEQ ID NO:13 and SEQ ID NO:14 (I52-32A and I52-32B);(xxxv) SEQ ID NO:15 and SEQ ID NO:16 (I52-33A and I52-33B)(xxxvi) SEQ ID NO:17 and SEQ ID NO:18 (I32-06A and I32-06B);(xxxvii) SEQ ID NO:19 and SEQ ID NO:20 (I32-19A and I32-19B);(xxxviii) SEQ ID NO:21 and SEQ ID NO:22 (I32-28A and I32-28B); and(xxxix) SEQ ID NO:23 and SEQ ID NO:24 I53-40A.1 and I53-40B.1).
  • 9. The nanostructure of claim 6, wherein the number of identical first polypeptides in each first assembly is different than the number of identical second polypeptides in each second assembly.
  • 10. The nanostructure of claim 9, wherein each first assembly comprises five copies of the identical first polypeptide, and each second assembly comprises three copies of the identical second polypeptide.
  • 11. The nanostructure of claim 10, wherein the nanostructure comprises twelve first assemblies and twenty second assemblies.
  • 12. The nanostructure of claim 9, wherein each first assembly comprises three copies of the identical first polypeptide, and each second assembly comprises two copies of the identical second polypeptide.
  • 13. The nanostructure of claim 12, wherein the nanostructure comprises twenty first assemblies and thirty second assemblies.
  • 14. The nanostructure of claim 9, wherein each first assembly comprises five copies of the identical first polypeptide, and each second assembly comprises two copies of the identical second polypeptide.
  • 15,. The nanostructure of claim 14, wherein the nanostructure comprises twelve first assemblies and thirty second assemblies.
  • 16. The nanostructure of claim 6, further comprising a cargo within the nanostructure.
  • 17. The nanostructure of claim 16, wherein the cargo comprises a nucleic acid.
  • 18. A recombinant nucleic acid encoding the isolated polypeptide of claim 1.
  • 19. A recombinant expression vector comprising the recombinant nucleic acid of claim 18 operatively linked to a promoter.
  • 20. A recombinant host cell, comprising the recombinant expression vectors of claim 19.
CROSS REFERENCE

This application is a continuation of U.S. patent application Ser. No. 15/490,351 filed Apr. 18, 2017, which is a divisional application of U.S. patent application Ser. No, 14/930,792 filed Nov. 3, 2015, now U.S. Pat. No. 9,630,994 issued Apr. 25, 2017, which claims priority to U.S. Provisional Patent Application Ser. No. 62/074,167 filed Nov. 3, 2014 each incorporated by reference herein in its entirety.

STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH

This invention was made with U.S. government support under CHE-1332907, awarded by the National Science Foundation, and DGE-0718124, awarded by the National Science Foundation. The U.S. Government has certain rights in the invention.

Provisional Applications (1)
Number Date Country
62074167 Nov 2014 US
Divisions (1)
Number Date Country
Parent 14930792 Nov 2015 US
Child 15490351 US
Continuations (1)
Number Date Country
Parent 15490351 Apr 2017 US
Child 16427493 US