POST PROCESS PURIFICATION FOR GAMMA-BUTYROLACTONE PRODUCTION

Abstract
Post purification processes and methods for making pure biobased gamma-butyrolactone from renewable carbon resources comprising filtration and/or distillation and/or peroxide treatment are described herein.
Description
BACKGROUND OF THE INVENTION

With dwindling petroleum resources, increasing energy prices, and environmental concerns, development of energy efficient biorefinery processes to produce biobased chemicals from renewable, low cost, carbon resources offers a unique solution to overcoming the increasing limitations of petroleum-based chemicals.


One chemical with wide industrial and pharmaceutical uses that could be manufactured using a biorefinery process is gamma-butyrolactone (GBL). The global market demand for GBL has been estimated at 850 million lbs/yr, translating to total sales of $1 billion annually. Gamma-buytrolactone is a colorless, weak odor liquid that is used predominantly as an intermediate in the manufacture of commercially important chemicals such as 1,4-butanediol (BDO), tetrahydrofuran (THF), N-methylpyrrolidone (NMP), N-ethylpyrrolidone (NEP), 2-pyrrolidinone, N-vinylpyrrolidone (NVP), polyvinylpyrrolidone (PVP) and so forth. These chemicals have applications in high performance solvents for electronics, lube oil extraction, magnetic wire coatings, engineering resins, pharmaceutical intermediates, cosmetics, hair spray and high valued polymers. GBL by itself has many uses including as a solvent for paint stripping, degreaser, viscosity modifier for polyurethanes, dispersant for water soluble inks, curing agent for urethanes and polyamides, etchant for metal coated plastics, rubber additive and herbicide ingredient.


Petroleum-based GBL is manufactured by several different chemical processes. For example, it is synthesized by dehydration of gamma-hydroxybutyric acid (GHB), by the reaction of acetylene with formaldehyde or vapor phase hydrogenation of maleic anhydride or succinic anhydride and their esters. The latter two methods are respectively known as the Reppe process and the Davy process. The Reppe process was developed in the 1940's and historically was the first commercial route to making 1,4-butanediol. The process starts by reacting acetylene and formaldehyde together which is then followed by a series of hydrogenation stages to obtain BDO and finally dehydrogenation to generate GBL. The main disadvantages of this process are that the starting reactants are quite hazardous and generally present the manufacturer with handling and environmental challenges. Additionally, acetylene is a relatively expensive starting material.


The Davy Process, developed in the 1990's, uses a multistage process that starts by reacting molten maleic anhydride with methanol to produce monomethyl maleate. Next the monomethyl maleate is converted from mono to dimethyl maleate in the presence of an acid resin catalyst. Using catalytic vapor phase hydrogenation, the dimethyl maleate is converted to dimethyl succinate and then finally through a series of additional reactions to a GBL. The final product is refined to obtain the high purity GBL. Many patents describe the various types of hydrogenation catalysts used to convert maleic anhydride or succinic anhydride to GBL. These include copper chromite (described in U.S. Pat. No. 3,065,243), copper chromite with nickel (U.S. Pat. No. 4,006,165), and mixtures of copper, zinc or aluminum oxides (U.S. Pat. No. 5,347,021) as well as reduced copper and aluminum oxides mixtures (U.S. Pat. No. 6,075,153).


Impurities or side products are always generated during the production of GBL by the various processes described above. For petroleum-derived GBL, fractional distillation has been the method of choice for purification. For example, EP Patent Application 0 301 852 describes a process for the purification of GBL derived from a feed mixture containing a minor amount of diethyl succinate which is removed in a final step by fractionally distilling the mixture. Others have additionally shown the separation of mixtures of GBL with THF or 1,4-BDO by distillation methods (see U.S. Pat. Nos. 6,846,389B2; 7,351,311 and U.S. patent application US 2010/0101931). While these methods in themselves may be suitable for purifying petroleum-derived GBL, biobased GBL has been found to contain additional “biological” impurities which require a combination of purification steps that are tailored to removing them.


A need therefore exists to develop post processing purification methods for biobased GBL production that result in high purity, pharamaceutical grade GBL and GBL products. These post processing steps help remove undesirable biological impurities resulting from the production of GBL from biomass.


SUMMARY OF THE INVENTION

The invention generally relates to post processing methods of an integrated biorefinery processes for producing high purity, high yield, biobased, gamma-butyrolactone (GBL) from renewable carbon resources with a reduced amount of impurities. Producing GBL from a genetically engineered biomass generates impurities that are unique to producing a biobased product.


The post-processing steps for production of pure biobased GBL include but are not limited to separation techniques, for example, filtration, distillation, oxidation or other chemical/physical processes and combinations of these processes for the removal of impurities from the biobased GBL that may contribute to undesirable impurities including those impurities that contribute to odor and color properties. In certain embodiments, the order of these processes can be changed, repeated and varied to generate the desired final purity level. For example, filtration can be done either first, or after a series of distillations. In other embodiments, filtration is done before and after one or more distillations.


The undesirable impurities include but are not limited to: fatty acids, water, thiophenes, nitrogen-containing ring compounds (e.g., pyrrolidone), acids, alcohols, amines, metals (Ca, Mg, Na, Fe, Cr, Ni) and other side products or contaminants resulting from the production of the biobased GBL product. These side products (e.g., impurities) contribute to undesirable color and odor properties. Reduction of these impurities can be as much as 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95% 99.5% based on the starting amount of GBL. For example, the total reduction can be between about 10% to about 99%, from about 10% to about 80%, from about 10% to about 75%, from about 10% to about 60%, from about 10% to about 50%, from about 20% to about 60%. Reducing these impurities to amounts that do not adversely contribute to undesirable color or odor properties (e.g., low odor or low color) is accomplished by the methodologies described herein.


In a first aspect of the invention a process for production of a biobased gamma-butyrolactone is described, comprising combining a genetically engineered biomass comprising poly-4-hydroxybutyrate and a catalyst; heating the biomass with the catalyst to convert the poly 4-hydroxybutyrate to a gamma-butyrolactone product; and removing impurities from the gamma-butyrolactone product forming a pure gamma-butyrolactone.


In a second aspect, a process for production of a biobased gamma-butyrolactone is described, comprising combining a genetically engineered biomass comprising poly-4-hydroxybutyrate and a catalyst; heating the biomass with the catalyst to convert the poly 4-hydroxybutyrate to a gamma-butyrolactone product; and filtering the gamma-butyrolactone product to a pure gamma-butyrolactone.


In a third aspect, a process for production of a biobased gamma-butyrolactone, is described comprising combining a genetically engineered biomass comprising poly-4-hydroxybutyrate and a catalyst; heating the biomass with the catalyst to convert the poly 4-hydroxybutyrate to a gamma-butyrolactone product; and distilling the gamma-butyrolactone product to a pure gamma-butyrolactone. In a particular embodiment of the third aspect, water is added prior to distilling.


In a fourth aspect, a process for production of a biobased gamma-butyrolactone, is described comprising combining a genetically engineered biomass comprising poly-4-hydroxybutyrate and a catalyst; heating the biomass with the catalyst to convert the poly 4-hydroxybutyrate to a gamma-butyrolactone product; filtering the gamma-butyrolactone product, and distilling the gamma-butyrolactone product one or more times to a pure gamma-butyrolactone. In a particular embodiment of the fourth aspect, water is added prior to distilling.


In a fifth aspect of any one of the other aspects, the biobased gamma-butyrolactone is further treated with an ion exchange resin. In a sixth aspect of any one of the other aspects, the biobased gamma-butyrolactone is further treated with activated carbon and/or activated carbon.


In a seventh aspect, the biobased gamma-butyrolactone is further treated with an oxidizing compound such as but not limited to ozone gas. In an eighth aspect, water is added to the gamma-butyrolactone at least about 20% by weight GBL.


In an embodiment of the first, second, third, fourth, fifth, sixth, seven, or eighth aspect, the pure gamma-butyrolactone has a purity of at least 99.5%, low color and low odor. In a second embodiment of the first, second, third, fourth, fifth, sixth, seven, or eighth aspect, the pure gamma-butyrolactone is colorless and odorless.


In a third embodiment of the first, second, third, fourth, fifth, sixth, seven, or eighth aspect, the APHA color value is less than 20, less than 19, less than 18, less than 17, less than 16, less than 15, less than 14, less than 13, less than 12, less than 11, less than 10, less than 9, less than 8, and intervals between the integers (e.g, 10.1, 9.4, 8.8, etc.) or in a range between 7 and 20. In a fourth embodiment of the first, second, third, fourth, fifth, sixth, seven, or eighth aspect, the APHA color value is less than 7. In a fifth embodiment of the first, second, fourth, fifth, sixth, seven, or eighth aspect, the pH of the pure butyrolactone is less than 6, less than 5, less than 4, (e.g., 5.40, 4.88, 4.76, 4.58, 3.75).


In a sixth embodiment of the first, second, third, fourth, fifth, sixth, seven, or eighth aspect water is added to the gamma-butyrolactone product prior to distilling. In a seventh embodiment of the first, second, third, fourth, fifth, sixth, seven, or eighth aspect, water and a hydrogen peroxide solution, alkyl hydroperoxide, aryl hydroperoxide, peracid, perester, perborate salt, percarbonate salt, persulfate salt or hypochlorite salt is added to the gamma-butyrolactone product prior to distilling. In an eighth embodiment of the first, second, third fourth, fifth, sixth, seven, or eighth aspect, the distilling step is repeated one, two, three or more times. Combinations of any of these embodiments and aspects are also contemplated.


In a ninth embodiment, the water that is added to any of the aspects or embodiments above is at least at or about 20% by weight GBL.


In one aspect, a process for the production of gamma-butyrolactone (GBL) product from a genetically engineered microbial biomass metabolizing glucose or any other renewable feedstock to produce 4-hydroxybutyrate homopolymer (P4HB) inside the microbial cells, followed by controlled heating of the biomass containing P4HB with a catalyst forming the gamma-butyrolactone (GBL) product is described. The level of P4HB in the biomass should be greater than 10% by weight of the total biomass. The advantages of this bioprocess are that it uses a renewable carbon source as the feedstock material, the genetically engineered microbe produces P4HB in very high yield without adverse toxicity effects to the host cell (which could limit process efficiency) and when combined with a catalyst and heated is capable of producing biobased GBL in high yield with high purity.


In certain aspects, a recombinant engineered P4HB biomass from a host organism serves as a renewable source for converting 4-hydroxybutyrate homopolymer to the useful intermediate GBL. In some embodiments, a source of the renewable feedstock is selected from glucose, fructose, sucrose, arabinose, maltose, lactose, xylose, fatty acids, vegetable oils, and biomass derived synthesis gas or a combination of two or more of these. The produced P4HB biomass is then treated in the presence of a catalyst to produce gamma-butyrolactone (GBL). In other embodiments, the P4HB biomass is dried prior to combining with the catalyst. In certain embodiments, the process further comprises recovering the gamma-butyrolactone product. In certain embodiments, the recovery is by condensation.


In some embodiments the GBL is further processed for production of other desired commodity and specialty products, for example 1,4-butanediol (BDO), tetrahydrofuran (THF), N-methylpyrrolidone (NMP), N-ethylpyrrolidone (NEP), 2-pyrrolidinone, N-vinylpyrrolidone (NVP), polyvinylpyrrolidone (PVP) and the like.


The host organism used to produce the biomass containing P4HB has been genetically modified by introduction of genes and/or deletion of genes in a wild-type or genetically engineered P4HB production organism creating strains that synthesize P4HB from inexpensive renewable feedstocks. An exemplary pathway for production of P4HB is provided in FIG. 1 and it is understood that additional enzymatic changes that contribute to this pathway can also be introduced or suppressed for a desired production of P4HB.


In one aspect, the present invention provides a process for production of biobased gamma-butyrolactone product. In certain embodiments, gamma-butyrolactone in the product has 100% biobased carbon content (e.g, as determined based on 14C isotope analysis). The process includes combining a genetically engineered biomass comprising poly-4-hydroxybutyrate and a catalyst; heating the biomass with the catalyst to convert 4-hydroxybutyrate to gamma-butyrolactone product. In certain embodiments, a yield of gamma-butyrolactone product is about 85% by weight or greater based on one gram of a gamma-butyrolactone in the product per gram of the poly-4-hydroxybutyrate. The genetically engineered recombinant host produces a 4-hydroxybutyrate polymer.


In another aspect, the genetically engineered biomass for use in any of the processes (e.g., any of the aspects recited herein) of the invention is from a recombinant host having a poly-4-hydroxybutyrate pathway, wherein the host has an inhibiting mutation in its CoA-independent NAD-dependent succinic semialdehyde dehydrogenase gene or its CoA-independent NADP-dependent succinic semialdehyde dehydrogenase gene, or having inhibiting mutations in both genes, and having stably incorporated one or more genes encoding one or more enzymes selected from a succinyl-CoA:coenzyme A transferase wherein the succinyl-CoA:coenzyme A transferase is able to convert succinate to succinyl-CoA, a succinate semialdehyde dehydrogenase wherein the succinate semialdehyde dehydrogenase is able to convert succinyl-CoA to succinic semialdehyde, a succinic semialdehyde reductase wherein the succinic semialdehyde reductase is able to convert succinic semialdehyde to 4-hydroxybutyrate, a CoA transferase wherein the CoA transferase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-CoA, and a polyhydroxyalkanoate synthase wherein the polyhydroxyalkanoate synthase is able to polymerize 4-hydroxybutyryl-CoA to poly-4-hydroxybutyrate. In a further aspect, the host has two or more, three or more, four or more or all five of the stably incorporating genes encoding the enzymes listed above. The biomass host is bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof, for example any one or more of species described herein.


In yet another aspect of the invention, the genetically engineered biomass for use in the processes of the invention (e.g., any of the aspects recited herein) is from a recombinant host having stably incorporated one or more genes encoding one or more enzymes selected from: a phosphoenolpyruvate carboxylase wherein the phosphoenolpyruvate carboxylase is able to convert phosphoenolpyruvate to oxaloacetate, an isocitrate lyase wherein the isocitrate lyase is able to convert isocitrate to glyoxalate, a malate synthase wherein the malate synthase is able to convert glyoxalate to malate and succinate, a succinate-CoA ligase (ADP-forming) wherein the succinate-CoA ligase (ADP-forming) is able to convert succinate to succinyl-CoA, an NADP-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NADP-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADPH+H+, an NAD-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NAD-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADH+H+, a butyrate kinase wherein the butyrate kinase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-phosphate, a phosphotransbutyrylase wherein the phosphotransbutyrylase is able to convert 4-hydroxybutyryl-phosphate to 4-hydroxybutyryl-CoA; and optionally having a disruption in one or more genes selected from yneI, gabD, pykF, pykA, maeA and maeB. The biomass host is bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof, for example any one or more of species described herein.


In a further aspect, the genetically engineered biomass for use in the processes of the invention (e.g., any of the aspects recited herein) is from a recombinant host having a poly-4-hydroxybutyrate pathway and stably expressing two or more genes encoding two or more enzymes, three or more genes encoding three or more enzymes, four of more genes encoding four or more enzymes or five or more genes encoding five or more enzymes selected from: a phosphoenolpyruvate carboxylase wherein the phosphoenolpyruvate carboxylase is able to convert phosphoenol pyruvate to oxaloacetate, a isocitrate lyase wherein the isocitrate lyase is able to convert isocitrate to glyoxalate, a malate synthase wherein the malate synthase is able to convert glyoxalate to malate and succinate, an NADP-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NADP-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3 bisphosphoglycerate forming NADPH+H, an NAD-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NAD-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3 bisphosphoglycerate forming NADH+H; and optionally having a disruption in one or more genes, two or more genes, three or more genes, four or more genes, five or more gene, or six genes selected from yneI, gabD, pykF, pykA, maeA and maeB. The biomass host is bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof, for example any one or more of species described herein.


In another embodiment, the genetically engineered biomass for use in the processes of the invention (e.g., any of the aspects recited herein) is from a recombinant host having a poly-4-hydroxybutyrate pathway, wherein the host has an inhibiting mutation in its CoA-independent NAD-dependent succinic semialdehyde dehydrogenase gene or its CoA-independent NADP-dependent succinic semialdehyde dehydrogenase gene, or having inhibiting mutations in both genes, and having stably incorporated genes encoding the following enzymes: a succinyl-CoA:coenzyme A transferase wherein the succinyl-CoA:coenzyme A transferase is able to convert succinate to succinyl-CoA, a succinate semialdehyde dehydrogenase wherein the succinate semialdehyde dehydrogenase is able to convert succinyl-CoA to succinic semialdehyde, a succinic semialdehyde reductase wherein the succinic semialdehyde reductase is able to convert succinic semialdehyde to 4-hydroxybutyrate, a CoA transferase wherein the CoA transferase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-CoA, and a polyhydroxyalkanoate synthase wherein the polyhydroxyalkanoate synthase is able to polymerize 4-hydroxybutyryl-CoA to poly-4-hydroxybutyrate. The biomass host is bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof, for example any one or more of species described herein.


In yet another embodiment, the genetically engineered biomass for use in the processes of the invention (e.g., any of the aspects recited herein) is from a recombinant host having stably incorporated genes encoding the following enzymes: a phosphoenolpyruvate carboxylase wherein the phosphoenolpyruvate carboxylase is able to convert phosphoenolpyruvate to oxaloacetate, an isocitrate lyase wherein the isocitrate lyase is able to convert isocitrate to glyoxalate, a malate synthase wherein the malate synthase is able to convert glyoxalate to malate and succinate, a succinate-CoA ligase (ADP-forming) wherein the succinate-CoA ligase (ADP-forming) is able to convert succinate to succinyl-CoA, an NADP-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NADP-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADPH+H+, an NAD-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NAD-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADH+H+, a butyrate kinase wherein the butyrate kinase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-phosphate, a phosphotransbutyrylase wherein the phosphotransbutyrylase is able to convert 4-hydroxybutyryl-phosphate to 4-hydroxybutyryl-CoA; and optionally having a disruption in one or more genes selected from yneI, gabD, pykF, pykA, maeA and maeB. The biomass host is bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof, for example any one or more of species described herein.


In certain embodiments, wherein the genetically engineered biomass for use in the processes of the invention (e.g., any of the aspects recited herein) is from a recombinant host having a poly-4-hydroxybutyrate pathway, wherein the host has stably incorporated one or more genes encoding one or more enzymes selected from a succinyl-CoA:coenzyme A transferase wherein the succinyl-CoA:coenzyme A transferase is able to convert succinate to succinyl-CoA, a succinate semialdehyde dehydrogenase wherein the succinate semialdehyde dehydrogenase is able to convert succinyl-CoA to succinic semialdehyde, a succinic semialdehyde reductase wherein the succinic semialdehyde reductase is able to convert succinic semialdehyde to 4-hydroxybutyrate, a CoA transferase wherein the CoA transferase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-CoA, and a polyhydroxyalkanoate synthase wherein the polyhydroxyalkanoate synthase is able to polymerize 4-hydroxybutyryl-CoA to poly-4-hydroxybutyrate. The biomass host is bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof, for example any one or more of species described herein.


In other embodiments, the genetically engineered biomass for use in the processes of the invention (e.g., any of the aspects recited herein) is from a recombinant host having stably incorporated one or more genes encoding one or more enzymes selected from: a phosphoenolpyruvate carboxylase wherein the phosphoenolpyruvate carboxylase is able to convert phosphoenolpyruvate to oxaloacetate, an isocitrate lyase wherein the isocitrate lyase is able to convert isocitrate to glyoxalate, a malate synthase wherein the malate synthase is able to convert glyoxalate to malate and succinate, a succinate-CoA ligase (ADP-forming) wherein the succinate-CoA ligase (ADP-forming) is able to convert succinate to succinyl-CoA, an NADP-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NADP-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADPH+H+, an NAD-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NAD-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADH+H+, a butyrate kinase wherein the butyrate kinase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-phosphate, a phosphotransbutyrylase wherein the phosphotransbutyrylase is able to convert 4-hydroxybutyryl-phosphate to 4-hydroxybutyryl-CoA; and optionally having a disruption in one or more genes selected from yneI, gabD, pykF, pykA, maeA and maeB. The biomass host is bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof, for example any one or more of species described herein.


In a certain aspect of the invention for use in any of the processes or aspects of the invention described herein, a recombinant host is cultered with a renewable feedstock to produce a 4-hydroxybutyrate biomass, the produced biomass is then treated in the presence of a catalyst to produce gamma-butyrolactone (GBL) product, wherein a yield of gamma-butyrolactone product is about 85% by weight. The biomass host is bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof, for example any one or more of species described herein.


In certain embodiments, the source of the renewable feedstock is selected from glucose, fructose, sucrose, arabinose, maltose lactose xylose, fatty acids, vegetable oils, and biomass derived synthesis gas or a combination thereof.


The invention also pertains to a biobased gamma-butyrolactone product produced by the processes described herein. In certain aspects, the amount of gamma-butyrolactone in the product produced is 85% or greater than 85%. In a further aspect, the invention pertains to a poly-4-hydroxybutyrate biomass produced from renewable resources which is suitable as a feedstock for producing gamma-butyrolactone product, wherein the level of poly-4-hydroxybutyrate in the biomass is greater than 50% by weight of the biomass.


In certain embodiments of the invention, the biomass host is bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof. The bacteria includes but is not limited to Escherichia coli, Alcaligenes eutrophus (renamed as Ralstonia eutropha), Bacillus spp., Alcaligenes latus, Azotobacter, Aeromonas, Comamonas, Pseudomonads), Pseudomonas, Ralstonia, Klebsiella), Synechococcus sp PCC7002, Synechococcus sp. PCC 7942, Synechocystis sp. PCC 6803, and Thermosynechococcus elongatus BP-I (cyanobacteria), Chlorobium tepidum (green sulfur bacteria), Chloroflexus auranticus (green non-sulfur bacteria), Chromatium tepidum and Chromatium vinosum (purple sulfur bacteria), Rhodospirillum rubrum, Rhodobacter capsulatus, and Rhodopseudomonas palustris. In other embodiments, the recombinant host is algae. The algae include but are not limited to Chlorella minutissima, Chlorella emersonii, Chlorella sorokiniana, Chlorella ellipsoidea, Chlorella sp., or Chlorella protothecoides.


In certain embodiments of the invention described herein, the heating is at a temperature of about 100° C. to about 350° C. or about 200° C. to about 350° C., or from about 225° C. to 300° C. In some embodiments, the heating reduces the water content of the biomass to about 5 wt %, or less. In the embodiments described, the heating is for a time period from about 30 seconds to about 5 minutes or is from about 5 minutes to about 2 hours. In certain embodiments the gamma-butyrolactone comprises less than 5% of undesired side products. In certain embodiments, the catalyst is sodium carbonate or calcium hydroxide. The weight percent of catalyst is in the range of about 4% to about 50%. In particular embodiments, the weight % of the catalyst is in the range of about 4% to about 50%, and the heating is at about 300° C. In certain embodiments, the gamma-butyrolactone product is further recovered. In some embodiments, the catalyst is 4% by weight calcium hydroxide and the heating is at a temperature of 300° C.


Additionally, the expended (residual) PHA reduced biomass is further utilized for energy development, for example as a fuel to generate process steam and/or heat.





BRIEF DESCRIPTION OF THE DRAWINGS

The foregoing will be apparent from the following more particular description of example embodiments of the invention, as illustrated in the accompanying drawings in which like reference characters refer to the same parts throughout the different views. The drawings are not necessarily to scale, emphasis instead being placed upon illustrating embodiments of the present invention.



FIG. 1 is a schematic diagram of exemplary E. coli central metabolic pathways showing reactions that were modified or introduced in the Examples or could be modified. Numbers in the figure refer to reaction numbers in Table 1A. Reactions that were eliminated by deleting the corresponding genes are marked with an “X”. Abbreviations: “GA3P”, D-glyceraldehyde-3-phosphate; “G1,3P”, 1,3-diphosphateglycerate; “PEP”, phosphoenolpyruvate; “PYR”, pyruvate; “AcCoA”, acetyl-CoA; “CIT”, citrate; “ICT”, isocitrate; “αKG”, alpha-ketoglutarate; “SUC-CoA”, succinyl CoA; “SUC”, succinate; “Fum”, fumarate; “MAL”, L-malate; “OAA”, oxaloacetate; “SSA”, succinic semialdehyde; “4HB”, 4-hydroxybutyrate; “4HB-CoA”, 4-hydroxybutyryl CoA; “P4HB”, poly-4-hydroxybutyrate. Numbered reactions: “1”, glyceraldehyde-3-phosphate dehydrogenase; “2”, pyruvate kinase; “3”, phosphoenolpyruvate carboxylase; “4”, malic enzyme; “5”, isocitrate lyase; “6”, malate dehydrogenase; “7”, succinate semialdehyde dehydrogenase; “8”, alpha-ketoglutarate decarboxylase; “9”, succinic semialdehyde reductase; “10”, CoA transferase; “11”, polyhydroxyalkanoate synthase; “12”, succinate-semialdehyde dehydrogenase, NADP+-dependent.



FIG. 2 is a schematic of GBL recovery from biomass with residual converted to solid fuel, according to various embodiments.



FIG. 3 is a weight loss vs. time curve at 300° C. in N2 for dry P4HB fermentation broth without lime (solid curve) and with 5% lime addition (dashed curve), according to various embodiments. The curves show the weight loss slopes and onset times for completed weight loss.



FIG. 4 (A-C) is a series of gas chromatograms of P4HB pure polymer, P4HB dry broth and P4HB dry broth+5% lime (Ca(OH)2) catalyst after pyrolysis at 300° C., according to one embodiment.



FIG. 5 is a mass spectral library match of GC-MS peak @6.2 min to GBL (gamma-butyrolactone) according to one embodiment.



FIG. 6 is a mass spectral library match of GC-MS peak @11.1 min peak for GBL dimer according to one embodiment.



FIG. 7 is a schematic diagram of the equipment used for the scaled up pyrolysis of P4HB biomass.



FIG. 8 is a schematic diagram of the post-processing steps for producing purified GBL.





DETAILED DESCRIPTION OF THE INVENTION

A description of example embodiments of the invention follows.


The present invention provides post purification processes and methods for the manufacture of high purity, biobased gamma-butyrolactone (GBL) from a genetically engineered microbe producing poly-4-hydroxybutyrate polymer (P4HB biomass).


The removal of impurities in the gamma-butyrolactone product is accomplished by post processing separation techniques such as filtration, distillation, oxidation, adsorption, ion exchange and combinations and cycles (e.g., repeated filtration/distillation) of these.


Biobased, biodegradable polymers such as polyhydroxyalkanoates (PHAs), are naturally produced in biomass systems, such as microbial biomass (e.g., bacteria including cyanobacteria, yeast, fungi), plant biomass, or algal biomass. Genetically-modified biomass systems have been developed which produce a wide variety of biodegradable PHA polymers and copolymers in high yield (Lee (1996), Biotechnology & Bioengineering 49:1-14; Braunegg et al. (1998), J. Biotechnology 65:127-161; Madison, L. L. and Huisman, G. W. (1999), Metabolic Engineering of Poly-3-Hydroxyalkanoates; From DNA to Plastic, in: Microbiol. Mol. Biol. Rev. 63:21-53). PHA polymers are well known to be thermally unstable compounds that readily degrade when heated up to and beyond their melting points (Cornelissen et al., Fuel, 87, 2523, 2008). This is usually a limiting factor when processing the polymers for plastic applications that can, however, be leveraged to create biobased, chemical manufacturing processes starting from 100% renewable resources.


When pure poly-4-hydroxybutyrate (P4HB), produced using petroleum derived 1,4-butanediol, is heated up to 250-350° C., it thermally degrades to volatile GBL exclusively by unzipping of the polymer chain (Kim et al. (2006), Polymer Degradation and Stability, 91:2333-2341). As described herein in a biobased production, the addition of low cost catalysts are added to a genetically engineered biomass with an increased production of P4HB to speed up the degradation reaction to gamma-butyrolactone product. The gamma-butyrolactone product is recovered and the inexpensive catalyst is left with the residual biomass or can optionally be recycled back to the process after suitable regeneration including thermal regeneration, the biobased gamma-butyrolactone product is further processed to produce a purer biobased gamma-butyrolactone.


This process is an economical and environmental alternative to the traditional petroleum-based processes. For the purposes of this invention P4HB is defined to also include the copolymer of 4-hydroxybutyrate with 3-hydroxybutyrate where the % of 4-hydroxybutyrate in the copolymer is greater than 80%, 85%, 90% preferably greater than 95% of the monomers in the copolymer. In certain embodiments, the P4HB biomass is produced by improved P4HB production processes using the recombinant hosts described herein. These recombinant hosts have been genetically constructed to increase the yield of P4HB by manipulating (e.g., inhibition and/or overexpression) certain genes in the P4HB pathway to increase the yield of P4HB in the biomass. The P4HB biomass is produced in a fermentation process in which the genetically engineered microbe is fed a renewable substrate. Renewable substrates include fermentation feedstocks such as sugars, vegetable oils, fatty acids or synthesis gas produced from plant crop materials. The level of P4HB produced in the biomass from the sugar substrate is greater than 10% (e.g., about 15%, about 20%, about 30%, about 40%, about 50%, about 60%, about 70%, about 80%) of the total dry weight of the biomass. The P4HB biomass is then combined with a catalyst and heated to thermally decompose the P4HB to biobased GBL.


Described herein are an alternative processes for manufacturing biobased GBL based on using renewable carbon sources to produce a biobased poly-4-hydroxybutyrate (P4HB) polymer in a biomass that is then converted to biobased gamma-butyrolactone product and post processed to produce a pure biobased gamma-butyrolactone product.


Post Processing Techniques

In the production of gamma-butyrolactone product from biobased sources, impurities are found in the final product. These impurities result from the feedstock, growth media, added metals, catalysts and the like including side products from pyrolysis and other processes in the production of the biobased gamma-butyrolactone product.


The post processing techniques can be completed in batch processes or continuous processes as desired or needed. These processes include filtration, distillation, oxidation, adsorption, ion exhange and the like. The processes can be sequential or repeated as needed. For example, filtration can be followed by one or more distillation and optionally the resulting distillation product can further be filtered or further processed (e.g., oxidation or distillation) as desired or needed to further purifiy the GBL to remove impurities.


It is then necessary to remove these impurities producing a pure gamma-butyrolactone from the gamma-butyrolactone product. In certain aspects, the pure gamma-butyrolactone is about 98.5% pure, about 98.6% pure, about 98.7% pure, about 98.8% pure, about 98.9% pure, about 99% pure, about 99.1% pure, about 99.2% pure, about 99.3% pure, about 99.4% pure or about 99.5% pure by weight. In particular embodiments, the gamma-butyrolactone post processed from the gamma-butyrolactone product is about 99.5% pure.


In the post processing techniques, the impurities (e.g., contaminants) are removed from the gamma-butyrolactone product. The impurities are advantageously minimized or eliminated to obtain a GBL that has few or less impurities that the GBL product. The beneficial removal of the impurities results in a pure GBL. The percent reduction in impurities by weight is about 10%, about 15%, about 20%, about 25%, about 30%, about 35%, about 40%, about 45%, about 50%, about 55%, about 60%, about 65%, about 70%, about 75%, about 80%, about 85%, about 90% about 95%, about 99%, or about 99.5%.


For example in certain embodiments, water is an impurity and the gamma-butyrolactone after post processing will comprise less than about 500 ppm of water. The post processing techniques will remove water to less than about 1500 ppm of water, less than about 1000 ppm of water to about less than 500 ppm water.


In other embodiments, residual color is observed and can be removed by filtration techniques; these filtration techniques can remove the color. As detailed in the examples, color of the GBL liquid during any of the purification steps is determined using the APHA scale values for the biobased GBL is less than 20, for example, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, for example less than 15, less than 10, less than 8, less than 7, or less than 5 Low color as described herein refers to an APHA value of less than 20, for example, less than 15, less than 10 or less than 8.


Filtration

In certain apects of the invention, the impurities are separated from the gamma-butyrolactone product by filtration. The filtration can be filtration under vacuum, decantation, centrifugation, filtration employing a filtration media or membrane. Depending on the impurity, the filtration media or membrane is chosen. In certain embodiments, the membrane can be paper or be coated or another material for binding or adsorbing various impurities. Vacuum filtration is employed using standard filtration funnels.


Examples of filtration media include but are not limited to activated carbon, silver impreganated activated carbon, silica, ion-exchange resins (e.g., cationic exchange column, anionic exchange column) and the like.


Distillation

Distillation, including vacuum distillation, can also be utilized for fractioning the GBL from the impurities. The distillation can be a continuous process for fractional distillation of the GBL from impurities such as unwanted side products derived from the thermolysis reaction of the P4HB or from the biomass. The distillation can also be accomplished by a batch process. Optimization of the distillation process is possible by changing the process variables (e.g., pressure, temperature, number of columns). For example, a plurality of distillation columns can be used.


Further, fractional distillation may be employed to separate the components by repeated vaporization-condensation cycles within a packed fractionating column. In certain embodiments, water and/or oxidizing compounds (e.g., hydrogen peroxide solution, alkyl hydroperoxide, aryl hydroperoxide, peracids, peresters, perborate salts, percarbonate salts, persulfate salts, hypochlorite salts, combinations of these and the like) are added to the gamma-butyrolactone product prior to distillation to facilitate the removal of unwanted organic impurities which contribute negatively to the color and odor of the liquid GBL. The water present in the biomass (1-20% by wt. biomass) is usually removed during the first distillation stage. After the distillation process is complete, any residual water in the GBL can later be removed using standard techniques well known in the art, for example, by drying the GBL over molecular sieves.


Additionally, GBL product liquid generated post distillation can be treated with ozone to oxidize any residual organic impurities found in the GBL liquid to generate higher purity (85% or greater) GBL.


Recombinant Hosts with Metabolic Pathways for Producing P4HB


Genetic engineering of hosts (e.g., bacteria, fungi, algae, plants and the like) as production platforms for modified and new materials provides a sustainable solution for high value eco-friendly industrial applications for production of chemicals. Described herein are process methods of producing biobased gamma-butyrolactone from a genetically modified recombinant polyhydroxyalkanoate P4HB biomass. The processes described herein avoid toxic effects to the host organism by producing the biobased chemical post culture or post harvesting, are cost effective and highly efficient (e.g., use less energy to make), decrease greenhouse gas emissions, use renewable resources and can be further processed to produce high purity products from GBL in high yield.


The PHA biomass utilized in the methods described herein is genetically engineered to produce poly-4-hydroxybutyrate (P4HB). An exemplary pathway for production of P4HB is provided in FIG. 1 and a more detailed description of the pathway, recombinant hosts that produce P4HB biomass is provided below. The pathway can be engineered to increase production of P4HB from carbon feed sources.


As used herein, “P4HB biomass” is intended to mean any genetically engineered biomass from a recombinant host (e.g., bacteria,) that includes a non-naturally occurring amount of the polyhydroxyalkanoate polymer e.g. poly-4-hydroxybutyrate (P4HB). In some embodiments, a source of the P4HB biomass is bacteria, yeast, fungi, algae, plant crop cyanobacteria, or a mixture of any two or more thereof. In certain embodiments, the biomass titer (g/L) of P4HB has been increased when compared to the host without the overexpression or inhibition of one or more genes in the P4HB pathway. In certain embodiments, the P4HB titer is reported as a percent dry cell weight (% dcw) or as grams of P4HB/Kg biomass.


“Overexpression” refers to the expression of a polypeptide or protein encoded by a DNA introduced into a host cell, wherein the polypeptide or protein is either not normally present in the host cell, or where the polypeptide or protein is present in the host cell at a higher level than that normally expressed from the endogenous gene encoding the polypeptide or protein. “Inhibition” or “down regulation” refers to the suppression or deletion of a gene that encodes a polypeptide or protein. In some embodiments, inhibition means inactivating the gene that produces an enzyme in the pathway. In certain embodiments, the genes introduced are from a heterologous organism.


Genetically engineered microbial PHA production systems with fast growing hosts such as Escherichia coli have been developed. In certain embodiments, genetic engineering also allows for the modification of wild-type microbes to improve the production of the P4HB polymer. Examples of PHA production modifications are described in Steinbuchel & Valentin, FEMS Microbiol. Lett. 128:219-28 (1995). PCT Publication No. WO 98/04713 describes methods for controlling the molecular weight using genetic engineering to control the level of the PHA synthase enzyme. Commercially useful strains, including Alcaligenes eutrophus (renamed as Ralstonia eutropha), Alcaligenes latus, Azotobacter vinlandii, and Pseudomonads, for producing PHAs are disclosed in Lee, Biotechnology & Bioengineering, 49:1-14 (1996) and Braunegg et al., (1998), J. Biotechnology 65: 127-161. U.S. Pat. Nos. 6,316,262, 7,229,804 6,759,219 and 6,689,589 describe biological systems for manufacture of PHA polymers containing 4-hydroxyacids, incorporated by reference herein.


Although there have been reports of producing 4-hydroxybutyrate copolymers from renewable resources such as sugar or amino acids, the level of 4HB in the copolymers produced from scalable renewable substrates has been much less than 50% of the monomers in the copolymers and therefore unsuitable for practicing the disclosed invention. Production of the P4HB biomass using an engineered microorganism with renewable resources where the level of P4HB in the biomass is sufficient to practice the disclosed invention (i.e., greater than 40%, 50%, 60% or 65% of the total biomass dry weight) has not previously been achieved.


The weight percent PHA in the wild-type biomass varies with respect to the source of the biomass. For microbial systems produced by a fermentation process from renewable resource-based feedstocks such as sugars, vegetable oils or glycerol, the amount of PHA in the wild-type biomass may be about 65 wt %, or more, of the total weight of the biomass. For plant crop systems, in particular biomass crops such as sugarcane or switchgrass, the amount of PHA may be about 3%, or more, of the total weight of the biomass. For algae or cyanobacterial systems, the amount of PHA may be about 40%, or more of the total weight of the biomass.


In certain aspects of the invention, the recombinant host has been genetically engineered to produce an increased amount of P4HB as compared to the wild-type host. The wild-type P4HB biomass refers to the amount of P4HB that an organism typically produces in nature.


For example, in certain embodiments, the P4HB is increased between about 20% to about 90% over the wild-type or between about 50% to about 80%. In other embodiments, the recombinant host produces at least about a 20% increase of P4HB over wild-type, at least about a 30% increase over wild-type, at least about a 40% increase over wild-type, at least about a 50% increase over wild-type, at least about a 60% increase over wild-type, at least about a 70% increase over wild-type, at least about a 75% increase over wild-type, at least about a 80% increase over wild-type or at least about a 90% increase over wild-type. In other embodiments, the P4HB is between about a 2 fold increase to about a 400 fold increase over the amount produced by the wild-type host. The amount of P4HB in the host or plant is determined by gas chromatography according to procedures described in Doi, Microbial Polyesters, John Wiley&Sons, p 24, 1990. In certain embodiments, a biomass titer of 100-120 g P4HB/Kg of biomass is achieved. In other embodiments, the amount of P4HB titer is presented as percent dry cell weight (% dcw).


Suitable Host Strains

In certain embodiments described herein, the host strain is E. coli K-12 strain LS5218 (Spratt et al., J. Bacteriol. 146 (3):1166-1169 (1981); Jenkins and Nunn, J. Bacteriol. 169 (1):42-52 (1987)). Other suitable E. coli K-12 host strains include, but are not limited to, MG1655 (Guyer et al., Cold Spr. Harb. Symp. Quant. Biol. 45:135-140 (1981)), WG1 and W3110 (Bachmann Bacteriol. Rev. 36(4):525-57 (1972)). Alternatively, E. coli strain W (Archer et al., BMC Genomics 2011, 12:9 doi:10.1186/1471-2164-12-9) or E. coli strain B (Delbruck and Luria, Arch. Biochem. 1:111-141 (1946)) and their derivatives such as REL606 (Lenski et al., Am. Nat. 138:1315-1341 (1991)) are other suitable E. coli host strains.


Other exemplary microbial host strains include but are not limited to: Ralstonia eutropha, Zoogloea ramigera, Allochromatium vinosum, Rhodococcus ruber, Delftia acidovorans, Aeromonas caviae, Synechocystis sp. PCC 6803, Synechococcus elongatus PCC 7942, Thiocapsa pfenigii, Bacillus megaterium, Acinetobacter baumannii, Acinetobacter baylyi, Clostridium kluyveri, Methylobacterium extorquens, Nocardia corralina, Nocardia salmonicolor, Pseudomonas fluorescens, Pseudomonas oleovorans, Pseudomonas sp. 6-19, Pseudomonas sp. 61-3 and Pseudomonas putida, Rhodobacter sphaeroides, Alcaligenes latus, Klebsiella oxytoca, Anaerobiospirillum succiniciproducens, Actinobacillus succinogenes, Mannheimia succiniciproducens, Rhizobium etli, Bacillus subtilis, Corynebacterium glutamicum, Gluconobacter oxydans, Zymomonas mobilis, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, and Clostridium acetobutylicum. Exemplary yeasts or fungi include species selected from Saccharomyces cerevisiae, Schizosaccharomyces pombe, Kluyveromyces lactis, Kluyveromyces marxianus, Aspergillus terreus, Aspergillus niger and Pichia pastoris.


Exemplary algal strains species include but are not limited to: Chlorella strains, species selected from: Chlorella minutissima, Chlorella emersonii, Chlorella sorokiniana, Chlorella ellipsoidea, Chlorella sp., or Chlorella protothecoides.


Source of Recombinant Genes

Sources of encoding nucleic acids for a P4HB pathway enzyme can include, for example, any species where the encoded gene product is capable of catalyzing the referenced reaction. Such species include both prokaryotic and eukaryotic organisms including, but not limited to, bacteria, including archaea and eubacteria, and eukaryotes, including yeast, plant, insect, animal, and mammal, including human. Exemplary species for such sources include, for example, Escherichia coli, Saccharomyces cerevisiae, Saccharomyces kluyveri, Clostridium kluyveri, Clostridium acetobutylicum, Clostridium beijerinckii, Clostridium saccharoperbutylacetonicum, Clostridium perjringens, Clostridium difficile, Clostridium botulinum, Clostridium tyrobutyricum, Clostridium tetanomorphum, Clostridium tetani, Clostridium propionicum, Clostridium aminobutyricum, Clostridium subterminale, Clostridium sticklandii, Ralstonia eutropha, Mycobacterium bovis, Mycobacterium tuberculosis, Porphyromonas gingivalis, Arabidopsis thaliana, Thermus thermophilus, Pseudomonas species, including Pseudomonas aeruginosa, Pseudomonas putida, Pseudomonas stutzeri, Pseudomonas fluorescens, Chlorella minutissima, Chlorella emersonii, Chlorella sorokiniana, Chlorella ellipsoidea, Chlorella sp., Chlorella protothecoides, Homo sapiens, Oryctolagus cuniculus, Rhodobacter spaeroides, Thermoanaerobacter brockii, Metallosphaera sedula, Leuconostoc mesenteroides, ChloroJlexus aurantiacus, Roseiflexus castenholzii, Erythrobacter, Simmondsia chinensis, Acinetobacter species, including Acinetobacter calcoaceticus and Acinetobacter baylyi, Porphyromonas gingivalis, Sulfolobus tokodaii, Sulfolobus solfataricus, Sulfolobus acidocaldarius, Bacillus subtilis, Bacillus cereus, Bacillus megaterium, Bacillus brevis, Bacillus pumilus, Rattus norvegicus, Klebsiella pneumonia, Klebsiella oxytoca, Euglena gracilis, Treponema denticola, Moorella thermoacetica, Thermotoga maritima, Halobacterium sauna rum, Geobacillus stearothermophilus, Aeropyrum pernix, Sus scrofa, Caenorhabditis elegans, Corynebacterium glutamicum, Acidaminococcusfermentans, Lactococcus lac tis, Lactobacillus plantarum, Streptococcus thermophilus, Enterobacter aerogenes, Candida, Aspergillus terreus, Pedicoccus pentosaceus, Zymomonas mobilus, Acetobacter pasteurians, Kluyveromyces lactis, Eubacterium barkeri, Bacteroides capillosus, Anaerotruncus colihominis, Natranaerobius thermophilusm, Campylobacter jejuni, Haemophilus influenzae, Serratia marcescens, Citrobacter amalonaticus, Myxococcus xanthus, Fusobacterium nuleatum, Penicillium chrysogenum marine gamma proteobacterium, and butyrate-producing bacterium. For example, microbial hosts (e.g., organisms) having P4HB biosynthetic production are exemplified herein with reference to an E. coli host. However, with the complete genome sequence available for now more than 550 species (with more than half of these available on public databases such as the NCBI), including 395 microorganism genomes and a variety of yeast, fungi, plant, and mammalian genomes, the identification of genes encoding the requisite P4HB biosynthetic activity for one or more genes in related or distant species, including for example, homologues, orthologs, paralogs and nonorthologous gene displacements of known genes, and the interchange of genetic alterations between organisms is routine and well known in the art. Accordingly, the metabolic alterations enabling biosynthesis of P4HB and other compounds of the invention described herein with reference to a particular organism such as E. coli can be readily applied to other microorganisms, including prokaryotic and eukaryotic organisms alike. Given the teachings and guidance provided herein, those skilled in the art will know that a metabolic alteration exemplified in one organism can be applied equally to other organisms.


Production of Transgenic Host for Producing 4HB

Transgenic (Recombinant) hosts for producing P4HB are genetically engineered using conventional techniques known in the art. The genes cloned and/or assessed for host strains producing P4HB-containing PHA and 4-carbon chemicals are presented below in Table 1A, along with the appropriate Enzyme Commission number (EC number) and references. Some genes were synthesized for codon optimization while others were cloned via PCR from the genomic DNA of the native or wild-type host. As used herein, “heterologous” means from another host. The host can be the same or different species. FIG. 1 is an exemplary pathway for producing P4HB.









TABLE 1A







Genes in microbial host strains producing 4HB-containing PHA and


4-carbon chemicals. A star (*) after the gene name denotes that the


nucleotide sequence was optimized for expression in E. coli.











Reaction






number


(FIG. 1)
Gene Name
Enzyme Name
EC Number
Accession No.














1
gapA
Glyceraldehyde 3-phosphate
1.2.1.12
NP_416293




dehydrogenase


1
gdp1
Glyceraldehyde-3-phosphate
1.2.1.12
XP_455496




dehydrogenase


1
gap2
Glyceraldehyde-3-phosphate
1.2.1.59
CAA58550




dehydrogenase (NADP+)




(phosphorylating)


1
gapB
Glyceraldehyde-3-phosphate
1.2.1.59
NP_390780




dehydrogenase 2


1
gapN
Putative NADP-dependent
1.2.1.12
NP_664849




glyceraldehyde-3-phosphate




dehydrogenase


2
pykF
Pyruvate kinase I
2.7.1.40
b1676


2
pykA
Pyruvate kinase II
2.7.1.40
b1854


3
ppcEc
Phosphoenolpyruvate carboxylase
4.1.1.31
NP_418391


3
ppcMs*
Phosphoenolpyruvate carboxylase
4.1.1.31
Gene/Protein ID 1;






Q02735


4
maeA
Malate dehydrogenase, NAD-
1.1.1.38
b1479




requiring


4
maeB
Malate dehydrogenase
1.1.1.40
b2463




(oxaloacetate-decarboxylating)




(NADP+)


5
aceA
Isocitrate lyase
4.1.3.1
NP_418439


6
aceB
Malate synthase A
2.3.3.9
NP_418438


7
sucD*
Succinate semialdehyde
1.2.1.76
Gene/Protein ID 2;




dehydrogenase

YP_001396394


8
kgdM
Alpha-ketoglutarate
4.1.1.71
NP_335730




decarboxylase


9
ssaRAt*
Succinic semialdehyde reductase
1.1.1.61
Gene/Protein ID 3;






AAK94781


9
4hbD
Succinic semialdehyde reductase
1.1.1.61
YP_001396393


9
ssaRAt2*
Succinic semialdehyde reductase
1.1.1.61
Gene/Protein ID 4;






XP_001210625


9
ssaRMm*
Succinic semialdehyde reductase
1.1.1.61
Gene/Protein ID 5;






AKR7A5;


9
yqhD
Succinic semialdehyde reductase
1.1.1.61
NP_417484


10
orfZ
CoA transferase
2.8.3.n
AAA92344


11
phaC1
Polyhydroxyalkanoate synthase
2.3.1.n
YP_725940


11
phaC3/C1*
Polyhydroxyalkanoate synthase
2.3.1.n
Gene/Protein ID 6




fusion protein


12
yneI
Succinate-semialdehyde
1.2.1.24
NP_416042




dehydrogenase, NADP+-




dependent


12
gabD
Succinate-semialdehyde
1.2.1.16
NP_417147




dehydrogenase, NADP+-




dependent


13
buk1
Butyrate kinase I
2.7.2.7
NP_349675


13
buk2
Butyrate kinase II
2.7.2.7
NP_348286


14
ptb
Phosphotransbutyrylase
2.3.1.19
NP_349676


15
sucCD
Succinate-CoA ligase (ADP-
6.2.1.5
NP_286444




forming)

NP_286445


15
cat1
Succinyl-CoA: coenzyme A
2.8.3.n
YP_001396395




transferase









Other proteins capable of catalyzing the reactions listed in Table 1A can be discovered by consulting the scientific literature, patents or by BLAST searches against e.g. nucleotide or protein databases at NCBI (www.ncbi.nlm.nih.gov/). Synthetic genes can then be created to provide an easy path from sequence databases to physical DNA. Such synthetic genes are designed and fabricated from the ground up, using codons to enhance heterologous protein expression, optimizing characteristics needed for the expression system and host. Companies such as e.g. DNA 2.0 (Menlo Park, Calif. 94025, USA) will provide such routine service. Proteins that may catalyze some of the biochemical reactions listed in Table 1A are provided in Tables 1B-1Z.









TABLE 1B







Suitable homologues for the Gap A protein (glyceraldehyde 3-phosphate


dehydrogenase-A, from Escherichia coli, EC No. 1.2.1.12, which acts


on D-glyceraldehyde 3-phosphate to produce 1,3-diphosphateglycerate;


protein acc. no. NP_416293.1)








Protein Name
Protein Accession No.





glyceraldehyde-3-phosphate dehydrogenase
NP_456222


glyceraldehyde-3-phosphate dehydrogenase A
ZP_04561688


glyceraldehyde-3-phosphate dehydrogenase
CBK85249


glyceraldehyde-3-phosphate dehydrogenase,
ZP_35729429


type I


glyceraldehyde-3-phosphate dehydrogenase
ZP_04613128


glyceraldehyde-3-phosphate dehydrogenase
NP_929794


glyceraldehyde-3-phosphate dehydrogenase A
YP_002648641


glyceraldehyde-3-phosphate dehydrogenase A
CBA72924


glyceraldehyde-3-phosphate dehydrogenase A
ZP_07394569
















TABLE 1C







Suitable homologues for the Gdp1 protein (glyceraldehyde 3-phosphate


dehydrogenase, from Kluyveromyces lactis, EC No. 1.2.1.12, which acts


on D-glyceraldehyde 3-phosphate to produce 1,3-diphosphateglycerate;


protein acc. no. XP_455496)








Protein Name
Protein Accession No.





hypothetical protein
XP_446770


unnamed protein product
CAA24607


glyceraldehyde 3-phosphate dehydrogenase
EDN63283


glyceraldehyde 3-phosphate dehydrogenase
Q9UVC0


glyceraldehyde 3-phosphate dehydrogenase
XP_002171328


glyceraldehyde 3-phosphate dehydrogenase
Q01077


hypothetical protein CRE_18959
XP_003115497


glyceraldehyde 3-phosphate dehydrogenase
CAA06030


glyceraldehyde 3-phosphate dehydrogenase
ABQ81648
















TABLE 1D







Suitable homologues for the Gap2 protein (glyceraldehyde-3-phosphate


dehydrogenase (NADP+) (phosphorylating), from Synechocystis sp., EC


No. 1.2.1.59, which acts on D-glyceraldehyde 3-phosphate to produce


1,3-diphosphateglycerate; protein acc. no. CAA58550)








Protein Name
Protein Accession No.





glyceraldehyde 3-phosphate dehydrogenase
NP_442821


glyceraldehyde 3-phosphate dehydrogenase
YP_003889819


glyceraldehyde 3-phosphate dehydrogenase
YP_002372721


unnamed protein product
CAO91151


glyceraldehyde 3-phosphate dehydrogenase
ZP_01729953


glyceraldehyde 3-phosphate dehydrogenase
YP_723521


glyceraldehyde 3-phosphate dehydrogenase,
ZP_06309941


type I


glyceraldehyde 3-phosphate dehydrogenase
ZP_07113693


glyceraldehyde 3-phosphate dehydrogenase
ZP_01623628
















TABLE 1E







Suitable homologues for the GapB protein (glyceraldehyde-3-phosphate


dehydrogenase 2, from Bacillus subtilis, EC No. 1.2.1.59, which acts


on D-glyceraldehyde 3-phosphate to produce 1,3-diphosphateglycerate;


protein acc. no. NP_390780)








Protein Name
Protein Accession No.





glyceraldehyde 3-phosphate dehydrogenase
YP_003974321


glyceraldehyde 3-phosphate dehydrogenase
YP_003921301


glyceraldehyde 3-phosphate dehydrogenase
YP_001487767


glyceraldehyde 3-phosphate dehydrogenase
YP_080196


glyceraldehyde 3-phosphate dehydrogenase
YP_148579


glyceraldehyde 3-phosphate dehydrogenase
YP_001376482


glyceraldehyde 3-phosphate dehydrogenase
ZP_01173259


glyceraldehyde 3-phosphate dehydrogenase,
ZP_06809473


type I


glyceraldehyde 3-phosphate dehydrogenase
YP_001126741
















TABLE 1F







Suitable homologues for the GapN protein (putative NADP-


dependent glyceraldehyde-3-phosphate dehydrogenase, from



Streptococcus pyogenes, EC No. 1.2.1.12, which acts on D-



glyceraldehyde 3-phosphate to produce 1,3-diphosphateglycerate;


protein acc. no. NP_664849)










Protein Name
Protein Accession No.







NADP-dependent glyceraldehyde-3-
YP_002997128



phosphate dehydrogenase



NADP-dependent glyceraldehyde-3-
YP_002744716



phosphate dehydrogenase



NADP-dependent glyceraldehyde-3-
Q3C1A6



phosphate dehydrogenase



glyceraldehyde-3-phosphate
ZP_07725052



dehydrogenase (NADP+)



NADP-dependent glyceraldehyde-3-
YP_820625



phosphate dehydrogenase



NADP-dependent glyceraldehyde-3-
YP_001034755



phosphate dehydrogenase, putative



NAD-dependent DNA ligase LigA
ZP_01825832



glyceraldehyde-3-phosphate
ZP_06011937



dehydrogenase (NADP+)



aldehyde dehydrogenase
YP_003307897

















TABLE 1G







Suitable homologues for the Ppc protein (phosphoenolpyruvate


carboxylase, from Escherichia coli, EC No. 4.1.1.31, which acts


on phosphoenolpyruvate and carbon dioxide to produce oxaloacetate;


protein acc. no. NP_418391)










Protein Name
Protein Accession No.







phosphoenolpyruvate carboxylase
ZP_02904134



phosphoenolpyruvate carboxylase
YP_002384844



phosphoenolpyruvate carboxylase
YP_003367228



phosphoenolpyruvate carboxylase
ZP_02345134



phosphoenolpyruvate carboxylase
ZP_04558550



phosphoenolpyruvate carboxylase
YP_003615503



phosphoenolpyruvate carboxylase
YP_002241183



phosphoenolpyruvate carboxylase
CBK84190



phosphoenolpyruvate carboxylase
YP_003208553

















TABLE 1H







Suitable homologues for the Ppc protein (phosphoenolpyruvate


carboxylase, from Medicago sativa, EC No. 4.1.1.31, which acts


on phosphoenolpyruvate and carbon dioxide to produce oxaloacetate;


protein acc. no. Q02909)










Protein Name
Protein Accession No.







phosphoenolpyruvate carboxylase
CAA09588



phosphoenolpyruvate carboxylase
P51061



phosphoenolpyruvate carboxylase 3
AAU07998



phosphoenolpyruvate carboxylase
ACN32213



phosphoenolpyruvate carboxylase
BAC20365



predicted protein
XP_002330719



phosphoenolpyruvate carboxylase
ABV80356



phosphoenolpyruvate carboxylase
AAD31452



phosphoenolpyruvate carboxylase
CAJ86550

















TABLE 1I







Suitable homologues for the AceA protein (isocitrate lyase, from



Escherichia coli K-12, EC No. 4.1.3.1, which acts on isocitrate to



produce glyoxylate and succinate; protein acc. no. NP_418439)










Protein Name
Protein Accession No.







isocitrate lyase
NP_290642



isocitrate lyase
ZP_04558565



isocitrate lyase
YP_002218096



isocitrate lyase, putative
YP_002932565



isocitrate lyase
YP_002241049



hypothetical protein ESA_00054
YP_001436195



isocitrate lyase
YP_003261295



isocitrate lyase family protein
ZP_07952710



isocitrate lyase
YP_002514615



isocitrate lyase
YP_001234628

















TABLE 1J







Suitable homologues for the AceB protein (malate


synthase A, from Escherichia coli K-12, EC No.


2.3.3.9, which acts on glyoxylate and acetyl-CoA to


produce malate; protein acc. no. NP_418438)










Protein Name
Protein Accession No.







malate synthase
YP_002385083



malate synthase A
ZP_06356448



malate synthase
YP_002917220



malate synthase
YP_001480725



malate synthase
YP_001399288



malate synthase A
YP_003714066



malate synthase
NP_933534



malate synthase A
YP_002253716



malate synthase
YP_081279

















TABLE 1K







Suitable homologues for the SucD protein (succinate semialdehyde


dehydrogenase, from Clostridium kluyveri, EC No. 1.2.1.76,


which acts on succinyl-CoA to produce succinate semialdehyde;


protein acc. no. YP_001396394)








Protein Name
Protein Accession No.





CoA-dependent succinate semialdehyde
AAA92347


dehydrogenase


succinate-semialdehyde dehydrogenase
ZP_06559980


[NAD(P)+]


succinate-semialdehyde dehydrogenase
ZP_05401724


[NAD(P)+]


aldehyde-alcohol dehydrogenase family
ZP_07821123


protein


succinate-semialdehyde dehydrogenase
ZP_06983179


[NAD(P)+]


succinate-semialdehyde dehydrogenase
YP_001928839


hypothetical protein CLOHYLEM_05349
ZP_03778292


succinate-semialdehyde dehydrogenase
YP_003994018


[NAD(P)+]


succinate-semialdehyde dehydrogenase
NP_904963
















TABLE 1L







Suitable homologues for the KgdM protein (alpha-ketoglutarate


decarboxylase, from Mycobacterium tuberculosis, EC No. 4.1.1.71,


which acts on alpha-ketoglutarate to produce succinate semialdehyde


and carbon dioxide; protein acc. no. NP_335730)










Protein Name
Protein Accession No.







alpha-ketoglutarate decarboxylase
YP_001282558



alpha-ketoglutaratedecarboxylase
NP_854934



2-oxoglutarate dehydrogenase sucA
ZP_06454135



2-oxoglutarate dehydrogenase sucA
ZP_04980193



alpha-ketoglutarate decarboxylase
NP_961470



alpha-ketoglutarate decarboxylase Kgd
YP_001852457



alpha-ketoglutarate decarboxylase
NP_301802



alpha-ketoglutarate decarboxylase
ZP_05215780



alpha-ketoglutarate decarboxylase
YP_001702133

















TABLE 1M







Suitable homologues for the SsaRAt protein (succinic semialdehyde


reductase, from Arabidopsis thaliana, EC No. 1.1.1.61, which acts on


succinate semialdehyde to produce 4-hydroxybutyrate; protein acc. no.


AAK94781)








Protein Name
Protein Accession No.





6-phosphogluconate dehydrogenase NAD-
XP_002885728


binding domain-containing protein


hypothetical protein isoform 1
XP_002266252


predicted protein
XP_002320548


hypothetical protein isoform 2
XP_002266296


unknown
ACU22717


3-hydroxyisobutyrate dehydrogenase,
XP_002524571


putative


unknown
ABK22179


unknown
ACJ85049


predicted protein
XP_001784857
















TABLE 1N







Suitable homologues for the 4hbD protein (succinic semialdehyde


reductase, from Clostridium kluyveri, EC No. 1.1.1.61, which acts on


succinate semialdehyde to produce 4-hydroxybutyrate; protein acc. no.


YP_001396393)










Protein Name
Protein Accession No.







NAD-dependent 4-hydroxybutyrate
NP_348201



dehydrogenase



NAD-dependent 4-hydroxybutyrate
ZP_05401720



dehydrogenase



4-hydroxybutyrate dehydrogenase
ZP_06902666



NAD-dependent 4-hydroxybutyrate
ZP_06983178



dehydrogenase



NAD-dependent 4-hydroxybutyrate
NP_904964



dehydrogenase



NAD-dependent 4-hydroxybutyrate
ZP_04389726



dehydrogenase



alcohol dehydrogenase, iron-dependent
ZP_07821131



NAD-dependent 4-hydroxybutyrate
ZP_05427218



dehydrogenase



hypothetical protein CLOL250_02815
ZP_02076027

















TABLE 1O







Suitable homologues for the SsaRAt2 protein (succinic semialdehyde


reductase, from Aspergillus terreus, EC No. 1.1.1.61, which acts on


succinate semialdehyde to produce 4-hydroxybutyrate; protein acc. no.


XP_001210625)








Protein Name
Protein Accession No.





aflatoxin B1-aldehyde reductase, putative
XP_001268918


aflatoxin B1-aldehyde reductase, putative
XP_001264422


hypothetical protein An08g06440
XP_001392759


Pc13g11860
XP_002559603


TPA: aflatoxin B1-aldehyde reductase
CBF89011


GliO-like, putative


aflatoxin B1 aldehyde reductase
EEH21318


aflatoxin B1 aldehyde reductase member,
XP_003069315


putative


aldo/keto reductase
XP_002625767


aflatoxin B1 aldehyde reductase member 2
XP_002845070
















TABLE 1P







Suitable homologues for the SsaRMm protein (succinic


semialdehyde reductase, from Mus musculus, EC No.


1.1.1.61, which acts on succinate semialdehyde to produce


4-hydroxybutyrate; protein acc. no. AKR7A5)








Protein Name
Protein Accession No.





aflatoxin B1 aldehyde reductase
XP_001092177


member 2


AKR7A2 protein
AAI49541


similar to aflatoxin B1 aldehyde
XP_001917301


reductase member 3


aldo-keto reductase family 7, member A3
XP_002685838
















TABLE 1Q







Suitable homologues for the YqhD protein (succinic semialdehyde


reductase, from Escherichia coli K-12, EC No. 1.1.1.61, which acts


on succinate semialdehyde to produce 4-hydroxybutyrate; protein acc.


no. NP_417484)










Protein Name
Protein Accession No.







alcohol dehydrogenase yqhD
ZP_02900879



alcohol dehydrogenase, NAD(P)-
YP_002384050



dependent



putative alcohol dehydrogenase
YP_003367010



alcohol dehydrogenase YqhD
ZP_02667917



putative alcohol dehydrogenase
YP_218095



hypothetical protein ESA_00271
YP_001436408



iron-containing alcohol dehydrogenase
YP_003437606



hypothetical protein CKO_04406
YP_001455898



alcohol dehydrogenase
ZP_03373496

















TABLE 1R







Suitable homologues for the OrfZ protein (CoA transferase, from



Clostridium kluyveri DSM 555, EC No. 2.8.3.n, which acts on 4-



hydroxybutyrate to produce 4-hydroxybutyryl CoA; protein acc. no.


AAA92344)










Protein Name
Protein Accession No.







4-hydroxybutyrate coenzyme A
YP_001396397



transferase



acetyl-CoA hydrolase/transferase
ZP_05395303



acetyl-CoA hydrolase/transferase
YP_001309226



4-hydroxybutyrate coenzyme A
NP_781174



transferase



4-hydroxybutyrate coenzyme A
ZP_05618453



transferase



acetyl-CoA hydrolase/transferase
ZP_05634318



4-hydroxybutyrate coenzyme A
ZP_00144049



transferase



hypothetical protein ANASTE_01215
ZP_02862002



4-hydroxybutyrate coenzyme A
ZP_07455129



transferase

















TABLE 1S







Suitable homologues for the PhaC1 protein (polyhydroxyalkanoate


synthase, from Ralstonia eutropha H16, EC No. 2.3.1.n, which


acts on (R)-3-hydroxybutyryl-CoA or 4-hydroxybutyryl-CoA +


[(R)-3-hydroxybutanoate-co-4-hydroxybutanoate]n to produce


[(R)-3-hydroxybutanoate-co-4-hydroxybutanoate](n+1) + CoA


and also acts on 4-hydroxybutyryl-CoA + [4-hydroxybutanoate]n to


produce [4-hydroxybutanoate](n+1) + CoA; Protein acc. no. YP_725940


(Peoples and Sinskey, J. Biol. Chem. 264: 15298-15303 (1989).










Protein Name
Protein Accession No.







polyhydroxyalkanoic acid synthase
YP_002005374



PHB synthase
BAB96552



PhaC
AAF23364



Polyhydroxyalkanoate synthase protein
AAC83658



PhaC



polyhydroxybutyrate synthase
AAL17611



poly(R)-hydroxyalkanoic acid synthase,
YP_002890098



class I



poly-beta-hydroxybutyrate polymerase
YP_159697



PHB synthase
CAC41638



PHB synthase
YP_001100197

















TABLE 1T







Suitable homologues for the PhaC3/C1 protein (Polyhydroxyalkanoate


synthase fusion protein from Pseudomonas putida and Ralstonia eutropha


JMP134, EC No. 2.3.1.n, which acts on (R)-3-hydroxybutyryl-CoA or 4-


hydroxybutyryl-CoA + [(R)-3-hydroxybutanoate-co-4-hydroxybutanoate]n


to produce [(R)-3-hydroxybutanoate-co-4-hydroxybutanoate](n+1) +


CoA and also acts on 4-hydroxybutyryl-CoA + [4-hydroxybutanoate]n


to produce [4-hydroxybutanoate](n+1) + CoA










Protein Name
Protein Accession No.







Poly(R)-hydroxyalkanoic acid synthase,
YP_295561



class I



Poly(3 -hydroxybutyrate) polymerase
YP_725940



polyhydroxyalkanoic acid synthase
AAW65074



polyhydroxyalkanoic acid synthase
YP_002005374



Poly(R)-hydroxyalkanoic acid synthase,
YP_583508



class I



intracellular polyhydroxyalkanoate
ADM24646



synthase



Poly(3-hydroxyalkanoate) polymerase
ZP_00942942



polyhydroxyalkanoic acid synthase
YP_003752369



PhaC
AAF23364

















TABLE 1U







Suitable homologues for the Buk1 protein (butyrate kinase I, from



Clostridium acetobutylicum ATCC824, EC No. 2.7.2.7, which



acts on 4-hydroxybutyrate to produce 4-hydroxybutyryl phosphate










Protein Name
Protein Accession No.







butyrate kinase
YP_001788766



butyrate kinase
YP_697036



butyrate kinase
YP_003477715



butyrate kinase
YP_079736



acetate and butyrate kinase
ZP_01667571



butyrate kinase
YP_013985



butyrate kinase
ZP_04670620



butyrate kinase
ZP_04670188



butyrate kinase
ZP_07547119

















TABLE 1V







Suitable homologues for the Buk2 protein (butyrate kinase II, from



Clostridium acetobutylicum ATCC824, EC No. 2.7.2.7, which



acts on 4-hydroxybutyrate to produce 4-hydroxybutyryl phosphate










Protein Name
Protein Accession No.







butyrate kinase
YP_001311072



hypothetical protein CLOSPO_00144
ZP_02993103



hypothetical protein COPEUT_01429
ZP_02206646



butyrate kinase
EFR5649



butyrate kinase
ZP_0720132



butyrate kinase
YP_0029418



butyrate kinase
YP_002132418



butyrate kinase
ZP_05389806



phosphate butyryltransferase
ADQ27386

















TABLE 1W







Suitable homologues for the Ptb protein (phosphotransbutyrylase,


from Clostridium acetobutylicum ATCC824, EC No. 2.3.1.19, which


acts on 4-hydroxybutyryl phosphate to produce 4-hydroxybutyryl CoA










Protein Name
Protein Accession No.







phosphate butyryltransferase
YP_001884531



hypothetical protein COPCOM_01477
ZP_03799220



phosphate butyryltransferase
YP_00331697



phosphate butyryltransferase
YP_004204177



phosphate acetyl/butyryltransferase
ZP_05265675



putative phosphate
ZP_05283680



acetyl/butyryltransferase



bifunctional enoyl-CoA
YP_426556



hydratase/phosphate acetyltransferase



hypothetical protein CLOBOL_07039
ZP_02089466



phosphate butyryltransferase
YP_003564887

















TABLE 1X







Suitable homologues for the SucC protein (succinate-CoA


ligase (ADP-forming), beta subunit, from Escherichia coli


K-12, EC No. 6.2.1.5, which acts on succinate and CoA


to produce succinyl-CoA










Protein Name
Protein Accession No.







succinyl-CoA synthetase, beta chain
YP_003942629



succinyl-CoA synthetase subunit beta
YP_003005213



succinyl-CoA synthetase subunit beta
YP_002150340



succinyl-CoA ligase (ADP-forming)
ZP_06124567



succinyl-CoA synthetase subunit beta
YP_001187988



succinyl-CoA synthetase subunit beta
ZP_01075062



succinyl-CoA ligase (ADP-forming)
ZP_05984280



succinyl-CoA synthetase subunit beta
YP_003699804



succinyl-CoA synthetase subunit beta
YP_003443470

















TABLE 1Y







Suitable homologues for the SucD protein (succinate-CoA


ligase (ADP-forming), alpha subunit, from Escherichia coli


K-12, EC No. 6.2.1.5, which acts on succinate and CoA to


produce succinyl-CoA










Protein Name
Protein Accession No.







succinyl-CoA synthetase subunit alpha
YP_402344



succinate-CoA ligase
ZP_07949625



succinyl-CoA synthetase subunit alpha
NP_792024



succinyl-CoA synthetase, alpha subunit
YP_001784751



succinyl-CoA synthetase alpha chain
ZP_03822017



succinyl-CoA ligase
ZP_07004580



hypothetical protein
XP_002872045



ARALYDRAFT_489184



succinyl-CoA synthetase subunit alpha
YP_896208



succinyl-CoA synthetase (ADP-
YP_611746



forming) alpha subunit

















TABLE 1Z







Suitable homologues for the Cat1 protein (succinyl-CoA:coenzyme


A transferase, from Clostridium kluyveri DSM 555, EC No.


2.8.3.n, which acts on succinate and acetyl-CoA to


produce succinyl-CoA and acetate










Protein Name
Protein Accession No.







succinyl-CoA synthetase subunit
YP_402344



alpha



succinate-CoA ligase
ZP_07949625



succinyl-CoA synthetase subunit
NP_792024



alpha



succinyl-CoA synthetase, alpha
YP_001784751



subunit



succinyl-CoA synthetase alpha chain
ZP_03822017



succinyl-CoA ligase
ZP_07004580



hypothetical protein
XP_002872045



ARALYDRAFT_489184



succinyl-CoA synthetase subunit
YP_896208



alpha



succinyl-CoA synthetase (ADP-
YP_611746



forming) alpha subunit










Suitable Extrachromosomal Vectors and Plasmids

A “vector,” as used herein, is an extrachromosomal replicon, such as a plasmid, phage, or cosmid, into which another DNA segment may be inserted so as to bring about the replication of the inserted segment. Vectors vary in copy number and depending on the origin of their replication they contain, their size, and the size of insert. Vectors with different origin of replications can be propagated in the same microbial cell unless they are closely related such as pMB1 and ColE1. Suitable vectors to express recombinant proteins can constitute pUC vectors with a pMB 1 origin of replication having 500-700 copies per cell, pBluescript vectors with a ColE1 origin of replication having 300-500 copies per cell, pBR322 and derivatives with a pMB1 origin of replication having 15-20 copies per cell, pACYC and derivatives with a p15A origin of replication having 10-12 copies per cell, and pSC101 and derivatives with a pSC101 origin of replication having about 5 copies per cell as described in the QIAGEN® Plasmid Purification Handbook (found on the world wide web at: //kirshner.med.harvard.edu/files/protocols/QIAGEN_QIAGENPlasmidPurification_EN.pdf).


Suitable Strategies and Expression Control Sequences for Recombinant Gene Expression

Strategies for achieving expression of recombinant genes in E. coli have been extensively described in the literature (Gross, Chimica Oggi 7(3):21-29 (1989); Olins and Lee, Cur. Op. Biotech. 4:520-525 (1993); Makrides, Microbiol. Rev. 60(3):512-538 (1996); Hannig and Makrides, Trends in Biotech. 16:54-60 (1998)). Expression control sequences can include constitutive and inducible promoters, transcription enhancers, transcription terminators, and the like which are well known in the art. Suitable promoters include, but are not limited to, Plac, Ptac, Ptrc, PR, PL, Ptrp, PphoA, Para, PuspA, PrspU, Psyn (Rosenberg and Court, Ann Rev. Genet. 13:319-353 (1979); Hawley and McClure, Nucl. Acids Res. 11 (8):2237-2255 (1983); Harley and Raynolds, Nucl. Acids Res. 15:2343-2361 (1987); also ecocyc.org and partsregistry.org.


Construction of Recombinant Hosts

Recombinant hosts containing the necessary genes that will encode the enzymatic pathway for the conversion of a carbon substrate to P4HB may be constructed using techniques well known in the art.


Methods of obtaining desired genes from a source organism (host) are common and well known in the art of molecular biology. Such methods can be found described in, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual, Third Ed., Cold Spring Harbor Laboratory, New York (2001); Ausubel et al., Current Protocols in Molecular Biology, John Wiley and Sons, Baltimore, Md. (1999). For example, if the sequence of the gene is known, the DNA may be amplified from genomic DNA using polymerase chain reaction (Mullis, U.S. Pat. No. 4,683,202) with primers specific to the gene of interest to obtain amounts of DNA suitable for ligation into appropriate vectors. Alternatively, the gene of interest may be chemically synthesized de novo in order to take into consideration the codon bias of the host organism to enhance heterologous protein expression. Expression control sequences such as promoters and transcription terminators can be attached to a gene of interest via polymerase chain reaction using engineered primers containing such sequences. Another way is to introduce the isolated gene into a vector already containing the necessary control sequences in the proper order by restriction endonuclease digestion and ligation. One example of this latter approach is the BioBrick™ technology (see the world wide web at biobricks.org) where multiple pieces of DNA can be sequentially assembled together in a standardized way by using the same two restriction sites.


In addition to using vectors, genes that are necessary for the enzymatic conversion of a carbon substrate to P4HB can be introduced into a host organism by integration into the chromosome using either a targeted or random approach. For targeted integration into a specific site on the chromosome, the method generally known as Red/ET recombineering is used as originally described by Datsenko and Wanner (Proc. Natl. Acad. Sci. USA, 2000, 97, 6640-6645). Random integration into the chromosome involved using a mini-Tn5 transposon-mediated approach as described by Huisman et al. (U.S. Pat. Nos. 6,316,262 and 6,593,116).


Culturing of Host to Produce P4HB Biomass

In general, the recombinant host is cultured in a medium with a carbon source and other essential nutrients to produce the P4HB biomass by fermentation techniques either in batches or continuously using methods known in the art. Additional additives can also be included, for example, antifoaming agents and the like for achieving desired growth conditions. Fermentation is particularly useful for large scale production. An exemplary method uses bioreactors for culturing and processing the fermentation broth to the desired product. Other techniques such as separation techniques can be combined with fermentation for large scale and/or continuous production.


As used herein, the term “feedstock” refers to a substance used as a carbon raw material in an industrial process. When used in reference to a culture of organisms such as microbial or algae organisms such as a fermentation process with cells, the term refers to the raw material used to supply a carbon or other energy source for the cells. Carbon sources useful for the production of GBL include simple, inexpensive sources, for example, glucose, sucrose, lactose, fructose, xylose, maltose, arabinose and the like alone or in combination. In other embodiments, the feedstock is molasses or starch, fatty acids, vegetable oils or a lignocelluloses material and the like. It is also possible to use organisms to produce the P4HB biomass that grow on synthesis gas (CO2, CO and hydrogen) produced from renewable biomass resources.


Introduction of P4HB pathway genes allows for flexibility in utilizing readily available and inexpensive feedstocks. A “renewable” feedstock refers to a renewable energy source such as material derived from living organisms or their metabolic byproducts including material derived from biomass, often consisting of underutilized components like chaff or stover. Agricultural products specifically grown for use as renewable feedstocks include, for example, corn, soybeans, switchgrass and trees such as poplar, wheat, flaxseed and rapeseed, sugar cane and palm oil. As renewable sources of energy and raw materials, agricultural feedstocks based on crops are the ultimate replacement of declining oil reserves. Plants use solar energy and carbon dioxide fixation to make thousands of complex and functional biochemicals beyond the current capability of modern synthetic chemistry. These include fine and bulk chemicals, pharmaceuticals, nutraceuticals, flavanoids, vitamins, perfumes, polymers, resins, oils, food additives, bio-colorants, adhesives, solvents, and lubricants.


Combining P4HB Biomass with Catalyst


In general, during or following production (e.g., culturing) of the P4HB biomass, the biomass is combined with a catalyst under suitable conditions to help convert the P4HB polymer to high purity gamma-butyrolactone product. The catalyst (in solid or solution form) and biomass are combined for example by mixing, flocculation, centrifuging or spray drying, or other suitable method known in the art for promoting the interaction of the biomass and catalyst driving an efficient and specific conversion of P4HB to gamma-butyrolactone. In some embodiments, the biomass is initially dried, for example at a temperature between about 100° C. and about 150° C. and for an amount of time to reduce the water content of the biomass. The dried biomass is then re-suspended in water prior to combining with the catalyst. Suitable temperatures and duration for drying are determined for product purity and yield and can in some embodiments include low temperatures for removing water (such as between 25° C. and 150° C.) for an extended period of time or in other embodiments can include drying at a high temperature (e.g., above 450° C.) for a short duration of time. Under “suitable conditions” refers to conditions that promote the catalytic reaction. For example, under conditions that maximize the generation of the product gamma-butyrolactone such as in the presence of co-agents or other material that contributes to the reaction efficiency. Other suitable conditions include in the absence of impurities, such as metals or other materials that would hinder the reaction from progression.


As used herein, “catalyst” refers to a substance that initiates or accelerates a chemical reaction without itself being affected or consumed in the reaction. Examples of useful catalysts include metal catalysts. In certain embodiments, the catalyst lowers the temperature for initiation of thermal decomposition and increases the rate of thermal decomposition at certain pyrolysis temperatures (e.g., about 200° C. to about 325° C.).


In some embodiments, the catalyst is a chloride, oxide, hydroxide, nitrate, phosphate, sulphonate, carbonate or stearate compound containing a metal ion. Examples of suitable metal ions include aluminum, antimony, barium, bismuth, cadmium, calcium, cerium, chromium, cobalt, copper, gallium, iron, lanthanum, lead, lithium, magnesium, molybdenum, nickel, palladium, potassium, silver, sodium, strontium, tin, tungsten, vanadium or zinc and the like. In some embodiments, the catalyst is an organic catalyst that is an amine, azide, enol, glycol, quaternary ammonium salt, phenoxide, cyanate, thiocyanate, dialkyl amide and alkyl thiolate. In some embodiments, the catalyst is calcium hydroxide. In other embodiments, the catalyst is sodium carbonate. Mixtures of two or more catalysts are also included.


In certain embodiments, the amount of metal catalyst is about 0.1% to about 15% or about 1% to about 25%, or 4% to about 50%, or about 4% to about 50% based on the weight of metal ion relative to the dry solid weight of the biomass. In some embodiments, the amount of catalyst is between about 7.5% and about 12%. In other embodiments, the amount of catalyst is about 0.5% dry cell weight, about 1%, about 2%, about 3%, about 4%, about 5, about 6%, about 7%, about 8%, about 9%, or about 10%, or about 11%, or about 12%, or about 13%, or about 14%, or about 15%, or about 20%, or about 30%, or about 40% or about 50% or amounts in between these.


As used herein, the term “sufficient amount” when used in reference to a chemical reagent in a reaction is intended to mean a quantity of the reference reagent that can meet the demands of the chemical reaction and the desired purity of the final product.


Thermal Degradation of the P4HB Biomass

“Heating,” “pyrolysis”, “thermolysis” and “torrefying” as used herein refer to thermal degradation (e.g., decomposition) of the P4HB biomass for conversion to GBL. In general, the thermal degradation of the P4HB biomass occurs at an elevated temperature in the presence of a catalyst. For example, in certain embodiments, the heating temperature for the processes described herein is between about 200° C. to about 400° C. In some embodiments, the heating temperature is about 200° C. to about 350° C. In other embodiments, the heating temperature is about 300° C. “Pyrolysis” typically refers to a thermochemical decomposition of the biomass at elevated temperatures over a period of time. The duration can range from a few seconds to hours. In certain conditions, pyrolysis occurs in the absence of oxygen or in the presence of a limited amount of oxygen to avoid oxygenation. The processes for P4HB biomass pyrolysis can include direct heat transfer or indirect heat transfer. “Flash pyrolysis” refers to quickly heating the biomass at a high temperature for fast decomposition of the P4HB biomass, for example, depolymerization of a P4HB in the biomass. Another example of flash pyrolysis is RTP™ rapid thermal pyrolysis. RTP™ technology and equipment from Envergent Technologies, Des Plaines, Ill. converts feedstocks into bio-oil. “Torrefying” refers to the process of torrefaction, which is an art-recognized term that refers to the drying of biomass at elevated temperature with loss of water and organic volatiles to produce a torrefied biomass with enhanced solid fuel properties. The torrefied biomass typically has higher heating value, greater bulk density, improved grindability for pulverized fuel boilers, increased mold resistance and reduced moisture sensitivity compared to biomass dried to remove free water only (e.g. conventional oven drying at 105° C.). The torrefaction process typically involves heating a biomass in a temperature range from 200-350° C., over a relatively long duration (e.g., 10-30 minutes), typically in the absence of oxygen. The process results for example, in a torrefied biomass having a water content that is less than 7 wt % of the biomass. The torrefied biomass may then be processed further. In some embodiments, the heating is done in a vacuum, at atmospheric pressure or under controlled pressure. In certain embodiments, the heating is accomplished without the use or with a reduced use of petroleum generated energy.


In certain embodiments, the P4HB biomass is dried prior to heating so that the final water content of the biomass prior to pyrolysis is in the range of 1-20% by weight biomass. Alternatively, in other embodiments, drying is done during the thermal degradation (e.g., heating, pyrolysis or torrefaction) of the P4HB biomass. Drying reduces the water content of the biomass. In certain embodiments, the biomass is dried at a temperature of between about 100° C. to about 350° C., for example, between about 200° C. and about 275° C. In some embodiments, the dried 4PHB biomass has a water content of 5 wt %, or less.


In certain embodiments, the heating of the P4HB biomass/catalyst mixture is carried out for a sufficient time to efficiently and specifically convert the P4HB biomass to GBL. In certain embodiments, the time period for heating is from about 30 seconds to about 1 minute, from about 30 seconds to about 1.5 minutes, from about 1 minute to about 10 minutes, from about 1 minute to about 5 minutes or a time between, for example, about 1 minute, about 2 minutes, about 1.5 minutes, about 2.5 minutes, about 3.5 minutes.


In other embodiments, the time period is from about 1 minute to about 2 minutes. In still other embodiments, the heating time duration is for a time between about 5 minutes and about 30 minutes, between about 30 minutes and about 2 hours, or between about 2 hours and about 10 hours or for greater that 10 hours (e.g., 24 hours).


In certain embodiments, the heating temperature is at a temperature of about 200° C. to about 350° C. including a temperature between, for example, about 205° C., about 210° C., about 215° C., about 220° C., about 225° C., about 230° C., about 235° C., about 240° C., about 245° C., about 250° C., about 255° C. about 260° C., about 270° C., about 275° C., about 280° C., about 290° C., about 300° C., about 310° C., about 320° C., about 330° C., about 340° C., or 345° C. In certain embodiments, the temperature is about 250° C. In certain embodiments, the temperature is about 275° C. In other embodiments, the temperature is about 300° C.


In certain embodiments, the process also includes flash pyrolyzing the residual biomass for example at a temperature of 500° C. or greater for a time period sufficient to decompose at least a portion of the residual biomass into pyrolysis liquids. In certain embodiments, the flash pyrolyzing is conducted at a temperature of 500° C. to 750° C. In some embodiments, a residence time of the residual biomass in the flash pyrolyzing is from 1 second to 15 seconds, or from 1 second to 5 seconds or for a sufficient time to pyrolyze the biomass to generate the desired pyrolysis precuts, for example, pyrolysis liquids. In some embodiments, the flash pyrolysis can take place instead of torrefaction. In other embodiments, the flash pyrolysis can take place after the torrrefication process is complete.


As used herein, “pyrolysis liquids” are defined as a low viscosity fluid with up to 15-20% water, typically containing sugars, aldehydes, furans, ketones, alcohols, carboxylic acids and lignins. Also known as bio-oil, this material is produced by pyrolysis, typically fast pyrolysis of biomass at a temperature that is sufficient to decompose at least a portion of the biomass into recoverable gases and liquids that may solidify on standing. In some embodiments, the temperature that is sufficient to decompose the biomass is a temperature between 400° C. to 800° C.


In certain embodiments, “recovering” the gamma-butyrolactone vapor includes condensing the vapor. As used herein, the term “recovering” as it applies to the vapor means to isolate it from the P4HB biomass materials, for example including but not limited to: recovering by condensation, separation methodologies, such as the use of membranes, gas (e.g., vapor) phase separation, such as distillation, and the like. Thus, the recovering may be accomplished via a condensation mechanism that captures the monomer component vapor, condenses the monomer component vapor to a liquid form and transfers it away from the biomass materials.


As a non-limiting example, the condensing of the gamma-butyrolactone vapor may be described as follows. The incoming gas/vapor stream from the pyrolysis/torrefaction chamber enters an interchanger, where the gas/vapor stream may be pre-cooled. The gas/vapor stream then passes through a chiller where the temperature of the gas/vapor stream is lowered to that required to condense the designated vapors from the gas by indirect contact with a refrigerant. The gas and condensed vapors flow from the chiller into a separator, where the condensed vapors are collected in the bottom. The gas, free of the vapors, flows from the separator, passes through the Interchanger and exits the unit. The recovered liquids flow, or are pumped, from the bottom of the separator to storage. For some of the products, the condensed vapors solidify and the solid is collected.


In certain embodiments, recovery of the catalyst is further included in the processes of the invention. For example, when a calcium catalyst is used calcination is a useful recovery technique. Calcination is a thermal treatment process that is carried out on minerals, metals or ores to change the materials through decarboxylation, dehydration, devolatilization of organic matter, phase transformation or oxidation. The process is normally carried out in reactors such as hearth furnaces, shaft furnaces, rotary kilns or more recently fluidized beds reactors. The calcination temperature is chosen to be below the melting point of the substrate but above its decomposition or phase transition temperature. Often this is taken as the temperature at which the Gibbs free energy of reaction is equal to zero. For the decomposition of CaCO3 to CaO, the calcination temperature at ΔG-0 is calculated to be ˜850° C. Typically for most minerals, the calcination temperature is in the range of 800-1000° C. but calcinations can also refer to heating carried out in the 200-800° C. range.


To recover the calcium catalyst from the biomass after recovery of the GBL, one would transfer the spent biomass residue directly from pyrolysis or torrefaction into a calcining reactor and continue heating the biomass residue in air to 825-850° C. for a period of time to remove all traces of the organic biomass. Once the organic biomass is removed, the catalyst could be used as is or purified further by separating the metal oxides present (from the fermentation media and catalyst) based on density using equipment known to those in the art.


In certain embodiments, the process is selective for producing gamma-butyrolactone product with a relatively small amount of undesired side products (e.g., dimerized product of GBL (3-(dihydro-2(3H)-furanylidene) dihydro-2(3H)-furanone), other oligomers of GBL or other side products). For example, in some embodiments the use of a specific catalyst in a sufficient amount will reduce the production of undesired side products and increase the yield of gamma-butyrolactone by at least about 2 fold. In some embodiments, the production of undesired side products will be reduced to at least about 50%, at least about 40%, at least about 30%, at least about 20% at least about 10%, or about at least 5%. In certain embodiment, the undesired side products will be less than about 5% of the recovered gamma-butyrolactone, less than about 4% of the recovered gamma-butyrolactone, less than about 3% of the recovered gamma-butyrolactone, less than about 2% of the recovered gamma-butyrolactone, or less than about 1% of the recovered gamma-butyrolactone.


The processes described herein can provide a yield of GBL expressed as a percent yield, for example, when grown from glucose as a carbon source, the yield is up to 95% based on a gram of GBL recovered per gram P4HB contained in the biomass fed to the process (reported as percent). In other embodiments, the yield is in a range between about 40% and about 95%, for example between about 50% and about 70%, or between about 60% and 70%. In other embodiment, the yield is about 75%, about 70%, about 65%, about 60%, about 55%, about 50%, about 45% or about 40%.


As used herein, “gamma-butyrolactone” or GBL refers to the compound with the following chemical structure:




embedded image


The term “gamma-butyrolactone product” refers to a product that contains at least about 70 up to 100 weight percent gamma-butyrolactone. For example, in a certain embodiment, the gamma-butyrolactone product may contain 95% by weight gamma-butyrolactone and 5% by weight side products. In some embodiments, the amount of gamma-butyrolactone in the gamma-butyrolactone product is about 71% by weight, about 72% by weight, about 73% by weight, about, 74% by weight, about 75% by weight, about 76% by weight, about 77% by weight, about 78% by weight, about 79% by weight, about 80% by weight, 81% by weight, about 82% by weight, about 83% by weight, about, 84% by weight, about 85% by weight, about 86% by weight, about 87% by weight, about 88% by weight, about 89% by weight, about 90% by weight, 91% by weight, about 92% by weight, about 93% by weight, about, 94% by weight, about 95% by weight, about 96% by weight, about 97% by weight, about 98% by weight, about 99% by weight, about 99.5% or about 100% by weight. In particular embodiments, the weight percent of gamma-butyrolactone product produced by the processes described herein is 85% or greater than 85%.


In other embodiments, the gamma-butyrolactone product can be further purified if needed by additional methods known in the art, for example, by distillation, by reactive distillation (e.g., the gamma-butryolactone product is acidified first to oxidize certain components (e.g., for ease of separation) and then distilled) by treatment with activated carbon for removal of color and/or odor bodies, by ion exchange treatment, by liquid-liquid extraction-with GBL immiscible solvent (e.g., nonpolar solvents, like cyclopentane or hexane) to remove fatty acids etc, for purification after GBL recovery, by vacuum distillation, by extraction distillation or using similar methods that would result in further purifying the gamma-butyrolactone product to increase the yield of gamma-butyrolactone. Combinations of these treatments can also be utilized.


In certain embodiments, GBL is further chemically modified and/or substituted to other four carbon products (C4 products) and derivatives including but not limited to succinic acid, 1,4-butanediamide, succinonitrile, succinamide, N-vinyl-2-pyrrolidone (NVP), 2-pyrrolidone (2-Py), N-methyl-2-pyrrolidone (NMP), tetrahydrofuran (THF), 1,4-butanediol (BDO). Methods and reactions for production of these derivatives from gamma-butyrolactone are readily known by one skilled in the art.


As used herein, the term “residual biomass” refers to the biomass after PHA conversion to the small molecule intermediates. The residual biomass may then be converted via torrefaction to a useable, fuel, thereby reducing the waste from PHA production and gaining additional valuable commodity chemicals from typical torrefaction processes. The torrefaction is conducted at a temperature that is sufficient to densify the residual biomass. In certain embodiments, processes described herein are integrated with a torrefaction process where the residual biomass continues to be thermally treated once the volatile chemical intermediates have been released to provide a fuel material. Fuel materials produced by this process are used for direct combustion or further treated to produce pyrolysis liquids or syngas. Overall, the process has the added advantage that the residual biomass is converted to a higher value fuel which can then be used for the production of electricity and steam to provide energy for the process thereby eliminating the need for waste treatment.


The term “gamma-butyrolactone” refers to the post processed gamma-butyrolactone product that has been purified further to remove impurities.


A “carbon footprint” is a measure of the impact the processes have on the environment, and in particular climate change. It relates to the amount of greenhouse gases produced.


It may be desirable to label the constituents of the biomass or starting chemicals. For example, it may be useful to deliberately label with an isotope of carbon (e.g., 13C) to facilitate structure determination or for other means such as origin and certainly of renewable content. In one way, this is achieved by growing microorganisms genetically engineered to express the constituents, e.g., polymers, but instead of the usual media, the bacteria are grown on a growth medium with 13C-containing carbon source, such as glucose, pyruvic acid, or other feedstocks discussed herein. In this way polymers can be produced that are labeled with 13C uniformly, partially, or at specific sites.


Additionally, labeling allows the exact percentage in bioplastics that came from renewable sources (e.g., plant derivatives) determined via ASTM D6866-an industrial application of radiocarbon dating. ASTM D6866 measures the Carbon 14 content of biobased materials; and since fossil-based materials no longer have Carbon 14, ASTM D6866 can effectively dispel inaccurate claims of biobased content. In this analysis technique for determination of Renewable resources, the ratio of 14C to total carbon within a sample (14C/C) is measured. Research has noted that fossil fuels and petrochemicals generally have a 14C/C ratio of less than about 1×1015. However, polymers derived entirely from renewable resources typically have a 14C/C ratio of about 1.2×10−12. Other Suitable techniques for 14C analysis are known in the art and include accelerator mass spectrometry, liquid scintillation counting, and isotope mass spectrometry. These techniques are described in U.S. Pat. Nos. 3,885,155; 4,427,884; 4,973,841; 5,438,194; and 5,661,299. Accuracy of radioanalytical procedures used to determine the biobased content of manufactured products is outlined in Norton et al, Bioresource Technology, 98 1052-1056 (2007), incorporated by reference.


The application of ASTM D6866 to derive a “bio-based content” is built on the same concepts as radiocarbon dating, but without use of the age equations. The analysis is performed by deriving a ratio of the amount of radiocarbon (14C) in an unknown sample to that of a modem reference standard. The ratio is reported as a percentage with the units “pMC” (percent modem carbon). If the material being analyzed is a mixture of present day radiocarbon and fossil carbon (containing no radiocarbon), then the pMC value obtained correlates directly to the amount of biomass material present in the sample.


The modem reference standard used in radiocarbon dating is a NIST (National Institute of Standards and Technology) standard with a known radiocarbon content equivalent approximately to the year AD 1950. The year AD 1950 was chosen because it represented a time prior to thermo-nuclear weapons testing, which introduced large amounts of excess radiocarbon into the atmosphere with each explosion (termed “bomb carbon”). The AD 1950 reference represents 100 pMC.


In the compositions of the invention for making articles the bio-based chemicals comprise at least about 50% (e.g., at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, or at least about 95%, at least about 96%, at at least about 97%, at least about 98%, at least about 99%, up to 100%) bio-based content based on the total weight of the composition. In this regard, the synthetic polymer is composed of a sufficient amount of bio-based components (i.e., the precursors are substantially composed of materials derived from renewable resources), and the composition comprises a sufficient amount to achieve the desired bio-based content level.


EXAMPLES

The present technology is further illustrated by the following examples, which should not be construed as limiting in any way.


Experimental Methods
Measurement of GBL Color

The color of purified, biobased GBL liquids was measured using a Gretag Macbeth Color-Eye 7000A spectrophotometer. The color of commercial petroleum-based GBL liquids is reported as a single number on the APHA cobalt-platinum yellowness scale. This scale uses a series of platinum-cobalt compound solutions where the highest value is 500. In order to report the GBL liquid color on the APHA scale, APHA solutions standards (Sigma Aldrich) were first scanned on the Gretag spectrophotometer and their yellowness index (YI) measured using ASTM E313 method. A correlation plot was then constructed of APHA color vs. E313 yellowness index values. The biobased GBL liquids were then measured for E313 yellowness index and these values were converted to APHA color using the correlation. Typical APHA values for the biobased GBL final product were <20.


Measurement of Thermal Degradation Behavior by Thermogravimetric Analysis (TGA)

The isothermal weight loss versus time for biomass samples was measured using a TA Instruments Q500 Thermogravimetric Analyzer (TGA). TGA is a technique commonly used to measure the thermal degradation behavior of materials such as PHA's. The instrument consists of a sensitive balance from which a sample is suspended. A furnace is then brought up around the sample and programmed to heat at a specified rate (ramp conditions) or to a certain temperature and hold (isothermal conditions). A purge gas is swept across the sample during heating which is typically nitrogen or air. As the sample is heated, it begins to lose weight which is recorded by the balance. At the end of the analysis, the results can then be plotted as percent sample weight loss versus temperature or time. When plotted as weight loss versus time, the rate of degradation can then be determined from the slope of this curve. For the following examples, 5-10 mg of dry biomass was weighed into a platinum pan and then loaded onto the TGA balance. The purge gas used was nitrogen at a flow rate of 60 ml/min. For isothermal test conditions, the biomass sample was preheated from room temperature to the programmed isothermal temperature at a heating rate of 150-200° C./min and held at the isothermal temperature for 10-30 min. The data was then plotted as % sample weight loss vs. time and thermal degradation rate calculated from the initial slope of the curve.


Measurement of Thermal Degradation Products by Pyrolysis-Gas Chromatography-Mass Spectroscopy (Py-GC-MS).

In order to identify and semi-quantitate the monomer compounds generated from dry biomass while being heated at various temperatures, an Agilent 7890A/5975 GC-MS equipped with a Frontier Lab PY-2020iD pyrolyzer was used. For this technique, a sample is weighed into a steel cup and loaded into the pyrolyzer autosampler. When the pyrolyzer and GC-MS are started, the steel cup is automatically placed into the pyrolyzer which has been set to a specific temperature. The sample is held in the pyrolyzer for a short period of time while volatiles are released by the sample. The volatiles are then swept using helium gas into the GC column where they condense onto the column which is at room temperature. Once the pyrolysis is over, the GC column is heated at a certain rate in order to elute the volatiles released from the sample. The volatile compounds are then swept using helium gas into an electro ionization/mass spectral detector (mass range 10-700 daltons) for identification and quantitation.


For the following examples, 200-400 μg of dry biomass was weighed into a steel pyrolyzer cup using a microbalance. The cup was then loaded into the pyrolyzer autosampler. The pyrolyzer was programmed to heat to temperatures ranging from 225-350° C. for a duration of 0.2-1 minutes. The GC column used in the examples was either a Frontier Lab Ultra Alloy capillary column or an HP-5MS column (length 30 m, ID 0.25 μm, film thickness 0.25 μm). The GC was then programmed to heat from room temperature to 70° C. over 5 minutes, then to 240° C. at 10° C./min for 4 min. and finally to 270° C. at 20° C./min for 1.5 min Total GC run time was 25 minutes. Peaks showing in the chromatogram were identified by the best probability match to spectra from a NIST mass spectral library. GBL ‘purity’ was measured by taking the area counts for GBL peak and dividing it by the area counts for GBL dimer peak.


These examples describe a number of biotechnology tools and methods for the construction of strains that generate a product of interest. Suitable host strains, the potential source and a list of recombinant genes used in these examples, suitable extrachromosomal vectors, suitable strategies and regulatory elements to control recombinant gene expression, and a selection of construction techniques to overexpress genes in or inactivate genes from host organisms are described. These biotechnology tools and methods are well known to those skilled in the art.


Example 1
4HB Polymer Production Before Microbial Strain Modification

This example shows the 4HB polymer production capability of microbial strains have not been optimized to incorporate high mole % 4HB from renewable carbon resources. The strains used in this example are listed in Table 2. Strains 1 and 2 were described by Dennis and Valentin (U.S. Pat. No. 6,117,658).









TABLE 2







Strains used in Example 1










Relevant host genome



Strains
modifications
Genes overexpressed





1

Ptac-phaCAB




Plac-orfZ-′cat1-sucD-4hbD


2
yneI-negative
Ptac-phaCAB




Plac-orfZ-′cat1-sucD-4hbD


3
ΔyneI ΔgabD
PX-phaC, P12-phaAB




Plac-orfZ-′cat1-sucD-4hbD









Strain 3 contained deletions of both the yneI and gabD chromosomal genes (FIG. 1 and Table 1A, Reaction Number 12) which encode the CoA-independent, NAD-dependent succinate semialdehyde (SSA) dehydrogenase and the CoA-independent, NADP-dependent SSA dehydrogenase, respectively. To accomplish this, a derivative strain of LS5218 (Jenkins and Nunn J. Bacteriol. 169:42-52 (1987)) was used that expressed phaA, phaB and phaC as described previously by Huisman et al. (U.S. Pat. No. 6,316,262). Single null gabD and yneI mutants were constructed as described by Farmer et al. (WO Patent No. 2010/068953) and used the Red/ET recombineering method described by Datsenko and Wanner (Proc. Natl. Acad. Sci. USA. 97:6640-6645 (2000)), a method well known to those skilled in the art. This resulted in strain 3 that had the entire coding sequences of both the yneI and gabD genes removed from the genome. Note that strains 1, 2, and 3 contain the same gene cassette Plac-orfZ-‘cat1-sucD-4-hbD as described by Dennis and Valentin, where sucD is not codon-optimized for expression in E. coli.


To examine production of P3HB-co-4HB (poly-3-hydroxybutyrate-co-4-hydroxybutyrate), strain 3 was cultured overnight in a sterile tube containing 3 mL of LB and appropriate antibiotics. From this, 50 μL was added in triplicate to Duetz deep-well plate wells containing 450 μL of LB and antibiotics. This was grown for 6 hours at 30° C. with shaking. Then, 25 μL of each LB culture replicate was added to 3 additional wells containing 475 μL of LB medium supplemented with 10 g/L glucose, 100 μM IPTG, 100 μg/mL ampicillin, and 25 μg/mL chloramphenicol, and incubated at 30° C. with shaking for 72 hours. Thereafter, production well sets were combined (1.5 mL total) and analyzed for polymer content. At the end of the experiment, cultures were spun down at 4150 rpm, washed once with distilled water, frozen at −80° C. for at least 30 minutes, and lyophilized overnight. The next day, a measured amount of lyophilized cell pellet was added to a glass tube, followed by 3 mL of butanolysis reagent that consists of an equal volume mixture of 99.9% n-butanol and 4.0 N HCl in dioxane with 2 mg/mL diphenylmethane as internal standard. After capping the tubes, they were vortexed briefly and placed on a heat block set to 93° C. for six hours with periodic vortexing. Afterwards, the tube was cooled down to room temperature before adding 3 mL distilled water. The tube was vortexed for approximately 10 s before spinning down at 620 rpm (Sorvall Legend RT benchtop centrifuge) for 2 min. 1 mL of the organic phase was pipetted into a GC vial, which was then analyzed by gas chromatography-flame ionization detection (GC-FID) (Hewlett-Packard 5890 Series II). The quantity of PHA in the cell pellet was determined by comparing against a standard curve for 4HB (for P4HB analysis) or by comparing against standard curves for both 3HB and 4HB (for PHB-co-4HB analysis). The 4HB standard curve was generated by adding different amounts of a 10% solution of γ-butyrolactone (GBL) in butanol to separate butanolysis reactions. The 3HB standard curve was generated by adding different amounts of 99% ethyl 3-hydroxybutyrate to separate butanolysis reactions.


The results in Table 3 show that strain 3 incorporated similarly low mole % 4HB into the copolymer as was described in U.S. Pat. No. 6,117,658.









TABLE 3







P3HB-co-4HB polymer production from microbial strains









Strains
Mole % 3HB
Mole % 4HB





1
98.5
1.5


2
95.0
5.0


3
97.6 ± 0.9
2.4 ± 0.9









Example 2
P4HB Production Via an α-Ketoglutarate Decarboxylase or a Succinyl-CoA Dehydrogenase

Several metabolic pathways were proposed to generate succinic semialdehyde (SSA) from the tricarboxylic acid (TCA) cycle (reviewed by Steinbüchel and Lütke-Eversloh, Biochem. Engineering J. 16:81-96 (2003) and Efe et al., Biotechnology and Bioengineering 99:1392-1406 (2008). One pathway converts succinyl-CoA to SSA via a succinyl-CoA dehydrogenase, which is encoded by sucD (Söhling and Gottschalk, J. Bacterial. 178:871-880 (1996); FIG. 1, Reaction number 7). A second pathway converts alpha-ketoglutarate to SSA via an alpha-ketoglutarate decarboxylase that is encoded by kgdM (Tian et al. Proc. Natl. Acad. Sci. U.S.A. 102:10670-10675 (2005); FIG. 1, Reaction number 8). A third pathway converts alpha-ketoglutarate to SSA via L-glutamate and 4-aminobutyrate using a glutamate dehydrogenase (EC 1.4.1.4), a glutamate decarboxylase (EC 4.1.1.15), and a 4-aminobutyrate transaminase (EC 2.6.1.19), or a 4-aminobutyrate aminotransferase (EC 2.6.1.19). Van Dien et al. (WO Patent No. 2010/141920) showed that both the sucD and the kgdM pathways worked independently of each other and were additive when combined to produce 4HB. Note that kgdM is called sucA in van Dien et al.


In this example, the two metabolic pathways via sucD or kdgM were compared to see which one could produce the highest P4HB titers. The following three strains were thus constructed using the well known biotechnology tools and methods described above, all of which contained chromosomal deletions of yneI and gabD and overexpressed a PHA synthase, and a CoA transferase, and either an alpha-ketoglutarate decarboxylase with an SSA reductase (strain 5), or a succinyl-CoA dehydrogenase with an SSA reductase (strain 6). Strain 4 served as a negative control and just contained the empty vector instead of Ptrc-kgdM-ssaRAt* or Ptrc-sucD*-ssaRAt* (see Table 4).









TABLE 4







Microbial Strains used in Example 2










Relevant




host genome


Strains
modifications
Genes overexpressed





4
ΔyneI ΔgabD
PrpsU-orfZ; Psyn1-phaC1


5
ΔyneI ΔgabD
PrpsU-orfZ; Psyn1-phaC1; Ptrc-kgdM-ssaRAt*


6
ΔyneI ΔgabD
PrpsU-orfZ; Psyn1-phaC1; Ptrc-sucD*-ssaRAt*









The strains were grown in a 24 hour shake plate assay. The production medium consisted of 1×E2 minimal salts solution containing 10 g/L glucose, 5 g/L sodium 4-hydroxybutyrate, 2 mM MgSO4, 1× Trace Salts Solution, and 100 μM IPTG. 50×E2 stock solution consists of 1.275 M NaNH4HPO4.4H2O, 1.643 M K2HPO4, and 1.36 M KH2PO4. 1000× stock Trace Salts Solution is prepared by adding per 1 L of 1.5 NHCL: 50 g FeSO4.7H2O, 11 g ZnSO4.7H2O, 2.5 g MnSO4.4H2O, 5 g CuSO4.5H2O, 0.5 g (NH4)6Mo7O24.4H2O, 0.1 g Na2B4O7, and 10 g CaCl2.2H2O. At the end of the growth phase, the biomass and P4HB titers were determined as described in Example 1.


The results in Table 5 surprisingly show that only strain 6 expressing the sucD pathway produced significant amounts of P4HB. In contrast to the strains described by van Dien et al. (WO Patent No. 2010/141920) that produced 4HB via both the kgdM and sucD pathways in similar amounts, the alpha-ketoglutarate decarboxylase pathway used here produced only very low amounts of P4HB.









TABLE 5







Biomass and P4HB titer









Strains
Biomass Titer (g/L)
P4HB Titer (% dcw)





4
2.33 ± 0.02
0.0 ± 0.0


5
2.06 ± 0.03
0.1 ± 0.0


6
2.59 ± 0.01
6.9 ± 0.1









Example 3
Improvement in P(4HB) Production by Overexpressing Certain Succinic Semialdehyde Reductase Genes
Effect of 4hbd on P4HB Production

The succinic semialdehyde (SSA) reductase gene 4hbD was used by Dennis and Valentin (U.S. Pat. No. 6,117,658) to produce P3HB-co-4HB copolymer. To see how effective overproduction of this SSA reductase was for P4HB homopolymer production, the 4hbD gene was overexpressed by the IPTG-inducible Ptrc promoter (strain 8). An empty vector containing strain served as a control (strain 7). The host strain used contained chromosomal deletions of genes yneI and gabD and also overexpressed the recombinant genes org sucD* and phaC3/C1* as shown in Table 6.









TABLE 6







Microbial Strains used in this section of Example 3










Relevant




host genome


Strains
modifications
Genes overexpressed





7
ΔyneI ΔgabD
PrpsU-orfZ, PuspA-phaC3/C1*-sucD*


8
ΔyneI ΔgabD
PrpsU-orfZ, PuspA-phaC3/C1*-sucD*, Ptrc-4hbD









The strains were grown in a 48 hour shake plate assay. The production medium consisted of 1×E2 minimal salts solution containing 20 g/L glucose, 1× Trace Salts Solution and 100 μM IPTG. Both E2 medium and trace elements are described in Example 2. At the end of the growth phase, the biomass and P4HB titers were determined as described in Example 1.


As shown in Table 7, strain 8 expressing 4hbD incorporated low amounts of 4HB into the polymer, similar to the strains described in U.S. Pat. No. 6,117,658 and verified in Example 1. However, very unexpectedly, the empty vector control strain 7, which did not express the 4hbd gene, produced significantly increased P4HB titers.









TABLE 7







Biomass and P4HB titer for microbial strains 7 and 8









Strains
Biomass Titer (g/L)
P4HB Titer (% dcw)





7
2.64 ± 0.04
17.09 ± 0.06


8
4.20 ± 0.09
 3.17 ± 0.24









Effect of Other SSA Reductase Genes on P4HB Production

Since the 4hbD-encoded SSA reductase unexpectedly did not produce higher amounts of P4HB than its parental strain, another known SSA reductase from Arabidopsis thaliana (Breitkreuz et al., J. Biol. Chem. 278:41552-41556 (2003)) was cloned in search of a catalytically more active enzyme. In addition, several genes whose protein sequences were found to be homologous to the A. thaliana enzyme were tested. These included putative SSA reductase genes from Mus musculus and Aspergillus terreus. Furthermore, to investigate if an unspecific aldehyde dehydrogenase from E. coli that did not show significant homology to the Arabidopsis enzyme could catalyze the SSA to 4HB reaction, gene yqhD was also cloned. YqhD was shown previously to have a catalytic activity to convert 3-hydroxypropionaldehyde to 1,3-propanediol (Emptage et al., U.S. Pat. No. 7,504,250). The resulting strains are listed in Table 8.









TABLE 8







Microbial strains used in Example 3










Relevant




host genome


Strains
modifications
Genes overexpressed












9
ΔyneI ΔgabD
PrpsU-orfZ, PuspA-phaC3/C1*-sucD*


10
ΔyneI ΔgabD
PrpsU-orfZ, PuspA-phaC3/C1*-sucD*,




Ptrc-ssaRAt*


11
ΔyneI ΔgabD
PrpsU-orfZ, PuspA-phaC3/C1*-sucD*,




Ptrc-ssaRMm*


12
ΔyneI ΔgabD
PrpsU-orfZ, PuspA-phaC3/C1*-sucD*,




Ptrc-ssaRAt2*


13
ΔyneI ΔgabD
PrpsU-orfZ, PuspA-phaC3/C1*-sucD*, Ptrc-yqhD









Strains 9 to 13 were grown and the biomass and P4HB titers were determined as described above. Table 9 shows that unlike the 4hbD-encoded SSA reductase, overproduction of the SSA reductase from A. thaliana significantly increased P4HB production. This clearly illustrates how unpredictable the metabolic engineering outcome is albeit the known function of both the C. kluyveri and A. thaliana enzymes. The putative SSA reductase genes from M. musculus and A. terreus also improved P4HB production to various degrees. Unexpectedly, the unspecific E. coli aldehyde dehydrogenase YqhD increased P4HB production to a similar degree as was observed for the A. thaliana SSA reductase.









TABLE 9







Biomass and P4HB titer for microbial strains 9-13









Strains
Biomass Titer (g/L)
P4HB Titer (% dcw)












9
2.64 ± 0.04
17.09 ± 0.06


10
4.80 ± 0.12
28.46 ± 0.65


11
3.96 ± 0.79
23.31 ± 4.32


12
3.60 ± 0.29
19.74 ± 0.43


13
5.07 ± 0.07
27.99 ± 1.36









Example 4
Improved P4HB Production by Deletion of Pyruvate Kinases

Removal of pyruvate kinase I encoded by pykF and pyruvate kinase II encoded by pykA (FIG. 1, Reaction number 2) has been shown to reduce the production of acetate and favor the generation of CO2 (Zhu et al. (2001) Biotechnol. Prog. 17:624-628). These results indicate that removal of pykF and pykA causes carbon flux to be diverted to the TCA cycle, and so these genetic modifications have been described as being useful for the microbial production of succinate and 1,4-butanediol (Park et al., WO Patent No. 2009/031766). To determine if deleting the pyruvate kinase genes pykF and pykA would lead to improved P4HB titers, the following two strains were constructed using the well known biotechnology tools and methods described above. Both of these strains contained chromosomal deletions of yneI and gabD and overexpressed a PHA synthase, a succinyl-CoA dehydrogenase, an SSA reductase and a CoA-transferase. Strain 14 retained its native unmodified copies of pykF and pykA on the chromosome, while strain 15 has both of these genes removed (Table 10).









TABLE 10







Microbial strains used in Example 4










Relevant host genome



Strains
modifications
Genes overexpressed





14
ΔyneI ΔgabD
Psyn1-phaC1-PuspA-sucD*-ssaRAt*;




PrpsU-orfZ


15
ΔyneI ΔgabD ΔpykF
Psyn1-phaC1-PuspA-sucD*-ssaRAt*;



ΔpykA
PrpsU-orfZ









The strains were grown in a 48 hour shake plate assay. The production medium consisted of 1×E2 minimal salts solution containing 30 g/L glucose and 1× Trace Salts Solution. Both E2 medium and trace elements are described in Example 2. At the end of the growth phase, the biomass and P4HB titers were determined as described in Example 1.


The results in Table 11 show that strain 15 which lacks pykF and pykA produced more P4HB than strain 14 that retained these two genes.









TABLE 11







Biomass and P4HB titer for microbial strains 14 and 15.









Strain
Biomass Titer (g/L)
P4HB Titer (% dcw)





14
10.26 ± 0.44
25.6 ± 4.8


15
14.17 ± 0.11
46.3 ± 2.2









Example 5
Improved P4HB Production by Overexpression of PEP Carboxylase

Overexpression of PEP carboxylase (FIG. 1, Reaction number 3) has been used to enhance the production of both the aspartate family of amino acids and succinate by increasing carbon flow into the TCA cycle. However, since many wild-type homologues of PEP carboxylase are feedback-regulated by L-aspartate or other TCA cycle-derived metabolites, a considerable amount of prior art has been created regarding the identification of either feedback-desensitized mutants (Sugimoto et al., U.S. Pat. No. 5,876,983; San et al., US Patent No. 2005/0170482) or alternative homologues that naturally exhibit less allosteric regulation (Rayapati and Crafton, US Patent No. 2002/0151010). To determine whether overexpression of PEP carboxylase would lead to improved P4HB titer, the following three strains were constructed using the well known biotechnology tools and methods described above. These strains contained chromosomal deletions of yneI and gabD and overexpressed a PHA synthase, a succinyl-CoA dehydrogenase, an SSA reductase, a CoA-transferase, and either wild-type PEP carboxylase (ppcEc) from E. coli (strain 17) or wild-type PEP carboxylase (ppcMs) from Medicago sativa (strain 18) which has reduced allosteric regulation (Rayapati and Crafton, US20020151010 A1). Strain 16 served as a negative control and contained only an empty vector instead of Psyn1-ppcEc or Psyn1-ppcMs (Table 12).









TABLE 12







Microbial strains used in Example 5










Relevant host




genome


Strains
modifications
Genes overexpressed





16
ΔyneI ΔgabD
Psyn1-phaC1-PuspA-sucD*-ssaRAt*; PrpsU-orfZ


17
ΔyneI ΔgabD
Psyn1-phaC1-PuspA-sucD*-ssaRAt*; PrpsU-orfZ;




Psyn1-ppcEc


18
ΔyneI ΔgabD
Psyn1-phaC1-PuspA-sucD*-ssaRAt*; PrpsU-orfZ;




Psyn1-ppcMs*









The strains were grown in a 44 hour shake plate assay. The production medium consisted of 1×E2 minimal salts solution containing 25 g/L glucose and 1× Trace Salts Solution. Both E2 medium and trace elements are described in Example 2. At the end of the growth phase, the biomass and P4HB titers were determined as described in Example 1.


The results in Table 13 show that both strains 17 and 18, which express either wild-type E. coli PEP carboxylase or a less-regulated homologue thereof, produced significantly higher amounts of P4HB than control strain 16.









TABLE 13







Biomass and P4HB titer for microbial strains 16, 17 and 18.









Strains
Biomass Titer (g/L)
P4HB Titer (% dcw)





16
2.31 ± 0.01
14.93 ± 0.83


17
2.85 ± 0.29
25.57 ± 1.59


18
3.02 ± 0.13
24.31 ± 0.65









Example 6
Improved P4HB Production by Deleting Malic Enzymes


E. coli possesses two isoforms of malic enzyme which require either NAD+ (maeA) or NADP+ (maeB) as reducing cofactor (Bologna et al., J. Bacteriol. 189(16):5937-5946 (2007) for the reversible conversion of malate to pyruvate (FIG. 1, Reaction number 4). Deletion of both maeA and maeB has been shown to enhance the production of L-lysine and L-threonine in E. coli, presumably by preventing the loss of carbon from the TCA cycle (van Dien et al., WO Patent No. 2005/010175). To determine if deleting both malic enzymes would also lead to improved P4HB titers, the following two strains were constructed using the well known biotechnology tools and methods described above. Both of these strains contained chromosomal deletions of yneI and gabD and overexpressed a PHA synthase, a succinyl-CoA dehydrogenase, an SSA reductase and a CoA-transferase. Strain 19 retained its native unmodified copies of maeA and maeB on the chromosome, while strain 20 has both of these genes removed (Table 14).









TABLE 14







Microbial strains used in Example 6










Relevant host




genome


Strains
modifications
Genes overexpressed





19
ΔyneI ΔgabD
Psyn1-phaC1-PuspA-sucD*-ssaRAt*; PrpsU-orfZ


20
ΔyneI ΔgabD
Psyn1-phaC1-PuspA-sucD*-ssaRAt*; PrpsU-orfZ



ΔmaeA ΔmaeB









The strains were grown in a 48 hour shake plate assay. The production medium consisted of 1×E2 minimal salts solution containing 30 g/L glucose and 1× Trace Salts Solution. Both E2 medium and trace elements are described in Example 2. At the end of the growth phase, the biomass and P4HB titers were determined as described in Example 1.


The results in Table 15 show that strain 20 which lacks maeA and maeB produced more P4HB than strain 19 which retained these two genes.









TABLE 15







Biomass and P4HB titer for microbial strains 19 and 20









Strain
Biomass Titer (g/L)
P4HB Titer (% dcw)





19
10.26 ± 0.44
25.6 ± 4.8


20
12.50 ± 1.15
40.0 ± 4.6









Example 7
Improved P4HB Production by Overexpressing the Glyoxylate Bypass
Effect of Removing the Glyoxylate Bypass Genes

Noronha et al. (Biotechnology and Bioengineering 68(3): 316-327 (2000)) concluded that the glyoxylate shunt is inactive in a fadR-positive (and iclR-positive) E. coli strain using 13C-NMR/MS. However, mutants of E. coli that are fadR-negative were described by Maloy et al. (J. Bacteriol. 143:720-725 (1980)) to have elevated levels of the glyoxylate shunt enzymes, isocitrate lyase and malate synthase. Since the LS5218 host strain parent used in these examples contains an unknown mutation in the fadR gene, called fadR601 (E. coli Genetic Resources at Yale, The Coli Genetic Stock Center, CGSC#: 6966; found at the world wide web: //cgsc.biology.yale.edu/index.php), it was of interest to investigate if carbon was channeled through the glyoxylate shunt (FIG. 1, Reaction numbers 5 and 6) and/or the oxidative branch of the TCA cycle via alpha-ketoglutarate towards succinyl-CoA. Two strains were thus constructed, both of which contained chromosomal deletions of yneI, gabD, pykF, pykA, maeA, maeB and overexpressed a PHA synthase, a succinyl-CoA dehydrogenase, an SSA reductase, a CoA-transferase and a PEP carboxylase (strain 21). Strain 22 contained additional deletions of the aceA and aceB genes encoding isocitrate lyase and malate synthase, respectively (Table 16).









TABLE 16







Microbial strains used in this section of Example 7










Relevant host



Strains
genome modifications
Genes overexpressed





21
fadR601, ΔgabD, ΔyneI,
PrpsU-orfZ, Psyn1-ppcEc, Psyn1-



ΔpykF, ΔpykA, ΔmaeA, ΔmaeB
phaC1-PuspA-sucD*-ssaRAt*


22
fadR601, ΔgabD, ΔyneI, ΔpykF,
PrpsU-orfZ, Psyn1-ppcEC, Psyn1-



ΔpykA, ΔmaeA, ΔmaeB,
phaC1-PuspA-sucD*-ssaRAt*



ΔaceB, ΔaceA









The strains were grown in a 24 hour shake plate assay. The production medium consisted of 1×E2 minimal salts solution containing 15 g/L glucose, 1×Trace Salts Solution. Both E2 medium and trace elements are described in Example 2. At the end of the growth phase, the biomass and P4HB titers were determined as described in Example 1.


The results in Table 17 show that strain 22 containing an inactive glyoxylate shunt had highly reduced P4HB titers as compared to its parental strain 21.









TABLE 17







Biomass and P4HB titer for microbial strains 21 and 22









Strains
Biomass Titer (g/L)
P4HB Titer (% dcw)





21
3.5 ± 0.3
20.2 ± 7.0


22
3.0 ± 0.1
 7.9 ± 0.3









Effect of Overexpressing the Glyoxylate Bypass Genes

Two strains were constructed both of which contained chromosomal deletions of yneI, gabD, pykF, pykA and overexpressed a PHA synthase, a succinyl-CoA dehydrogenase, an SSA reductase, a CoA-synthetase and a PEP carboxylase (strain 23). Strain 24 overexpressed in addition the aceBA genes from the IPTG-inducible Ptrc promoter while strain 23 contained an empty vector (Table 18).









TABLE 18







Microbial strains used in this section of Example 7










Relevant host genome



Strains
modifications
Genes overexpressed





23
fadR601, ΔgabD, ΔyneI,
PrpsU-orfZ, Psyn1-ppcEc, Psyn1-



ΔpykF, ΔpykA
phaC1-PuspA-sucD*-ssaRAt*


24
fadR601, ΔgabD, ΔyneI,
PrpsU-orfZ, Psyn1-ppcEc, Psyn1-



ΔpykF, ΔpykA
phaC1-PuspA-sucD*-ssaRAt*,




Ptrc-aceBA









The strains were grown in a 24 hour shake plate assay. The production medium consisted of 1×E2 minimal salts solution containing 15 g/L glucose, 1× Trace Salts Solution and 100 μM IPTG. Both E2 medium and trace elements are described in Example 2. At the end of the growth phase, the biomass and P4HB titers were determined as described in Example 1.


The results in Table 19 show that strain 24 overexpressing the two glyoxylate shunt pathway enzymes produced higher P4HB titers than its parent strain 23 that did not express the aceBA genes from the Ptrc promoter.









TABLE 19







Biomass and P4HB titer for microbial strains 23 and 24









Strains
Biomass Titer (g/L)
P4HB Titer (% dcw)





23
3.12 ± 0.03
21.0 ± 1.2


24
3.27 ± 0.09
27.0 ± 1.0









Example 8
Improved P4HB Production by Overexpressing Glyceraldehydes-3-Phosphate Dehydrogenase

Martinez et al., (Metab. Eng. 10:352-359 (2009)) genetically engineered an Escherichia coli strain to increase NADPH availability to improve the productivity of lycopene and s-caprolactone that require NADPH in its biosynthesis. Their approach involved an alteration of the glycolysis step where glyceraldehyde-3-phosphate is oxidized to 1,3 bisphosphoglycerate. This reaction is catalyzed by NAD-dependent endogenous glyceraldehyde-3-phosphate dehydrogenase (GAPDH) encoded by the gapA gene (FIG. 1, Reaction number 1). They constructed a recombinant E. coli strain by replacing the native NAD-dependent gapA gene with a NADP-dependent GAPDH from Clostridium acetobutylicum and demonstrated significant higher lycopene and ε-caprolactone productivity than the parent strains.


To determine whether the overexpression of an NADPH-generating GAPDH would lead to improved P4HB titer, the following six strains were constructed using the well known biotechnology tools and methods described earlier. All strains contained chromosomal deletions of yneI and gabD and overexpressed a PHA synthase, a succinyl-CoA dehydrogenase, an SSA reductase, a CoA-transferase. Strain 25 contained an empty vector and served as a negative control where no other recombinant gene was expressed. Strains 26 to 29 overexpressed a gene from an IPTG-inducible promoter that encodes an NADPH-generating GAPDH from various organisms, i.e. gdp1 from Kluyveromyces lactis, gap2 from Synechocystis sp. PCC6803, gapB from Bacillus subtilis, and gapN from Streptococcus pyogenes, respectively. As another control, strain 30 overexpressed the E. coli gapA gene that encodes the NADH-generating GAPDH (Table 20).









TABLE 20







Microbial strains used in Example 8










Relevant host




genome


Strains
modifications
Genes overexpressed





25
ΔgabD, ΔyneI
PrpsU-orfZ, Psyn1-phaC1-PuspA-sucD*-ssaRAt*


26
ΔgabD, ΔyneI
PrpsU-orfZ, Psyn1-phaC1-PuspA-sucD*-ssaRAt*




Ptrc-gdp1


27
ΔgabD, ΔyneI
PrpsU-orfZ, Psyn1-phaC1-PuspA-sucD*-ssaRAt*




Ptrc-gap2


28
ΔgabD, ΔyneI
PrpsU-orfZ, Psyn1-phaC1-PuspA-sucD*-ssaRAt*




Ptrc-gapB


29
ΔgabD, ΔyneI
PrpsU-orfZ, Psyn1-phaC1-PuspA-sucD*-ssaRAt*




Ptrc-gapN


30
ΔgabD, ΔyneI
PrpsU-orfZ, Psyn1-phaC1-PuspA-sucD*-ssaRAt*




Ptrc-gapA









The strains were grown in a 24 hour shake plate assay. The production medium consisted of 1×E2 minimal salts solution containing 10 g/L glucose and 1×Trace Salts Solution and 100 μM IPTG. Both E2 medium and trace elements are described in Example 2. At the end of the growth phase, the biomass and P4HB titers were determined as described in Example 1.


The results in Table 21 show that strains 26, 27, and 29 produced higher amounts of P4HB than control strain 25. Interestingly, strain 28 produced much less P4HB than strain 25. Surprisingly, overexpression of the endogenous gapA gene encoding the NADH-generating GAPDH in strain 30 outperformed all other strains.









TABLE 21







Biomass and P4HB titer for microbial strains 25-30









Strains
Biomass Titer (g/L)
P4HB Titer (% dcw)





25
2.52 ± 0.03
14.0 ± 0.3


26
2.84 ± 0.01
25.0 ± 1.0


27
2.50 ± 0.10
21.5 ± 0.9


28
2.20 ± 0.10
 2.3 ± 0.1


29
2.48 ± 0.01
21.0 ± 1.0


30
3.03 ± 0.08
32.5 ± 0.6

















Gene ID 001 Nucleotide Sequence: Medicago sativa phosphoenolpyruvate



carboxylase ppc*


(SEQ ID NO. 1)



ATGGCAAACAAAATGGAAAAGATGGCAAGCATTGACGCGCAACTGCGCCAGTTGGTCCCGGCAA



AAGTCAGCGAGGACGACAAATTGATTGAATACGATGCTCTGTTGCTGGACCGCTTTCTGGACAT


TCTGCAAGATCTGCATGGCGAGGATCTGAAGGATTCGGTTCAGGAAGTTTACGAACTGTCTGCG


GAGTATGAGCGTAAGCATGACCCGAAGAAGCTGGAAGAGCTGGGTAACTTGATTACGAGCTTTG


ACGCGGGCGACAGCATTGTCGTGGCGAAATCGTTCTCTCATATGCTGAATCTGGCGAACCTGGC


CGAAGAAGTTCAAATTGCTCACCGCCGTCGTAACAAGCTGAAGAAGGGTGATTTTCGTGATGAG


AGCAATGCGACCACCGAGTCCGATATTGAGGAGACTCTGAAGAAACTGGTTTTCGACATGAAGA


AGTCTCCGCAAGAAGTGTTTGACGCGTTGAAGAATCAGACCGTGGACCTGGTGCTGACGGCACA


TCCTACCCAGAGCGTTCGCCGTTCCCTGCTGCAAAAGCATGGTCGTGTTCGTAATTGCTTGAGC


CAGCTGTATGCGAAAGACATTACCCCGGATGACAAACAAGAGCTGGACGAGGCACTGCAGCGTG


AAATCCAGGCAGCGTTCCGTACCGATGAAATCAAACGTACCCCGCCGACCCCACAAGACGAAAT


GCGTGCTGGCATGAGCTATTTCCACGAAACCATCTGGAAGGGCGTCCCGAAGTTCCTGCGTCGC


GTGGACACCGCGTTGAAGAACATCGGCATTAACGAACGCGTGCCGTATAACGCCCCGCTGATTC


AATTCAGCAGCTGGATGGGTGGCGACCGTGACGGCAATCCGCGTGTTACGCCAGAAGTGACCCG


TGATGTTTGTCTGCTGGCGCGTATGATGGCGGCGAATTTGTACTATAGCCAGATTGAAGATCTG


ATGTTTGAGCTGTCTATGTGGCGCTGTAATGATGAGTTGCGTGTGCGTGCCGAAGAACTGCACC


GCAATAGCAAGAAAGACGAAGTTGCCAAGCACTACATCGAGTTCTGGAAGAAGATCCCGTTGAA


CGAGCCGTACCGTGTTGTTCTGGGTGAGGTCCGCGATAAGCTGTATCGCACCCGTGAGCGCAGC


CGTTATCTGCTGGCACACGGTTATTGCGAAATTCCGGAGGAGGCGACCTTTACCAACGTGGATG


AATTTCTGGAACCGCTGGAGCTGTGTTATCGTAGCCTGTGCGCGTGCGGTGACCGCGCGATTGC


GGACGGTTCTTTGCTGGATTTCCTGCGCCAGGTGAGCACGTTTGGTCTGAGCCTGGTCCGTCTG


GATATCCGTCAGGAATCGGACCGCCATACGGATGTGATGGACGCTATTACCAAACACCTGGAAA


TTGGCAGCTACCAGGAGTGGAGCGAGGAGAAACGTCAAGAGTGGCTGCTGAGCGAGCTGATCGG


TAAGCGTCCGCTGTTCGGTCCAGATCTGCCGCAAACCGACGAAATCCGCGACGTTCTGGACACC


TTTCGTGTGATTGCCGAACTGCCGAGCGACAACTTCGGCGCGTACATTATCTCCATGGCCACCG


CCCCGAGCGATGTCCTGGCAGTCGAGCTGCTGCAACGCGAATGTAAGGTCCGTAACCCGTTGCG


CGTGGTTCCGCTGTTTGAAAAGCTGGATGACCTGGAGAGCGCACCGGCCGCACTGGCTCGTCTG


TTTAGCATTGACTGGTACATTAACCGTATTGATGGTAAACAGGAAGTGATGATTGGTTACTCCG


ACAGCGGTAAAGATGCGGGTCGTTTTAGCGCCGCATGGCAGCTGTACAAGGCACAAGAAGATCT


GATCAAGGTTGCACAGAAGTTCGGCGTTAAACTGACCATGTTCCACGGTCGCGGTGGTACGGTT


GGCCGTGGTGGCGGCCCAACCCACCTGGCGATTCTGAGCCAACCGCCGGAGACTATCCATGGTT


CCTTGCGTGTCACCGTCCAGGGCGAAGTGATTGAGCAAAGCTTCGGCGAGGAACATCTGTGCTT


TCGCACCCTGCAGCGTTTTACGGCCGCGACTTTGGAACACGGCATGCGTCCGCCATCCAGCCCA


AAGCCAGAATGGCGTGCGCTGATGGACCAAATGGCGGTTATCGCGACCGAGGAGTATCGCAGCA


TTGTGTTCAAAGAGCCGCGTTTTGTGGAGTATTTCCGTTTGGCAACGCCGGAGATGGAGTACGG


CCGCATGAATATCGGCAGCCGTCCGGCAAAACGTCGCCCGTCCGGCGGCATCGAGACGCTGCGT


GCCATCCCGTGGATTTTCGCGTGGACGCAGACCCGTTTCCATTTGCCGGTGTGGCTGGGTTTCG


GTGCCGCCTTTCGTCAAGTCGTGCAGAAGGACGTGAAGAATCTGCATATGCTGCAGGAGATGTA


CAACCAGTGGCCGTTCTTTCGTGTCACCATTGATCTGGTGGAAATGGTCTTTGCGAAAGGTGAT


CCGGGCATCGCGGCGTTGAATGACCGTCTGCTGGTTTCCAAAGACCTGTGGCCTTTTGGTGAAC


AGCTGCGTAGCAAGTACGAGGAAACCAAGAAACTGCTGTTGCAAGTTGCGGCGCACAAGGAGGT


GCTGGAAGGTGACCCTTATCTGAAGCAACGCCTGCGTCTGCGTGACTCGTACATCACGACCCTG


AATGTCTTTCAGGCGTATACCCTGAAGCGTATCCGTGACCCGAATTACAAAGTGGAAGTTCGCC


CTCCGATCAGCAAGGAGAGCGCGGAGACTAGCAAACCAGCGGACGAACTGGTCACCCTGAATCC


GACCTCGGAGTATGCTCCGGGTTTGGAAGATACGCTGATTCTGACGATGAAGGGTATCGCGGCT


GGCATGCAGAACACGGGCTAA





Gene ID 001 Protein Sequence: Medicago sativa phosphoenolpyruvate


carboxylase ppc*


(SEQ ID NO. 2)



MANKMEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLKDSVQEVYELSA



EYERKHDPKKLEELGNLITSFDAGDSIVVAKSFSHMLNLANLAEEVQIAHRRRNKLKKGDFRDE


SNATTESDIEETLKKLVFDMKKSPQEVFDALKNQTVDLVLTAHPTQSVRRSLLQKHGRVRNCLS


QLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAGMSYFHETIWKGVPKFLRR


VDTALKNIGINERVPYNAPLIQFSSWMGGDRDGNPRVTPEVTRDVCLLARMMAANLYYSQIEDL


MFELSMWRCNDELRVRAEELHRNSKKDEVAKHYIEFWKKIPLNEPYRVVLGEVRDKLYRTRERS


RYLLAHGYCEIPEEATFTNVDEFLEPLELCYRSLCACGDRAIADGSLLDFLRQVSTFGLSLVRL


DIRQESDRHTDVMDAITKHLEIGSYQEWSEEKRQEWLLSELIGKRPLFGPDLPQTDEIRDVLDT


FRVIAELPSDNFGAYIISMATAPSDVLAVELLQRECKVRNPLRVVPLFEKLDDLESAPAALARL


FSIDWYINRIDGKQEVMIGYSDSGKDAGRFSAAWQLYKAQEDLIKVAQKFGVKLTMFHGRGGTV


GRGGGPTHLAILSQPPETIHGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPSSP


KPEWRALMDQMAVIATEEYRSIVFKEPRFVEYFRLATPEMEYGRMNIGSRPAKRRPSGGIETLR


AIPWIFAWTQTRFHLPVWLGFGAAFRQVVQKDVKNLHMLQEMYNQWPFFRVTIDLVEMVFAKGD


PGIAALNDRLLVSKDLWPFGEQLRSKYEETKKLLLQVAAHKEVLEGDPYLKQRLRLRDSYITTL


NVFQAYTLKRIRDPNYKVEVRPPISKESAETSKPADELVTLNPTSEYAPGLEDTLILTMKGIAA


GMQNTG





Gene ID 002 Nucleotide Sequence: Clostridium kluyveri succinate


semialdehyde dehydrogenase sucD*


(SEQ ID NO. 3)



ATGTCCAACGAGGTTAGCATTAAGGAGCTGATTGAGAAGGCGAAAGTGGCGCAGAAAAAGCTGG



AAGCGTATAGCCAAGAGCAAGTTGACGTTCTGGTCAAGGCGCTGGGTAAAGTTGTGTACGACAA


CGCCGAGATGTTCGCGAAAGAGGCGGTGGAGGAAACCGAGATGGGTGTTTACGAGGATAAAGTG


GCTAAATGTCATCTGAAATCTGGTGCAATCTGGAATCACATTAAAGATAAGAAAACCGTTGGTA


TTATCAAGGAAGAACCGGAGCGTGCGCTGGTGTACGTCGCGAAGCCTAAAGGTGTTGTGGCGGC


GACGACCCCTATCACCAATCCTGTGGTTACCCCGATGTGTAACGCGATGGCAGCAATTAAAGGT


CGCAACACCATCATTGTCGCCCCGCATCCGAAGGCGAAGAAGGTGAGCGCGCACACCGTGGAGC


TGATGAATGCAGAACTGAAAAAGTTGGGTGCGCCGGAAAACATTATCCAGATCGTTGAAGCCCC


AAGCCGTGAAGCAGCCAAGGAGTTGATGGAGAGCGCAGACGTGGTTATCGCCACGGGTGGCGCA


GGCCGTGTTAAAGCAGCGTACTCCTCCGGCCGTCCGGCATACGGTGTCGGTCCGGGCAATTCTC


AGGTCATTGTCGATAAGGGTTACGATTATAACAAAGCTGCCCAGGACATCATTACCGGCCGCAA


GTATGACAACGGTATCATTTGCAGCTCTGAGCAGAGCGTGATCGCACCGGCGGAGGACTACGAC


AAGGTCATCGCGGCTTTCGTCGAGAATGGCGCGTTCTATGTCGAGGATGAGGAAACTGTGGAGA


AATTCCGTAGCACGCTGTTCAAGGATGGCAAGATCAATAGCAAAATCATCGGTAAATCCGTGCA


GATCATCGCTGACCTGGCTGGTGTCAAGGTGCCGGAAGGCACCAAGGTGATCGTGTTGAAGGGC


AAGGGTGCCGGTGAAAAGGACGTTCTGTGCAAGGAGAAAATGTGCCCGGTCCTGGTTGCCCTGA


AATATGACACCTTTGAGGAGGCGGTCGAGATCGCGATGGCCAACTATATGTACGAGGGTGCGGG


CCATACCGCCGGTATCCACAGCGATAACGACGAGAATATCCGCTACGCGGGTACGGTGCTGCCA


ATCAGCCGTCTGGTTGTCAACCAGCCAGCAACTACGGCCGGTGGTAGCTTTAACAATGGTTTTA


ATCCGACCACCACCTTGGGCTGCGGTAGCTGGGGCCGTAACTCCATTAGCGAGAACCTGACGTA


TGAGCATCTGATTAATGTCAGCCGTATTGGCTATTTCAATAAGGAGGCAAAAGTTCCTAGCTAC


GAGGAGATCTGGGGTTAA





Gene ID 002 Protein Sequence: Clostridium kluyveri succinate


semialdehyde dehydrogenase sucD*


(SEQ ID NO. 4)



MSNEVSIKELIEKAKVAQKKLEAYSQEQVDVLVKALGKVVYDNAEMFAKEAVEETEMGVYEDKV



AKCHLKSGAIWNHIKDKKTVGIIKEEPERALVYVAKPKGVVAATTPITNPVVTPMCNAMAAIKG


RNTIIVAPHPKAKKVSAHTVELMNAELKKLGAPENIIQIVEAPSREAAKELMESADVVIATGGA


GRVKAAYSSGRPAYGVGPGNSQVIVDKGYDYNKAAQDIITGRKYDNGIICSSEQSVIAPAEDYD


KVIAAFVENGAFYVEDEETVEKERSTLFKDGKINSKIIGKSVQIIADLAGVKVPEGTKVIVLKG


KGAGEKDVLCKEKMCPVLVALKYDTFEEAVEIAMANYMYEGAGHTAGIHSDNDENIRYAGTVLP


ISRLVVNQPATTAGGSFNNGFNPTTTLGCGSWGRNSISENLTYEHLINVSRIGYFNKEAKVPSY


EEIWG(SEQ ID NO. 4)





Gene ID 003 Nucleotide Sequence: Arabidopsis thaliana succinic


semialdehyde reductase ssaRAt*


(SEQ ID NO. 5)



ATGGAAGTAGGTTTTCTGGGTCTGGGCATTATGGGTAAAGCTATGTCCATGAACCTGCTGAAAA



ACGGTTTCAAAGTTACCGTGTGGAACCGCACTCTGTCTAAATGTGATGAACTGGTTGAACACGG


TGCAAGCGTGTGCGAGTCTCCGGCTGAGGTGATCAAGAAATGCAAATACACGATCGCGATGCTG


AGCGATCCGTGTGCAGCTCTGTCTGTTGTTTTCGATAAAGGCGGTGTTCTGGAACAGATCTGCG


AGGGTAAGGGCTACATCGACATGTCTACCGTCGACGCGGAAACTAGCCTGAAAATTAACGAAGC


GATCACGGGCAAAGGTGGCCGTTTTGTAGAAGGTCCTGTTAGCGGTTCCAAAAAGCCGGCAGAA


GACGGCCAGCTGATCATCCTGGCAGCAGGCGACAAAGCACTGTTCGAGGAATCCATCCCGGCCT


TTGATGTACTGGGCAAACGTTCCTTTTATCTGGGTCAGGTGGGTAACGGTGCGAAAATGAAACT


GATTGTTAACATGATCATGGGTTCTATGATGAACGCGTTTAGCGAAGGTCTGGTACTGGCAGAT


AAAAGCGGTCTGTCTAGCGACACGCTGCTGGATATTCTGGATCTGGGTGCTATGACGAATCCGA


TGTTCAAAGGCAAAGGTCCGTCCATGACTAAATCCAGCTACCCACCGGCTTTCCCGCTGAAACA


CCAGCAGAAAGACATGCGTCTGGCTCTGGCTCTGGGCGACGAAAACGCTGTTAGCATGCCGGTC


GCTGCGGCTGCGAACGAAGCCTTCAAGAAAGCCCGTAGCCTGGGCCTGGGCGATCTGGACTTTT


CTGCTGTTATCGAAGCGGTAAAATTCTCTCGTGAATAA





Gene ID 003 Protein Sequence: Arabidopsis thaliana succinic


semialdehyde reductase ssaRAt*


(SEQ ID NO. 6)



MEVGFLGLGIMGKAMSMNLLKNGFKVTVWNRTLSKCDELVEHGASVCESPAEVIKKCKYTIAML



SDPCAALSVVFDKGGVLEQICEGKGYIDMSTVDAETSLKINEAITGKGGRFVEGPVSGSKKPAE


DGQLIILAAGDKALFEESIPAFDVLGKRSFYLGQVGNGAKMKLIVNMIMGSMMNAFSEGLVLAD


KSGLSSDTLLDILDLGAMTNPMFKGKGPSMIKSSYPPAFPLKHQQKDMRLALALGDENAVSMPV


AAAANEAFKKARSLGLGDLDFSAVIEAVKFSRE





Gene ID 004 Nucleotide Sequence: Aspergillus terreus succinic


semialdehyde reductase ssaRAt2*


(SEQ ID NO. 7)



ATGCCACTGGTTGCTCAAAATCCACTGCCACGTGCTATTCTGGGTCTGATGACTTTCGGTCCGA



GCGAAAGCAAAGGTGCGCGTATCACTTCCCTGGATGAGTTTAACAAGTGCCTGGATTACTTCCA


GCAGCAGGGCTTCCAGGAAATCGATACCGCGCGCATCTACGTCGGCGGTGAACAGGAGGCATTC


ACGGCGCAGGCAAAGTGGAAAGAACGCGGCCTGACGCTGGCGACTAAGTGGTATCCGCAGTACC


CGGGTGCGCACAAACCGGATGTCCTGCGTCAGAACCTGGAGCTGTCCCTGAAAGAACTGGGCAC


GAACCAGGTCGATATCTTCTATCTGCACGCCGCGGATCGTTCTGTGCCGTTCGCGGAAACTCTG


GAAACTGTTAACGAACTGCACAAAGAAGGCAAATTTGTTCAGCTGGGTCTGTCTAACTACACCG


CTTTCGAAGTAGCTGAAATCGTGACCCTGTGTAACGAGCGTGGTTGGGTTCGTCCGACTATCTA


CCAGGCGATGTATAACGCTATCACCCGTAACATCGAAACTGAACTGATCCCGGCGTGCAAGCGT


TACGGTATTGACATTGTTATCTACAACCCACTGGCGGGTGGCCTGTTCAGCGGCAAATACAAAG


CACAGGACATCCCGGCTGAAGGTCGTTACAGCGACCAATCTTCCATGGGCCAGATGTACCGCAA


CCGTTACTTTAAGGACGCAACCTTTGACGCTCTGCGCCTGATCGAACCGGTTGTTGCGAAGCAC


GGCCTGACGATGCCGGAAACCGCGTTCCGCTGGGTCCACCACCACTCCGCACTGAACATGGAAG


ATGGCGGCCGTGACGGCATCATTCTGGGTGTAAGCAGCCTGGCTCAGCTGGAAAACAACCTGAA


AGACATTCAGAAAGGTCCGCTGCCGCAGGAGGTTGTAGACGTCCTGGATCAGGCTTGGCTGGTG


GCTAAGCCGACGGCTCCAAACTACTGGCATCTGGACCTGAAATACACGTACGACACCCAGGAAG


CTCTGTTCAAACCGAAATCTAAGGCGTAA





Gene ID 004 Protein Sequence: Aspergillus terreus succinic


semialdehyde reductase ssaRAt2*


(SEQ ID NO. 8)



MPLVAQNPLPRAILGLMTFGPSESKGARITSLDEFNKCLDYFQQQGFQEIDTARIYVGGEQEAF



TAQAKWKERGLTLATKWYPQYPGAHKPDVLRQNLELSLKELGTNQVDIFYLHAADRSVPFAETL


ETVNELHKEGKFVQLGLSNYTAFEVAEIVTLCNERGWVRPTIYQAMYNAITRNIETELIPACKR


YGIDIVIYNPLAGGLFSGKYKAQDIPAEGRYSDQSSMGQMYRNRYFKDATFDALRLIEPVVAKH


GLTMPETAFRWVHHHSALNMEDGGRDGIILGVSSLAQLENNLKDIQKGPLPQEVVDVLDQAWLV


AKPTAPNYWHLDLKYTYDTQEALFKPKSKAAVKFSRE





Gene ID 005 Nucleotide Sequence: Mus musculus succinic semialdehyde


reductase ssaRMm*


(SEQ ID NO. 9)



ATGCTGCGTGCTGCTTCTCGTGCTGTTGGTCGTGCTGCTGTACGTTCCGCTCAACGTTCTGGTA



CTAGCGTTGGCCGTCCGCTGGCGATGTCCCGTCCACCGCCGCCTCGCGCAGCTAGCGGTGCCCC


GCTGCGTCCGGCAACCGTACTGGGCACTATGGAGATGGGTCGTCGCATGGACGCTTCTGCATCC


GCGGCAAGCGTTCGTGCGTTCCTGGAACGTGGCCATAGCGAACTGGATACCGCTTTCATGTATT


GCGACGGTCAGTCCGAAAATATCCTGGGTGGCCTGGGCCTGGGTCTGGGCTCCGGTGATTGTAC


CGTTAAAATTGCGACCAAGGCGAACCCTTGGGAGGGCAAGAGCCTGAAGCCGGATTCTGTGCGT


TCTCAGCTGGAGACTTCTCTGAAACGTCTGCAGTGTCCGCGCGTAGACCTGTTCTATCTGCATG


CGCCGGACCACAGCACTCCGGTAGAGGAAACTCTGCGTGCGTGTCATCAGCTGCACCAGGAAGG


CAAGTTCGTCGAACTGGGTCTGTCTAACTACGCATCTTGGGAAGTGGCAGAAATCTGTACGCTG


TGTAAGTCTAATGGTTGGATCCTGCCAACCGTGTACCAGGGCATGTACAACGCTACCACCCGCC


AGGTAGAAGCAGAACTGCTGCCGTGCCTGCGTCACTTCGGCCTGCGCTTTTACGCTTACAACCC


GCTGGCGGGTGGTCTGCTGACGGGCAAATACAAGTATGAAGATAAAGATGGTAAACAACCGGTC


GGTCGTTTCTTTGGTAACAACTGGGCCGAAACCTACCGTAATCGCTTCTGGAAAGAGCACCACT


TTGAAGCGATCGCACTGGTTGAAAAAGCGCTGCAGACGACTTATGGCACTAACGCGCCGCGTAT


GACCTCCGCTGCGCTGCGTTGGATGTACCACCATAGCCAGCTGCAGGGTACTCGCGGCGATGCC


GTTATCCTGGGCATGAGCTCCCTGGAACAGCTGGAACAGAACCTGGCCGCGACTGAAGAGGGCC


CGCTGGAACCGGCAGTTGTCGAAGCTTTTGACCAGGCATGGAACATGGTGGCGCACGAATGTCC


AAACTATTTCCGCTAA





Gene ID 005 Protein Sequence: Mus musculus succinic semialdehyde


reductase ssaRMm*


(SEQ ID NO. 10)



MLRAASRAVGRAAVRSAQRSGTSVGRPLAMSRPPPPRAASGAPLRPATVLGTMEMGRRMDASAS



AASVRAFLERGHSELDTAFMYCDGQSENILGGLGLGLGSGDCTVKIATKANPWEGKSLKPDSVR


SQLETSLKRLQCPRVDLFYLHAPDHSTPVEETLRACHQLHQEGKFVELGLSNYASWEVAEICTL


CKSNGWILPTVYQGMYNATTRQVEAELLPCLRHFGLRFYAYNPLAGGLLTGKYKYEDKDGKQPV


GRFFGNNWAETYRNRFWKEHHFEAIALVEKALQTTYGTNAPRMTSAALRWMYHHSQLQGTRGDA


VILGMSSLEQLEQNLAATEEGPLEPAVVEAFDQAWNMVAHECPNYFR





Gene ID 006 Nucleotide Sequence: Pseudomonas putida/Ralstonia



eutropha JMP134 Polyhydroxyalkanoate synthase fusion protein



phaC3/C1


(SEQ ID NO: 11)



ATGACTAGAAGGAGGTTTCATATGAGTAACAAGAACAACGATGAGCTGGCGACGGGTAAAGGTG



CTGCTGCATCTTCTACTGAAGGTAAATCTCAGCCGTTTAAATTCCCACCGGGTCCGCTGGACCC


GGCCACTTGGCTGGAATGGAGCCGTCAGTGGCAAGGTCCGGAGGGCAATGGCGGTACCGTGCCG


GGTGGCTTTCCGGGTTTCGAAGCGTTCGCGGCGTCCCCGCTGGCGGGCGTGAAAATCGACCCGG


CTCAGCTGGCAGAGATCCAGCAGCGTTATATGCGTGATTTCACCGAGCTGTGGCGTGGTCTGGC


AGGCGGTGACACCGAGAGCGCTGGCAAACTGCATGACCGTCGCTTCGCGTCCGAAGCGTGGCAC


AAAAACGCGCCGTATCGCTATACTGCGGCATTTTACCTGCTGAACGCACGTGCACTGACGGAAC


TGGCTGATGCAGTAGAAGCGGATCCGAAAACCCGTCAGCGTATCCGTTTTGCGGTTTCCCAGTG


GGTAGATGCTATGAGCCCGGCTAACTTCCTGGCCACCAACCCGGACGCTCAGAACCGTCTGATC


GAGAGCCGTGGTGAAAGCCTGCGTGCCGGCATGCGCAATATGCTGGAAGATCTGACCCGCGGTA


AAATTTCCCAAACCGATGAGACTGCCTTCGAAGTAGGCCGTAACATGGCAGTTACCGAAGGTGC


TGTGGTATTCGAAAACGAGTTCTTCCAGCTGCTGCAGTACAAACCTCTGACTGACAAAGTATAC


ACCCGTCCGCTGCTGCTGGTACCGCCGTGCATTAACAAGTTCTATATTCTGGACCTGCAGCCGG


AAGGTTCTCTGGTCCGTTACGCAGTCGAACAGGGTCACACTGTATTCCTGGTGAGCTGGCGCAA


TCCAGACGCTAGCATGGCTGGCTGTACCTGGGATGACTATATTGAAAACGCGGCTATCCGCGCC


ATCGAGGTTGTGCGTGATATCAGCGGTCAGGACAAGATCAACACCCTGGGCTTTTGTGTTGGTG


GCACGATCATCTCCACTGCCCTGGCGGTCCTGGCCGCCCGTGGTGAGCACCCGGTGGCCTCTCT


GACCCTGCTGACTACCCTGCTGGACTTCACCGATACTGGTATCCTGGATGTTTTCGTGGACGAG


CCACACGTTCAGCTGCGTGAGGCGACTCTGGGCGGCGCCAGCGGCGGTCTGCTGCGTGGTGTCG


AGCTGGCCAATACCTTTTCCTTCCTGCGCCCGAACGACCTGGTTTGGAACTACGTTGTTGACAA


CTATCTGAAAGGCAACACCCCGGTACCTTTCGATCTGCTGTTCTGGAACGGTGATGCAACCAAC


CTGCCTGGTCCATGGTACTGTTGGTACCTGCGTCATACTTACCTGCAGAACGAACTGAAAGAGC


CGGGCAAACTGACCGTGTGTAACGAACCTGTGGACCTGGGCGCGATTAACGTTCCTACTTACAT


CTACGGTTCCCGTGAAGATCACATCGTACCGTGGACCGCGGCTTACGCCAGCACCGCGCTGCTG


AAGAACGATCTGCGTTTCGTACTGGGCGCATCCGGCCATATCGCAGGTGTGATCAACCCTCCTG


CAAAGAAAAAGCGTTCTCATTGGACCAACGACGCGCTGCCAGAATCCGCGCAGGATTGGCTGGC


AGGTGCTGAGGAACACCATGGTTCCTGGTGGCCGGATTGGATGACCTGGCTGGGTAAACAAGCC


GGTGCAAAACGTGCAGCTCCAACTGAATATGGTAGCAAGCGTTATGCTGCAATCGAGCCAGCGC


CAGGCCGTTACGTTAAAGCGAAAGCATAA





Gene ID 006 Protein Sequence: Pseudomonas putida/Ralstonia



eutropha JMP134 Polyhydroxyalkanoate synthase fusion protein



phaC3/C1


(SEQ ID NO. 12)



MSNKNNDELATGKGAAASSTEGKSQPFKFPPGPLDPATWLEWSRQWQGPEGNGGTVPGGFPGFE



AFAASPLAGVKIDPAQLAEIQQRYMRDFTELWRGLAGGDTESAGKLHDRRFASEAWHKNAPYRY


TAAFYLLNARALTELADAVEADPKTRQRIRFAVSQWVDAMSPANFLATNPDAQNRLIESRGESL


RAGMRNMLEDLTRGKISQTDETAFEVGRNMAVTEGAVVFENEFFQLLQYKPLTDKVYTRPLLLV


PPCINKFYILDLQPEGSLVRYAVEQGHTVFLVSWRNPDASMAGCTWDDYIENAAIRAIEVVRDI


SGQDKINTLGFCVGGTIISTALAVLAARGEHPVASLTLLTTLLDFTDTGILDVFVDEPHVQLRE


ATLGGASGGLLRGVELANTFSFLRPNDLVWNYVVDNYLKGNTPVPFDLLFWNGDATNLPGPWYC


WYLRHTYLQNELKEPGKLTVCNEPVDLGAINVPTYIYGSREDHIVPWTAAYASTALLKNDLRFV


LGASGHIAGVINPPAKKKRSHWTNDALPESAQDWLAGAEEHHGSWWPDWMTWLGKQAGAKRAAP


TEYGSKRYAAIEPAPGRYVKAKA






Example 9
Generation of Gamma-Butyrolactone from the Pyrolysis of a Genetically Engineered Microbe Producing Poly-4-hydroxybutyrate

Biomass containing poly(4-hydroxybutyrate) (P4HB) was produced in a 20L New Brunswick Scientific fermentor (BioFlo 4500) using a genetically modified E. coli strain specifically designed for production of poly-4HB from glucose syrup as a carbon feed source. Examples of the E. coli strains, fermentation conditions, media and feed conditions are described in U.S. Pat. Nos. 6,316,262; 6,689,589; 7,081,357; and 7,229,804 incorporated by reference herein. The E. coli strain generated a fermentation broth which had a P4HB titer of approximately 100-120 g of P4HB/kg of broth. After the fermentation was complete, 100 g of the fermentation broth (e.g. P4HB biomass) was mixed with an aqueous slurry containing 10% by weight lime (Ca(OH)2 95+%, Sigma Aldrich). A 2 g portion of the broth+lime mixture was then dried in an aluminum weigh pan at 150° C. using an infrared heat balance (MB-45 Ohaus Moisture Analyzer) to constant weight. Residual water remaining was <5% by weight. The final lime concentration in the dry broth was 50 g lime/kg of dry solids or 5% by wt. A sample containing only dried fermentation broth (no lime addition) was prepared as well. Additionally, a sample of pure poly-4HB was recovered by solvent extraction as described in U.S. Pat. Nos. 7,252,980 and 7,713,720, followed by oven drying to remove the residual solvent.


The dry P4HB biomass samples were analyzed by TGA using an isothermal temperature of 300° C. under a N2 gas purge. FIG. 3 shows the TGA weight loss vs. time curves for the dry fermentation broth with lime (dashed curve), and without lime (solid curve). Each dry broth sample showed a single major weight loss event. Also shown in the plots are the slopes of the weight loss curves (indicating the thermal degradation rate) and the onset times for completion of weight loss. Table 22 shows the thermal degradation rate data for the two dry broth samples. With the addition of 5 wt % lime, the dry broth showed a 34% faster rate of weight loss as compared to the dry broth with no lime added. Also the onset time for completion of thermal degradation was approximately 30% shorter in the dry broth with added lime sample. These results showed that the lime catalyst significantly sped up the P4HB biomass thermal degradation process.


Both dry broth samples and a pure poly-4HB sample were then analyzed by Py-GC-MS in order to identify the compounds being generated during thermal degradation at 300° C. in an inert atmosphere. FIG. 4 shows the chromatograms of pyrolyzed pure poly-4HB, dry broth without added lime, and dry broth with added lime. For all of the samples, two major thermal degradation components were identified from the pyrolysis at 300° C.: GBL (peak at 6.2 min), and the dimer of GBL (peak at 11.1 min). The dimer of GBL was identified as (3-(dihydro-2(3H)-furanylidene)dihydro-2(3H)-furanone). FIG. 4 shows the mass spectral library matches identifying these two peaks.


Table 22 below summarizes the Py-GC-MS data measured for the pure poly-4HB polymer, dry poly-4HB broth without added lime, and the dry poly-4HB broth with added lime. Both the selectivity and yield of GBL from broth were observed to increase with addition of the lime catalyst. The yield was calculated by taking the GBL peak area counts and dividing by the weight of P4HB in each sample. For the broth samples, the % P4HB was measured to be ˜49% by weight of the total biomass. The fermentation broth media typically has potassium (4-7% by wt.) and sodium metal salts (<1% by wt.) present in it so that the increase in the yield of GBL was only 10% after lime addition. However, the selectivity for GBL was increased by a factor of 2 after the lime addition. As is evident from Table 22, higher lime concentration suppressed the formation of the GBL dimer, while increasing the yield of GBL relative to weight of poly-4HB pyrolyzed.









TABLE 22







Summary of Pyrolysis-GC-MS at 300° C. and TGA data


for poly-4HB pure polymer, dry poly-4HB broth and


dry poly-4HB broth with added lime.












Area Counts
Thermal



Ratio of
GBL/mg of
Degradation



GBL/GBL
poly-4HB
Rate*


Sample ID
Dimer
pyrolized
(% Wt loss/min)





Poly-4HB pure polymer
14.7
8.72 × 106
—


Dry poly-4HB broth
26.5
1.37 × 107
−79.7


Dry poly-4HB broth +
54.0
1.51 × 107
−107


5% by wt lime





*Measured from the slope of the TGA weight loss curves at 300° C. under N2 atmosphere.






Example 10
Effect of Temperature, Catalyst Type, Catalyst Concentration and Broth Type on the Generation of Gamma-Butyrolactone from the Pyrolysis of a Genetically Engineered Microbe Producing Poly-4-hydroxybutyrate

In this example, a designed experiment (DOE) was carried out to determined the effects of pyrolysis temperature, catalyst type, catalyst concentration and broth type on the purity of GBL produced from a P4HB-containing microbial fermentation broth. Table 23 shows the DOE parameters and conditions tested. Sixteen different experimental conditions were tested in total. Py-GC-MS was used to measure the GBL purity. Two replicates at each condition were carried out for a total of thirty-two Py-GC-MS runs. TGA was also measured to assess the effect of the catalysts on the thermal degradation rate of P4HB at the various pyrolysis temperatures. Only single runs at each experimental condition were made for these measurements. For comparision, dry broth+P4HB samples (washed and unwashed) having no catalyst added were also prepared and analyzed by TGA and Py-GC-MS but were not part of the overall experiment.









TABLE 23







Design of Experiment parameters and conditions for determining


the effect of pyrolysis temperature, catalyst type, catalyst


concentration and broth type on GBL purity generated


from microbial fermentation broth + P4HB.












Catalyst
Pyrolysis


Broth Type
Catalyst type
Concentration*
Temp (° C.)





Unwashed
Ca(OH)2, Mg(OH)2,
1, 3, 5, 10%
225, 250, 275, 300



FeSO4, Na2CO3


Washed
Ca(OH)2, Mg(OH)2,
1, 3, 5, 10%
225, 250, 275, 300



FeSO4, Na2CO3





*Wt % metal ion relative to the dry cell mass of the broth.






Biomass containing poly(4-hydroxybutyrate) (poly-4HB) was produced in a 20L New Brunswick Scientific fermentor (BioFlo 4500) using a genetically modified E. coli strain specifically designed for high yield production of poly-4HB from glucose syrup as a carbon feed source. Examples of the E. coli strains, fermentation conditions, media and feed conditions are described in U.S. Pat. Nos. 6,316,262; 6,689,589; 7,081,357; and 7,229,804. The E. coli strain generated a fermentation broth which had a PHA titer of approximately 100-120 g of PHA/kg of broth. After fermentation, the fermentation broth containing the microbial biomass and P4HB polymer was split into two fractions. One fraction was used without any further processing and was identified as ‘unwashed’ broth. The unwashed broth had a dry solids content of 13.7% (dry solids weight was measured using an MB-45 Ohaus Moisture Analyzer). The other fraction was washed by adding an equal volume of distilled-deionized water to the broth, stirring the mixture for 2 minutes, centrifuging and then decanting the liquid and retaining the solid biomass+P4HB. The wash step was repeated a second time and then after centrifuging and decanting, the remaining solids were resuspended again in DI water to give a 12.9% by weight dry solids solution. This material was designated ‘washed’ broth. Table 24 shows the trace metals analysis by Ion Chromatography of the two broth types. The results showed that the unwashed broth had high levels of potassium and sodium ions present due to the media components used to grow the microbial cells. After the washing step, the potassium, magnesium and sodium ions were significantly reduced thereby reducing the overall metals content of the broth+P4HB by a factor of 6.









TABLE 24







Summary of Ion Chromatography results for fermentation broth + P4HB


before and after washing with distilled deionized water.













Metal Ion



Broth + P4HB Type
Metal Ion
Concentration







Unwashed
Calcium
39.8 ppm




Magnesium
 811 ppm




Potassium
6.07%




Sodium
0.38%



Washed (2 times)
Calcium
40.2 ppm




Magnesium
 419 ppm




Potassium
0.83%




Sodium
None detected










The pyrolysis catalysts used in this experiment included Ca(OH)2 (95+% Sigma Aldrich), Mg(OH)2 (Sigma Aldrich), FeSO4 7H2O (JT Baker), and Na2CO3 (99.5+% Sigma Aldrich). Aqueous slurries of the Ca(OH)2, Mg(OH)2 and FeSO47H2O catalysts were prepared in DI water (25-30% by weight solids) and added to the broth samples while the Na2CO3 was added to the broth+P4HB directly as a solid. As shown in Table 23, the catalyst concentrations targeted for the experiment were 1%, 3%, 5% and 10% based on the weight of the metal ion relative to the dry solids weight of the broth. To prepare the broth+P4HB/catalyst samples, 10 g of either washed or unwashed broth was added to a 15 ml centrifuge tube. Next, the appropriate amount of catalyst solution or solid was added and the mixture vortexed for 30 sec. The mixture was then centrifuged, decanted and poured into a drying dish. Finally the drying dish was placed in an oven at 110° C. and dried to constant weight. Dry samples of unwashed and washed broth containing no catalysts were also prepared by centrifuging, decanting and drying at 110° C.


Table 25 shows results from the TGA and Py-GC-MS analyses on the broth+P4HB samples which have no catalysts added.









TABLE 25







Summary of TGA and Py-GC-MS results for broth + P4HB


samples having no catalyst added to them.











Broth

Pyrolysis
TGA Slope
GBL/GBL Dimer


Type
Catalyst
Temp. (° C.)
(% Wt loss/min)
Peak Area Ratio





unwashed
None
225
−17.9
45.6


washed
None
225
−1.88
32.2


unwashed
None
250
−43.9
23.1


washed
None
250
−4.38
32.4


unwashed
None
275
−64.0
36.6


washed
None
275
−8.39
39.2


unwashed
None
300
−97.0
28.9


washed
None
300
−28.9
40.3









The results from Table 25 show that washing the broth+P4HB before pyrolyzing had a significant impact on lowering the rate of thermal decomposition at all pyrolysis temperatures. From the Ion Chromatography results in Table 24, it can be seen that the overall concentration of metal ions present in the washed broth was lowered by a factor of 6 as compared to the unwashed broth. This indicated that the metal ions present in the broth+P4HB after a fermentation run, by themselves had a catalytic effect on the degradation rate of P4HB during pyrolysis. Kim et al (2008, Polymer Degradation and Stability, 93, p 776-785) have shown that the metal ions Ca, Na, Mg, Zn, Sn and Al are all effective in catalyzing the thermal degradation of P4HB. What was not shown however was the effect that these metal ions had on the purity of the GBL produced by thermal decomposition of P4HB. Table 25 shows that for the unwashed broth+P4HB samples, the GBL purity (GBL/GBL dimer peak area ratio) decreased as the pyrolysis temperature increased. For the washed samples, the purity marginally improved with increasing pyrolysis temperature. The data in Table 25 suggests that for any process making biobased GBL by thermal decomposition of P4HB and a catalyst, there exits a trade off between speed of reaction and purity of the final product. The following data will show that the type and concentration of catalyst used significantly impacts both the thermal degradation rate and GBL purity in unanticipated ways.


Table 26 summarizes the TGA and Py-GC-MS experimental results for the pyrolysis of broth+P4HB as a function of catalyst type, concentration, pyrolysis temperature and broth type.


Table 26. Summary of TGA and Py-GC-MS results for broth+P4HB as a function of catalyst type, catalyst concentration, pyrolysis temperature and broth type.









TABLE 26







Summary of TGA and Py-GC-MS data for broth + P4HB.
















Catalyst

TGA Slope
GBL/GBL



Broth

Concentration
Pyrolysis
(% Wt
Dimer Peak


Run#
Type
Catalyst
(Wt %)*
Temp. (° C.)
loss/min)
Area Ratio
















1
unwashed
FeSO4
1%
225
−1.07
—


2
unwashed
FeSO4
1%
225
—
—


3
unwashed
Na2CO3
10%
225
−77.6
142.9


4
unwashed
Na2CO3
10%
225
—
91.74


5
washed
Ca(OH)2
3%
225
−35.0
480.7


6
washed
Ca(OH)2
3%
225
—
617.3


7
washed
Mg(OH)2
5%
225
−33.1
147.6


8
washed
Mg(OH)2
5%
225
—
122.1


9
unwashed
Mg(OH)2
1%
250
−41.6
38.19


10
unwashed
Mg(OH)2
1%
250
—
49.75


11
unwashed
Ca(OH)2
10%
250
−78.2
1546


12
unwashed
Ca(OH)2
10%
250
—
2016


13
washed
Na2CO3
3%
250
−111
36.11


14
washed
Na2CO3
3%
250
—
28.30


15
washed
FeSO4
5%
250
−0.918
—


16
washed
FeSO4
5%
250
—
—


17
washed
Ca(OH)2
1%
275
−14.2
35.39


18
washed
Ca(OH)2
1%
275
—
55.07


19
washed
FeSO4
10%
275
−1.17
—


20
washed
FeSO4
10%
275
—
—


21
unwashed
Mg(OH)2
3%
275
−109
118.1


22
unwashed
Mg(OH)2
3%
275
—
135.2


23
unwashed
Na2CO3
5%
275
−185
29.81


24
unwashed
Na2CO3
5%
275
—
30.84


25
washed
Na2CO3
1%
300
−172
23.53


26
washed
Na2CO3
1%
300
—
17.33


27
washed
Mg(OH)2
10%
300
−55.5
48.59


28
washed
Mg(OH)2
10%
300
—
25.52


29
unwashed
FeSO4
3%
300
−12.5
—


30
unwashed
FeSO4
3%
300
—
—


31
unwashed
Ca(OH)2
5%
300
−164
46.49


32
unwashed
Ca(OH)2
5%
300
—
34.45





*Wt % metal ion relative to the dry solids weight of the broth.






Statistical analysis of the data in Table 26 (using JMP statistical software from SAS), showed that for the fastest thermal degradation rate, the optimum variable parameters to use would be unwashed broth+P4HB, Na2CO3 as the catalyst at 5% concentration and a pyrolysis temperature of 300° C. Catalyst type was the most significant variable affecting the degradation rates which varied from −1 to −185% wt loss/min. Samples with FeSO4 catalyst had degradation rates lower than even the washed broth+P4HB indicating that this compound acted more as a P4HB thermal stabilizer rather than a catalyst promoter. The samples which had the highest degradation rates were those with either Na2CO3 or Ca(OH)2. Higher temperatures and generally higher catalyst concentration also favored faster degradation rates.


The statistical analysis of the GBL purity data showed that the optimum variable parameters for highest GBL purity were found using Ca(OH)2 catalyst at 10% concentration and a pyrolysis temperature of 250° C. In comparison to the other variables, broth type had a negligible effect on the GBL purity. The most statistically significant variables for GBL purity, which ranged in value from 17 to 2016 (GBL/GBL dimer peak area ratio) were catalyst concentration and type. It was noted that the upper range values for GBL purity in the experimental results were much higher than those observed for the unwashed broth+P4HB samples in Table 25. This indicated that the metal ions remaining in broth from fermentation (mostly potassium) were not as effective for improving GBL purity as those used in the experiment. Pyrolysis tempertature was also found to be a statistically significant variable for GBL purity (higher temperatures generated more dimer). In Table 26, the missing Py-GC-MS data for broth+P4HB with FeSO4 as the catalyst was due to the fact that the samples took too long to pyrolyze under the Py-GC-MS conditions and therefore could not be quantitated. This was in agreement with the TGA data which showed FeSO4 acted as a thermal stabilizer rather than catalyst promoter.


As shown in Example 9, addition of the catalyst Ca(OH)2 to microbial biomass+P4HB suppressed the formation of GBL dimer producing a purer GBL liquid during pyrolysis of the biomass The above experimental data confirmed this observation and showed that catalyst concentration and pyrolysis temperature were also important in determining the optimum conditions for producing high purity GBL from dry broth+P4HB by pyrolysis. The choice of catalyst and pyrolysis temperature was also shown to impact the rate of P4HB thermal degradation. Therefore one needs to carefully choose the correct conditions to optimize both variables when designing a robust process for production of biobased GBL.


Example 11
Larger Scale Production of Gamma-Butyrolactone from the Pyrolysis of a Genetically Engineered Microbe Producing Poly-4-hydroxybutyrate

In the following example, GBL production from pyrolyis of a fermentation broth+P4HB+catalyst mixture will be outlined showing the ability to produce a high purity, high yield biobased GBL on the hundred gram scale.


Biomass containing poly-4-hydroxybutyrate (poly-4HB) was produced in a 20L New Brunswick Scientific fermentor (BioFlo 4500) using a genetically modified E. coli strain specifically designed for high yield production of poly-4HB from glucose syrup as a carbon feed source. Examples of the E. coli strains, fermentation conditions, media and feed conditions are described in U.S. Pat. Nos. 6,316,262; 6,689,589; 7,081,357; and 7,229,804. The E. coli strain generated a fermentation broth which had a PHA titer of approximately 100-120 g of PHA/kg of broth. After fermentation, the broth was washed with DI water by adding an equal volume of water, mixing for 2 minutes, centrifuging and decanting the water. Next, the washed broth was mixed with lime (Ca(OH)2 standard hydrated lime 98%, Mississippi Lime) targeting 4% by wt dry solids. The mixture was then dried in a rotating drum dryer at 125-130° C. to a constant weight. Moisture levels in the dried biomass were approximately 1-2% by weight. The final wt % calcium ion in the dried broth+P4HB was measured by Ion Chromatography to be 1.9% (3.5% by wt. Ca(OH)2).


Pyrolysis of the dried broth+P4HB+Ca(OH)2 was carried out using a rotating, four inch diameter quartz glass kiln suspended within a clamshell tube furnace. At the start of the process, a weighed sample of dried broth+P4HB+Ca(OH)2 was placed inside of the glass kiln and a nitrogen purge flow established. The furnace rotation and heat up would then be started. As the temperature of the furnace reached its set point value, gases generated by the broth+P4HB+Ca(OH)2 sample would be swept out of the kiln by the nitrogen purge and enter a series of glass condensers or chilled traps. The condensers consisted of a vertical, cooled glass condenser tower with a condensate collection bulb located at the its base. A glycol/water mixture held at 0° C. was circulated through all of the glass condensers. The cooled gases that exited the top of the first condenser were directed downward through a second condenser and through a second condensate collection bulb before being bubbled through a glass impinger filled with deionized water. FIG. 7 shows a schematic diagram of the pyrolyzer and gas collection equipment.


For the larger scale pyrolysis experiment, 292 g of dried broth+P4HB+Ca(OH)2 was first loaded into the quartz kiln at room temperature. The total weight of P4HB biomass was estimated to be 281.4 g based on Ca(OH)2 loading. The wt % P4HB in the mixture was also measured to be 66.7% (see Doi, Microbial Polyesters, John Wiley and Sons, p 23, 1990) based on the dry solids which made the mass of P4HB in the kiln equal to 195 g. The system was then sealed up and a nitrogen purge of approximately 1500 ml/min was established. Power was applied to the furnace and the dried broth+P4HB+Ca(OH)2 was heated up to the target pyrolysis temperature of 250° C. During pyrolysis, the products of thermal degradaton of biomass+P4HB, GBL, were collected in the condensate traps below the cooled condensers. Water could be seen to collect initially in each of the collection bulbs. The majority of the liquified product (>95%) was collected in the first glass collection bulb. Total pyrolysis run time was approximately 60 minutes. The weight of the remaining biomass after pyrolysis was measured to be 11.9 g.


After the completion of the pyrolysis run, the condensates from the condensers were collected and weighed. The results showed that the combined condensate weight was 181 g. Analysis of the condensate by Karl Fisher moisture analysis and GC-MS showed that the condensate contained 6.1% water, 0.06% fatty acids with the balance of the material being GBL products. The GBL product yield ((g of GBL product/g of starting P4HB)×100%) therefore was calculated to be approximately 87%. The GC-MS results also showed that the major impurity in the GBL product was GBL dimer where the peak area ratio of GBL/GBL dimer was calculated to be 2777. This was in agreement with the results from the experiment in Example 10 showing that the optimum process conditions for highest GBL purity were at the 250° C. pyrolysis temperature with the Ca(OH)2 catalyst. Other impurities such as organosulfur and amide compounds were also detected as being present in the condensate by GC-MS. The conversion of the P4HB biomass solid to liquid ((g of dry Biomass−g Residual biomass/g of dry biomass)×100%) was calculated to be 96%.


In another embodiment, it is also possible to subject the gamma-butyrolactone generated from processes described herein directly to hydrogenation, esterification or amidation conditions to produce the corresponding diol, hydroxyl ester and amide (e.g., 1,4-butanediol, alkyl 4-hydroxy butyrate, or N-alkyl 2-pyrrolidone when subjected to hydrogenation with H2, esterification with alkyl alcohol and amidation with alkyl amine respectively).


The processing of fats and oils to produce alcohols provides some guidance in this respect. Oils and fats are significant sources of fatty alcohols that are used in a variety of applications such as lubricants and surfactants. The fats are not typically hydrogenated directly as the intensive reaction conditions tend to downgrade the glycerol to lower alcohols such as propylene glycol and propanol during the course of the hydrogenation. For this reason it is more conventional to first hydrolyze the oil and then pre-purify the fatty acids to enable a more efficient hydrogenation (see for instance Lurgi's hydrogenation process in Bailey's Industrial Oil and Fat Products, Sixth Edition, Six Volume Set. Edited by Fereidoon Shahidi, John Wiley & Sons, Inc. 2005).


Example 12
Purification of Biobased Gamma-Butyrolactone by Single Distillation

This example shows that a single distillation of crude GBL is not sufficient to either remove odor causing compounds or color-causing organic compounds thereby providing a stable color product.


A single distillation of filtered, crude GBL, obtained by the thermolysis of P4HB-containing biomass as outlined in Example 11 was performed under vacuum using a 4 ft, jacketed, glass distillation column filled with high performance 316 stainless steel packing. The 5-liter distillation flask at the bottom of the column was first charged with 3575.4 g of unpurified, crude GBL material. Water (610 g) was distilled first distilled off at about 24 in. of vacuum at an overhead vapor temperature of 64° C. The reflux ratio (reflux/distillate) was 10/30. After removal of the water fraction, a transition or second cut containing water, acetic acid, other organic acids, and GBL was obtained at 95-123° C., 27 in. vacuum, and a reflux ratio of 30/10. Upon removal of the second cut, pure GBL product was collected at 123° C. and a reflux ratio of 30/10. The total weight of the pure GBL was 2161 g. The color of the pure GBL collected was visually straw-yellow and had a very strong odor. Upon standing overnight, the GBL noticably became darker. The application of simple rectification procedures for the purification step of GBL crude was shown to be not sufficient to produce odor-free and low color product.


Example 13
Purification of Biobased Gamma-Butyrolactone by Distillation, Steam Stripping and Peroxide Treatment

This example outlines a procedure for the purification of biobased GBL liquid prepared from pyrolysis of a genetically engineered microbe producing poly-4-hydroxybutyrate polymer mixed with a catalyst as outlined previously in Example 11.


The GBL purification is a batch process whereby the “crude” GBL liquid recovered after pyrolysis is first filtered to remove any solid particulates (typically <1% of the total crude GBl weight) and then distilled twice to remove compounds contributing to odor and color. FIG. 8 shows a schematic diagram of the overall GBL purification process.


Filtration of the crude GBL liquid was carried out on a lab scale using a Buchner fritted-glass funnel coupled to an Erlenmeyer receiving flask. Approximately 1 liter of crude GBL was filtered which resulted in approximately 0.99 liters of recovered GBL liquid.


The distillation of the filtered GBL liquid was carried out using a high vacuum, 20 stage glass distillation column. The stage section of the column was contained inside a silver-coated, evacuated, glass insulating sleeve in order to minimize any heat losses from the column during the distillation process. The distillation was performed under vacuum conditions using a vacuum pump equipped with a liquid nitrogen cold trap. Typical column operating pressures during distillation were in the 25 in.Hg range. Cooling water, maintained at 10° C., was run through the condenser at the top of the column to assist in the fractionation of the vapor. The column was also fitted with two thermocouples: one at the top of the column to monitor vapor temperature and one at the bottom of the column to monitor the liquid feed temperature. At the start of the distillation, approximately 1 liter of filtered GBL liquid was charged into the bottom of the column, the condenser cooling water and the vacuum were then turned on. Once the pressure had stabilized, the filtered GBL liquid was slowly heated using a heating mantle to the boiling point of GBL (204° C.).


During the initial stages of the distillation, water contained in the filtered GBL was removed first and discarded along with lower boiling impurities. When the water and lower boiling impurities were completely removed, the GBL liquid feed temperature increased to the boiling point of GBL. At this stage, the vapor generated at the top of the column was mostly GBL which was condensed, collected and reserved for further distillation. When it was observed that the temperature of the liquid feed increased quickly above 204° C., the distillation was stopped. The total amount of GBL liquid recovered in the first distillation was 0.9 liters with a purity of 97%.


After the remaining feed liquid from the first distillation was cooled, it was removed from the column and the 0.9 liters of distilled GBL liquid was added. Along with the distilled GBL liquid, 203 g (or 20% by weight GBL) of distilled/deionized water (MILLI-Q® Water System, Millipore) was added to the bottom of the column. The addition of the water was found to enhance removal of many impurities via steam stripping. After addition of the water, the second distillation was carried out under vacuum as described previously. The resulting GBL liquid recovered was shown to be 98% pure.


Another variation for the second distillation was tried whereby 1-3% (by weight GBL) of a 30% hydrogen peroxide solution was added along with the DI water to the previously distilled GBL liquid. The peroxide acts to oxidize the impurities in the GBL liquid making them less volatile and thereby easier to separate. To carry out this distillation, 0.9 liters of previously distilled GBL liquid were added to the bottom of the distillation column along with 203 g of DI water and 10.2 g of 30-32% hydrogen peroxide (Sigma Aldrich). The condenser cooling water and vacuum were started and the GBL liquid feed heated. The distillation generated a water fraction first and second transitional fraction prior to the pure GBL vapor. Both the first and second fractions were discarded and the pure GBL liquid collected. Analysis of the GBL liquid by GC-MS showed that is was >99.5% pure with very low odor and color. To remove additional water, the purified GBL liquid can be stored over dry molecular sieves (3-4 Å pore size, Sigma Aldrich) until used.


Another variation on the above purification steps is to add DI water and/or 30% hydrogen peroxide solution during the first distillation stage.


Example 14
Purification of Biobased Gamma-Butyrolactone by Ozone Post Treatment

In this example, a method for post treating GBL liquid after the first or second distillation with ozone gas is described. Treatment with ozone also helps to oxidize impurities present in the GBL making them easier to separate by distillation. In a 500 ml stirred, glass sparge vessel, 250 ml of distilled GBL liquid was added. Ozone was generated by a lab scale corona discharge device (OZ1PCS, Ozotech Inc.) and mixed with air. The gas mixture was then introduced into the vessel at a concentration of 0.5% by volume ozone. The gas mixture was bubbled through the GBL liquid while stirring for approximately 2 hours. After the 2 hours, the GBL liquid is removed and distilled as described in Example 12. The purified GBL liquid can then be analyzed by GC-MS to determine its purity.


Example 15
Purification of Biobased Gamma-Butyrolactone by Activated Carbon Post Treatment

For this example, the purified, biobased GBL liquid is contacted with activated carbon, charcoal or mesoporous carbon to remove further impurities. The GBL can be mixed with 1-20% by weight activated carbon, then the mixture centrifuged to remove the solids. Alternatively, the GBL liquid can be run through a packed column containing the activated carbon. The purified GBL liquid can then be analyzed by GC-MS to determine its purity.


Example 16
Purification of Biobased Gamma Butyrolactone by Ion Exchange Treatment

In this example, a method for treating biobased GBL liquid with ion exchange resins is described. Exposure of the GBL to ion exchange resins helps to remove ionic impurities generated during the pyrolysis of the P4HB biomass+catalyst. The treatment can be done on the “crude” biobased GBL, or after the first or second distillation. To carry out the ion exchange process, two 147 ml columns were placed in series. The first column was packed with a cationic ion exchange resin (DOWEX® G26, Sigma Aldrich) while the second column was packed with an anionic ion exchange Resin (DOWEX® 66 freebase, Sigma Aldrich). The columns were equilibrated with multiple column volumes of deionized water prior to any GBL treatment. In order to minimize the amount of water that would likely end up in the GBL product following the ion exchange treatment, nitrogen was used to expel any excess water out of the column packing prior to exposing to GBL liquid. During Ion Exchange (IE) treatment, GBL liquid was supplied to the columns by an FMI metering pump at a rate of 5 ml/min GBL liquid was collected in 100 ml fractions and analyzed by ion chromatography and GC-MS to determine level of impurities. Upon the completion of the product loading, multiple column volumes of deionized water were used to push any product back off of the resin. All of the fractions were then collected and loaded into the column for distillation as previously described in Example 12. The purified GBL liquid can then be analyzed by GC-MS to determine its purity.


The embodiments, illustratively described herein may suitably be practiced in the absence of any element or elements, limitation or limitations, not specifically disclosed herein. Thus, for example, the terms “comprising,” “including,” “containing,” etc. shall be read expansively and without limitation. Additionally, the terms and expressions employed herein have been used as terms of description and not of limitation, and there is no intention in the use of such terms and expressions of excluding any equivalents of the features shown and described or portions thereof, but it is recognized that various modifications are possible within the scope of the claimed technology. Additionally, the phrase “consisting essentially of will be understood to include those elements specifically recited and those additional elements that do not materially affect the basic and novel characteristics of the claimed technology. The phrase “consisting of” excludes any element not specified.


The present disclosure is not to be limited in terms of the particular embodiments described in this application. Many modifications and variations can be made without departing from its spirit and scope, as will be apparent to those skilled in the art. Functionally equivalent methods and compositions within the scope of the disclosure, in addition to those enumerated herein, will be apparent to those skilled in the art from the foregoing descriptions. Such modifications and variations are intended to fall within the scope of the appended claims. The present disclosure is to be limited only by the terms of the appended claims, along with the full scope of equivalents to which such claims are entitled. It is to be understood that this disclosure is not limited to particular methods, reagents, compounds compositions or biological systems, which can of course vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.


In addition, where features or aspects of the disclosure are described in terms of Markush groups, those skilled in the art will recognize that the disclosure is also thereby described in terms of any individual member or subgroup of members of the Markush group.


All publications, patent applications, issued patents, and other documents referred to in this specification are herein incorporated by reference as if each individual publication, patent application, issued patent, or other document was specifically and individually indicated to be incorporated by reference in its entirety. Definitions that are contained in text incorporated by reference are excluded to the extent that they contradict definitions in this disclosure.


The teachings of all patents, published applications and references cited herein are incorporated by reference in their entirety.


While this invention has been particularly shown and described with references to example embodiments thereof, it will be understood by those skilled in the art that various changes in form and details may be made therein without departing from the scope of the invention encompassed by the appended claims.

Claims
  • 1. A process for production of a biobased gamma-butyrolactone, comprising a) combining a genetically engineered biomass comprising poly-4-hydroxybutyrate and a catalyst;b) heating the biomass with the catalyst to convert the poly 4-hydroxybutyrate to a gamma-butyrolactone product; andc) removing impurities from the gamma-butyrolactone product forming a pure gamma-butyrolactone.
  • 2. A process for production of a biobased gamma-butyrolactone, comprising a) combining a genetically engineered biomass comprising poly-4-hydroxybutyrate and a catalyst;b) heating the biomass with the catalyst to convert the poly 4-hydroxybutyrate to a gamma-butyrolactone product; andc) filtering the gamma-butyrolactone product to a pure gamma-butyrolactone.
  • 3. A process for production of a biobased gamma-butyrolactone, comprising a) combining a genetically engineered biomass comprising poly-4-hydroxybutyrate and a catalyst;b) heating the biomass with the catalyst to convert the poly 4-hydroxybutyrate to a gamma-butyrolactone product; andc) distilling the gamma-butyrolactone product to a pure gamma-butyrolactone.
  • 4. A process for production of a biobased gamma-butyrolactone, comprising a) combining a genetically engineered biomass comprising poly-4-hydroxybutyrate and a catalyst;b) heating the biomass with the catalyst to convert the poly 4-hydroxybutyrate to a gamma-butyrolactone product;c) filtering the gamma-butyrolactone product, andd) distilling the gamma-butyrolactone product one or more time to a pure gamma-butyrolactone.
  • 5. The process of claim 3, wherein water is added to the gamma-butyrolactone product prior to distilling.
  • 6. The process of claim 3, wherein a hydrogen peroxide solution, alkyl hydroperoxide, aryl hydroperoxide, peracids, peresters, perborate salts, percarbonate salts, persulfate salts, hypochlorite salts, and combinations of these are added to the gamma-butyrolactone product prior to distilling.
  • 7. The process of claim 3, wherein water and hydrogen peroxide solution are added to the gamma-butyrolactone product prior to distilling.
  • 8. The process of claim 1, wherein the biobased gamma-butyrolactone is further treated with an ion exchange resin, activated carbon or ozone.
  • 9. (canceled)
  • 10. (canceled)
  • 11. The process of claim 1, wherein the pure gamma-butyrolactone, has a purity of at least 99.5%, low color and low odor.
  • 12. The process of claim 1, wherein the pure gamma-butyrolactone is colorless and odorless.
  • 13. (canceled)
  • 14. (canceled)
  • 15. The process of claim 1, wherein the APHA of the pure gamma-butyrolactone is between 7 and 20.
  • 16. The process of claim 3, wherein the distilling step is repeated.
  • 17. The process of claim 5, wherein the water is added to the gamma-butyrolactone product at least at 20% by weight GBL.
  • 18. The process of claim 1, wherein the genetically engineered biomass is from a recombinant host having a poly-4-hydroxybutyrate pathway, wherein the host has an inhibiting mutation in its CoA-independent NAD-dependent succinic semialdehyde dehydrogenase gene or its CoA-independent NADP-dependent succinic semialdehyde dehydrogenase gene, or having the inhibiting mutations in both genes, and having stably incorporated one or more genes encoding one or more enzymes selected from a succinyl-CoA:coenzyme A transferase wherein the succinyl-CoA:coenzyme A transferase is able to convert succinate to succinyl-CoA, a succinate semialdehyde dehydrogenase wherein the succinate semialdehyde dehydrogenase is able to convert succinyl-CoA to succinic semialdehyde, a succinic semialdehyde reductase wherein the succinic semialdehyde reductase is able to convert succinic semialdehyde to 4-hydroxybutyrate, a CoA transferase wherein the CoA transferase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-CoA, and a polyhydroxyalkanoate synthase wherein the polyhydroxyalkanoate synthase is able to polymerize 4-hydroxybutyryl-CoA to poly-4-hydroxybutyrate.
  • 19. The process of claim 1, wherein the genetically engineered biomass is from a recombinant host having stably incorporated one or more genes encoding one or more enzymes selected from: a phosphoenolpyruvate carboxylase wherein the phosphoenolpyruvate carboxylase is able to convert phosphoenolpyruvate to oxaloacetate, an isocitrate lyase wherein the isocitrate lyase is able to convert isocitrate to glyoxalate, a malate synthase wherein the malate synthase is able to convert glyoxalate to malate and succinate, a succinate-CoA ligase (ADP-forming) wherein the succinate-CoA ligase (ADP-forming) is able to convert succinate to succinyl-CoA, an NADP-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NADP-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADPH+H+, an NAD-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NAD-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADH+H+, a butyrate kinase wherein the butyrate kinase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-phosphate, a phosphotransbutyrylase wherein the phosphotransbutyrylase is able to convert 4-hydroxybutyryl-phosphate to 4-hydroxybutyryl-CoA; and optionally having a disruption in one or more genes selected from yneI, gabD, pykF, pykA, maeA and maeB.
  • 20. The process of claim 1, wherein the process further includes an initial step of culturing a recombinant host with a renewable feedstock to produce a poly-4-hydroxybutyrate biomass.
  • 21. The process of claim 20, wherein a source of the renewable feedstock is selected from glucose, fructose, sucrose, arabinose, maltose, lactose, xylose, fatty acids, vegetable oils, and biomass derived synthesis gas or a combination thereof.
  • 22. The process of claim 1, wherein the biomass host is a bacteria, yeast, fungi, algae, cyanobacteria, or a mixture of any two or more thereof.
  • 23. (canceled)
  • 24. (canceled)
  • 25. (canceled)
  • 26. The process of claim 1, wherein heating is at a temperature of from about 100° C. to about 350° C.
  • 27. The process of claim 1, wherein the catalyst is sodium carbonate or calcium hydroxide.
  • 28. The process of claim 27, wherein the weight percent of catalyst is in the range of about 4% to about 50%.
  • 29. The process of claim 1, wherein heating reduces the water content of the biomass to about 5 wt %, or less.
  • 30. (canceled)
  • 31. (canceled)
  • 32. (canceled)
  • 33. (canceled)
  • 34. The process of claim 1, further comprising recovering the gamma-butyrolactone product.
  • 35. The process of claim 1, wherein the gamma-butyrolactone product comprises less than 5% by weight of side products.
  • 36. The process of claim 1, wherein the gamma-butyrolactone is further processed to form one or more of the following: 1,4-butanediol (BDO), tetrahydrofuran (THF), N-methylpyrrolidone (NMP), M-ethylpyrrolidone (NEP), 2-pyrrolidinone, N-vinylpyrrolidone (NVP) and polyvinylpyrrolidone (PVP).
  • 37. The process of claim 1, wherein the genetically engineered biomass is from a recombinant host having a poly-4-hydroxybutyrate pathway, wherein the host has optionally an inhibiting mutation in its CoA-independent NAD-dependent succinic semialdehyde dehydrogenase gene or its CoA-independent NADP-dependent succinic semialdehyde dehydrogenase gene, or having inhibiting mutations in both genes, and having stably incorporated genes encoding the following enzymes: a succinyl-CoA:coenzyme A transferase wherein the succinyl-CoA:coenzyme A transferase is able to convert succinate to succinyl-CoA, a succinate semialdehyde dehydrogenase wherein the succinate semialdehyde dehydrogenase is able to convert succinyl-CoA to succinic semialdehyde, a succinic semialdehyde reductase wherein the succinic semialdehyde reductase is able to convert succinic semialdehyde to 4-hydroxybutyrate, a CoA transferase wherein the CoA transferase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-CoA, and a polyhydroxyalkanoate synthase wherein the polyhydroxyalkanoate synthase is able to polymerize 4-hydroxybutyryl-CoA to poly-4-hydroxybutyrate.
  • 38. The process of claim 1, wherein the genetically engineered biomass is from a recombinant host having stably incorporated genes encoding the following enzymes: a phosphoenolpyruvate carboxylase wherein the phosphoenolpyruvate carboxylase is able to convert phosphoenolpyruvate to oxaloacetate, an isocitrate lyase wherein the isocitrate lyase is able to convert isocitrate to glyoxalate, a malate synthase wherein the malate synthase is able to convert glyoxalate to malate and succinate, a succinate-CoA ligase (ADP-forming) wherein the succinate-CoA ligase (ADP-forming) is able to convert succinate to succinyl-CoA, an NADP-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NADP-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADPH+H+, an NAD-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NAD-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADH+H+, a butyrate kinase wherein the butyrate kinase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-phosphate, a phosphotransbutyrylase wherein the phosphotransbutyrylase is able to convert 4-hydroxybutyryl-phosphate to 4-hydroxybutyryl-CoA; and optionally having a disruption in one or more genes selected from yneI, gabD, pykF, pykA, maeA and maeB.
  • 39. The process of claim 1, wherein the genetically engineered biomass is from a recombinant host having a poly-4-hydroxybutyrate pathway, wherein the host has stably incorporated one or more genes encoding one or more enzymes selected from a succinyl-CoA:coenzyme A transferase wherein the succinyl-CoA:coenzyme A transferase is able to convert succinate to succinyl-CoA, a succinate semialdehyde dehydrogenase wherein the succinate semialdehyde dehydrogenase is able to convert succinyl-CoA to succinic semialdehyde, a succinic semialdehyde reductase wherein the succinic semialdehyde reductase is able to convert succinic semialdehyde to 4-hydroxybutyrate, a CoA transferase wherein the CoA transferase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-CoA, and a polyhydroxyalkanoate synthase wherein the polyhydroxyalkanoate synthase is able to polymerize 4-hydroxybutyryl-CoA to poly-4-hydroxybutyrate.
  • 40. The process of claim 1, wherein the genetically engineered biomass is from a recombinant host having stably incorporated one or more genes encoding one or more enzymes selected from: a phosphoenolpyruvate carboxylase wherein the phosphoenolpyruvate carboxylase is able to convert phosphoenolpyruvate to oxaloacetate, an isocitrate lyase wherein the isocitrate lyase is able to convert isocitrate to glyoxalate, a malate synthase wherein the malate synthase is able to convert glyoxalate to malate and succinate, a succinate-CoA ligase (ADP-forming) wherein the succinate-CoA ligase (ADP-forming) is able to convert succinate to succinyl-CoA, an NADP-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NADP-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADPH+H+, an NAD-dependent glyceraldeyde-3-phosphate dehydrogenase wherein the NAD-dependent glyceraldeyde-3-phosphate dehydrogenase is able to convert glyceraldehyde 3-phosphate to 1,3-bisphosphoglycerate forming NADH+H+, a butyrate kinase wherein the butyrate kinase is able to convert 4-hydroxybutyrate to 4-hydroxybutyryl-phosphate, a phosphotransbutyrylase wherein the phosphotransbutyrylase is able to convert 4-hydroxybutyryl-phosphate to 4-hydroxybutyryl-CoA; and optionally having a disruption in one or more genes selected from yneI, gabD, pykF, pykA, maeA and maeB.
  • 41. The process of claim 1, wherein the weight % of the catalyst is in the range of about 4% to about 50%, and the heating is at about 300° C.
  • 42. The process of claim 1, wherein the catalyst is about 4% by weight calcium hydroxide and the heating is at a temperature of 300° C.
  • 43. A pure biobased gamma-butyrolactone produced by the process of claim 1.
  • 44. The product of claim 43, wherein the gamma-butyrolactone product comprises less than 5% by weight of side products.
  • 45. The process of claim 1, wherein product is about 85% by weight or greater based on one gram of a gamma-butyrolactone in the product per gram of poly-4-hydroxybutyrate.
RELATED APPLICATIONS

This application claims the benefit of U.S. Provisional Application No. 61/610,795, filed on Mar. 14, 2012, and U.S. Provisional Application No. 61/522,182, filed on Aug. 10, 2011. The entire teachings of the above applications are incorporated herein by reference.

PCT Information
Filing Document Filing Date Country Kind 371c Date
PCT/US2012/050337 8/10/2012 WO 00 2/7/2014
Provisional Applications (2)
Number Date Country
61610795 Mar 2012 US
61522182 Aug 2011 US