Coronavirus disease 2019 (COVID-19) is an infectious disease caused by the severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2). The disease affects multiple organs in the body including the lungs. There is an urgent need for the development of therapeutics to combat COVID-19.
In certain aspects, the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64. In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
In some embodiments, the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63. In some embodiments, the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64. In some embodiments, the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65. In some embodiments, the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
In some embodiments, the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle.
In certain aspects, the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64. In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
In some embodiments, the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63. In some embodiments, the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64. In some embodiments, the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65. In some embodiments, the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66. In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
In some embodiments, the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64. In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
In some embodiments, the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63. In some embodiments, the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64. In some embodiments, the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65. In some embodiments, the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
In some embodiments, the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises SEQ ID NO: 16.
In some embodiments, the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus.
In certain aspects, the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises SEQ ID NO: 16.
In some embodiments, the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the antibody is administered in combination with a second pharmaceutical agent.
In certain aspects, the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises SEQ ID NO: 16.
In some embodiments, the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the antibody is administered in combination with a second pharmaceutical agent.
In certain aspects, the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 71, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 75, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 79, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 83, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 87, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 91, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 95, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 99, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 103, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 107, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 115, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 119, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 123, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 127, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 131, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 139, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 143, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 147, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 151, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 155, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 159, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 163, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 167, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 171, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 175, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 179, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:183.
In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 72, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 76, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 80, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 84, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 88, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 92, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 96, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 100, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 104, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 108, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 116, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 120, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 124, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 128, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 132, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 140, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 144, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 148, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 152, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 156, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 160, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 164, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 168, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 172, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 176, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 180, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:184.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 73, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 77, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 81, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 85, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 89, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 93, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 97, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 101, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 105, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 109, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 117, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 121, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 125, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 129, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 133, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 141, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 145, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 149, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 153, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 157, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 161, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 165, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 169, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 173, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 177, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 181, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 185.
In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 74, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 78, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 82, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 86, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 90, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 94, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 98, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 102, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 106, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 110, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 118, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 122, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 126, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 130, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 134, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 142, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 146, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 150, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 154, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 158, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 162, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 166, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 170, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 174, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 178, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 182, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 186.
In some embodiments, variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
In some embodiments, variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
In some embodiments, variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9.
In some embodiments, variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
In some embodiments, the variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3 of SEQ ID NO: 107; the CDR1, CDR2, and CDR3 of SEQ ID NO: 115; the CDR1, CDR2, and CDR3 of SEQ ID NO: 119, the CDR1, CDR2, and CDR3 of SEQ ID NO: 123, the CDR1, CDR2, and CDR3 of SEQ ID NO: 127; the CDR1, CDR2, and CDR3 of SEQ ID NO: 131; the CDR1, CDR2, and CDR3 of SEQ ID NO: 139; the CDR1, CDR2, and CDR3 of SEQ ID NO: 143; the CDR1, CDR2, and CDR3 of SEQ ID NO: 147; the CDR1, CDR2, and CDR3 of SEQ ID NO: 151; the CDR1, CDR2, and CDR3 of SEQ ID NO: 155; the CDR1, CDR2, and CDR3 of SEQ ID NO: 159; the CDR1, CDR2, and CDR3 of SEQ ID NO: 163; the CDR1, CDR2, and CDR3 of SEQ ID NO: 167, the CDR1, CDR2, and CDR3 of SEQ ID NO: 171, the CDR1, CDR2, and CDR3 of SEQ ID NO: 175, the CDR1, CDR2, and CDR3 of SEQ ID NO: 179, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 183.
In some embodiments, the variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3 of SEQ ID NO: 108; the CDR1, CDR2, and CDR3 of SEQ ID NO: 116; the CDR1, CDR2, and CDR3 of SEQ ID NO: 120; the CDR1, CDR2, and CDR3 of SEQ ID NO: 124; the CDR1, CDR2, and CDR3 of SEQ ID NO: 128; the CDR1, CDR2, and CDR3 of SEQ ID NO: 132; the CDR1, CDR2, and CDR3 of SEQ ID NO: 140; the CDR1, CDR2, and CDR3 of SEQ ID NO: 144; the CDR1, CDR2, and CDR3 of SEQ ID NO: 148; the CDR1, CDR2, and CDR3 of SEQ ID NO: 152; the CDR1, CDR2, and CDR3 of SEQ ID NO: 156; the CDR1, CDR2, and CDR3 of SEQ ID NO: 160; the CDR1, CDR2, and CDR3 of SEQ ID NO: 164; the CDR1, CDR2, and CDR3 of SEQ ID NO: 168, the CDR1, CDR2, and CDR3 of SEQ ID NO: 172, the CDR1, CDR2, and CDR3 of SEQ ID NO: 176, the CDR1, CDR2, and CDR3 of SEQ ID NO: 180, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 184.
In some embodiments, the variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105; the CDR1, CDR2, and CDR3 of SEQ ID NO: 109; the CDR1, CDR2, and CDR3 of SEQ ID NO: 117; the CDR1, CDR2, and CDR3 of SEQ ID NO: 121; the CDR1, CDR2, and CDR3 of SEQ ID NO: 125; the CDR1, CDR2, and CDR3 of SEQ ID NO: 129; the CDR1, CDR2, and CDR3 of SEQ ID NO: 133; the CDR1, CDR2, and CDR3 of SEQ ID NO: 141; the CDR1, CDR2, and CDR3 of SEQ ID NO: 145; the CDR1, CDR2, and CDR3 of SEQ ID NO: 149; the CDR1, CDR2, and CDR3 of SEQ ID NO: 153; the CDR1, CDR2, and CDR3 of SEQ ID NO: 157; the CDR1, CDR2, and CDR3 of SEQ ID NO: 161; the CDR1, CDR2, and CDR3 of SEQ ID NO: 165; the CDR1, CDR2, and CDR3 of SEQ ID NO: 169, the CDR1, CDR2, and CDR3 of SEQ ID NO: 173, the CDR1, CDR2, and CDR3 of SEQ ID NO: 177, the CDR1, CDR2, and CDR3 of SEQ ID NO: 181, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 185.
In some embodiments, the variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106; the CDR1, CDR2, and CDR3 of SEQ ID NO: 110; the CDR1, CDR2, and CDR3 of SEQ ID NO: 118; the CDR1, CDR2, and CDR3 of SEQ ID NO: 122; the CDR1, CDR2, and CDR3 of SEQ ID NO: 126; the CDR1, CDR2, and CDR3 of SEQ ID NO: 130; the CDR1, CDR2, and CDR3 of SEQ ID NO: 134; the CDR1, CDR2, and CDR3 of SEQ ID NO: 142; the CDR1, CDR2, and CDR3 of SEQ ID NO: 146; the CDR1, CDR2, and CDR3 of SEQ ID NO: 150; the CDR1, CDR2, and CDR3 of SEQ ID NO: 154; the CDR1, CDR2, and CDR3 of SEQ ID NO: 158; the CDR1, CDR2, and CDR3 of SEQ ID NO: 162, the CDR1, CDR2, and CDR3 of SEQ ID NO: 166; the CDR1, CDR2, and CDR3 of SEQ ID NO: 170, the CDR1, CDR2, and CDR3 of SEQ ID NO: 174, the CDR1, CDR2, and CDR3 of SEQ ID NO: 178, the CDR1, CDR2, and CDR3 of SEQ ID NO: 182, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 186.
In some embodiments, the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: 70. In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74. In some embodiments, the molecule comprises SEQ ID NO: 75, SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90. In some embodiments, the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106. In some embodiments, the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118. In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122.
In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126. In some embodiments, the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146. In some embodiments, the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162. In some embodiments, the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178. In some embodiments, the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 71, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 75, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 79, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 83, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 87, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 91, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 95, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 99, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 103, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 107, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 115, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 119, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 123, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 127, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 131, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 139, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 143, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 147, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 151, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 155, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 159, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 163, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 167, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 171, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 175, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 179, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:183.
In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 72, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 76, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 80, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 84, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 88, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 92, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 96, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 100, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 104, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 108, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 116, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 120, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 124, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 128, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 132, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 140, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 144, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 148, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 152, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 156, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 160, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 164, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 168, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 172, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 176, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 180, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:184.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 73, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 77, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 81, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 85, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 89, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 93, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 97, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 101, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 105, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 109, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 117, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 121, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 125, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 129, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 133, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 141, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 145, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 149, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 153, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 157, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 161, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 165, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 169, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 173, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 177, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 181, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 185.
In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 74, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 78, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 82, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 86, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 90, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 94, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 98, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 102, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 106, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 110, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 118, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 122, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 126, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 130, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 134, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 142, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 146, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 150, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 154, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 158, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 162, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 166, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 170, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 174, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 178, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 182, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 186.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9.
In some embodiments, variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
In some embodiments, the variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3 of SEQ ID NO: 107; the CDR1, CDR2, and CDR3 of SEQ ID NO: 115; the CDR1, CDR2, and CDR3 of SEQ ID NO: 119, the CDR1, CDR2, and CDR3 of SEQ ID NO: 123, the CDR1, CDR2, and CDR3 of SEQ ID NO: 127; the CDR1, CDR2, and CDR3 of SEQ ID NO: 131; the CDR1, CDR2, and CDR3 of SEQ ID NO: 139; the CDR1, CDR2, and CDR3 of SEQ ID NO: 143; the CDR1, CDR2, and CDR3 of SEQ ID NO: 147; the CDR1, CDR2, and CDR3 of SEQ ID NO: 151; the CDR1, CDR2, and CDR3 of SEQ ID NO: 155; the CDR1, CDR2, and CDR3 of SEQ ID NO: 159; the CDR1, CDR2, and CDR3 of SEQ ID NO: 163; the CDR1, CDR2, and CDR3 of SEQ ID NO: 167, the CDR1, CDR2, and CDR3 of SEQ ID NO: 171, the CDR1, CDR2, and CDR3 of SEQ ID NO: 175, the CDR1, CDR2, and CDR3 of SEQ ID NO: 179, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 183.
In some embodiments, the variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3 of SEQ ID NO: 108; the CDR1, CDR2, and CDR3 of SEQ ID NO: 116; the CDR1, CDR2, and CDR3 of SEQ ID NO: 120; the CDR1, CDR2, and CDR3 of SEQ ID NO: 124; the CDR1, CDR2, and CDR3 of SEQ ID NO: 128; the CDR1, CDR2, and CDR3 of SEQ ID NO: 132; the CDR1, CDR2, and CDR3 of SEQ ID NO: 140; the CDR1, CDR2, and CDR3 of SEQ ID NO: 144; the CDR1, CDR2, and CDR3 of SEQ ID NO: 148; the CDR1, CDR2, and CDR3 of SEQ ID NO: 152; the CDR1, CDR2, and CDR3 of SEQ ID NO: 156; the CDR1, CDR2, and CDR3 of SEQ ID NO: 160; the CDR1, CDR2, and CDR3 of SEQ ID NO: 164; the CDR1, CDR2, and CDR3 of SEQ ID NO: 168, the CDR1, CDR2, and CDR3 of SEQ ID NO: 172, the CDR1, CDR2, and CDR3 of SEQ ID NO: 176, the CDR1, CDR2, and CDR3 of SEQ ID NO: 180, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 184.
In some embodiments, the variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105; the CDR1, CDR2, and CDR3 of SEQ ID NO: 109; the CDR1, CDR2, and CDR3 of SEQ ID NO: 117; the CDR1, CDR2, and CDR3 of SEQ ID NO: 121; the CDR1, CDR2, and CDR3 of SEQ ID NO: 125; the CDR1, CDR2, and CDR3 of SEQ ID NO: 129; the CDR1, CDR2, and CDR3 of SEQ ID NO: 133; the CDR1, CDR2, and CDR3 of SEQ ID NO: 141; the CDR1, CDR2, and CDR3 of SEQ ID NO: 145; the CDR1, CDR2, and CDR3 of SEQ ID NO: 149; the CDR1, CDR2, and CDR3 of SEQ ID NO: 153; the CDR1, CDR2, and CDR3 of SEQ ID NO: 157; the CDR1, CDR2, and CDR3 of SEQ ID NO: 161; the CDR1, CDR2, and CDR3 of SEQ ID NO: 165; the CDR1, CDR2, and CDR3 of SEQ ID NO: 169, the CDR1, CDR2, and CDR3 of SEQ ID NO: 173, the CDR1, CDR2, and CDR3 of SEQ ID NO: 177, the CDR1, CDR2, and CDR3 of SEQ ID NO: 181, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 185.
In some embodiments, the variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106; the CDR1, CDR2, and CDR3 of SEQ ID NO: 110; the CDR1, CDR2, and CDR3 of SEQ ID NO: 118; the CDR1, CDR2, and CDR3 of SEQ ID NO: 122; the CDR1, CDR2, and CDR3 of SEQ ID NO: 126; the CDR1, CDR2, and CDR3 of SEQ ID NO: 130; the CDR1, CDR2, and CDR3 of SEQ ID NO: 134; the CDR1, CDR2, and CDR3 of SEQ ID NO: 142; the CDR1, CDR2, and CDR3 of SEQ ID NO: 146; the CDR1, CDR2, and CDR3 of SEQ ID NO: 150; the CDR1, CDR2, and CDR3 of SEQ ID NO: 154; the CDR1, CDR2, and CDR3 of SEQ ID NO: 158; the CDR1, CDR2, and CDR3 of SEQ ID NO: 162, the CDR1, CDR2, and CDR3 of SEQ ID NO: 166; the CDR1, CDR2, and CDR3 of SEQ ID NO: 170, the CDR1, CDR2, and CDR3 of SEQ ID NO: 174, the CDR1, CDR2, and CDR3 of SEQ ID NO: 178, the CDR1, CDR2, and CDR3 of SEQ ID NO: 182, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 186.
In some embodiments, the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74. In some embodiments, the molecule comprises SEQ ID NO: SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90. In some embodiments, the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106. In some embodiments, the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118.
In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122. In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126. In some embodiments, the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146. In some embodiments, the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162. In some embodiments, the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178. In some embodiments, the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27.
In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24.
In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the antibody is administered in combination with a second pharmaceutical agent.
In certain aspects, the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain. In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 187, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 211. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 188, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 212.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 189, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 213. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 190, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 214. In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214.
In some embodiments, the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50. In some embodiments, the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114. In some embodiments, the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain. In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 187, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 211.
In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 188, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 212.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 189, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 213.
In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 190, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 214.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43.
In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214. In some embodiments, the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50. In some embodiments, the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114. In some embodiments, the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
The patent or application file contains at least one drawing originally in color. To conform to the requirements for PCT patent applications, many of the figures presented herein are black and white representations of images originally created in color.
The following are definitions of terms used in the present specification. The initial definition provided for a group or term herein applies to that group or term throughout the present specification individually or as part of another group, unless otherwise indicated. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art.
The singular forms “a”, “an” and “the” include plural reference unless the context clearly dictates otherwise. The use of the word “a” or “an” when used in conjunction with the term “comprising” in the claims and/or the specification may mean “one,” but it is also consistent with the meaning of “one or more,” “at least one,” and “one or more than one.”
As used herein the term “about” is used herein to mean approximately, roughly, around, or in the region of When the term “about” is used in conjunction with a numerical range, it modifies that range by extending the boundaries above and below the numerical values set forth. In general, the term “about” is used herein to modify a numerical value above and below the stated value by a variance of 20 percent up or down (higher or lower).
As used herein, the term “subject” refers to a vertebrate animal. In one embodiment, the subject is a mammal or a mammalian species. In one embodiment, the subject is a human. In one embodiment, the subject is a healthy human adult. In other embodiments, the subject is a non-human vertebrate animal, including, without limitation, non-human primates, laboratory animals, livestock, racehorses, domesticated animals, and non-domesticated animals. In one embodiment, the term “human subjects” means a population of healthy human adults.
As used herein, the term “patient” refers to a human or animal.
The term “mammal” includes, but is not limited to, a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, or non-human primate, such as a monkey, chimpanzee, baboon or rhesus. In one embodiment, the mammal is a human.
As used herein, the term “therapeutically effective” includes prophylaxis, as well as treatment of a subject having suspected of having a viral infection.
In certain aspects, the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64. In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
In some embodiments, the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63. In some embodiments, the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64. In some embodiments, the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65. In some embodiments, the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
In some embodiments, the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle.
In certain aspects, the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64. In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
In some embodiments, the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63. In some embodiments, the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64. In some embodiments, the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65. In some embodiments, the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66. In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
In some embodiments, the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64. In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
In some embodiments, the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63. In some embodiments, the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64. In some embodiments, the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65. In some embodiments, the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
In some embodiments, the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises SEQ ID NO: 16.
In some embodiments, the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus.
In certain aspects, the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises SEQ ID NO: 16.
In some embodiments, the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the antibody is administered in combination with a second pharmaceutical agent.
In certain aspects, the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises SEQ ID NO: 16.
In some embodiments, the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the antibody is administered in combination with a second pharmaceutical agent.
In certain aspects, the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 71, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 75, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 79, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 83, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 87, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 91, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 95, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 99, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 103, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 107, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 115, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 119, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 123, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 127, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 131, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 139, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 143, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 147, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 151, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 155, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 159, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 163, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 167, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 171, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 175, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 179, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:183.
In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 72, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 76, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 80, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 84, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 88, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 92, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 96, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 100, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 104, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 108, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 116, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 120, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 124, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 128, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 132, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 140, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 144, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 148, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 152, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 156, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 160, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 164, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 168, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 172, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 176, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 180, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:184.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 73, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 77, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 81, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 85, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 89, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 93, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 97, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 101, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 105, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 109, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 117, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 121, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 125, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 129, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 133, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 141, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 145, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 149, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 153, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 157, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 161, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 165, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 169, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 173, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 177, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 181, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 185.
In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 74, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 78, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 82, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 86, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 90, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 94, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 98, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 102, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 106, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 110, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 118, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 122, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 126, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 130, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 134, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 142, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 146, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 150, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 154, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 158, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 162, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 166, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 170, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 174, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 178, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 182, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 186.
In some embodiments, variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
In some embodiments, variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
In some embodiments, variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9.
In some embodiments, variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
In some embodiments, the variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3 of SEQ ID NO: 107; the CDR1, CDR2, and CDR3 of SEQ ID NO: 115; the CDR1, CDR2, and CDR3 of SEQ ID NO: 119, the CDR1, CDR2, and CDR3 of SEQ ID NO: 123, the CDR1, CDR2, and CDR3 of SEQ ID NO: 127; the CDR1, CDR2, and CDR3 of SEQ ID NO: 131; the CDR1, CDR2, and CDR3 of SEQ ID NO: 139; the CDR1, CDR2, and CDR3 of SEQ ID NO: 143; the CDR1, CDR2, and CDR3 of SEQ ID NO: 147; the CDR1, CDR2, and CDR3 of SEQ ID NO: 151; the CDR1, CDR2, and CDR3 of SEQ ID NO: 155; the CDR1, CDR2, and CDR3 of SEQ ID NO: 159; the CDR1, CDR2, and CDR3 of SEQ ID NO: 163; the CDR1, CDR2, and CDR3 of SEQ ID NO: 167, the CDR1, CDR2, and CDR3 of SEQ ID NO: 171, the CDR1, CDR2, and CDR3 of SEQ ID NO: 175, the CDR1, CDR2, and CDR3 of SEQ ID NO: 179, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 183.
In some embodiments, the variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3 of SEQ ID NO: 108; the CDR1, CDR2, and CDR3 of SEQ ID NO: 116; the CDR1, CDR2, and CDR3 of SEQ ID NO: 120; the CDR1, CDR2, and CDR3 of SEQ ID NO: 124; the CDR1, CDR2, and CDR3 of SEQ ID NO: 128; the CDR1, CDR2, and CDR3 of SEQ ID NO: 132; the CDR1, CDR2, and CDR3 of SEQ ID NO: 140; the CDR1, CDR2, and CDR3 of SEQ ID NO: 144; the CDR1, CDR2, and CDR3 of SEQ ID NO: 148; the CDR1, CDR2, and CDR3 of SEQ ID NO: 152; the CDR1, CDR2, and CDR3 of SEQ ID NO: 156; the CDR1, CDR2, and CDR3 of SEQ ID NO: 160; the CDR1, CDR2, and CDR3 of SEQ ID NO: 164; the CDR1, CDR2, and CDR3 of SEQ ID NO: 168, the CDR1, CDR2, and CDR3 of SEQ ID NO: 172, the CDR1, CDR2, and CDR3 of SEQ ID NO: 176, the CDR1, CDR2, and CDR3 of SEQ ID NO: 180, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 184.
In some embodiments, the variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105; the CDR1, CDR2, and CDR3 of SEQ ID NO: 109; the CDR1, CDR2, and CDR3 of SEQ ID NO: 117; the CDR1, CDR2, and CDR3 of SEQ ID NO: 121; the CDR1, CDR2, and CDR3 of SEQ ID NO: 125; the CDR1, CDR2, and CDR3 of SEQ ID NO: 129; the CDR1, CDR2, and CDR3 of SEQ ID NO: 133; the CDR1, CDR2, and CDR3 of SEQ ID NO: 141; the CDR1, CDR2, and CDR3 of SEQ ID NO: 145; the CDR1, CDR2, and CDR3 of SEQ ID NO: 149; the CDR1, CDR2, and CDR3 of SEQ ID NO: 153; the CDR1, CDR2, and CDR3 of SEQ ID NO: 157; the CDR1, CDR2, and CDR3 of SEQ ID NO: 161; the CDR1, CDR2, and CDR3 of SEQ ID NO: 165; the CDR1, CDR2, and CDR3 of SEQ ID NO: 169, the CDR1, CDR2, and CDR3 of SEQ ID NO: 173, the CDR1, CDR2, and CDR3 of SEQ ID NO: 177, the CDR1, CDR2, and CDR3 of SEQ ID NO: 181, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 185.
In some embodiments, the variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106; the CDR1, CDR2, and CDR3 of SEQ ID NO: 110; the CDR1, CDR2, and CDR3 of SEQ ID NO: 118; the CDR1, CDR2, and CDR3 of SEQ ID NO: 122; the CDR1, CDR2, and CDR3 of SEQ ID NO: 126; the CDR1, CDR2, and CDR3 of SEQ ID NO: 130; the CDR1, CDR2, and CDR3 of SEQ ID NO: 134; the CDR1, CDR2, and CDR3 of SEQ ID NO: 142; the CDR1, CDR2, and CDR3 of SEQ ID NO: 146; the CDR1, CDR2, and CDR3 of SEQ ID NO: 150; the CDR1, CDR2, and CDR3 of SEQ ID NO: 154; the CDR1, CDR2, and CDR3 of SEQ ID NO: 158; the CDR1, CDR2, and CDR3 of SEQ ID NO: 162, the CDR1, CDR2, and CDR3 of SEQ ID NO: 166; the CDR1, CDR2, and CDR3 of SEQ ID NO: 170, the CDR1, CDR2, and CDR3 of SEQ ID NO: 174, the CDR1, CDR2, and CDR3 of SEQ ID NO: 178, the CDR1, CDR2, and CDR3 of SEQ ID NO: 182, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 186.
In some embodiments, the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74. In some embodiments, the molecule comprises SEQ ID NO: SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90. In some embodiments, the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106. In some embodiments, the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118. In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122.
In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126. In some embodiments, the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146. In some embodiments, the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162. In some embodiments, the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178. In some embodiments, the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 71, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 75, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 79, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 83, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 87, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 91, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 95, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 99, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 103, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 107, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 115, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 119, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 123, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 127, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 131, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 139, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 143, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 147, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 151, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 155, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 159, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 163, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 167, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 171, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 175, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 179, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:183.
In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 72, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 76, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 80, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 84, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 88, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 92, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 96, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 100, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 104, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 108, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 116, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 120, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 124, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 128, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 132, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 140, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 144, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 148, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 152, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 156, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 160, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 164, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 168, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 172, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 176, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 180, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:184.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 73, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 77, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 81, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 85, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 89, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 93, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 97, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 101, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 105, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 109, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 117, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 121, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 125, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 129, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 133, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 141, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 145, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 149, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 153, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 157, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 161, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 165, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 169, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 173, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 177, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 181, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 185.
In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 74, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 78, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 82, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 86, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 90, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 94, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 98, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 102, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 106, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 110, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 118, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 122, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 126, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 130, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 134, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 142, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 146, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 150, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 154, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 158, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 162, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 166, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 170, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 174, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 178, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 182, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 186.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9.
In some embodiments, variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
In some embodiments, the variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3 of SEQ ID NO: 107; the CDR1, CDR2, and CDR3 of SEQ ID NO: 115; the CDR1, CDR2, and CDR3 of SEQ ID NO: 119, the CDR1, CDR2, and CDR3 of SEQ ID NO: 123, the CDR1, CDR2, and CDR3 of SEQ ID NO: 127; the CDR1, CDR2, and CDR3 of SEQ ID NO: 131; the CDR1, CDR2, and CDR3 of SEQ ID NO: 139; the CDR1, CDR2, and CDR3 of SEQ ID NO: 143; the CDR1, CDR2, and CDR3 of SEQ ID NO: 147; the CDR1, CDR2, and CDR3 of SEQ ID NO: 151; the CDR1, CDR2, and CDR3 of SEQ ID NO: 155; the CDR1, CDR2, and CDR3 of SEQ ID NO: 159; the CDR1, CDR2, and CDR3 of SEQ ID NO: 163; the CDR1, CDR2, and CDR3 of SEQ ID NO: 167, the CDR1, CDR2, and CDR3 of SEQ ID NO: 171, the CDR1, CDR2, and CDR3 of SEQ ID NO: 175, the CDR1, CDR2, and CDR3 of SEQ ID NO: 179, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 183.
In some embodiments, the variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3 of SEQ ID NO: 108; the CDR1, CDR2, and CDR3 of SEQ ID NO: 116; the CDR1, CDR2, and CDR3 of SEQ ID NO: 120; the CDR1, CDR2, and CDR3 of SEQ ID NO: 124; the CDR1, CDR2, and CDR3 of SEQ ID NO: 128; the CDR1, CDR2, and CDR3 of SEQ ID NO: 132; the CDR1, CDR2, and CDR3 of SEQ ID NO: 140; the CDR1, CDR2, and CDR3 of SEQ ID NO: 144; the CDR1, CDR2, and CDR3 of SEQ ID NO: 148; the CDR1, CDR2, and CDR3 of SEQ ID NO: 152; the CDR1, CDR2, and CDR3 of SEQ ID NO: 156; the CDR1, CDR2, and CDR3 of SEQ ID NO: 160; the CDR1, CDR2, and CDR3 of SEQ ID NO: 164; the CDR1, CDR2, and CDR3 of SEQ ID NO: 168, the CDR1, CDR2, and CDR3 of SEQ ID NO: 172, the CDR1, CDR2, and CDR3 of SEQ ID NO: 176, the CDR1, CDR2, and CDR3 of SEQ ID NO: 180, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 184.
In some embodiments, the variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105; the CDR1, CDR2, and CDR3 of SEQ ID NO: 109; the CDR1, CDR2, and CDR3 of SEQ ID NO: 117; the CDR1, CDR2, and CDR3 of SEQ ID NO: 121; the CDR1, CDR2, and CDR3 of SEQ ID NO: 125; the CDR1, CDR2, and CDR3 of SEQ ID NO: 129; the CDR1, CDR2, and CDR3 of SEQ ID NO: 133; the CDR1, CDR2, and CDR3 of SEQ ID NO: 141; the CDR1, CDR2, and CDR3 of SEQ ID NO: 145; the CDR1, CDR2, and CDR3 of SEQ ID NO: 149; the CDR1, CDR2, and CDR3 of SEQ ID NO: 153; the CDR1, CDR2, and CDR3 of SEQ ID NO: 157; the CDR1, CDR2, and CDR3 of SEQ ID NO: 161; the CDR1, CDR2, and CDR3 of SEQ ID NO: 165; the CDR1, CDR2, and CDR3 of SEQ ID NO: 169, the CDR1, CDR2, and CDR3 of SEQ ID NO: 173, the CDR1, CDR2, and CDR3 of SEQ ID NO: 177, the CDR1, CDR2, and CDR3 of SEQ ID NO: 181, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 185.
In some embodiments, the variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106; the CDR1, CDR2, and CDR3 of SEQ ID NO: 110; the CDR1, CDR2, and CDR3 of SEQ ID NO: 118; the CDR1, CDR2, and CDR3 of SEQ ID NO: 122; the CDR1, CDR2, and CDR3 of SEQ ID NO: 126; the CDR1, CDR2, and CDR3 of SEQ ID NO: 130; the CDR1, CDR2, and CDR3 of SEQ ID NO: 134; the CDR1, CDR2, and CDR3 of SEQ ID NO: 142; the CDR1, CDR2, and CDR3 of SEQ ID NO: 146; the CDR1, CDR2, and CDR3 of SEQ ID NO: 150; the CDR1, CDR2, and CDR3 of SEQ ID NO: 154; the CDR1, CDR2, and CDR3 of SEQ ID NO: 158; the CDR1, CDR2, and CDR3 of SEQ ID NO: 162, the CDR1, CDR2, and CDR3 of SEQ ID NO: 166; the CDR1, CDR2, and CDR3 of SEQ ID NO: 170, the CDR1, CDR2, and CDR3 of SEQ ID NO: 174, the CDR1, CDR2, and CDR3 of SEQ ID NO: 178, the CDR1, CDR2, and CDR3 of SEQ ID NO: 182, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 186.
In some embodiments, the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74. In some embodiments, the molecule comprises SEQ ID NO: SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90. In some embodiments, the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106. In some embodiments, the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118.
In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122. In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126. In some embodiments, the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146. In some embodiments, the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162. In some embodiments, the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178. In some embodiments, the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27.
In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24.
In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the antibody is administered in combination with a second pharmaceutical agent.
In certain aspects, the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain. In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 187, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 211. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 188, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 212.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 189, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 213. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 190, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 214. In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214.
In some embodiments, the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50. In some embodiments, the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114. In some embodiments, the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain. In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 187, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 211.
In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 188, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 212.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 189, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 213.
In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 190, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 214.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43.
In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214. In some embodiments, the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50. In some embodiments, the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114. In some embodiments, the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64. In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
In some embodiments, the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63. In some embodiments, the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64. In some embodiments, the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65. In some embodiments, the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
In some embodiments, the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle.
In certain aspects, the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64. In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
In some embodiments, the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63. In some embodiments, the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64. In some embodiments, the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65. In some embodiments, the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66. In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
In some embodiments, the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule, wherein the bispecific molecule comprises a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 59 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 63. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64. In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66.
In some embodiments, the first heavy chain comprises SEQ ID NO: 59 or SEQ ID NO: 63. In some embodiments, the first light chain comprises SEQ ID NO: 60 or SEQ ID NO: 64. In some embodiments, the second heavy chain comprises SEQ ID NO: 61 or SEQ ID NO: 65. In some embodiments, the second light chain comprises SEQ ID NO: 62 or SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 59 or CDR1, CDR2, and CDR3 of SEQ ID NO: 63. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 60 or CDR1, CDR2, and CDR3 of SEQ ID NO: 64. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 61 or CDR1, CDR2, and CDR3 of SEQ ID NO: 65. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 62 or CDR1, CDR2, and CDR3 of SEQ ID NO: 66.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28 or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14.
In some embodiments, the variable domain of the first heavy chain comprises SEQ ID NO: 13 or SEQ ID NO: 27. In some embodiments, the variable domain of the first light chain comprises SEQ ID NO: 14 or SEQ ID NO: 28. In some embodiments, the variable domain of the second heavy chain comprises SEQ ID NO: 27 or SEQ ID NO: 13. In some embodiments, the variable domain of the second light chain comprises SEQ ID NO: 28 or SEQ ID NO: 14.
In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 59, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 60, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 61, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 62. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 63, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 64, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 65, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 66. In some embodiments, the molecule comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NOs: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the molecule comprises SEQ ID NOs: 59, 60, 61, and 62. In some embodiments, the molecule comprises SEQ ID NOs: 63, 64, 65, and 66. In some embodiments, the molecule comprises SEQ ID NOs: 13, 14, 27, and 28.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus strain. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on an S protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on an S protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises SEQ ID NO: 16. In some embodiments, the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus.
In certain aspects, the invention provides a method of treating a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises SEQ ID NO: 16.
In some embodiments, the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the antibody is administered in combination with a second pharmaceutical agent.
In certain aspects, the invention provides a method of preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises SEQ ID NO: 16.
In some embodiments, the antibody comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15 and a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16. In some embodiments, the antibody comprises SEQ ID NO: 15 and SEQ ID NO: 16.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 15. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 16.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is SARS-CoV-2. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the antibody is administered in combination with a second pharmaceutical agent.
In certain aspects, the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 3 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 7 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 11 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 31 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 33 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 3 and the light chain variable domain comprises SEQ ID NO: 4. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 7 and the light chain variable domain comprises SEQ ID NO: 8. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 9 and the light chain variable domain comprises SEQ ID NO: 10. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 11 and the light chain variable domain comprises SEQ ID NO: 12. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 17 and the light chain variable domain comprises SEQ ID NO: 18. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 19 and the light chain variable domain comprises SEQ ID NO: 20. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 21 and the light chain variable domain comprises SEQ ID NO: 22. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 25 and the light chain variable domain comprises SEQ ID NO: 26. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 29 and the light chain variable domain comprises SEQ ID NO: 30. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 31 and the light chain variable domain comprises SEQ ID NO: 32. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 33 and the light chain variable domain comprises SEQ ID NO: 34. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 37 and the light chain variable domain comprises SEQ ID NO: 38. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 39 and the light chain variable domain comprises SEQ ID NO: 40. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 43 and the light chain variable domain comprises SEQ ID NO: 44. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 45 and the light chain variable domain comprises SEQ ID NO: 46.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 3; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 7; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 9; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 11; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 17. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 19; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 21; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 25; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 29; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 31. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 33; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 37; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 39; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 43; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 45. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 4; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 8; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 10; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 12; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 18. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 20; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 22; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 26; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 30; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 32. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 34; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 38; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 40; the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 44; or the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 46.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 71, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 75, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 79, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 83, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 87, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 91, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 95, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 99, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 103, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 107, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 115, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 119, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 123, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 127, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 131, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 139, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 143, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 147, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 151, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 155, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 159, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 163, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 167, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 171, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 175, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 179, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:183.
In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 72, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 76, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 80, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 84, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 88, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 92, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 96, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 100, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 104, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 108, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 116, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 120, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 124, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 128, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 132, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 140, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 144, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 148, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 152, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 156, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 160, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 164, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 168, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 172, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 176, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 180, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:184.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 73, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 77, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 81, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 85, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 89, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 93, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 97, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 101, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 105, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 109, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 117, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 121, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 125, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 129, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 133, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 141, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 145, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 149, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 153, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 157, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 161, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 165, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 169, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 173, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 177, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 181, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 185.
In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 74, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 78, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 82, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 86, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 90, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 94, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 98, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 102, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 106, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 110, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 118, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 122, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 126, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 130, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 134, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 142, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 146, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 150, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 154, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 158, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 162, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 166, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 170, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 174, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 178, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 182, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 186.
In some embodiments, variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
In some embodiments, variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
In some embodiments, variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9.
In some embodiments, variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
In some embodiments, the variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3 of SEQ ID NO: 107; the CDR1, CDR2, and CDR3 of SEQ ID NO: 115; the CDR1, CDR2, and CDR3 of SEQ ID NO: 119, the CDR1, CDR2, and CDR3 of SEQ ID NO: 123, the CDR1, CDR2, and CDR3 of SEQ ID NO: 127; the CDR1, CDR2, and CDR3 of SEQ ID NO: 131; the CDR1, CDR2, and CDR3 of SEQ ID NO: 139; the CDR1, CDR2, and CDR3 of SEQ ID NO: 143; the CDR1, CDR2, and CDR3 of SEQ ID NO: 147; the CDR1, CDR2, and CDR3 of SEQ ID NO: 151; the CDR1, CDR2, and CDR3 of SEQ ID NO: 155; the CDR1, CDR2, and CDR3 of SEQ ID NO: 159; the CDR1, CDR2, and CDR3 of SEQ ID NO: 163; the CDR1, CDR2, and CDR3 of SEQ ID NO: 167, the CDR1, CDR2, and CDR3 of SEQ ID NO: 171, the CDR1, CDR2, and CDR3 of SEQ ID NO: 175, the CDR1, CDR2, and CDR3 of SEQ ID NO: 179, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 183.
In some embodiments, the variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3 of SEQ ID NO: 108; the CDR1, CDR2, and CDR3 of SEQ ID NO: 116; the CDR1, CDR2, and CDR3 of SEQ ID NO: 120; the CDR1, CDR2, and CDR3 of SEQ ID NO: 124; the CDR1, CDR2, and CDR3 of SEQ ID NO: 128; the CDR1, CDR2, and CDR3 of SEQ ID NO: 132; the CDR1, CDR2, and CDR3 of SEQ ID NO: 140; the CDR1, CDR2, and CDR3 of SEQ ID NO: 144; the CDR1, CDR2, and CDR3 of SEQ ID NO: 148; the CDR1, CDR2, and CDR3 of SEQ ID NO: 152; the CDR1, CDR2, and CDR3 of SEQ ID NO: 156; the CDR1, CDR2, and CDR3 of SEQ ID NO: 160; the CDR1, CDR2, and CDR3 of SEQ ID NO: 164; the CDR1, CDR2, and CDR3 of SEQ ID NO: 168, the CDR1, CDR2, and CDR3 of SEQ ID NO: 172, the CDR1, CDR2, and CDR3 of SEQ ID NO: 176, the CDR1, CDR2, and CDR3 of SEQ ID NO: 180, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 184.
In some embodiments, the variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105; the CDR1, CDR2, and CDR3 of SEQ ID NO: 109; the CDR1, CDR2, and CDR3 of SEQ ID NO: 117; the CDR1, CDR2, and CDR3 of SEQ ID NO: 121; the CDR1, CDR2, and CDR3 of SEQ ID NO: 125; the CDR1, CDR2, and CDR3 of SEQ ID NO: 129; the CDR1, CDR2, and CDR3 of SEQ ID NO: 133; the CDR1, CDR2, and CDR3 of SEQ ID NO: 141; the CDR1, CDR2, and CDR3 of SEQ ID NO: 145; the CDR1, CDR2, and CDR3 of SEQ ID NO: 149; the CDR1, CDR2, and CDR3 of SEQ ID NO: 153; the CDR1, CDR2, and CDR3 of SEQ ID NO: 157; the CDR1, CDR2, and CDR3 of SEQ ID NO: 161; the CDR1, CDR2, and CDR3 of SEQ ID NO: 165; the CDR1, CDR2, and CDR3 of SEQ ID NO: 169, the CDR1, CDR2, and CDR3 of SEQ ID NO: 173, the CDR1, CDR2, and CDR3 of SEQ ID NO: 177, the CDR1, CDR2, and CDR3 of SEQ ID NO: 181, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 185.
In some embodiments, the variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106; the CDR1, CDR2, and CDR3 of SEQ ID NO: 110; the CDR1, CDR2, and CDR3 of SEQ ID NO: 118; the CDR1, CDR2, and CDR3 of SEQ ID NO: 122; the CDR1, CDR2, and CDR3 of SEQ ID NO: 126; the CDR1, CDR2, and CDR3 of SEQ ID NO: 130; the CDR1, CDR2, and CDR3 of SEQ ID NO: 134; the CDR1, CDR2, and CDR3 of SEQ ID NO: 142; the CDR1, CDR2, and CDR3 of SEQ ID NO: 146; the CDR1, CDR2, and CDR3 of SEQ ID NO: 150; the CDR1, CDR2, and CDR3 of SEQ ID NO: 154; the CDR1, CDR2, and CDR3 of SEQ ID NO: 158; the CDR1, CDR2, and CDR3 of SEQ ID NO: 162, the CDR1, CDR2, and CDR3 of SEQ ID NO: 166; the CDR1, CDR2, and CDR3 of SEQ ID NO: 170, the CDR1, CDR2, and CDR3 of SEQ ID NO: 174, the CDR1, CDR2, and CDR3 of SEQ ID NO: 178, the CDR1, CDR2, and CDR3 of SEQ ID NO: 182, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 186.
In some embodiments, the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74. In some embodiments, the molecule comprises SEQ ID NO: SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90. In some embodiments, the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106. In some embodiments, the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118. In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122.
In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126. In some embodiments, the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146. In some embodiments, the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162. In some embodiments, the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178. In some embodiments, the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain.
In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another. In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 51, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 55, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 67, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 71, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 75, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 79, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 83, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 87, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 91, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 95, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 99, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 103, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 107, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 115, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 119, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 123, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 127, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 131, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 139, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 143, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 147, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 151, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 155, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 159, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 163, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 167, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 171, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 175, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 179, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:183.
In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 52, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 56, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 68; a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 72, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 76, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 80, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 84, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 88, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 92, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 96, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 100, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 104, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 108, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 116, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 120, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 124, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 128, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 132, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 140, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 144, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 148, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 152, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 156, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 160, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 164, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 168, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 172, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 176, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 180, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO:184.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 53, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 57, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 69, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 73, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 77, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 81, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 85, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 89, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 93, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 97, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 101, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 105, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 109, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 117, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 121, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 125, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 129, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 133, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 141, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 145, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 149, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 153, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 157, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 161, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 165, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 169, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 173, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 177, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 181, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 185.
In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 54, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 58, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 70, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 74, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 78, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 82, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 86, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 90, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 94, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 98, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 102, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 106, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 110, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 118, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 122, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 126, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 130, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 134, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 142, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 146, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 150, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 154, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 158, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 162, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 166, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 170, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 174, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 178, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 182, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 186.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 17, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41.
In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 18, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42.
In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 19, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 21, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 15, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 29, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 25, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 37, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 39, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 9.
In some embodiments, variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 20, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 22, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 16, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 30, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 26, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 38, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 40, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 10.
In some embodiments, the variable domain of the first heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 51; the CDR1, CDR2, and CDR3 of SEQ ID NO: the CDR1, CDR2, and CDR3 of SEQ ID NO: 67; the CDR1, CDR2, and CDR3 of SEQ ID NO: 71; the CDR1, CDR2, and CDR3 of SEQ ID NO: 75; the CDR1, CDR2, and CDR3 of SEQ ID NO: 79; the CDR1, CDR2, and CDR3 of SEQ ID NO: 83; the CDR1, CDR2, and CDR3 of SEQ ID NO: 87; the CDR1, CDR2, and CDR3 of SEQ ID NO: 91; the CDR1, CDR2, and CDR3 of SEQ ID NO: 95; the CDR1, CDR2, and CDR3 of SEQ ID NO: 99; the CDR1, CDR2, and CDR3 of SEQ ID NO: 103; the CDR1, CDR2, and CDR3 of SEQ ID NO: 107; the CDR1, CDR2, and CDR3 of SEQ ID NO: 115; the CDR1, CDR2, and CDR3 of SEQ ID NO: 119, the CDR1, CDR2, and CDR3 of SEQ ID NO: 123, the CDR1, CDR2, and CDR3 of SEQ ID NO: 127; the CDR1, CDR2, and CDR3 of SEQ ID NO: 131; the CDR1, CDR2, and CDR3 of SEQ ID NO: 139; the CDR1, CDR2, and CDR3 of SEQ ID NO: 143; the CDR1, CDR2, and CDR3 of SEQ ID NO: 147; the CDR1, CDR2, and CDR3 of SEQ ID NO: 151; the CDR1, CDR2, and CDR3 of SEQ ID NO: 155; the CDR1, CDR2, and CDR3 of SEQ ID NO: 159; the CDR1, CDR2, and CDR3 of SEQ ID NO: 163; the CDR1, CDR2, and CDR3 of SEQ ID NO: 167, the CDR1, CDR2, and CDR3 of SEQ ID NO: 171, the CDR1, CDR2, and CDR3 of SEQ ID NO: 175, the CDR1, CDR2, and CDR3 of SEQ ID NO: 179, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 183.
In some embodiments, the variable domain of the first light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 52; the CDR1, CDR2, and CDR3 of SEQ ID NO: 56; the CDR1, CDR2, and CDR3 of SEQ ID NO: 68; the CDR1, CDR2, and CDR3 of SEQ ID NO: 72; the CDR1, CDR2, and CDR3 of SEQ ID NO: 76; the CDR1, CDR2, and CDR3 of SEQ ID NO: 80; the CDR1, CDR2, and CDR3 of SEQ ID NO: 84; the CDR1, CDR2, and CDR3 of SEQ ID NO: 88; the CDR1, CDR2, and CDR3 of SEQ ID NO: 92; the CDR1, CDR2, and CDR3 of SEQ ID NO: 96; the CDR1, CDR2, and CDR3 of SEQ ID NO: 100; the CDR1, CDR2, and CDR3 of SEQ ID NO: 104; the CDR1, CDR2, and CDR3 of SEQ ID NO: 108; the CDR1, CDR2, and CDR3 of SEQ ID NO: 116; the CDR1, CDR2, and CDR3 of SEQ ID NO: 120; the CDR1, CDR2, and CDR3 of SEQ ID NO: 124; the CDR1, CDR2, and CDR3 of SEQ ID NO: 128; the CDR1, CDR2, and CDR3 of SEQ ID NO: 132; the CDR1, CDR2, and CDR3 of SEQ ID NO: 140; the CDR1, CDR2, and CDR3 of SEQ ID NO: 144; the CDR1, CDR2, and CDR3 of SEQ ID NO: 148; the CDR1, CDR2, and CDR3 of SEQ ID NO: 152; the CDR1, CDR2, and CDR3 of SEQ ID NO: 156; the CDR1, CDR2, and CDR3 of SEQ ID NO: 160; the CDR1, CDR2, and CDR3 of SEQ ID NO: 164; the CDR1, CDR2, and CDR3 of SEQ ID NO: 168, the CDR1, CDR2, and CDR3 of SEQ ID NO: 172, the CDR1, CDR2, and CDR3 of SEQ ID NO: 176, the CDR1, CDR2, and CDR3 of SEQ ID NO: 180, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 184.
In some embodiments, the variable domain of the second heavy chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 53; the CDR1, CDR2, and CDR3 of SEQ ID NO: 57; the CDR1, CDR2, and CDR3 of SEQ ID NO: 69; the CDR1, CDR2, and CDR3 of SEQ ID NO: 73; the CDR1, CDR2, and CDR3 of SEQ ID NO: 77; the CDR1, CDR2, and CDR3 of SEQ ID NO: 81; the CDR1, CDR2, and CDR3 of SEQ ID NO: 85; the CDR1, CDR2, and CDR3 of SEQ ID NO: 89; the CDR1, CDR2, and CDR3 of SEQ ID NO: 93; the CDR1, CDR2, and CDR3 of SEQ ID NO: 97; the CDR1, CDR2, and CDR3 of SEQ ID NO: 101; the CDR1, CDR2, and CDR3 of SEQ ID NO: 105; the CDR1, CDR2, and CDR3 of SEQ ID NO: 109; the CDR1, CDR2, and CDR3 of SEQ ID NO: 117; the CDR1, CDR2, and CDR3 of SEQ ID NO: 121; the CDR1, CDR2, and CDR3 of SEQ ID NO: 125; the CDR1, CDR2, and CDR3 of SEQ ID NO: 129; the CDR1, CDR2, and CDR3 of SEQ ID NO: 133; the CDR1, CDR2, and CDR3 of SEQ ID NO: 141; the CDR1, CDR2, and CDR3 of SEQ ID NO: 145; the CDR1, CDR2, and CDR3 of SEQ ID NO: 149; the CDR1, CDR2, and CDR3 of SEQ ID NO: 153; the CDR1, CDR2, and CDR3 of SEQ ID NO: 157; the CDR1, CDR2, and CDR3 of SEQ ID NO: 161; the CDR1, CDR2, and CDR3 of SEQ ID NO: 165; the CDR1, CDR2, and CDR3 of SEQ ID NO: 169, the CDR1, CDR2, and CDR3 of SEQ ID NO: 173, the CDR1, CDR2, and CDR3 of SEQ ID NO: 177, the CDR1, CDR2, and CDR3 of SEQ ID NO: 181, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 185.
In some embodiments, the variable domain of the second light chain comprises the CDR1, CDR2, and CDR3 of SEQ ID NO: 54; the CDR1, CDR2, and CDR3 of SEQ ID NO: 58; the CDR1, CDR2, and CDR3 of SEQ ID NO: 70; the CDR1, CDR2, and CDR3 of SEQ ID NO: 74; the CDR1, CDR2, and CDR3 of SEQ ID NO: 78; the CDR1, CDR2, and CDR3 of SEQ ID NO: 82; the CDR1, CDR2, and CDR3 of SEQ ID NO: 86; the CDR1, CDR2, and CDR3 of SEQ ID NO: 90; the CDR1, CDR2, and CDR3 of SEQ ID NO: 94; the CDR1, CDR2, and CDR3 of SEQ ID NO: 98; the CDR1, CDR2, and CDR3 of SEQ ID NO: 102; the CDR1, CDR2, and CDR3 of SEQ ID NO: 106; the CDR1, CDR2, and CDR3 of SEQ ID NO: 110; the CDR1, CDR2, and CDR3 of SEQ ID NO: 118; the CDR1, CDR2, and CDR3 of SEQ ID NO: 122; the CDR1, CDR2, and CDR3 of SEQ ID NO: 126; the CDR1, CDR2, and CDR3 of SEQ ID NO: 130; the CDR1, CDR2, and CDR3 of SEQ ID NO: 134; the CDR1, CDR2, and CDR3 of SEQ ID NO: 142; the CDR1, CDR2, and CDR3 of SEQ ID NO: 146; the CDR1, CDR2, and CDR3 of SEQ ID NO: 150; the CDR1, CDR2, and CDR3 of SEQ ID NO: 154; the CDR1, CDR2, and CDR3 of SEQ ID NO: 158; the CDR1, CDR2, and CDR3 of SEQ ID NO: 162, the CDR1, CDR2, and CDR3 of SEQ ID NO: 166; the CDR1, CDR2, and CDR3 of SEQ ID NO: 170, the CDR1, CDR2, and CDR3 of SEQ ID NO: 174, the CDR1, CDR2, and CDR3 of SEQ ID NO: 178, the CDR1, CDR2, and CDR3 of SEQ ID NO: 182, or the CDR1, CDR2, and CDR3 of SEQ ID NO: 186.
In some embodiments, the molecule comprises SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, and SEQ ID NO: 54. In some embodiments, the molecule comprises SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, and SEQ ID NO: 58. In some embodiments, the molecule comprises SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, and SEQ ID NO: In some embodiments, the molecule comprises SEQ ID NO: 71, SEQ ID NO: 72, SEQ ID NO: 73, and SEQ ID NO: 74. In some embodiments, the molecule comprises SEQ ID NO: SEQ ID NO: 76, SEQ ID NO: 77, and SEQ ID NO: 78. In some embodiments, the molecule comprises SEQ ID NO: 79, SEQ ID NO: 80, SEQ ID NO: 81, and SEQ ID NO: 82. In some embodiments, the molecule comprises SEQ ID NO: 83, SEQ ID NO: 84, SEQ ID NO: 85, and SEQ ID NO: 86. In some embodiments, the molecule comprises SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, and SEQ ID NO: 90. In some embodiments, the molecule comprises SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, and SEQ ID NO: 94. In some embodiments, the molecule comprises SEQ ID NO: 95, SEQ ID NO: 96, SEQ ID NO: 97, and SEQ ID NO: 98. In some embodiments, the molecule comprises SEQ ID NO: 99, SEQ ID NO: 100, SEQ ID NO: 101, and SEQ ID NO: 102. In some embodiments, the molecule comprises SEQ ID NO: 103, SEQ ID NO: 104, SEQ ID NO: 105, and SEQ ID NO: 106. In some embodiments, the molecule comprises SEQ ID NO: 107, SEQ ID NO: 108, SEQ ID NO: 109, and SEQ ID NO: 110. In some embodiments, the molecule comprises SEQ ID NO: 115, SEQ ID NO: 116, SEQ ID NO: 117, and SEQ ID NO: 118.
In some embodiments, the molecule comprises SEQ ID NO: 119, SEQ ID NO: 120, SEQ ID NO: 121, and SEQ ID NO: 122. In some embodiments, the molecule comprises SEQ ID NO: 123, SEQ ID NO: 124, SEQ ID NO: 125, and SEQ ID NO: 126. In some embodiments, the molecule comprises SEQ ID NO: 127, SEQ ID NO: 128, SEQ ID NO: 129, and SEQ ID NO: 130. In some embodiments, the molecule comprises SEQ ID NO: 131, SEQ ID NO: 132, SEQ ID NO: 133, and SEQ ID NO: 133. In some embodiments, the molecule comprises SEQ ID NO: 139, SEQ ID NO: 140, SEQ ID NO: 141, and SEQ ID NO: 142. In some embodiments, the molecule comprises SEQ ID NO: 143, SEQ ID NO: 144, SEQ ID NO: 145, and SEQ ID NO: 146. In some embodiments, the molecule comprises SEQ ID NO: 147, SEQ ID NO: 148, SEQ ID NO: 149, and SEQ ID NO: 150. In some embodiments, the molecule comprises SEQ ID NO: 151, SEQ ID NO: 152, SEQ ID NO: 153, and SEQ ID NO: 154. In some embodiments, the molecule comprises SEQ ID NO: 155, SEQ ID NO: 156, SEQ ID NO: 157, and SEQ ID NO: 158. In some embodiments, the molecule comprises SEQ ID NO: 159, SEQ ID NO: 160, SEQ ID NO: 161, and SEQ ID NO: 162. In some embodiments, the molecule comprises SEQ ID NO: 163, SEQ ID NO: 164, SEQ ID NO: 165, and SEQ ID NO: 166. In some embodiments, the molecule comprises SEQ ID NO: 167, SEQ ID NO: 168, SEQ ID NO: 169, and SEQ ID NO: 170. In some embodiments, the molecule comprises SEQ ID NO: 171, SEQ ID NO: 172, SEQ ID NO: 173, and SEQ ID NO: 174. In some embodiments, the molecule comprises SEQ ID NO: 175, SEQ ID NO: 176, SEQ ID NO: 177, and SEQ ID NO: 178. In some embodiments, the molecule comprises SEQ ID NO: 179, SEQ ID NO: 180, SEQ ID NO: 181, and SEQ ID NO: 182. In some embodiments, the molecule comprises SEQ ID NO: 183, SEQ ID NO: 184, SEQ ID NO: 185, and SEQ ID NO: 186.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
In certain aspects, the invention provides a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27.
In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2.
In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a therapeutically effective amount of a synthesized monoclonal antibody, or a functional fragment thereof, comprising a heavy chain having a variable domain and a constant domain and a light chain having a variable domain and a constant domain, wherein the antibody binds an antigen on a coronavirus particle.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6.
In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 5 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 41 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 1 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 23 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 24.
In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 27 and the light chain variable domain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 28.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 5 and the light chain variable domain comprises SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 41 and the light chain variable domain comprises SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 35 and the light chain variable domain comprises SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 1 and the light chain variable domain comprises SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 23 and the light chain variable domain comprises SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 13 and the light chain variable domain comprises SEQ ID NO: 14.
In some embodiments, the heavy chain variable domain comprises SEQ ID NO: 27 and the light chain variable domain comprises SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24.
In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 5 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 6. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 41 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 42. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 35 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 36. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 1 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 2. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 23 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 24. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 13 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 14. In some embodiments, the heavy chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 27 and the light chain variable domain comprises the CDR1, CDR2, and CDR3 regions of SEQ ID NO: 28.
In some embodiments, the antibody neutralizes a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the coronavirus is a SARS-CoV-2 variant strain. In some embodiments, the variant strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the antibody specifically binds an epitope on the surface of the coronavirus. In some embodiments, the epitope comprises at least a portion of a coronavirus spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a receptor binding domain (RBD) of a spike protein. In some embodiments, the at least a portion of a coronavirus spike protein comprises a N-Terminal domain (NTD) of a spike protein. In some embodiments, the coronavirus is a SARS-CoV-2 coronavirus. In some embodiments, the antibody is administered in combination with a second pharmaceutical agent.
In certain aspects, the invention provides a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain. In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 187, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 211. In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 188, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 212.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 189, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 213. In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 190, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 214. In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13.
In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43. In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214.
In some embodiments, the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50. In some embodiments, the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114. In some embodiments, the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427. In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle.
In certain aspects, the invention provides a method of treating or preventing a COVID-19 infection in a subject in need thereof, the method comprising administering to the subject a composition comprising a bispecific molecule comprising a first polypeptide chain and a second polypeptide chain, wherein: the first polypeptide chain comprises: a first light chain comprising a variable domain and a constant domain; a first heavy chain comprising a variable domain and a constant domain; the second polypeptide chain comprises: a second light chain comprising a variable domain and a constant domain; and a second heavy chain comprising a variable domain and a constant domain. In some embodiments, the first polypeptide chain and the second polypeptide chain are covalently bonded to one another.
In some embodiments, the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 47, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 111, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 135, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 187, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 211.
In some embodiments, the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 48, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 112, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 136, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 188, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 212.
In some embodiments, the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 49, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 113, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 137, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 189, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 213.
In some embodiments, the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 50, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 114, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 138, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 190, or a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 214.
In some embodiments, the variable domain of the first heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 35, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13. In some embodiments, the variable domain of the first light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 36, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14. In some embodiments, the variable domain of the second heavy chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 13, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 45, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 43.
In some embodiments, the variable domain of the second light chain comprises a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 14, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 46, a polypeptide sequence which is at least 60%, 62%, 65%, 67%, 70%, 72%, 75%, 77%, 80%, 82%, 85%, 87%, 90%, 92%, 95%, 97%, 98%, 99% identical to SEQ ID NO: 44.
In some embodiments, the variable domain of the first heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 47; CDR1, CDR2, and CDR3 of SEQ ID NO: 111; CDR1, CDR2, and CDR3 of SEQ ID NO: 135; CDR1, CDR2, and CDR3 of SEQ ID NO: 187; or CDR1, CDR2, and CDR3 of SEQ ID NO: 211. In some embodiments, the variable domain of the first light chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 48, CDR1, CDR2, and CDR3 of SEQ ID NO: 112; CDR1, CDR2, and CDR3 of SEQ ID NO: 136; CDR1, CDR2, and CDR3 of SEQ ID NO: 188; or CDR1, CDR2, and CDR3 of SEQ ID NO: 212. In some embodiments, the variable domain of the second heavy chain comprises CDR1, CDR2, and CDR3 of SEQ ID NO: 49, CDR1, CDR2, and CDR3 of SEQ ID NO: 113; CDR1, CDR2, and CDR3 of SEQ ID NO: 137; CDR1, CDR2, and CDR3 of SEQ ID NO: 189; or CDR1, CDR2, and CDR3 of SEQ ID NO: 213. In some embodiments, the variable domain of the second light chain comprises CDR1, CDR2, and CDR3 SEQ ID NO: 50, CDR1, CDR2, and CDR3 of SEQ ID NO: 114; CDR1, CDR2, and CDR3 of SEQ ID NO: 138; CDR1, CDR2, and CDR3 of SEQ ID NO: 190; or CDR1, CDR2, and CDR3 of SEQ ID NO: 214. In some embodiments, the molecule comprises SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, and SEQ ID NO: 50. In some embodiments, the molecule comprises SEQ ID NO:111, SEQ ID NO: 112, SEQ ID NO: 113, and SEQ ID NO: 114. In some embodiments, the molecule comprises SEQ ID NO: 135, SEQ ID NO: 135, SEQ ID NO: 137, and SEQ ID NO: 138. In some embodiments, the molecule comprises SEQ ID NO: 187, SEQ ID NO: 188, SEQ ID NO: 189, and SEQ ID NO: 190. In some embodiments, the molecule comprises SEQ ID NO: 211, SEQ ID NO: 212, SEQ ID NO: 213, and SEQ ID NO: 214.
In some embodiments, the molecule further comprises one or more disulfide bonds. In some embodiments, the molecule further comprises one or more linker sequences. In some embodiments, the molecule is capable of neutralizing a coronavirus. In some embodiments, the coronavirus is a SARS-CoV-2 virus. In some embodiments, the SARS-CoV-2 virus strain is selected from the group consisting of WA1, B.1.1.7, B1.526, B1.351, P1, B1.352, and B.1.427.
In some embodiments, the molecule specifically recognizes a first epitope and a second epitope on a SARS-CoV-2 particle. In some embodiments, the first epitope comprises at least a portion of a receptor binding domain (RBD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the second epitope comprises at least a portion of a N-terminal domain (NTD) on a spike protein of a SARS-CoV-2 particle. In some embodiments, the composition is administered in combination with a second therapeutic agent.
Antibody Structure
Antibodies are glycoproteins with an immunoglobulin (Ig) monomeric functional domain. Secreted antibodies can have multiple Ig units. The Ig monomer is a “Y”-shaped molecule with four polypeptide chains: two identical heavy chains and two identical light chains. The chains can be connected by disulfide bonds.
There are five types of mammalian Ig heavy chains referred to as: α, δ, ε, γ, and μ, defining the class of antibody. Distinct heavy chains differ in their size and composition. Each heavy chain comprises of two regions—the constant region and the variable region. The constant region is identical in all antibodies of the same isotype, but differs in antibodies of different isotypes. The variable region of the heavy chain differs in antibodies produced by different B cells, but is the same for all antibodies produced by a single B cell or a B cell clone. The variable region of each heavy chain is approximately 110 amino acids long.
There are two types of light chains in mammals—lambda (λ) and kappa (κ). A light chain comprises of two domains, the constant domain and the variable domain. The approximate length of the light chain is 211 to 217 amino acids. Each antibody contains two identical light chains.
The two arms of the Y-shaped antibody molecule include the antibody binding sites, which that can bind two antigens. The two antigens can be identical or they can be different for example in bispecific antibodies. This region of the antibody is called the Fab (fragment, antigen binding) region and it confers the antibody with its specificity. Thus, the Fab includes one constant and one variable domain from each heavy and each light chain of the antibody. The variable domain, also called the Fv region, is the most important region for recognizing and binding to antigens such as viral proteins or receptors on the surface of host cells. There are three variable loops light chain (VL) and three variable loops on the heavy (VH) chain of the antibody, which are responsible for binding to the antigen. The loops are called the complementarity determining regions (CDRs).
The base of the Y-shaped molecule is called the Fc (Fragment, crystallizable) region and it is important for modulating immune cell activity. The Fc includes two heavy chains and it can bind to specific to ensure that each antibody generates an appropriate immune response for a particular antigen. It can also mediate different physiological effects including opsonization, cell lysis, and degranulation of mast cells, basophils and eosinophils. Additionally, the two N-terminal fragments of the antibody are called the Fab region, and the C-terminal fragment is called the Fc region.
In one embodiment, the subject matter described herein relates to monoclonal and bispecific antibodies, variants, fusion proteins comprising an antibody portion with an antigen recognition site of the required specificity. In some embodiments, antigen-binding fragment of an antibody is a portion of an antibody that possesses an at least one antigen recognition site. Fragments include for example but not limited to Fab, Fab′, F(ab′)2 Fv), and single chain (scFv).
The antibodies can be produced recombinantly by any means known in the art. In one embodiment, such an antibody is sequenced and the polynucleotide sequence is then cloned into a vector for expression or propagation. In one embodiment, the antibody is synthesized. The sequence encoding the antibody of interest may be maintained in a vector in a host cell and the host cell can then be expanded and frozen for future use. The polynucleotide sequence of such antibodies may be used for genetic manipulation to generate the bispecific molecules described herein.
Antibody Therapy
Antibody therapy uses monoclonal or bispecific antibodies to bind to pre-determined antigens. This therapy can stimulate the patient's immune system to attack those antigens such as viruses. In the clinical setting, the most common route of administration of therapeutic antibodies is the intravenous (IV) infusion. The can be followed by subcutaneous administration, although an intramuscular injection is also possible. Oral administration routes of antibodies are also being developed. The monoclonal and bispecific antibodies described herein can be administered to a subject through any useful method known in the art. The monoclonal and bispecific antibodies described herein can be administered daily. The monoclonal and bispecific antibodies described herein can be administered twice, three times, four times, five times, or several times a day. The monoclonal and bispecific antibodies described herein can be administered for 1, 2, 3, 4, 5, 6 days or for 1 or 2 weeks. In some embodiments, the monoclonal and bispecific antibodies described herein can be administered for a period longer than two weeks. The monoclonal and bispecific antibodies described herein can be administered in combination with any other therapeutically effective agent or a combination of agents.
COVID-19 Therapeutics—mAbs
The only treatment currently approved for the treatment of patients with COVID-19 is remdesivir. Remdesivir shows some benefit in shortening the time for recovery from severe COVID-19. There is currently an effort in the field to identify biologics or small molecules that have more potent and broad effects against the spread of the SARS-CoV-2 virus.
In some embodiments, the subject matter described herein relates to the isolation, characterization and providing the sequences of potent monoclonal antibodies (mAbs) against the SARS-CoV-2 virus, which causes COVID-19. In some embodiments, the subject matter disclosed herein describes the optimal COVID-19 patients from which to isolate potent mAbs against SARS-CoV-2. The mAbs can be isolated from blood samples from patients diagnosed with COVID-19 or patients exhibiting COVID-19 related symptoms. Once the antibody sequences are determined from these samples, the mAbs can be synthesized in vitro. In some embodiments, the mAb sequences can be modified and optimized prior to synthesis. These mAb can be used for subsequent characterization experiments. In some embodiment, the subject matter disclosed herein relates to the identification of mAbs significantly more potent, with than any other SARS-CoV-2 mAb known in the art to date. In some embodiments, the mAb lower IC50 and/or IC90 values,
The SARS-CoV-2 neutralizing mAbs described herein can be used for treatment of subjects infected with SARS-CoV-2. In some embodiments, the mAbs described herein reduce SARS-CoV-2 viral load in a subject in need thereof. In some embodiment, the mAbs described herein decrease disease severity in a subject in need thereof. In some embodiments, the mAbs described herein improve clinical outcome of COVID-19 in subjects in need thereof.
In some embodiments, the mAbs described herein can be used as prophylaxis to prevent high risk subjects and individuals from becoming infected with SARS-CoV-2. In some embodiment, the high risk subject can be healthcare workers in close proximity to COVID-19 patients or the family members of these healthcare workers. In some embodiment, the mAbs described herein can be used as prophylaxis for the general population at large.
Flow Through of Identification Process for the Potent COVID-19 mAbs
In one embodiment, the subject matter disclosed herein related to identification, isolation from patients, and characterization of potent mAbs against SARS-CoV-2, its variants, or any coronavirus. One embodiment of the method described herein for isolation of such antibodies is described below. In one embodiment, the subject matter disclosed herein related to administration of the antibodies described herein to subjects in need thereof to treat or prevent disease. In some embodiments, the treatment includes administration of one type of monoclonal antibody. In some embodiments, the treatment includes administration of a cocktail of two or more monoclonal antibodies.
Plasma samples from COVID-19 patients can be isolated and evaluated for the ability of potential antibodies contained within these plasma samples to: A) bind the viral envelope of SARS-CoV-2 or a variant strain (analysis can be by ELISA); and B) neutralize SARS-CoV-2 or a variant strain in vitro. Plasma samples from COVID-19 patients with severe disease or symptomology can have stronger antiviral activities than plasma samples from COVID-19 patients with non-severe disease. Plasma sample which are determined to have the strongest activity can be used to select patients for further analysis of monoclonal antibodies.
Peripheral blood mononuclear cells (PMBCs) can be isolated from COVID-19 patients whose plasma samples exhibit the strongest activity in order to isolate single B cells. These B-cells contain mAb-sequences that can be responsible for the strong plasma antiviral activity identified above. The antibody sequences can be recovered from these single B cells by any high throughput sequencing methods known in the art. The genes from the single B cells encoding for these mAb sequences can be synthesized and cloned into expression vectors. The encoded monoclonal antibodies can then be expressed in vitro and purified for subsequent analyses and characterization.
In vitro-produced and purified monoclonal antibodies can then tested for their ability to: A) bind to the virus envelope of SARS-CoV-2 or a variant strain (analysis can be by ELISA); and B) neutralize SARS-CoV-2 or a variant strain, thus stopping or preventing infections caused by coronaviruses. Neutralization analysis can be performed by both pseudotyped virus assay and/or live virus neutralization assays. Those mAbs that perform the best can then subjected to additional characterization studies including but not limited to ELISA competition assays, surface plasmon resonance (SPR) binding affinity analyses and size exclusion chromatography. Antibody performance can be indicated by potency, IC50 concentration, and IC90 concentration. An IC50 is a quantitative measure used to indicated the concentration of an antibody needed to inhibit a virus or a virus population by 50%. An IC90 is a quantitative measure used to indicated the concentration of an antibody needed to inhibit a virus or a virus population by 90%. These are measures of the potency of the antibody.
In one embodiment of the subject matter described herein, more than 100 million cells have been screened by the described method from 8 patients, 276 mAb sequences were synthesized, 66 mAbs were tested and characterized. In one embodiment, 6 mAbs have emerged as top hits with good antiviral activity against SARS-CoV-2. In one embodiment, 1 mAb has emerged with exceptional antiviral activity and potency against SARS-CoV-2. In one embodiment, the subject matter described herein relates to monoclonal antibodies with significantly higher potency than any other SARS-CoV-2 mAb known in the art to date. In one embodiment, the subject matter described herein relates to monoclonal antibodies with significantly lower IC50 and IC90 concentration values than any other mAb known in the art to date against SARS-CoV-2 or a variant strain.
In one embodiment, additional monoclonal antibodies are identified from the samples in the screening pipeline and if additional plasma samples from COVID-19 patient are screened for their ability to neutralize SARS-CoV-2.
The mAbs generated through the process described herein are significantly more potent than other antibodies known in the art against SARS-CoV-2 or a variant strain. In some embodiment, the subject matter described herein relates to mAbs against SARS-CoV-2 with high antiviral activity in subjects. In some embodiments the high antiviral activity is higher than the activity of SARS-CoV-2 known in the art. In some embodiments, the subjects are humans. In some embodiments, the subjects are human patients.
In some embodiments, more potent antibodies require smaller amounts (lower concentrations) to be administered to the subject in need thereof to achieve the desired COVID-19-related clinical effects. This can be achieved through administration of lower dosages to subjects. Therefore fewer potential side effects will be observed with less frequent dosing regimens or smaller amount of antibodies. This potentially will lower the antibody production costs. In some embodiments, the mAb against SARS-CoV-2 lead to faster recovery of subjects with COVID-19 and greater efficacy overall.
In some embodiments, the mAb described herein target multiple epitopes on the SARS-CoV-2 virus or a variant strain. In some embodiments, the subject matter disclosed herein relates to an antibody combination cocktails to be administered to the subject. In some embodiments, the antibodies in the cocktails target multiple epitopes on the SARS-CoV-2 virus or a variant strain. In some embodiments, the antibody combination cocktails provide even greater efficacy and lower the possibility of viral resistance than each individual antibody of the cocktail.
In some embodiments, the mAb described herein can be used for treatment and/or prevention of COVID-19 infection. In some embodiments, the mAbs described herein can be administered to the subject as a prevention or prophylaxis. In some embodiments, the mAbs can be used for diagnosis of COVID-19 subject exposure. In some embodiment, the mAbs described herein can be utilized in laboratory research and development activities.
Sequences of the mAbs Described Herein Against SARS-CoV-2 or a Variant Strain
Underlined and italicized amino acids represent the respective complementarity-determining regions (CDRs). There are three CDRs per sequence, appearing on the sequence in the order CDR1, CDR2, and CDR3.
In one embodiment, the monoclonal antibody 2-4 comprises SEQ ID NOs: 1 and 2.
SEQ ID NO: 1 is the variable region of the heavy chain of antibody number 2-4.
WINPNSGGTNYTQMFQG
RVTMTRDTSISTAYMEVSRLRSDDTAVYYCAR
DRSWAVVYYYMDV
WGKGTTVTVSS
SEQ ID NO: 2 is the variable region of the light chain of antibody number 2-4.
LV
FGGGTKLTVL
In one embodiment, the monoclonal antibody 4-8 comprises SEQ ID NOs: 3 and 4.
SEQ ID NO: 3 is the variable region of the heavy chain of antibody number 4-8.
RIIPILGIANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSS
SEQ ID NO: 4 is the variable region of the light chain of antibody number 4-8
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
In one embodiment, the monoclonal antibody 2-15 comprises SEQ ID NOs: 5 and 6.
SEQ ID NO: 5 is the variable region of the heavy chain of antibody number 2-15.
WINPISDGTNYAQKFQG
WVTMTRDTSISTVYMELSRLRSDDTAVYYCAR
GGSRCSGGNCYGWAYDAFDI
WGQGTMITVSS
SEQ ID NO: 6 is the variable region of the light chain of antibody number 2-15.
FV
FGTGTKVTVL
In one embodiment, the monoclonal antibody 2-38 comprises SEQ ID NOs: 7 and 8.
SEQ ID NO: 7 is the variable region of the heavy chain of antibody number 2-38.
SISSSSSYIYYADSVKG
RFTISRDNAKNSLYLQMNSLRAEDTAVYYCTR
AGWELRLDAFDI
WGQGTMVTVSS
SEQ ID NO: 8 is the variable region of the light chain of antibody number 2-38.
KNNRPS
GIPDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGILFG
In one embodiment, the monoclonal antibody 2-51 comprises SEQ ID NOs: 9 and 10.
SEQ ID NO: 9 is the variable region of the heavy chain of antibody number 2-51.
G
F
DPEDVETIYAQQFQG
RVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAYKSTWYFGY
WGQGTLVTVSS
SEQ ID NO: 10 is the variable region of the light chain of antibody number 2-51.
G
FGGGTKLTVL
In one embodiment, the monoclonal antibody 4-32 comprises SEQ ID NOs: 11 and 12.
SEQ ID NO: 11 is the variable region of the heavy chain of antibody number 4-32.
GISWNSGSIGYADSVKG
RFTISRDNAKNSLYLQMNSLRAEDTALYYCAK
GLVQDYDSSGYFFADRVSAFDI
WGQGTMVTVSS
SEQ ID NO: 12 is the variable region of the light chain of antibody number 4-32.
AASSLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPLTF
In one embodiment, the monoclonal antibody 2-7 comprises SEQ ID NOs: 13 and 14.
SEQ ID NO: 13 is the variable region of the heavy chain of antibody number 2-7, which specifically recognizes the receptor binding domain (RBD).
SEQ ID NO: 14 is the variable region of the light chain of antibody number 2-7, which specifically recognizes the RBD.
V
FGGGTKLTVL
In one embodiment, the monoclonal antibody 1-57 comprises SEQ ID NOs: 15 and 16.
SEQ ID NO: 15 is the variable region of the heavy chain of antibody number 1-57, which specifically recognizes the RBD.
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 16 is the variable region of the light chain of antibody number 1-57, which specifically recognizes the RBD.
In one embodiment, the monoclonal antibody 1-20 comprises SEQ ID NOs: 17 and 18.
SEQ ID NO: 17 is the variable region of the heavy chain of antibody number 1-which specifically recognizes the RBD.
VIYSGGSTFYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARD
LFYYGMDV
WGQGTTVTVSS
SEQ ID NO: 18 is the variable region of the light chain of antibody number 1-20, which specifically recognizes the RBD.
AASTLQS
GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPCFG
In one embodiment, the monoclonal antibody 2-30 comprises SEQ ID NOs: 19 and 20.
SEQ ID NO: 19 is the variable region of the heavy chain of antibody number 2-which specifically recognizes the RBD.
AISYDGNNKYYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
SILYGGGMDI
WGQGTTVTVSS
SEQ ID NO: 20 is the variable region of the light chain of antibody number 2-30, which specifically recognizes the RBD.
AASTLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNSYPLTF
In one embodiment, the monoclonal antibody 4-20 comprises SEQ ID NOs: 21 and 22.
SEQ ID NO: 21 is the variable region of the heavy chain of antibody number 4
IINPSGGGTTYAQ
KFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
PGGGSYQEFDY
WGQGTLVTVSS
SEQ ID NO: 22 is the variable region of the light chain of antibody number 4-20, which specifically recognizes the RBD.
AASSLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYNTLQVT
In one embodiment, the monoclonal antibody 4-18 comprises SEQ ID NOs: 23 and 24.
SEQ ID NO: 23 is the variable region of the heavy chain of antibody number 4-18, which specifically recognizes the N-Terminal domain (NTD).
VISYDGSNKHYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
DSGYNYGYSWFDP
WGQGTLVTVSS
SEQ ID NO: 24 is the variable region of the light chain of antibody number 4-18, which specifically recognizes the NTD.
DSERPS
GIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDNSGTYPN
WV
FGGGTKLTVL
In one embodiment, the monoclonal antibody 5-24 comprises SEQ ID NOs: 25 and 26.
SEQ ID NO: 25 is the variable region of the heavy chain of antibody number 5-24, which specifically recognizes the NTD.
VIWYDGSKKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
DPRDYYDFWSGYDYYYGLDV
WGQGTTVTVSS
SEQ ID NO: 26 is the variable region of the light chain of antibody number 5-24, which specifically recognizes the NTD.
T
FGGGTKVEIK
In one embodiment, the monoclonal antibody 5-7 comprises SEQ ID NOs: 27 and 28.
SEQ ID NO: 27 is the variable region of the heavy chain of antibody number 5-7, which specifically recognizes the NTD.
VINPSGGSTSYAE
KFRGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
DREPHSDSSGYWDSLKYYYYYALDV
WGQGTTVTVSS
SEQ ID NO: 28 is the variable region of the light chain of antibody number 5-7, which specifically recognizes the NTD.
AASTLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNTYPFTF
In one embodiment, the monoclonal antibody 1-68 comprises SEQ ID NOs: 29 and 30.
SEQ ID NO: 29 is the variable region of the heavy chain of antibody number 1-68, which specifically recognize the NTD.
GFDPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAVAGSSDVWYYYYGMDV
WGQGTTVTVSS
SEQ ID NO: 30 is the variable region of the light chain of antibody number 1-68, which specifically recognizes the NTD.
YV
FGTGTKVTVL
In one embodiment, the monoclonal antibody 2-43 comprises SEQ ID NOs: 31 and 32.
SEQ ID NO: 31 is the variable region of the heavy chain of antibody number 2-43, which recognizes an epitope other than the RBD or the NTD.
WINPNSGGTNYAQ
KFQGRVTMTRDTSITTAYMELRRLRSDDTAVYYCAR
GLGVGCSGGNCYLDYYYMDV
WGKGTTVTVSS
SEQ ID NO: 32 is the variable region of the light chain of antibody number 2-43, which recognizes an epitope other than the RBD or the NTD.
WV
FGGGTKLTVL
In one embodiment, the monoclonal antibody 4-19 comprises SEQ ID NOs: 33 and 34.
SEQ ID NO: 33 is the variable region of the heavy chain of antibody number 4-19, which recognizes an epitope other than the RBD or the NTD.
YIYYSGSTNYNPSL
KSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARS
AKHWLAPPGDYYYYMDV
WGKGTTVTVSS
SEQ ID NO: 34 is the variable region of the light chain of antibody number 4-19, which recognizes an epitope other than the RBD or the NTD.
AASTLQS
GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYLTFG
In one embodiment, the monoclonal antibody 2-17 comprises SEQ ID NOs: 35 and 36.
SEQ ID NO: 35 is the variable region of the heavy chain of antibody number 2-17, which recognizes an epitope other than the RBD or the NTD.
GNIPIFGTANYAQ
KFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR
GVGYRGVIPLNWFDP
WGQGTVVTVSS
SEQ ID NO: 36 is the variable region of the light chain of antibody number 2-17, which recognizes an epitope other than the RBD or the NTD.
GASTRAT
GIPVRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPFT
RBD Binders
In one embodiment, the monoclonal antibody 2-36 comprises SEQ ID NOs: 37 and 38.
SEQ ID NO: 37 is the variable region of the heavy chain of antibody number 2-36, which specifically recognizes the RBD.
SEQ ID NO: 38 is the variable region of the light chain of antibody number 2-36, which specifically recognizes the RBD.
In one embodiment, the monoclonal antibody 1-87 comprises SEQ ID NOs: 39 and 40.
SEQ ID NO: 39 is the variable region of the heavy chain of antibody number 1-87, which specifically recognizes the NTD.
G
F
DPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GIAVIGPPPSTYYYYGMDV
WGQGTTVTVSS
SEQ ID NO: 40 is the variable region of the light chain of antibody number 1-87, which specifically recognizes the NTD.
YV
FGTGTKVTVL
In one embodiment, the monoclonal antibody 2-15mut comprises SEQ ID NOs: 41 and 42.
SEQ ID NO: 41 is the variable region of the heavy chain of the 2-15mut mAb.
WINPISDGTNYAQ
KFQGWVTMTRDTSISTVYMELSRLRSDDTAVYYCAR
GGSRCSGGNCYGWAYDAFDI
WGQGTMITVSS
SEQ ID NO: 42 is the variable region of the light chain of the 2-15mut mAb.
FV
FGTGTKVTVL
In one embodiment, the monoclonal antibody 4-8(39/51) comprises SEQ ID NOs: 43 and 44.
SEQ ID NO: 43 is the variable region of the heavy chain of the 4-8(39/51) mAb.
RNIPILGIANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSS
SEQ ID NO: 44 is the variable region of the light chain of the 4-8(39/51) mAb.
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
In one embodiment, the monoclonal antibody 4-8(39/51/57) comprises SEQ ID NOs: 45 and 46.
SEQ ID NO: 45 is the variable region of the heavy chain of the 4-8(39/51/57) mAb.
RNIPILGTANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSS
SEQ ID NO: 46 is the variable region of the light chain of the 4-8(39/51/57) mAb.
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
Nucleic Acid Sequences of the Monoclonal Antibodies Described Herein Against SARS-CoV-2 or Variant Strains
In some embodiments, the subject matter disclosed herein relates to DNA sequences that encode any of the monoclonal antibodies disclosed herein. In some embodiments, the subject matter disclosed herein relates to mRNA sequences that encode any of the antibodies disclosed herein. As used herein, the terms “nucleic acid” and “nucleotide sequence” refer to both DNA and RNA molecules, including base-modified, sugar-modified or backbone-modified DNA or RNA molecules.
In some embodiments, the subject matter disclosed herein relates to an isolated nucleic acid having a nucleotide sequence encoding any of the antibodies of the present disclosure. In some embodiments, the nucleotide sequences encoding any of the antibodies of the present disclosure are codon-optimized for efficient expression in a host system. In some embodiments, the nucleotide sequences encoding any of the antibodies of the present disclosure are codon-optimized to increase the translational efficiency of the nucleotide sequences. In some embodiments, the nucleotide sequences encoding any of the antibodies of the present disclosure are codon-optimized to accommodate the codon bias of the host system. In some embodiments, the nucleotide sequences encoding any of the antibodies of the present disclosure are codon-optimized to remove redundancy and/or evolutionary constraints, including, but not limited to, the availability of tRNA isoacceptors, TATA box, Shine-Dalgarno sequences.
In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 1. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 2. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 3. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 4. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 5. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 6. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 7. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 8. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 9. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 10. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 11. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 12. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 13. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 14. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 15. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 16. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 17. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 18. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 19. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 20. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 21. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 22. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 23. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 24. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 25. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 26. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 27. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 28. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 29. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 30. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 31. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 32. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 33. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 34. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 35. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 36. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 37. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 38. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 39. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 40. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 41. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 42. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 43. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 44. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 45. In some embodiments, the subject matter disclosed herein relates to a codon-optimized, isolated nucleic acid comprising a nucleic acid sequence encoding a monoclonal antibody including SEQ ID NO: 46.
In some embodiments, the subject matter disclosed herein relates to a pharmaceutical composition comprising an isolated nucleic acid having a nucleotide sequence encoding any of the antibodies of the present disclosure and a pharmaceutically acceptable carrier. In some embodiments, the subject matter disclosed herein relates to a pharmaceutical composition comprising a codon-optimized, isolated nucleic acid having a nucleotide sequence encoding any of the antibodies of the present disclosure and a pharmaceutically acceptable carrier.
COVID-19 Therapeutics with Bispecific Antibodies
Monoclonal antibodies are homogeneous in their nature of interaction with the ligands/antigens and thereby generate an absolute mono-specificity for their target. However, sometimes this absolute specificity for a single antigen target can result in some limitations for treating agents such as viruses that are known to evolve their target epitopes and thereby escape from the targeting by monoclonal antibodies. To overcome such limitations, scientists have generated antibodies which can be engineered to target multiple epitopes using a single antibody-like molecule. These antibody-like molecules can bind two separate antigens at the same time and are referred to as “bispecific” antibodies. Their framework is composed of fragments of two monoclonal antibodies whose regions have a binding affinity to two separate antigens. Such a framework can be useful in binding antigens that are unconventional or rare. In some embodiments, the subject matter described herein relates to generating bispecific antibodies capable of neutralizing the SARS-CoV-2 virus and or variant strains.
The SARS-CoV-2 bispecific antibodies described herein can be used for treatment of subjects infected with SARS-CoV-2 or a variant strain. In some embodiments, the bispecific antibodies described herein reduce viral load in a subject in need thereof. In some embodiments, the bispecific antibodies described herein decrease disease severity in a subject in need thereof. In some embodiments, the bispecific antibodies described herein improve clinical outcome of COVID-19 in subjects in need thereof.
In some embodiments, the bispecific antibodies described herein can be used as prophylaxis to prevent high risk subjects and individuals from becoming infected with SARS-CoV-2 or a variant strain. In some embodiments, the high risk subject can be healthcare workers in close proximity to COVID-19 patients or the family members of these healthcare workers. In some embodiments, the bispecific antibodies described herein can be used as prophylaxis for the general population at large.
In some embodiments, more potent antibodies require smaller amounts to be administered to the subject to achieve the desired COVID-19-related recovery effects. This can be through lower dosages administered to the subjects and therefore less potential side effects, less frequent dosing regimens, or lower antibody production costs. In some embodiments, potency is measured by IC50 and IC90 concentration values.
In some embodiments, the bispecific antibodies described herein target multiple epitopes on the SARS-CoV-2 virus or a variant strain. In some embodiments, the subject matter disclosed herein relates to bispecific antibody combination cocktails. In some embodiments, the antibodies in the cocktails target multiple epitopes on the SARS-CoV-2 virus or a variant strain. In some embodiments, the bispecific antibody combination cocktails provide even greater efficacy and lower the possibility of viral resistance than each individual antibody of the cocktail. In some embodiments, the bispecific antibodies described herein can be utilized in laboratory research and development activities. In one embodiment, the bispecific antibodies describe herein includes the variable regions of a first and a second antibody, in which the first antibody binds to an epitope on the receptor binding domain (RBD) of the coronavirus, while the second binds to an epitope on the N-terminal domain (NTD) of the coronavirus.
Pairing the anti-RBD and the anti-NTD domain antibodies in such a bispecific format would mainly provide for increasing the genetic barrier for the virus to achieve resistance against the antibodies. It also allows clinical practitioners to only administer a single formulation of one bispecific antibody to patients thereby simplifying treatment. In some embodiments, the bispecific antibodies are administered in a cocktail of two or more antibodies. As for marketing and supply chain benefits, bispecific antibodies present an economical alternative to producing in a single molecule format, those combinations of monoclonal antibodies known to increase the threshold of resistance to SARS-CoV-2.
In one embodiment, the subject matter disclosed herein relates to bispecific antibodies engineered for treatment and prevention of COVID-19 infections. Engineered bispecific antibodies can combine the binding specificity of two antibodies in only one molecule. Bispecific antibodies can recognize two antigens on different cells or on the same cell. Thus, by virtue of specifically binding the two antigens, engineered bispecific antibodies can bring two cells in close proximity or activate two receptors simultaneously. Additionally, blocking two target proteins with one antibody instead of two may be more efficient. In some embodiments, bispecific antibodies can target two viral epitopes providing higher barrier for viral escape. In some embodiments, bispecific antibodies can have synergetic effect on potency against the viral target.
In one embodiment, the engineered antibodies achieve bispecificity using the CrossMab format (Schaefer, 2011). The CrossMab engineering format allows for the bispecific antibody to adopt a more native antibody-like structure. This can facilitate binding of the bispecific antibody to weakly-expressed antigens, while avoiding overstimulation of immune responses. In some embodiments, bispecific antibodies in the CrossMab format can be anchored to a host cell membrane. This allows for improved local antibody concentration, targeting of sequential and/or interdependent virus entry steps, and compensating for monovalent binding.
As described herein, the CrossMab format for engineering bispecific antibodies can be utilized to engineer bispecific antibodies against the SARS-CoV-2 virus or a variant strain. As shown in
In one embodiment, the bispecific antibody comprises two polypeptide chains, one from each parental monoclonal antibody. In one embodiment, the first parental polypeptide arm comprises the light chain and the heavy chain polypeptides of the first parental antibody. The light chain can include the light chain variable domain (VL) comprising the light chain binding region and the light chain constant domain (CL) if the first parental antibody. The heavy chain can include the heavy chain variable domain (VH) comprising the heavy chain binding region and the heavy chain constant domain (CH) of the first parental antibody. In one embodiment, the first parental polypeptide arm also includes a domain, which promotes heterodimerization with the second polypeptide. In one embodiment, this heterodimerization domain can covalently bond the first parental polypeptide to the second parental polypeptide of the bispecific antibody.
In one embodiment, the second parental polypeptide arm comprises a light chain and a heavy chain polypeptides of the second parental antibody. The light chain can include the light chain variable domain (VL) comprising the light chain binding region and the light chain constant domain (CL) of the second parental antibody. The heavy chain can include the heavy chain variable domain (VH) comprising the heavy chain binding region and the heavy chain constant domain (CH) of the second parental antibody. In one embodiment, the second parental polypeptide arm also includes a domain, which promotes heterodimerization with the second polypeptide. In one embodiment, this heterodimerization domain can covalently bond the first parental polypeptide to the second parental polypeptide of the bispecific antibody. In one embodiment, the bispecific antibody further comprises linkers and disulfide bonds connecting the two parental polypeptides of the antibody. The linkers can be any suitable sequence of amino acids. In one embodiment, the
The bispecific antibodies described herein include the variable regions of a first and a second antibody, in which the first antibody binds to an epitope on the receptor binding domain (RBD) of the coronavirus and is selected from 8 monoclonal Abs (1-20, 1-57, 2-7, 2-2-30, 2-36, 2-43 and 4-20) while the second binds to an epitope on the N-terminal domain (NTD) of the coronavirus and is also selected from 8 monoclonal Abs (1-68, 1-87, 2-17, 2-51, 4-8, 4-18, 4-19 and 5-24).
The CrossMabs described herein utilize human IgG isotype 1 Fc backbone. The backbone can have additional mutations engineered for reduced Fc-effector function with the L234F, L235E and P331S mutations and for half-life with the M428L and N434S mutations.
In order to generate bispecific antibodies that would meet these goals, 58 candidate bispecific Abs were screened for their potency against SARS-CoV-2 live infectious virus using an in vitro assay. Briefly, purified candidate bispecific Ab was mixed with infectious live virus for 60 min and then added to a monolayer of Vero E6 cells to measure the extent of neutralization. Antibodies were diluted 5 fold from 10 μg/mL while virus was incubated with cells at MOI=0.1. Three days post infection, the cells were measured for the cytopathic effects induced by the live virus replication. Difference in the extent of infection from the control wells bearing no antibodies was converted to percentage and the value for inhibition of 50% of the virus (IC50) and 90% of the virus (IC90) was calculated using non-linear regression analysis.
Using the potency values, the bispecific antibodies of merit were nominated based on their fold enhancement of the IC90 concentrations that they achieved in comparison to their parental antibodies. Bispecific antibodies that had a potency with IC50≤10 ng/mL and with IC90≤50 ng/mL were chosen as the ones that would be capable of achieving the greatest barrier to resistance by SARS-CoV-2. Ab X and Ab Y are irrelevant single arm Fab controls. Selected bispecific antibody candidates achieve similar potency as co-administration of the two parental mAbs.
SARS-CoV-2 Variant Strains
In some embodiments, the bispecific antibodies exhibit neutralization activity against wild-type SARS-CoV-2 virus (WA1). In some embodiments, the bispecific antibodies exhibit neutralization activity against SARS-CoV-2 variants. In some embodiments, the bispecific antibodies disclosed herein show potent neutralization activities against SARS-CoV-2 wild-type and multiple variant virus strains. In some embodiments, the SARS-CoV-2 variants are B.1.1.7 (UK variant), B.1.351 (SA variant), B.1.526 (NY variant), or P.1 (Brazil variant).
In one embodiment, each arm of the bispecific antibody constructed is selected from 19 potent neutralizing antibodies against SARS-CoV-2. Additional bispecific antibodies 2-7/5-7, 2-7/1-57 and the CrossMab formats with reverse the knob and hole arms, namely 5-7/2-7 or 1-57/2-7, showed high potencies when tested against the wild-type virus. As 1-57 activity can be impacted by SARS-CoV-2 variant containing L452R mutation (such as California variant), which crashes mAb 1-57 heavy chain binding suggested by structural modeling, 2-7/5-7 was down-selected as development candidate and further characterized by neutralization against SARS-CoV-2 variants and showed potent neutralization against new emerging variants such as B.1.1.7 (UK variant), B.1.351 (SA variant), B.1.526 (NY variant) and P.1 (BZ variant). For many of the bispecific antibodies tested herein, both arms of the bispecific antibodies contribute to the neutralization activity of the bispecific molecule. These bispecific antibodies with potent neutralization activities against SARS-CoV-2 and the variants offer new therapeutics for the treatment and prevention of COVID-19, as a single antibody molecule to provide a higher genetic barrier for viral escape and lower cost than antibody combination. We expect the activity enhancement observed can be extended to other engineered bispecific antibody format.
Antibody Sequences for Bispecific Antibodies
Underlined and italicized amino acids represent the respective complementarity-determining regions (CDRs). There are three CDRs per sequence, appearing on the sequence in the order CDR1, CDR2, and CDR3.
The 2-17/2-7 bispecific antibody sequence can comprise:
SEQ ID NO: 47 is the amino acid sequence defining the 2-17 derived heavy chain of the 2-17/2-7 antibody 2-17HC-Hole-Cross
GNIPIFGTANYAQ
KFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR
GVGYRGVIPLNWFDP
WGQGTVVTVSSASTAAPSVFIFPPSDEQLKSGTA
SEQ ID NO: 48 is the amino acid sequence defining the 2-17 derived Light chain of the 2-17/2-7 antibody 2-17VLCH1
GASTRAT
GIPVRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPFT
SEQ ID NO: 49 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-17/2-7 antibody 2-7HC-Knob
SEQ ID NO: 50 is the amino acid sequence defining the 2-7 derived light chain of the 2-17/2-7 antibody 2-7LC
V
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV
The 1-57/5-7 bispecific antibody sequence can comprise:
SEQ ID NO: 51 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/5-7 antibody 1-57HC-Hole-Cross
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 52 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/5-7 antibody 1-57VLCH1
SEQ ID NO: 53 is the amino acid sequence defining the 5-7 derived heavy chain of the 1-57/5-7 antibody 5-7 HC-Knob
INPSGGSTSYAEKFRG
RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDR
EPHSDSSGYWDSLKYYYYYALDV
WGQGTTVTVSSASTKGPSVFPLAPSSK
SEQ ID NO: 54 is the amino acid sequence defining the 5-7 derived light chain of the 1-57/5-7 antibody 5-7LC
ASTLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNTYPFTFGP
The 5-7/1-57 bispecific antibody sequence can comprise:
SEQ ID NO: 55 is the amino acid sequence defining the 5-7 derived heavy chain of the 5-7/1-57 antibody 5-7HC-Hole-Cross
INPSGGSTSYAEKFRG
RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDR
EPHSDSSGYWDSLKYYYYYALDV
WGQGTTVTVSSASTAAPSVFIFPPSDE
SEQ ID NO: 56 is the amino acid sequence defining the 5-7 derived Light chain of the 5-7/1-57 antibody 5-7VLCH1
ASTLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNTYPFTFGP
SEQ ID NO: 57 is the amino acid sequence defining the 1-57 derived heavy chain of the 5-7/1-57 antibody 1-57HC-Knob
TRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYCAR
VHRWAYCINGVCFGAYSDY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSG
SEQ ID NO: 58 is the amino acid sequence defining the 1-57 derived light chain of the 5-7/1-57 antibody 1-57LC
GASSRAT
GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFG
The 2-7/5-7 bispecific antibody sequence can comprise:
SEQ ID NO: 59 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/5-7 antibody 2-7HC-Hole-Cross
KIERIFDY
WGQGTLVTVSSASTAAPSVFIFPPSDEQLKSGTASVVCLLNN
SEQ ID NO: 60 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/5-7 antibody 2-7VLCH1
SEQ ID NO: 61 is the amino acid sequence defining the 5-7 derived heavy chain of the 2-7/5-7 antibody 5-7 HC-Knob
INPSGGSTSYAEKFRG
RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDR
EPHSDSSGYWDSLKYYYYYALDV
WGQGTTVTVSSASTKGPSVFPLAPSSK
SEQ ID NO: 62 is the amino acid sequence defining the 5-7 derived light chain of the 2-7/5-7 antibody 5-7LC
ASTLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNTYPFTFGP
The 5-7/2-7 bispecific antibody sequence can comprise:
SEQ ID NO: 63 is the amino acid sequence defining the 5-7 derived heavy chain of the 5-7/2-7 antibody 5-7HC-Hole-Cross
INPSGGSTSYAEKFRG
RVTMTRDTSTSTVYMELSSLRSEDTAVYYCARDR
EPHSDSSGYWDSLKYYYYYALDV
WGQGTTVTVSSASTAAPSVFIFPPSDE
SEQ ID NO: 64 is the amino acid sequence defining the 5-7 derived Light chain of the 5-7/2-7 antibody 5-7VLCH1
ASTLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNTYPFTFGP
SEQ ID NO: 65 is the amino acid sequence defining the 2-7 derived heavy chain of the 5-7/2-7 antibody 2-7HC-Knob
KIERIFDY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
SEQ ID NO: 66 is the amino acid sequence defining the 2-7 derived light chain of the 5-7/2-7 antibody 2-7LC
The 2-17/1-57 bispecific antibody sequence can comprise:
SEQ ID NO: 67 is the amino acid sequence defining the 2-17 derived heavy chain of the 2-17/1-57 antibody 2-17HC-Hole-Cross
NIPIFGTANYAQ
KFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARGV
GYRGVIPLNWFDP
WGQGTVVTVSSASTAAPSVFIFPPSDEQLKSGTASVV
SEQ ID NO: 68 is the amino acid sequence defining the 2-17 derived light chain of the 2-17/1-57 antibody 2-17VLCH1
GASTRAT
GIPVRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPFT
SEQ ID NO: 69 is the amino acid sequence defining the 1-57 derived heavy chain of the 2-17/1-57 antibody 1-57HC-Knob
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 70 is the amino acid sequence defining the 1-57 derived light chain of the 2-17/1-57 antibody 1-57LC
The 2-17/2-15 bispecific antibody sequence can comprise:
SEQ ID NO: 71 is the amino acid sequence defining the 2-17 derived heavy chain of the 2-17/2-15 antibody 2-17HC-Hole-Cross
GNIPIFG
TANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR
GVGYRGVIPLNWFDP
WGQGTVVTVSSASTAAPSVFIFPPSDEQLKSGTA
SEQ ID NO: 72 is the amino acid sequence defining the 2-17 derived light chain of the 2-17/2-15 antibody 2-17VLCH1
GASTRAT
GIPVRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPFT
SEQ ID NO: 73 is the amino acid sequence defining the 2-15 derived heavy chain of the 2-17/2-15 antibody 2-15HC-Knob
WINPISDGTNYAQ
KFQGWVTMTRDTSISTVYMELSRLRSDDTAVYYCAR
GGSRCSGGNCYGWAYDAFDI
WGQGTMITVSSASTKGPSVFPLAPSSKST
SEQ ID NO: 74 is the amino acid sequence defining the 2-15 derived light chain of the 2-17/2-15 antibody 2-15LC
FV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 2-17/2-30 bispecific antibody sequence can comprise:
SEQ ID NO: 75 is the amino acid sequence defining the 2-17 derived heavy chain of the 2-17/2-30 antibody 2-17HC-Hole-Cross
GNIPIFGTANYAQ
KFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR
GVGYRGVIPLNWFDP
WGQGTVVTVSSASTAAPSVFIFPPSDEQLKSGTA
SEQ ID NO: 76 is the amino acid sequence defining the 2-17 derived light chain of the 2-17/2-30 antibody 2-17VLCH1
GASTRAT
GIPVRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPFT
SEQ ID NO: 77 is the amino acid sequence defining the 2-30 derived heavy chain of the 2-17/2-30 antibody 2-30 HC-Knob
AISYDGNNKYYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
SILYGGGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCL
SEQ ID NO: 78 is the amino acid sequence defining the 2-30 derived light chain of the 2-17/2-30 antibody 2-30 LC
AASTLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNSYPLTF
The 2-17/4-20 bispecific antibody sequence can comprise:
SEQ ID NO: 79 is the amino acid sequence defining the 2-17 derived heavy chain of the 2-17/4-20 antibody 2-17HC-Hole-Cross
GNIPIFGTANYAQ
KFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR
GVGYRGVIPLNWFDP
WGQGTVVTVSSASTAAPSVFIFPPSDEQLKSGTA
SEQ ID NO: 80 is the amino acid sequence defining the 2-17 derived light chain of the 2-17/4-20 antibody 2-17VLCH1
GASTRAT
GIPVRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPFT
SEQ ID NO: 81 is the amino acid sequence defining the 4-20 derived heavy chain of the 2-17/4-20 antibody 4-20 HC-Knob
IINPSGGGTTYAQ
KFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
PGGGSYQEFDY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGC
SEQ ID NO: 82 is the amino acid sequence defining the 4-20 derived light chain of the 2-17/4-20 antibody 4-20 LC
AASSLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYNTLQVT
The 5-24/1-57 bispecific antibody sequence can comprise:
SEQ ID NO: 83 is the amino acid sequence defining the 5-24 derived heavy chain of the 5-24/1-57 antibody 5-24HC-Hole-Cross
SEQ ID NO: 84 is the amino acid sequence defining the 5-24 derived light chain of the 5-24/1-57 antibody 5-24VLCH1
SEQ ID NO: 85 is the amino acid sequence defining the 1-57 derived heavy chain of the 5-24/1-57 antibody 1-57HC-Knob
SEQ ID NO: 86 is the amino acid sequence defining the 1-57 derived light chain of the 5-24/1-57 antibody 1-57LC
The 5-24/2-15 bispecific antibody sequence can comprise:
SEQ ID NO: 87 is the amino acid sequence defining the 5-24 derived heavy chain of the 5-24/2-15 antibody 5-24HC-Hole-Cross
SEQ ID NO: 88 is the amino acid sequence defining the 5-24 derived light chain of the 5-24/2-15 antibody 5-24VLCH1
SEQ ID NO: 89 is the amino acid sequence defining the 2-15 derived heavy chain of the 5-24/2-15 antibody 2-15HC-Knob
SEQ ID NO: 90 is the amino acid sequence defining the 2-15 derived light chain of the 5-24/2-15 antibody 2-15LC
The 5-24/4-20 bispecific antibody sequence can comprise:
SEQ ID NO: 91 is the amino acid sequence defining the 5-24 derived heavy chain of the 5-24/4-20 antibody 5-24HC-Hole-Cross
SEQ ID NO: 92 is the amino acid sequence defining the 5-24 derived light chain of the 5-24/4-20 antibody 5-24VLCH1
SEQ ID NO: 93 is the amino acid sequence defining the 4-20 derived heavy chain of the 5-24/4-20 antibody 4-20HC-Knob
SEQ ID NO: 94 is the amino acid sequence defining the 4-20 derived light chain of the 5-24/4-20 antibody 4-20LC
The 1-20/1-68 bispecific antibody sequence can comprise:
SEQ ID NO: 95 is the amino acid sequence defining the 1-20 derived heavy chain of the 1-20/1-68 antibody 1-20HC-Hole-Cross
SEQ ID NO: 96 is the amino acid sequence defining the 1-20 derived light chain of the 1-20/1-68 antibody 1-20VLCH1
SEQ ID NO: 97 is the amino acid sequence defining the 1-68 derived heavy chain of the 1-20/1-68 antibody 1-68HC-Knob
SEQ ID NO: 98 is the amino acid sequence defining the 1-68 derived light chain of the 1-20/1-68 antibody 1-68LC
YV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 1-20/2-17 bispecific antibody sequence can comprise:
SEQ ID NO: 99 is the amino acid sequence defining the 1-20 derived heavy chain of the 1-20/2-17 antibody 1-20HC-Hole-Cross
VIYSGGSTFYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARD
LFYYGMD
V
WGQGTTVTVSSASTAAPSVFIFPPSDEQLKSGTASVVCLLN
SEQ ID NO: 100 is the amino acid sequence defining the 1-20 derived light chain of the 1-20/2-17 antibody 1-20VLCH1
AASTLQS
GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPCFG
SEQ ID NO: 101 is the amino acid sequence defining the 2-17 derived heavy chain of the 1-20/2-17 antibody 2-17HC-Knob
GNIPIFGTANYAQ
KFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR
GVGYRGVIPLNWFDP
WGQGTVVTVSSASTKGPSVFPLAPSSKSTSGGTA
SEQ ID NO: 102 is the amino acid sequence defining the 2-17 derived light chain of the 1-20/2-17 antibody 2-17LC
GASTRAT
GIPVRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPFT
The 1-20/4-18 bispecific antibody sequence can comprise:
SEQ ID NO: 103 is the amino acid sequence defining the 1-20 derived heavy chain of the 1-20/4-18 antibody 1-20HC-Hole-Cross
VIYSGGSTFYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARD
LFYYGMDV
WGQGTTVTVSSASTAAPSVFIFPPSDEQLKSGTASVVCLLN
SEQ ID NO: 104 is the amino acid sequence defining the 1-20 derived light chain of the 1-20/4-18 antibody 1-20VLCH1
AASTLQS
GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPCFG
SEQ ID NO: 105 is the amino acid sequence defining the 4-18 derived heavy chain of the 1-20/4-18 antibody 4-18HC-Knob
VISYDGSNKHYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
DSGYNYGYSWFDP
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
SEQ ID NO: 106 is the amino acid sequence defining the 4-18 derived light chain of the 1-20/4-18 antibody 4-18LC
DSERPS
GIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDNSGTYPN
WV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 1-20/5-24 bispecific antibody sequence can comprise: SEQ ID NO: 107 is the amino acid sequence defining the 1-20 derived heavy
VIYSGGSTFYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARD
LFYYGMDV
WGQGTTVTVSSASTAAPSVFIFPPSDEQLKSGTASVVCLLN
SEQ ID NO: 108 is the amino acid sequence defining the 1-20 derived light chain of the 1-20/5-24 antibody 1-20VLCH1
AASTLQS
GVPSRFSGSGSGTEFTLTISSLQPEDFATYYCQQLNSYPCFG
SEQ ID NO: 109 is the amino acid sequence defining the 5-24 derived heavy chain of the 1-20/5-24 antibody 5-24HC-Knob
VIWYDGSKKYYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
DPRDYYDFWSGYDYYYGLDV
WGQGTTVTVSSASTKGPSVFPLAPSSKST
SEQ ID NO: 110 is the amino acid sequence defining the 5-24 derived light chain of the 1-20/5-24 antibody 5-24LC
T
FGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAK
Bispecific Antibodies with Both LALA (TM) and LS Mutations:
The 2-7/4-8(39/51/57) bispecific antibody sequence can comprise:
SEQ ID NO: 111 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/4-8(39/51/57) antibody 2-7HC-Hole-Cross
SEQ ID NO: 112 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/4-8(39/51/57) antibody 2-7VLCH1
V
FGGGTKLTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
SEQ ID NO: 113 is the amino acid sequence defining the 4-8(39/51/57) derived heavy chain of the 2-7/4-8(39/51/57) antibody 4-8(39/51/57) HC-Knob
RNIPILGTANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT
SEQ ID NO: 114 is the amino acid sequence defining the 4-8(39/51/57) derived light chain of the 2-7/4-8(39/51/57) antibody 4-8LC
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
The 2-17/2-36 bispecific antibody sequence can comprise:
SEQ ID NO: 115 is the amino acid sequence defining the 2-17 derived heavy chain of the 2-17/2-36 antibody 2-17HC-Hole-Cross
GNIPIFGTANYAQ
KFQGRVTITADESTSTAYMELSSLRSEDTAVYYCAR
GVGYRGVIPLNW
F
DP
WGQGTVVTVSSASTAAPSVFIFPPSDEQLKSGTA
SEQ ID NO: 116 is the amino acid sequence defining the 2-17 derived light chain of the 2-17/2-36 antibody 2-17VLCH1
GASTRAT
GIPVRFSGSGSGTEFTLTISSLQSEDFAVYYCQQYNNWPPFT
SEQ ID NO: 117 is the amino acid sequence defining the 2-36 derived heavy chain of the 2-17/2-36 antibody 2-36HC-Knob
SEQ ID NO: 118 is the amino acid sequence defining the 2-36 derived light chain of the 2-17/2-36 antibody 2-36LC
The 2-36/1-68 bispecific antibody sequence can comprise:
SEQ ID NO: 119 is the amino acid sequence defining the 2-36 derived heavy chain of the 2-36/1-68 antibody 2-36HC-Hole-Cross
SEQ ID NO: 120 is the amino acid sequence defining the 2-36 derived light chain of the 2-36/1-68 antibody 2-36VLCH1
SEQ ID NO: 121 is the amino acid sequence defining the 1-68 derived heavy chain of the 2-36/1-68 antibody 1-68HC-Knob
G
F
DPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAVAGSSDVWYYYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTS
SEQ ID NO: 122 is the amino acid sequence defining the 1-68 derived light chain of the 2-36/1-68 antibody 1-68LC
YV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 2-36/4-18 bispecific antibody sequence can comprise:
SEQ ID NO: 123 is the amino acid sequence defining the 2-36 derived heavy chain of the 2-36/4-18 antibody 2-36HC-Hole-Cross
SEQ ID NO: 124 is the amino acid sequence defining the 2-36 derived light chain of the 2-36/4-18 antibody 2-36VLCH1
SEQ ID NO: 125 is the amino acid sequence defining the 4-18 derived heavy chain of the 2-36/4-18 antibody 4-18HC-Knob
VISYDGSNKHYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
DSGYNYGYSWFDP
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
SEQ ID NO: 126 is the amino acid sequence defining the 4-18 derived light chain of the 2-36/4-18 antibody 4-18LC
DSERPS
GIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDNSGTYPN
WV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 2-30/1-68 bispecific antibody sequence can comprise:
SEQ ID NO: 127 is the amino acid sequence defining the 2-30 derived heavy chain of the 2-30/1-68 antibody 2-30HC-Hole-Cross
AISYDGNNKYYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
SILYGGGMDV
WGQGTTVTVSSASTAAPSVFIFPPSDEQLKSGTASVVCL
SEQ ID NO: 128 is the amino acid sequence defining the 2-30 derived light chain of the 2-30/1-68 antibody 2-30VLCH1
AASTLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNSYPLIF
SEQ ID NO: 129 is the amino acid sequence defining the 1-68 derived heavy chain of the 2-30/1-68 antibody 1-68HC-Knob
GFDPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAVAGSSDVWYYYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTS
SEQ ID NO: 130 is the amino acid sequence defining the 1-68 derived light chain of the 2-30/1-68 antibody 1-68LC
YV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 2-30/4-18 bispecific antibody can comprise:
SEQ ID NO: 131 is the amino acid sequence defining the 2-30 derived heavy chain of the 2-30/4-18 antibody 2-30HC-Hole-Cross
AISYDGNNKYYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAR
SILYGGGMDV
WGQGTTVTVSSASTAAPSVFIFPPSDEQLKSGTASVVCL
SEQ ID NO: 132 is the amino acid sequence defining the 2-30 derived light chain of the 2-30/4-18 antibody 2-30VLCH1
AASTLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQLNSYPLTF
SEQ ID NO: 133 is the amino acid sequence defining the 4-18 derived heavy chain of the 2-30/4-18 antibody 4-18HC-Knob
VISYDGSNKHYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
DSGYNYGYSW
F
DP
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
SEQ ID NO: 134 is the amino acid sequence defining the 4-18 derived light chain of the 2-30/4-18 antibody 4-18LC
DSERPS
GIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDNSGTYPN
WV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 2-7/4-8(39/51) bispecific antibody sequence can comprise:
SEQ ID NO: 135 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/4-8(39/51) antibody 2-7HC-Hole-Cross
SEQ ID NO: 136 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/4-8(39/51) antibody 2-7VLCH1
V
FGGGTKLTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
SEQ ID NO: 137 is the amino acid sequence defining the 4-8(39/51) derived heavy chain of the 2-7/4-8(39/51) antibody 4-8(39/51) HC-Knob
RNIPILGIANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT
SEQ ID NO: 138 is the amino acid sequence defining the 4-8(39/51) derived light chain of the 2-7/4-8(39/51) antibody 4-8LC
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
The 1-57/1-87 bispecific antibody sequence can comprise:
SEQ ID NO: 139 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/1-87 antibody 1-57HC-Hole-Cross
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 140 amino acid sequence defining the 1-57 derived light chain of the 1-57/1-87 antibody 1-57VLCH1
SEQ ID NO: 141 is the amino acid sequence defining the 1-87 derived heavy chain of the 1-57/1-87 antibody 1-87HC-Knob
G
F
DPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GIAVIGPPPSTYYYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTS
SEQ ID NO: 142 is the amino acid sequence defining the 1-87 derived light chain of the 1-57/1-87 antibody 1-87LC
YV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 1-57/4-8(39/51) bispecific antibody can comprise:
SEQ ID NO: 143 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/4-8(39/51) antibody 1-57HC-Hole-Cross
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 144 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/4-8(39/51) antibody 1-57VLCH1
SEQ ID NO: 145 is the amino acid sequence defining the 4-8(39/51) derived heavy chain of the 1-57/4-8(39/51) antibody 4-8(39/51) HC-Knob
RNIPILGIANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT
SEQ ID NO: 146 is the amino acid sequence defining the 4-8(39/51) derived light chain of the 1-57/4-8(39/51) antibody 4-8(39/51)LC
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
The 2-7/2-51 bispecific antibody:
SEQ ID NO: 147 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/2-51 antibody 2-7HC-Hole-Cross
SEQ ID NO: 148 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/2-51 antibody 2-7VLCH1
V
FGGGTKLTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
SEQ ID NO: 149 is the amino acid sequence defining the 2-51 derived heavy chain of the 2-7/2-51 antibody 2-51 HC-Knob
GFDPEDVETIYAQQFQG
RVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAYKSTWYFGY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG
SEQ ID NO: 150 is the amino acid sequence defining the 2-51 derived light chain of the 2-7/2-51 antibody 2-51LC
G
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV
The 2-15/4-8(39/51) bispecific antibody sequence can comprise:
SEQ ID NO: 151 is the amino acid sequence defining the 2-15 derived heavy chain of the 2-15/4-8(39/51) antibody 2-15HC-Hole-Cross
WINPISDGTNYAQ
KFQGWVTMTRDTSISTVYMELSRLRSDDTAVYYCAR
GGSRCSGGNCYGWA
YDAFDI
WGQGTMITVSSASTAAPSVFIFPPSDEQL
SEQ ID NO: 152 is the amino acid sequence defining the 2-15 derived light chain of the 2-15/4-8(39/51) antibody 2-15VLCH1
FV
FGTGTKVTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
SEQ ID NO: 153 is the amino acid sequence defining the 4-8(39/51) derived heavy chain of the 2-15/4-8(39/51) antibody 4-8(39/51) HC-Knob
RNIPILGIANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT
SEQ ID NO: 154 is the amino acid sequence defining the 4-8(39/51) derived light chain of the 2-15/4-8(39/51) antibody 4-8(39/51)LC
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
The 1-57/4-18 bispecific antibody sequence can comprise:
SEQ ID NO: 155 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/4-18 antibody 1-57HC-Hole-Cross
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 156 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/4-18 antibody 1-57VLCH1
SEQ ID NO: 157 is the amino acid sequence defining the 4-18 derived heavy chain of the 1-57/4-18 antibody 4-18HC-Knob
VISYDGSNKHYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
DSGYNYGYSWFDP
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
SEQ ID NO: 158 is the amino acid sequence defining the 4-18 derived light chain of the 1-57/4-18 antibody 4-18LC
DSERPS
GIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDNSGTYPN
WV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 2-7/1-68 bispecific antibody can comprise:
SEQ ID NO: 159 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/1-68 antibody 2-7HC-Hole-Cross
SEQ ID NO: 160 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/1-68 antibody 2-7VLCH1
V
FGGGTKLTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
SEQ ID NO: 161 is the amino acid sequence defining the 1-68 derived heavy chain of the 2-7/1-68 antibody 1-68HC-Knob
G
F
DPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAVAGSSDVWYYYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTS
SEQ ID NO: 162 is the amino acid sequence defining the 1-68 derived light chain of the 2-7/1-68 antibody 1-68LC
YV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 4-20/4-18 bispecific antibody sequence can comprise:
SEQ ID NO: 163 is the amino acid sequence defining the 4-20 derived heavy chain of the 4-20/4-18 antibody 4-20HC-Hole-Cross
IINPSGGGTTYAQ
KFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
PGGGSYQEFDY
WGQGTLVTVSSASTAAPSVFIFPPSDEQLKSGTASVVC
SEQ ID NO: 164 is the amino acid sequence defining the 4-20 derived light chain of the 4-20/4-18 antibody 4-20VLCH1
AASSLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYNTLQVT
SEQ ID NO: 165 is the amino acid sequence defining the 4-18 derived heavy chain of the 4-20/4-18 antibody 4-18HC-Knob
VISYDGSNKHYADSV
KGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
DSGYNYGYSWFDP
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
SEQ ID NO: 166 is the amino acid sequence defining the 4-18 derived light chain of the 4-20/4-18 antibody 4-18LC
DSERPS
GIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDNSGTYPN
WV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 2-15mut/2-51 bispecific antibody sequence can comprise:
SEQ ID NO: 167 is the amino acid sequence defining the 2-15mut derived heavy chain of the 2-15mut/2-51 antibody 2-15HC-Hole-Cross
WINPISDGTNYAQ
KFQGWVTMTRDTSISTVYMELSRLRSDDTAVYYCAR
GGSRCSGGNCYGWAYDAFDI
WGQGTMITVSSASTAAPSVFIFPPSDEQL
SEQ ID NO: 168 is the amino acid sequence defining the 2-15mut derived light chain of the 2-15mut/2-51 antibody 2-15mutVLCH1
FV
FGTGTKVTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
SEQ ID NO: 169 is the amino acid sequence defining the 2-51 derived heavy chain of the 2-15mut/2-51 antibody 2-51 HC-Knob
GFDPEDVETIYAQQFQG
RVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAYKSTWYFGY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG
SEQ ID NO: 170 is the amino acid sequence defining the 2-51 derived light chain of the 2-15mut/2-51 antibody 2-51LC
G
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV
The 4-20/4-8(39/51) bispecific antibody sequence can comprise:
SEQ ID NO: 171 is the amino acid sequence defining the 4-20 derived heavy chain of the 4-20/4-8(39/51) antibody 4-20HC-Hole-Cross
I
INPSGGGTTYAQ
KFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
PGGGSYQEFDY
WGQGTLVTVSSASTAAPSVFIFPPSDEQLKSGTASVVC
SEQ ID NO: 172 is the amino acid sequence defining the 4-20 derived light chain of the 4-20/4-8(39/51) antibody 4-20VLCH1
AASSLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYNTLQVT
SEQ ID NO: 173 is the amino acid sequence defining the 4-8(39/51) derived heavy chain of the 4-20/4-8(39/51) antibody 4-8(39/51) HC-Knob
RNIPILGIANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT
SEQ ID NO: 174 is the amino acid sequence defining the 4-8(39/51) derived light chain of the 4-20/4-8(39/51) antibody 4-8(39/51)LC
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
The 1-57/2-51 bispecific antibody sequence can comprise:
SEQ ID NO: 175 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/2-51 antibody 1-57HC-Hole-Cross
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 176 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/2-51 antibody 1-57VLCH1
SEQ ID NO: 177 is the amino acid sequence defining the 2-51 derived heavy chain of the 1-57/2-51 antibody 2-51 HC-Knob
G
F
DPEDVETIYAQQFQG
RVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAYKSTWYFGY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG
SEQ ID NO: 178 is the amino acid sequence defining the 2-51 derived light chain of the 1-57/2-51 antibody 2-51LC
G
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV
The 4-20/1-87 bispecific antibody sequence can comprise:
SEQ ID NO: 179 is the amino acid sequence defining the 4-20 derived heavy chain of the 4-20/1-87 antibody 4-20HC-Hole-Cross
IINPSGGGTTYAQ
KFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
PGGGSYQEFDY
WGQGTLVTVSSASTAAPSVFIFPPSDEQLKSGTASVVC
SEQ ID NO: 180 is the amino acid sequence defining the 4-20 derived light chain of the 4-20/1-87 antibody 4-20VLCH1
AASSLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYNTLQVT
SEQ ID NO: 181 is the amino acid sequence defining the 1-87 derived heavy chain of the 4-20/1-87 antibody 1-87HC-Knob
G
F
DPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GIAVIGPPPSTYYYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTS
SEQ ID NO: 182 is the amino acid sequence defining the 1-87 derived light chain of the 4-20/1-87 antibody 1-87LC
YV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 1-57/1-68 bispecific antibody sequence can comprise:
SEQ ID NO: 183 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/1-68 antibody 1-57HC-Hole-Cross
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 184 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/1-68 antibody 1-57VLCH1
SEQ ID NO: 185 is the amino acid sequence defining the 1-68 derived heavy chain of the 1-57/1-68 antibody 1-68HC-Knob
GEDPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAVAGSSDVWYYYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTS
SEQ ID NO: 186 is the amino acid sequence defining the 1-68 derived light chain of the 1-57/1-68 antibody 1-68LC
YV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
Bispecific Antibodies with LS Mutations Only
The 2-7/4-8(39/51/57) bispecific antibody sequence can comprise:
SEQ ID NO: 187 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/4-8(39/51/57) antibody 2-7HC-Hole-Cross
SEQ ID NO: 188 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/4-8(39/51/57) antibody 2-7VLCH1
STV
FGGGTKLTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYF
SEQ ID NO: 189 is the amino acid sequence defining the 4-8(39/51/57) derived heavy chain of the 2-7/4-8(39/51/57) antibody 4-8(39/51/57) HC-Knob
SEQ ID NO: 190 is the amino acid sequence defining the 4-8(39/51/57) derived light chain of the 2-7/4-8(39/51/57) antibody 4-8LC
QDNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAV
The 2-17/2-36 bispecific antibody sequence can comprise:
SEQ ID NO: 191 is the amino acid sequence defining the 2-17 derived heavy chain of the 2-17/2-36 antibody 2-17HC-Hole-Cross
SEQ ID NO: 192 is the amino acid sequence defining the 2-17 derived light chain of the 2-17/2-36 antibody 2-17VLCH1
FT
FGGGTKVEIKSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
SEQ ID NO: 193 is the amino acid sequence defining the 2-36 derived heavy chain of the 2-17/2-36 antibody 2-36HC-Knob
SEQ ID NO: 194 is the amino acid sequence defining the 2-36 derived light chain of the 2-17/2-36 antibody 2-36LC
QT
FGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPRE
The 2-36/1-68 bispecific antibody sequence:
SEQ ID NO: 195 is the amino acid sequence defining the 2-36 derived heavy chain of the 2-36/1-68 antibody 2-36HC-Hole-Cross
SEQ ID NO: 196 is the amino acid sequence defining the 2-36 derived light chain of the 2-36/1-68 antibody 2-36VLCH1
QT
FGQGTKVEIKSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
SEQ ID NO: 197 is the amino acid sequence defining the 1-68 derived heavy chain of the 2-36/1-68 antibody 1-68HC-Knob
GG
F
DPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYC
SEQ ID NO: 198 is the amino acid sequence defining the 1-68 derived light chain of the 2-36/1-68 antibody 1-68LC
STYV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFY
The 2-36/4-18 bispecific antibody sequence can comprise:
SEQ ID NO: 199 is the amino acid sequence defining the 2-36 derived heavy chain of the 2-36/4-18 antibody 2-36HC-Hole-Cross
SEQ ID NO: 200 is the amino acid sequence defining the 2-36 derived light chain of the 2-36/4-18 antibody 2-36VLCH1
QT
FGQGTKVEIKSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFP
SEQ ID NO: 201 is the amino acid sequence defining the 4-18 derived heavy chain of the 2-36/4-18 antibody 4-18HC-Knob
SEQ ID NO: 202 is the amino acid sequence defining the 4-18 derived light chain of the 2-36/4-18 antibody 4-18LC
KDSERPS
GIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDNSGTY
PNWV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFY
The 2-30/1-68 bispecific antibody sequence can comprise:
SEQ ID NO: 203 is the amino acid sequence defining the 2-30 derived heavy chain of the 2-30/1-68 antibody 2-30HC-Hole-Cross
SEQ ID NO: 204 is the amino acid sequence defining the 2-30 derived light chain of the 2-30/1-68 antibody 2-30VLCH1
PLT
FGGGTKVEIKSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY
SEQ ID NO: 205 is the amino acid sequence defining the 1-68 derived heavy chain of the 2-30/1-68 antibody 1-68HC-Knob
MGGFDPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVY
SEQ ID NO: 206 is the amino acid sequence defining the 1-68 derived light chain of the 2-30/1-68 antibody 1-68LC
SSSTYV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLIS
The 2-30/4-18 bispecific antibody sequence can comprise:
SEQ ID NO: 207 is the amino acid sequence defining the 2-30 derived heavy chain of the 2-30/4-18 antibody 2-30HC-Hole-Cross
SEQ ID NO: 208 is the amino acid sequence defining the 2-30 derived light chain of the 2-30/4-18 antibody 2-30VLCH1
PL
T
FGGGTKVEIKSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDY
SEQ ID NO: 209 is the amino acid sequence defining the 4-18 derived heavy chain of the 2-30/4-18 antibody 4-18HC-Knob
SEQ ID NO: 210 is the amino acid sequence defining the 4-18 derived light chain of the 2-30/4-18 antibody 4-18LC
TYPNWV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLIS
The 2-7/4-8(39/51) bispecific antibody sequence can comprise:
SEQ ID NO: 211 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/4-8(39/51) antibody 2-7HC-Hole-Cross
SEQ ID NO: 212 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/4-8(39/51) antibody 2-7VLCH1
TSSTV
FGGGTKLTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVK
SEQ ID NO: 213 is the amino acid sequence defining the 4-8(39/51) derived heavy chain of the 2-7/4-8(39/51) antibody 4-8(39/51) HC-Knob
SEQ ID NO: 214 is the amino acid sequence defining the 4-8(39/51) derived light chain of the 2-7/4-8(39/51) antibody 4-8LC
AV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYP
The 1-57/1-87 bispecific antibody sequence can comprise:
SEQ ID NO: 215 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/1-87 antibody 1-57HC-Hole-Cross
SEQ ID NO: 216 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/1-87 antibody 1-57VLCH1
SPST
FGQGTKLEIKSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKD
SEQ ID NO: 217 is the amino acid sequence defining the 1-87 derived heavy chain of the 1-57/1-87 antibody 1-87HC-Knob
SEQ ID NO: 218 is the amino acid sequence defining the 1-87 derived light chain of the 1-57/1-87 antibody 1-87LC
YV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 1-57/4-8(39/51) bispecific antibody sequence can comprise:
SEQ ID NO: 219 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/4-8(39/51) antibody 1-57HC-Hole-Cross
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 220 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/4-8(39/51) antibody 1-57VLCH1
SEQ ID NO: 221 is the amino acid sequence defining the 4-8(39/51) derived heavy chain of the 1-57/4-8(39/51) antibody 4-8(39/51) HC-Knob
RNIPILGIANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT
SEQ ID NO: 222 is the amino acid sequence defining the 4-8(39/51) derived light chain of the 1-57/4-8(39/51) antibody 4-8LC
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
The 2-7/2-51 bispecific antibody sequence can comprise:
SEQ ID NO: 223 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/2-51 antibody 2-7HC-Hole-Cross
SEQ ID NO: 224 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/2-51 antibody 2-7VLCH1
V
FGGGTKLTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
SEQ ID NO: 225 is the amino acid sequence defining the 2-51 derived heavy chain of the 2-7/2-51 antibody 2-51 HC-Knob
G
F
DPEDVETIYAQQFQG
RVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAYKSTWYFGY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG
SEQ ID NO: 226 is the amino acid sequence defining the 2-51 derived light chain of the 2-7/2-51 antibody 2-51LC
G
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV
The 2-15/4-8(39/51) bispecific antibody sequence can comprise:
SEQ ID NO: 227 is the amino acid sequence defining the 2-15 derived heavy chain of the 2-15/4-8(39/51) antibody 2-15HC-Hole-Cross
WINPISDGTNYAQ
KFQGWVTMTRDTSISTVYMELSRLRSDDTAVYYCAR
GGSRCSGGNCYGWAYDAFDI
WGQGTMITVSSASTAAPSVFIFPPSDEQL
SEQ ID NO: 228 is the amino acid sequence defining the 2-15 derived light chain of the 2-15/4-8(39/51) antibody 2-15VLCH1
FV
FGTGTKVTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
SEQ ID NO: 229 is the amino acid sequence defining the 4-8(39/51) derived heavy chain of the 2-15/4-8(39/51) antibody 4-8(39/51) HC-Knob
RNIPILGIANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCAS
LQTVDTAIEKYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT
SEQ ID NO: 230 is the amino acid sequence defining the 4-8(39/51) derived light chain of the 2-15/4-8(39/51) antibody 4-8LC
DNKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFG
The 1-57/4-18 bispecific antibody sequence can comprise:
SEQ ID NO: 231 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/4-18 antibody 1-57HC-Hole-Cross
RTRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYC
SEQ ID NO: 232 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/4-18 antibody 1-57VLCH1
SEQ ID NO: 233 is the amino acid sequence defining the 4-18 derived heavy chain of the 1-57/4-18 antibody 4-18HC-Knob
VISYDGSNKHYADSVKG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
DSGYNYGYSWFDP
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
SEQ ID NO: 234 is the amino acid sequence defining the 4-18 derived light chain of the 1-57/4-18 antibody 4-18LC
DSERPS
GIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDNSGTYPN
WV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 2-7/1-68 bispecific antibody sequence can comprise:
SEQ ID NO: 235 is the amino acid sequence defining the 2-7 derived heavy chain of the 2-7/1-68 antibody 2-7HC-Hole-Cross
SEQ ID NO: 236 is the amino acid sequence defining the 2-7 derived light chain of the 2-7/1-68 antibody 2-7VLCH1
VF
GGGTKLTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
SEQ ID NO: 237 is the amino acid sequence defining the 1-68 derived heavy chain of the 2-7/1-68 antibody 1-68HC-Knob
GEDPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAVAGSSDVWYYYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTS
SEQ ID NO: 238 is the amino acid sequence defining the 1-68 derived light chain of the 2-7/1-68 antibody 1-68LC
YV
FGTGTKVTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 4-20/4-18 bispecific antibody sequence can comprise:
SEQ ID NO: 239 is the amino acid sequence defining the 4-20 derived heavy chain of the 4-20/4-18 antibody 4-20HC-Hole-Cross
IINPSGGGTTYAQKFQG
RVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
PGGGSYQEFDY
WGQGTLVTVSSASTAAPSVFIFPPSDEQLKSGTASVVC
SEQ ID NO: 240 is the amino acid sequence defining the 4-20 derived light chain of the 4-20/4-18 antibody 4-20VLCH1
AASSLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYNTLQVT
SEQ ID NO: 241 is the amino acid sequence defining the 4-18 derived heavy chain of the 4-20/4-18 antibody 4-18HC-Knob
VISYDGSNKHYADSVKG
RFTISRDNSKNTLYLQMNSLRAEDTAVYYCAK
DSGYNYGYSWEDP
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
SEQ ID NO: 242 is the amino acid sequence defining the 4-18 derived light chain of the 4-20/4-18 antibody 4-18LC
DSERPS
GIPERFSGSSSGTTVTLTISGVQAEDEADYYCQSTDNSGTYPN
WV
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGA
The 2-15mut/2-51 bispecific antibody sequence can comprise:
SEQ ID NO: 243 is the amino acid sequence defining the 2-15mut derived heavy chain of the 2-15mut/2-51 antibody 2-15HC-Hole-Cross
WINPISDGTNYAQKFQG
WVTMTRDTSISTVYMELSRLRSDDTAVYYCAR
GGSRCSGGNCYGWAYDAFDI
WGQGTMITVSSASTAAPSVFIFPPSDEQL
SEQ ID NO: 244 is the amino acid sequence defining the 2-15mut derived Light chain of the 2-15mut/2-51 antibody 2-15mutVLCH1
FV
FGTGTKVTVLSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
SEQ ID NO: 245 is the amino acid sequence defining the 2-51 derived heavy chain of the 2-15mut/2-51 antibody 2-51 HC-Knob
G
F
DPEDVETIYAQQFQG
RVTMTEDTSTDTAYMELSSLRSEDTAVYYCAT
GWAYKSTWYFGYWG
QGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALG
SEQ ID NO: 246 is the amino acid sequence defining the 2-51 derived light chain of the 2-15mut/2-51 antibody 2-51LC
G
FGGGTKLTVLGQPKAAPSVTLFPPSSEELQANKATLVCLISDFYPGAV
The 4-20/4-8(39/51) bispecific antibody sequence can comprise:
SEQ ID NO: 247 is the amino acid sequence defining the 4-20 derived heavy chain of the 4-20/4-8(39/51) antibody 4-20HC-Hole-Cross
IINPSGGGTTYAQKFQG
RVTMTRDTSTSTVYMELSSLRSEDTAVYYCAR
PGGGSYQEFDY
WGQGTLVTVSSASTAAPSVFIFPPSDEQLKSGTASVVC
SEQ ID NO: 248 is the amino acid sequence defining the 4-20 derived light chain of the 4-20/4-8(39/51) antibody 4-20VLCH1
ASSLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYNTLQVTFG
SEQ ID NO: 249 is the amino acid sequence defining the 4-8(39/51) derived heavy chain of the 4-20/4-8(39/51) antibody 4-8(39/51) HC-Knob
NIPILGIANYAQKFQG
RVTITADKSTSTAYMELSSLRSEDTAVYYCASLQ
TVDTAIEKYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAAL
SEQ ID NO: 250 is the amino acid sequence defining the 4-8(39/51) derived light chain of the 4-20/4-8(39/51) antibody 4-8LC
NKRPS
GIPERFSGSNSGNTATLTISGTQAMDEADYYCQAWDSSTAVFGGG
The 1-57/2-51 bispecific antibody sequence can comprise:
SEQ ID NO: 251 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/2-51 antibody 1-57HC-Hole-Cross
TRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYCAR
VHRWAYCINGVCFGAYSDY
WGQGTLVTVSSASTAAPSVFIFPPSDEQLKS
SEQ ID NO: 252 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/2-51 antibody 1-57VLCH1
GASSRAT
GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFG
SEQ ID NO: 253 is the amino acid sequence defining the 2-51 derived heavy chain of the 1-57/2-51 antibody 2-51 HC-Knob
FDPEDVETIYAQQFQG
RVTMTEDTSTDTAYMELSSLRSEDTAVYYCATGW
AYKSTWYFGY
WGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLV
SEQ ID NO: 254 is the amino acid sequence defining the 2-51 derived light chain of the 1-57/2-51 antibody 2-51LC
The 4-20/1-87 bispecific antibody sequence can comprise:
SEQ ID NO: 255 is the amino acid sequence defining the 4-20 derived heavy chain of the 4-20/1-87 antibody 4-20HC-Hole-Cross
INPSGGGTTYAQ
KFQGRVTMTRDTSTSTVYMELSSLRSEDTAVYYCARPG
GGSYQEFDY
WGQGTLVTVSSASTAAPSVFIFPPSDEQLKSGTASVVCLLN
SEQ ID NO: 256 is the amino acid sequence defining the 4-20 derived light chain of the 4-20/1-87 antibody 4-20VLCH1
ASSLQS
GVPSRFSGSGSGTDFTLTISSLQPEDFATYYCQQSYNTLQVTFG
SEQ ID NO: 257 is amino acid sequence defining the 1-87 derived heavy chain of the 4-20/1-87 antibody 1-87HC-Knob
FDPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCATGI
AVIGPPPSTYYYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT
SEQ ID NO: 258 is the amino acid sequence defining the 1-87 derived light chain of the 4-20/1-87 antibody 1-87LC
The 1-57/1-68 bispecific antibody sequence can comprise:
SEQ ID NO: 259 is the amino acid sequence defining the 1-57 derived heavy chain of the 1-57/1-68 antibody 1-57HC-Hole-Cross
TRNKANSYTTEYAASV
KGRFTISRDDAKNSLYLQMNSLKTEDTAVYYCAR
VHRWAYCINGVCFGAYSDY
WGQGTLVTVSSASTAAPSVFIFPPSDEQLKS
SEQ ID NO: 260 is the amino acid sequence defining the 1-57 derived light chain of the 1-57/1-68 antibody 1-57VLCH1
GASSRAT
GIPDRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPSTFG
SEQ ID NO: 261 is the amino acid sequence defining the 1-68 derived heavy chain of the 1-57/1-68 antibody 1-68HC-Knob
FDPEDAETIYAQ
KFQGRVTMTEDTSTDTAYMELSSLRSEDTAVYYCATGW
AVAGSSDVWYYYYGMDV
WGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGT
SEQ ID NO: 262 is the amino acid sequence defining the 1-68 derived light chain of the 1-57/1-68 antibody 1-68LC
In some embodiments, a bispecific antibody can be generated from any combination of two monoclonal antibodies described herein. In some embodiments, the subject matter disclosed herein related to the DNA sequence encoding a bispecific antibody comprising any SEQ ID NO from 1-262 or a combination of SEQ ID NOs 1-262. In some embodiments, the subject matter disclosed herein related to the RNA sequence encoding a bispecific antibody comprising any SEQ ID NO from 1-262 or a combination of SEQ ID NOs 1-262.
Examples are provided below to facilitate a more complete understanding of the invention. The following examples illustrate the exemplary modes of making and practicing the invention. However, the scope of the invention is not limited to specific embodiments disclosed in these Examples, which are for purposes of illustration only, since alternative methods can be utilized to obtain similar results.
By studying 40 COVID-19 patient cases in great detail, it was found that patients with more severe disease develop more robust antibodies in their blood to the coronavirus. These antibodies include antibodies specific to the spike protein trimer. For the disease to be classified as severe, the COVID-19 patients need mechanical ventilation in an intensive care unit and treatment with hydroxychloroquine, remdesivir, and/or tocilizumab. For the disease to be classified as non-severe, the COVID-19 patients do not require intensive care.
From the COVID-19 patient cases that indicated the most robust antibody responses in the experiments in
The experimental protocol can include the following steps. PBMCs from infected individuals were collected and stained with LIVE/DEAD™ Fixable Yellow Dead Cell Stain Kit (Invitrogen, cat: L34959) at room temperature for 20 minutes to exclude dead cells. Then the cells were incubated with 10 μg/ml spike trimer firstly and further an antibody cocktail for identification of SARS-CoV-2 S trimer specific B cells. The cocktail consisted of CD3-PE-CF594(BD Biosciences, cat:562406), CD19-PE-cy7(Biolegend, cat:302216), CD20-APC-cy7(Biolegend, cat:302314), IgM-V450(BD Biosciences, cat:561286), CD27-PerCP-Cy5.5(BD Biosciences, cat:560612) and Anti-His-PE (Biolegend, cat:362603). Spiker trimer-specific single B cells were gated as CD3-CD19 CD27+Spike trimer+ and sorted into Eppendorf® LoBind microcentrifuge tubes (Sigma, cat: Z666505). After antigen-specific CD27+ memory B cell enrichment, 1310 B cells were loaded on 10× Chromium Chips. All of the experimental processes were performed before library preparation in a BSL3-level laboratory. Single-cell lysis and RNA first-strand synthesis was performed using 10× Chromium Single Cell 5′ Library & Gel Bead Kit according to the manufacturer's protocol. The following RNA and VDJ library preparation is performed according to the manufacturer's protocol (Chromium Single Cell V(D)J Reagent Kits, 10× Genomics) in a BSL-2 laboratory. Sequencing was performed on a Hiseq 2500 platform running Rapid SBS Kit V2 2×100 bp kit (Illumina), with a 26×91 pair-end reading mode. Armed with this information, each monoclonal antibody was reconstructed, now over 250 monoclonal antibodies are obtained by this method.
As shown in
In order to determine where on the SAR-CoV-2 envelope these monoclonal antibodies bind, competition ELISA experiments were performed in order to map the epitopes of these new monoclonal antibodies. As shows in
To further characterize the binding affinity of these new monoclonal antibodies, surface plasmon resonance experiments were performed to determine the binding affinity of the most promising monoclonal antibodies to the SARS-CoV-2 spike trimer. As shown in
As shown in
Abstract
The SARS-CoV-2 pandemic rages on with devasting consequences on human lives and the global economy. The discovery and development of virus-neutralizing monoclonal antibodies could be one approach to treat or prevent infection by this novel coronavirus. Here we report the isolation of 61 SARS-CoV-2-neutralizing monoclonal antibodies from 5 infected patients hospitalized with severe disease. Among these are 19 antibodies that potently neutralized the authentic SARS-CoV-2 in vitro, 9 of which exhibited exquisite potency, with 50% virus-inhibitory concentrations of 1 to 9 ng/mL. Epitope mapping showed this collection of 19 antibodies to be about equally divided between those directed to the receptor-binding domain (RBD) and those to the N-terminal domain (NTD), indicating that both of these regions at the top of the viral spike are quite immunogenic. In addition, two other powerful neutralizing antibodies recognized quaternary epitopes that are overlapping with the domains at the top of the spike. Cryo-electron microscopy structures of one antibody targeting RBD, a second targeting NTD, and a third bridging RBD and NTD revealed recognition of the closed, “all RBD-down” conformation of the spike. Several of these monoclonal antibodies are promising candidates for clinical development as potential therapeutic and/or prophylactic agents against SARS-CoV-2.
Background
A novel coronavirus, now termed SARS-CoV-21,2, has caused nearly 8 million confirmed infections globally, leading to about 450,000 deaths. This pandemic has also put much of the world on pause, with unprecedented disruption of lives and unparalleled damage to the economy. A return to some semblance of normalcy will depend on science to deliver an effective solution, and the scientific community has responded admirably. Drug development is well underway, and vaccine candidates are entering clinical trials. Another promising approach is the isolation of SARS-CoV-2-neutralizing monoclonal antibodies (mAbs) that could be used as therapeutic or prophylactic agents. The primary target for such antibodies is the viral spike, a trimeric protein 3,4 that is responsible for binding to the ACE2 receptor on the host cell1,3,5,6. The spike protein is comprised of two subunits. The S1 subunit has two major structural elements: RBD and NTD; the S2 subunit mediates virus-cell membrane fusion after the RBD engages ACE2. Reports of discovery of neutralizing mAbs that target the RBD have been published recently7-11. We now describe our efforts in isolating and characterizing a collection of mAbs that not only target multiple epitopes on the viral spike but also show exquisite potency in neutralizing SARS-CoV-2.
Patient Selection
Forty patients with PCR-confirmed SARS-CoV-2 infection were enrolled in an observational cohort study on virus-neutralizing antibodies. Plasma samples from all subjects were first tested for neutralizing activity against SARS-CoV-2 pseudovirus (Wuhan-Hu-1 spike pseudotyped with vesicular stomatitis virus). Widely varying neutralizing titers were observed, with IC50 ranging from a reciprocal plasma dilution of <100 to ˜13,000 (
Monoclonal Antibody Isolation and Construction
Peripheral blood mononuclear cells from each patient were put through an experimental schema (
Monoclonal Antibody Screening
All 252 transfection supernatants were screened for binding to S trimer and RBD by enzyme-linked immunosorbent assays (ELISAs), as well as for neutralization against SARS-CoV-2 pseudovirus and live virus. These results are graphically represented in FIGS. and tabulated in
Sequence Analysis of S Trimer-Specific Monoclonal Antibodies
Of the 121 mAbs that bound S trimer, 88% were IgG isotype, with IgG1 being predominant (
Antigen Binding and Virus Neutralization
Since the screening for pseudovirus neutralization was performed quantitatively with serial dilutions of the transfection supernatants, we plotted in
The pseudovirus neutralization profiles for these purified 19 mAbs are shown in the top portion of
Epitope Mapping
All 19 potent neutralizing mAbs (
Second, a similar “checkerboard” competition experiment was carried out by ELISA for 14 of our RBD-directed mAbs plus CR302213,14. Here, the heatmap shows that there are four epitope clusters that are serially overlapping (
One potent neutralizing mAb, 2-43, did not bind S trimer by ELISA (
The results in
Cryo-Electron Microscopy
To further understand antibody recognition of the viral spike and to aid the interpretation of the mapping studies, we determined cryo-EM structures of Fabs from three mAbs in complex with the S trimer4. First, single-particle analysis of the complex with 2-4 Fab (RBD-directed) yielded maps of high quality (
Second, we also produced 3D cryo-EM reconstructions of the Fab of 4-8 (NTD-directed) in complex with the S trimer (
Third, a 7.8 Å resolution reconstructions of the Fab of 2-43 in complex with the S trimer (
Armed with these three cryo-EM reconstructions, we used the Venn diagrams from
We have discovered a collection of SARS-CoV-2-neutralizing mAbs that are not only potent but also diverse. Nine of these antibodies can neutralize the authentic virus in vitro at concentrations of 9 ng/mL of less (
The isolation of two mAbs (2-43 and 2-51) directed to epitopes that do not map to RBD and NTD is also unprecedented. Cryo-EM of 2-43 bound to the S trimer has confirmed its epitope as quaternary in nature, crossing from the top of RBD to the top of an adjacent NTD (
The potency and diversity of our SARS-CoV-2-neutralizing mAbs are likely attributable to patient selection. Previously, we observed that infected individuals with severe disease developed a more robust virus-neutralizing antibody response 25. If Patient 2 had not been included, five of the top neutralizing mAbs would be lost. The diversity of our antibodies is also attributable, in part, to the choice of using the S trimer to sort from memory B cells, while most groups focused on the use of RBD7,9-11,16-19,21. The characterization of this diverse collection of mAbs has allowed us to observe that all potent SARS-CoV-2-neutralizing antibodies described to date are directed to the top of the viral spike. RBD and NTD are, no doubt, quite immunogenic. Neutralizing antibodies to the stem region of the S trimer remain to be discovered. In conclusion, we believe several of our monoclonal antibodies with exquisite virus-neutralizing activity are promising candidates for development as modalities to treat or prevent SARS-CoV-2 infection.
Methods
Expression and Purification of SARS-CoV-2 Proteins
The mammalian expression vector that encodes the ectodomain of the SARS-CoV-2 S trimer and the vector encoding RBD fused with SD1 at the N-terminus and an HRV-3C protease cleavage site followed by a mFc tag and an 8×His tag at the C-terminus were kindly provided by Jason McLellan4. SARS-CoV-2 NTD (aa1-290) with an HRV-3C protease cleavage site, a mFc tag, and an 8×His tag at the C-terminus was also cloned into mammalian expression vector pCAGGS. Each expression vector was transiently transfected into Expi293 cells using 1 mg/mL of polyethylenimine (Polysciences). Five days post transfection, the S trimer was purified using Strep-Tactin XT Resin (Zymo Research), and the RBD-mFc and NTD-mFc were purified using protein A agarose (ThermoFisher Scientific). In order to obtain RBD-SD1 and NTD, the mFc and 8×His tags at the C-terminus were removed by HRV-3C protease (Millipore-Sigma) and then purified using Ni-NTA resin (Invitrogen) followed by protein A agarose.
Sorting for S Trimer-Specific B Cells and Single-Cell BCR Sequencing
Peripheral blood mononuclear cells from five patients and one healthy donor were stained with LIVE/DEAD™ Fixable Yellow Dead Cell Stain Kit (Invitrogen) at ambient temperature for 20 mins, followed by washing with RPMI-1640 complete medium and incubation with 10 μg/mL of S trimer at 4° C. for 45 mins. Afterwards, the cells were washed again and incubated with a cocktail of flow cytometry and hashtag antibodies, containing CD3 PE-CF594 (BD Biosciences), CD19 PE-Cy7 (Biolegend), CD20 APC-Cy7 (Biolegend), IgM V450 (BD Biosciences), CD27 PerCP-Cy5.5 (BD Biosciences), anti-His PE (Biolegend), and human Hashtag 3 (Biolegend) at 4° C. for 1 hr. Stained cells were then washed, resuspended in RPMI-1640 complete medium and sorted for S trimer-specific memory B cells (CD3-CD19+CD27+S trimer+live single lymphocytes). The sorted cells were mixed with mononuclear cells from the same donor, labeled with Hashtag 1, and loaded into the 10× Chromium chip of the 5′ Single Cell Immune Profiling Assay (10× Genomics) at the Columbia University Human Immune Monitoring Core (HIMC; RRID:SCR_016740). The library preparation and quality control were performed according to manufacturer's protocol and sequenced on a NextSeq 500 sequencer (Illumina).
Identification of S Trimer-Specific Antibody Transcripts
For each sample, full-length antibody transcripts were assembled using the VDJ module in Cell Ranger (version 3.1.0, 10× Genomics) with default parameters and the GRCh38 genome as reference. To identify cells from the antigen sort, we first used the count module in Cell Ranger to calculate copies of all hashtags in each cell from the Illumina NGS raw reads. High confidence antigen-specific cells were identified as follows. Briefly, based on the copy numbers of the hashtags observed, a cell must contain more than 100 copies of the antigen sort-specific hashtag to qualify as an antigen-specific cell. Because hashtags can fall off from cells and bind to cells from a different population in the sample mixture, each cell usually has both sorted and spiked-in-specific hashtags. To enrich for true antigen-specific cells, the copy number of the specific hashtag has to be at least 1.5× higher than that of the non-specific hashtag. Low quality cells were identified and removed using the cell-calling algorithm in Cell Ranger. Cells that do not have productive H and L chain pairs were excluded. If a cell contains more than two H or/and L chain transcripts, the transcripts with less than 3 unique molecular identifiers were removed. Cells with identical H and L chain sequences, which may have resulted from mRNA leakage, were merged into one cell. Additional filters were applied to remove low quality cells and/or transcripts in the antibody gene annotation process.
Antibody Transcript Annotation and Selection Criteria
Antigen-specific antibody transcripts were processed using our bioinformatics pipeline SONAR for quality control and annotation26. Briefly, V(D)J genes were assigned for each transcript using BLAST27 with customized parameters against a germline gene database obtained from the international ImMunoGeneTics information system (IMGT) database26,28. Based on BLAST alignments of V and J regions, CDR3 was identified using the conserved second cysteine in the V region and WGXG (H chain) or FGXG (L chain) motifs in the J region (X represents any amino acid). For H chain transcripts, the constant domain 1 (CH1) sequences were used to assign isotype using BLAST with default parameters against a database of human CH1 genes obtained from IMGT. A BLAST E-value threshold of 1 E-6 was used to find significant isotype assignments, and the CH1 allele with the lowest E-value was used. Sequences other than the V(D)J region were removed and transcripts containing incomplete V(D)J or/and frame shift were excluded. We then aligned each of the remaining transcripts to the assigned germline V gene using CLUSTALO29 and calculated the somatic hypermutation level.
To select representative antibodies for functional characterization, we first clustered all antibodies using USEARCH30 with the following criteria: identical heavy chain V and J gene assignments, the same length of CDRH3, and CDRH3 identity higher than 0.9. For each cluster, cells with the same light chain V and J gene assignments were grouped into a clone. All clone assignments were manually checked. We then calculated the clonal size for each clone, and one H and L chain pair per clone was chosen for antibody synthesis. For clones with multiple members, the member with the highest somatic hypermutation level was chosen for synthesis. For cells having multiple high quality H or L chains, which may be from doublets, we synthesized all H and L chain combinations.
Analysis of S Trimer-Specific Antibody Repertoire
Because 88% of the S trimer-specific antibodies were IgG isotype, we therefore compared the repertoire features to IgG repertoires from three healthy donors31 (17,243 H chains, 27,575 kappa L chains, 20,889 lambda L chains). The repertoire data from the three healthy donors were combined and annotated using SONAR with the same process as above.
Antibody Expression and Purification
For each antibody, variable genes were optimized for human cell expression and synthesized by GenScript. VH and VL were inserted separately into plasmids (gWiz or pcDNA3.4) that encode the constant region for H chain and L chain. Monoclonal antibodies were expressed in Expi293 (ThermoFisher, A14527) by co-transfection of H chain and L chain expressing plasmids using polyethylenimine and culture in 37° C. shaker at 125 RPM and 8% CO2. On day 3 post transfection, 400 μL of supernatant were collected for screening for binding to S trimer and RBD by ELISA, and for neutralization of SARS-CoV-2 pseudovirus and authentic virus. Supernatants were also collected on day 5 for antibody purification by rProtein A Sepharose (GE, 17-1279-01) affinity chromatography.
Production of Pseudoviruses
Recombinant Indiana VSV (rVSV) expressing SARS-CoV-2 spike was generated as previouslydescribed32,33. HEK293T cells were grown to 80% confluency before transfection with pCMV3-SARS-CoV-2-spike (Sino Biological) using FuGENE 6 (Promega). Cells were cultured overnight at 37° C. with 5% CO2. The next day, medium was removed and VSV-G pseudotyped ΔG-luciferase (G*ΔG-luciferase, Kerafast) was used to infect the cells in DMEM at a MOI of 3 for 1 hr before washing the cells with 1×DPBS three times. DMEM supplemented with 2% fetal bovine serum and 100 I.U./mL of penicillin and 100 μg/mL of streptomycin were added to the inoculated cells, which were cultured overnight as described above. The supernatant was harvested the following day and clarified by centrifugation at 300 g for 10 mins before aliquoting and storing at −80° C.
Pseudovirus Neutralization
Neutralization assays were performed by incubating pseudoviruses with serial dilutions of heat inactivated plasma together with supernatant or purified antibodies, and scored by the reduction in luciferase gene expression. In brief, Vero E6 cells (ATCC) were seeded in a 96-well plate at a concentration of 2×104 cells per well. Pseudoviruses were incubated the next day with serial dilutions of the test samples in duplicate or triplicate for 30 mins at 37° C. The mixture was added to cultured cells and incubated for an additional 24 hrs. The luminescence was measured by Britelite plus Reporter Gene Assay System (PerkinElmer). IC50 was defined as the dilution at which the relative light units were reduced by 50% compared with the virus control wells (virus+cells) after subtraction of the background in the control groups with cells only. The IC50 values were calculated using non-linear regression in GraphPad Prism 8.0.
Authentic SARS-CoV-2 Neutralization
Supernatants containing expressed mAbs were diluted 1:10 and 1:50 in EMEM with 7.5% inactivated fetal calf serum and incubated with authentic SARS-CoV-2 (strain USA-WA1/2020; MOI 0.1) for 1 hr at 37° C. Post-incubation, the mixture was transferred onto a monolayer of Vero E6 cells that was cultured overnight. After incubation of the cells with the mixture for 70 hrs at 37° C., cytopathic effects (CPE) caused by the infection were scored for each well from 0 to 4 to indicate the degree of virus inhibition. Semi-quantitative representation of the inhibition for each antibody-containing supernatant at a dilution of 1:50 is shown in the lowest panel of
An end-point dilution assay in a 96-well plate format was performed to measure the neutralization activity of select purified mAbs. In brief, each antibody was serially diluted (5-fold dilutions) starting at 20 μg/mL. Triplicates of each mAb dilution were incubated with SARS-CoV-2 at aMOI of 0.1 in EMEM with 7.5% inactivated fetal calf serum for 1 hr at 37° C. Post incubation, the virus-antibody mixture was transferred onto a monolayer of Vero-E6 cells grown overnight. The cells were incubated with the mixture for 70 hrs. CPE were visually scored for each well in a blinded fashion by two independent observers. The results were then converted into percentage neutralization at a given mAb concentration, and the averages ±SEM were plotted using a five-parameter dose-response curve in GraphPad Prism 8.0.
Epitope Mapping by ELISA
50 ng/well of S trimer, 50 ng/well of RBD, and 100 ng/well of NTD were coated on ELISA plates at 4° C. overnight. The ELISA plates were then blocked with 300 μL of blocking buffer (1% BSA and 10% bovine calf serum (BCS) (Sigma) in PBS at 37° C. for 2 hrs. Afterwards, supernatants from the antibody transfection or purified antibodies were serially diluted using dilution buffer (1% BSA and 20% BCS in PBS), incubated at 37° C. for 1 hr. Next, 100 μL of 10,000-fold diluted Peroxidase AffiniPure goat anti-human IgG (H+L) antibody (Jackson ImmunoResearch) were added into each well and incubated for 1 hr at 37° C. The plates were washed between each step with PB ST (0.5% Tween-20 in PBS). Finally, the TMB substrate (Sigma) was added and incubated before the reaction was stopped using 1M sulfuric acid. Absorbance was measured at 450 nm.
For the competition ELISA, purified mAbs were biotin-labeled using One-Step Antibody Biotinylation Kit (Miltenyi Biotec) following manufacturer recommendations and purified using 40K MWCO Desalting Column (ThermoFisher Scientific). 50 μL of serially diluted competitor antibodies were added into S trimer-precoated ELISA plates, followed by μL of biotinylated antibodies at a concentration that achieves an OD450 reading of 1.5 in the absence of competitor antibodies. Plates were incubated at 37° C. for 1 hr, and 100 μL of 500-fold diluted Avidin-HRP (ThermoFisher Scientific) were added into each well and incubated for another 1 hr at 37° C. The plates were washed by PBST between each of the previous steps. The plates were developed afterwards with TMB and absorbance was read at 450 nm after the reaction was stopped.
For the ACE2 competition ELISA, 100 ng of ACE2 protein (Abcam) was immobilized on the plates at 4° C. overnight. The unbound ACE2 was washed away by PB ST and then the plates were blocked. After washing, 100 ng of S trimer in 50 μL of dilution buffer was added into each well, followed by adding another 50 μL of serially diluted competitor antibodies and then incubating the plates at 37° C. for 1 hr. The ELISA plates were washed 4 times by PBST and then 100 μL of 2000-fold diluted anti-strep-HRP (Millipore Sigma) were added into each well for another 1 hr at 37° C. The plates were then washed, developed with TMB, and absorbance was read at 450 nm after the reaction was stopped.
For all the competition ELISA experiments, the relative binding of biotinylated antibodies or ACE2 to the S trimer in the presence of competitors was normalized by comparing to competitor-free controls. Relative binding curve and the area under curve (AUC) were generated by fitting the non-linear five-parameter dose-response curve in GraphPad Prism 8.0.
Cell-Surface Competition Binding Assay
Expi293 cells were co-transfected with vectors encoding pRRL-cPPT-PGK-GFP (Addgene) and pCMV3-SARS-CoV-2 (2019-nCoV) Spike (Sino Biological) at a ratio of 1:1. Two days after transfection, cells were incubated with a mixture of biotinylated mAb 2-43 (0.25 μg/mL) and serially diluted competitor antibodies at 4° C. for 1 hr. Then 100 μL of diluted APC-streptavidin (Biolegend) were added to the cells and incubated at 4° C. for 45 mins. Cells were washed 3 times with FACS buffer before each step. Finally, cells were resuspended and 2-43 binding to cell-surface S trimer was quantified on LSRII flow cytometer (BD Biosciences). The mean fluorescence intensity of APC in GFP-positive cells was analyzed using FlowJo and the relative binding of 2-43 to S trimer in the presence of competitors was calculated as the percentage of the mean fluorescence intensity compared to that of the competitor-free controls.
Cryo-EM Data Collection and Processing
SARS-CoV-2 S trimer at a final concentration of 2 mg/ml was incubated with 6-fold molar excess per spike monomer of the antibody Fab fragments for 30 mins in 10 mM Tris-HCl, 150 mM NaCl, and 0.005% n-Dodecyl-β-D-maltoside (DDM). 2 μL of sample were incubated on C-flat 1.2/1.3 carbon grids for 30 secs and vitrified using a Leica EM GP Plunge Freezer. Data were collected on a Titan Krios electron microscope operating at 300 kV equipped with a Gatan K3 direct detector and energy filter using the Leginon software package34. A total electron fluence of 51.3 e/Å2 was fractionated over 40 frames, with a total exposure time of 2 secs. A magnification of 81,000× resulted in a pixel size of 1.058 Å, and a defocus range of −0.4 to −3.5 μm was used. All processing was done using cryoSPARC v2.14.235. Raw movies were aligned and dose-weighted using patch motion correction, and the CTF was estimated using patch CTF estimation. A small subset of approximately 200 micrographs were picked using blob picker, followed by 2D classification and manual curation of particle picks, and used to train a Topaz neural network36. This network was then used to pick particles from the remaining micrographs, which were extracted with a box size of 384 pixels. For the Fab 2-4 dataset, 2D classification followed by ab initio modelling and 3D heterogeneous refinement revealed 83,927 particles with three 2-4 Fabs bound, one to each RBD. Our construction of these particles using Non-Uniform Refinement with imposed C3 symmetry resulted in a 3.6 Å map, as determined by the gold standard FSC. Given the relatively low resolution of the RBD-Fab interface, masked local refinement was used to obtain a 3.5 Å map with significantly improved density. A masked local refinement of the remainder of the S timer resulted in a 3.5 Å reconstruction. These two local refinements were aligned and combined using the vop maximum function in UCSF Chimera37. This was repeated for the half maps, which were used, along with the refinement mask from the global Non-Uniform refinement, to calculate the 3DFSC38 and obtain an estimated resolution of 3.2 Å. All maps have been submitted to the EMDB with the ID EMD-22156. For the Fab 4-8 dataset, image preprocessing and particle picking was performed as above. 2D classification, ab initio modelling, and 3D heterogeneous classification revealed 47,555 particles with 3 Fabs bound, one to each NTD and with all 3 RBDs in the down conformation. While this particle stack was refined to 3.9 Å using Non-Uniform refinement with imposed C3 symmetry, significant molecular motion prevented the visualization of the Fab epitope at high resolution (EMD-22159). In addition, 105,278 particles were shown to have 3 Fabs bound, but with 1 RBD in the up conformation. These particles were refined to 4.0 Å using Non-Uniform refinement with Cl symmetry (EMD-22158), and suffered from the same conformational flexibility as the all-RBD-down particles. This flexibility was visualized using 3D variability analysis in cryoSPARC. For the Fab 2-43 dataset, which was collected at an electron fluence of 53.4 e/Å2, image preprocessing and particle picking was performed as above, save that motion correction was performed using MotionCor239. 2D classification, ab initio modelling, and 3D heterogeneous classification revealed 18,884 particles with 3 Fabs bound, which was refined to 7.8 Å resolution 601 (EMD-22157).
Cryo-EM Model Fitting
An initial homology model of the 2-4 Fab was built using Schrodinger Release 2020-2: BioLuminate40. The RBD was initially modeled using the coordinates from PDB ID 6W41. The remainder of the S timer was modeled using the coordinates from PDB ID 6VSB. These models were docked into the consensus map using Chimera. The model was then fitted interactively using ISOLDE 1.0b541 and COOT 0.8.9.242, and using real space refinement in Phenix 1.1843. In cases where side chains were not visible in the experimental data, they were truncated to alanine. Validation was performed using Molprobity44 and EMRinger45. The model was submitted to the PDB with the ID 6XEY. Figures were prepared using ChimeraX46.
SARS-CoV-2 is phylogenetically closely related to SARS-CoV, which caused the 2002-2003 human epidemic. SARS-CoV and SARS-CoV-2 share 76% amino acid identity in their Spike proteins, raising the possibility of conserved immunogenic surfaces on these antigens. Many human monoclonal antibodies have now been shown to target the SARS-CoV-2 Spike protein, but cross-neutralizing antibodies are relatively uncommon in individuals with COVID-19. There are also SARS-like viruses including some zoonotic sarbecoviruses in bats or pangolins which could infect human cells, and therefore, have the potential to cause next pandemics.
Our invention claims to isolate and characterize a monoclonal antibody that could not only neutralize SARS-CoV-2 and SARS-CoV but also neutralize sarbecoviruses in bats and pangolins. Such cross-neutralizing antibodies are extremely valuable to understand how to confer broader protection against human SARS-like viruses that include the extensive reservoir of zoonotic sarbecoviruses in bats, pangolins, etc.
In order to find antibodies that have cross-neutralizing activities, we screened anti-SARS-CoV antibodies from COVID-19 convalescent patients. SARS-CoV-2 spike specific antibodies were isolated by single-B cell sorting and 10× genomics sequencing, and then the antibodies were synthesized and the transfection supernatants were used to screen anti-SARS-CoV antibodies using SARS-CoV pseudovirus. While most of the antibodies showed no or very weak neutralizing activity, antibody 2-36 was found to be a potent neutralizer against SARS-CoV (
We next characterized this antibody by first testing its binding to SARS-CoV-2 and SARS-CoV spikes by ELISA with CR3022, an antibody previously reported to have cross-activity, as a control. We confirmed that antibody 2-36 can bind to both SARS-CoV-2 and SARS-CoV spikes (
We then tested the neutralization activity of antibody 2-36 against SARS-CoV-2 and SARS-CoV, and showed that antibody 2-36 can potently neutralize SARS-CoV-2 with IC50 0.004 μg/ml (
We also tested antibody 2-36 against a panel of other coronaviruses including, MERS-CoV, human common cold coronavirus 229E and some bat and pangolin coronaviruses (
We also solved the Cryo-EM structure of antibody 2-36 in complex with SARS-CoV-2 Spike trimer (
As such, antibody 2-36 can serve as the starting point for engineering a more potent antibody against diverse bat coronaviruses with human pandemic potential. Such an antibody could be further developed and placed in the national stockpile for pandemic preparedness. Furthermore, we have a defined a conserved site in the spike that could be targeted for development of a broadly protective vaccine against bat coronaviruses with pandemic potential.
Antibody 2-36 is a monoclonal antibody that neutralizes SARS-CoV-2 variants, SARS-CoV, and other beta-coronaviruses. To screen monoclonal antibodies with cross-neutralizing activity against other beta-coronaviruses, more than 200 mAbs isolated from COVID-19 convalescent patients (Liu et al. Nature 2020) were tested on SARS-CoV pseudovirus. Monoclonal antibody 2-36 not only neutralizes SARS-CoV-2 pseudovirus at IC50˜0.04 μg/ml and authentic virus at IC50˜0.1 μg/mL, but also shows neutralizing activity against SARS-CoV, although with lower potency (IC50˜0.2 μg/mL on pseudovirus and IC50˜7.5 μg/mL on authentic virus). Monoclonal antibody 2-36 can block SARS-CoV-2 spike trimer binding to ACE2. Conservation analysis on the receptor-binding domain (RBD) among SARS-CoV-2, SARS-CoV, and some bat and pangolin coronavirus strains show that the 2-36 binding site is highly conserved. Antibody 2-36 was tested on different SARS-CoV-2 variants of concern/interest (including B.1.1.7, B.1.351, P.1, B.1.526, R.1, B.1.429) and many single mutations with high circulating frequency. The results show that antibody 2-36 can neutralize all these variants/mutations without any significant loss of activities. Moreover, besides SARS-CoV-2 and SARS-CoV, antibody 2-36 also neutralizes some bat and pangolin coronaviruses which can use human ACE2 as a receptor to enter host cells. These coronaviruses include but are not limited to RaTG13, WIV1, SHC014, GDPangolin, and GXPangolin viruses. Antibody 2-36 escape mutations were selected by in vitro passage of SARS-CoV-2 in Vero E6 cells in presence of 2-36 and confirmed that K378T in spike RBD, with very low frequency in nature, led to viral resistance. Taken these results together, 2-36 represents a promising strategic reserve drug candidate for the prevention and treatment of possible diseases caused by pre-emergent SARS-related CoVs.
As described herein, bispecific antibodies bearing either the 1400 arm or the A32 arm indicate that those arms of the bispecific antibody are not specific to and do not bind the spike protein of the SARS-CoV-2 virus. These antibodies provide an “irrelevant” control to demonstrate the need for avidity by “both” arms of bispecific antibodies being controlled for. Constructs bearing these irrelevant controls are referred to as single arm IgG controls. 1400 (PGDM1400) is a neutralizing monoclonal antibody against the human immunodeficiency virus (HIV). A32 is a non-neutralizing monoclonal antibody against HIV. The same control antibodies were used throughout the study. AbX and AbY are controls, X=PGDM1400 (HIV neutralization antibody). Y=A32 (HIV neutralization antibody). Because they do not neutralize SARS-CoV-2 or any variant strains, they are utilized herein to construct bispecific antibodies with one arm against SARS-CoV-2 and the other arm without any activity against SARS-CoV-2. These control antibodies, therefore, allow one to accurately attribute the contribution of each arm to the activity of the bispecific antibodies.
Constructed bispecific antibodies show potent neutralization against SARS-CoV-2 at a level similar or better than the parental antibodies. Both arms of the bispecific antibodies contribute to the neutralization activity of the bispecific molecule. A bispecific antibody is a single molecule with high barrier for viral escape and/or synergetic potency for COVID-19 treatment and prevention. Activity enhancement observed can be extended to any engineered bispecific antibody format.
The IC50 of bispecific antibody 2-7/5-7 is 0.002 μg/ml. The IC50 of the combination of parental antibodies 2-7 and 5-7 is 0.020 μg/ml.
This application claims the benefit of and priority to U.S. Provisional Patent Application No. 63/027,935, filed on May 20, 2020, U.S. Provisional Patent Application No. 63/032,518, filed on May 29, 2020, U.S. Provisional Patent Application No. 63/039,977, filed on Jun. 16, 2020, U.S. Provisional Patent Application No. 63/063,106, filed Aug. 7, 2020, U.S. Provisional Patent Application No. 63/123,767, filed Dec. 10, 2020, U.S. Provisional Patent Application No. 63/060,116, filed on Aug. 2, 2020, U.S. Provisional Patent Application No. 63/117,908, filed on Nov. 24, 2020, and U.S. Provisional Patent Application No. 63/165,729, filed on Mar. 24, 2021, the contents of each of which is hereby incorporated by reference in its entirety. All patents, patent applications and publications cited herein are hereby incorporated by reference in their entirety. The disclosures of these publications in their entireties are hereby incorporated by reference into this application. This patent disclosure contains material that is subject to copyright protection. The copyright owner has no objection to the facsimile reproduction by anyone of the patent document or the patent disclosure as it appears in the U.S. Patent and Trademark Office patent file or records, but otherwise reserves any and all copyright rights.
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/US2021/033513 | 5/20/2021 | WO |
Number | Date | Country | |
---|---|---|---|
63027935 | May 2020 | US | |
63032518 | May 2020 | US | |
63039977 | Jun 2020 | US | |
63060116 | Aug 2020 | US | |
63063106 | Aug 2020 | US | |
63117908 | Nov 2020 | US | |
63123767 | Dec 2020 | US | |
63165729 | Mar 2021 | US |