Claims
- 1. A process for purifying a product, said process comprising microfiltration of a fermentation broth containing the product at a microfiltration temperature within the range from 66° C. to 90° C.
- 2. The process according to claim 1, wherein said microfiltration is performed in the absence of activated carbon.
- 3. The process according to claim 1, wherein the microfiltration temperature is within the range from 70° C. to 90° C.
- 4. The process according to claim 1, wherein the microfiltration temperature is within the range from 70° C. to 80° C.
- 5. The process according to claim 1, wherein the microfiltration is performed as a cross flow microfiltration.
- 6. The process according to claim 5, wherein the microfiltration process is performed with a vibrating microfiltration membrane.
- 7. The process according to claim 5, wherein the microfiltration process is performed with backshock.
- 8. The process according to claim 1, wherein the microfiltration process is performed using a microfiltration membrane formed from a material selected from the group consisting of natural polymers, synthetic polymers, ceramics, metals and mixtures thereof
- 9. The process according to claim 1, wherein the microfiltration process is performed using a polysulphone membrane.
- 10. The process according to claim 1, wherein the microfiltration process is performed as a batch process.
- 11. The process according to claim 1, wherein the microfiltration process is performed as a continuous process.
- 12. The process according to claim 1, wherein the microfiltration process is followed by an ultrafiltration process.
- 13. The process according to claim 12, wherein the cut-off value of the ultrafiltration membrane is lower than four times the molecular weight of the fermentation-derived product.
- 14. The process according to claim 12, wherein the cut-off value of the ultrafiltration membrane is lower than twice the molecular weight of the fermentation-derived product.
- 15. The process according to claim 12, wherein the cut-off value of the ultrafiltration membrane is lower than the molecular weight of the fermentation-derived product.
- 16. The process according to claim 1, wherein the microfiltration process is followed by at least one chromatographic step or at least one precipitation step.
- 17. The process according to claim 1, wherein the product is at temperatures higher than 60° C. for less than 60 minutes.
- 18. The process according to claim 1, wherein the product is at temperatures higher than 60° C. for less than 30 minutes.
- 19. The process according to claim 1, wherein the product is at temperatures higher than 60° C. for less than 15 minutes.
- 20. The process according to claim 1, wherein the product is at temperatures higher than 60C. for less than 10 minutes.
- 21. The process according to claim 1, wherein the product is a protein.
- 22. The process according to claim 21, wherein said protein is a microbially derived protein.
- 23. The process according to claim 22, wherein the host cell producing said protein is selected from the group consisting of E. coli, Saccharomyces, Pichia, Candida and Kluyveromyces.
- 24. The process according to claim 22, wherein said protein is a pharmaceutical protein or a precursor thereof.
- 25. The process according to claim 21 wherein the product is a protein with a molar weight of less than 25000 Dalton.
- 26. The process according to claim 21 wherein the product is a protein with a molar weight of less than 10000 Dalton.
- 27. The process according to claim 21 wherein the product is a protein with a molar weight of less than 7000 Dalton.
- 28. The process according to claim 21 wherein the product is a protein with a molar weight of less than 4000 Dalton.
- 29. The process according to claim 21, wherein said protein is selected from the group consisting of glucagons-like peptide 1 (GLP-1), glucagons-like peptide 2 (GLP-2), glucagon, trefoil factor (TFF) peptides, interleukins, insulin, albumin, precursors thereof and analogs of any of the foregoing.
- 30. The process according to claim 29, wherein said protein is selected from the group consisting of human insulin, a human insulin precursor, a human insulin analog, a human insulin analog precursor, and Arg34-GLP-1(7-37).
- 31. The process according to claim 29, wherein said protein is selected from the group consisting of Arg34-GLP-1(7-37), Gly8-GLP-1(7-36)-amide, Gly8-GLP-1(7-37), Val8-GLP-1(7-36)-amide, Val8-GLP-1(7-37), Val8Asp22-GLP-1(7-36)amide, Val8Asp22-GLP-1(7-37), Val8Glu22-GLP-1(7-36)-amide, Val8Glu22-GLP-1(7-37), Val8Lys22-GLP-1(7-36)-amide, Val8Lys22-GLP-1(7-37), Val8Arg22-GLP-1(7-36)-amide, Val8Arg22-GLP-1(7-37), Val8His22-GLP-1(7-36)-amide, Val8 His22 -GLP-1(7-37), Val8Trp19Glu22-GLP-1(7-37), Val8Glu22Val25-GLP-1(7-37), Val8Tyr16Glu22-GLP-1(7-37), Val8Trp16Glu22-GLP-1(7-37), Val8Leu16Glu22-GLP-1(7-37), Val8Tyr8Glu22-GLP-1(7-37), Val8Glu22His37-GLP-1(7-37), Val8Glu22ILE33-GLP-1(7-37), Val8Trp16Glu22Val25Ile33-GLP-1(7-37), Val8Trp16Glu22Ile33-GLP-1(7-37), Val8Glu22Val25Ile33-GLP-1(7-37), Val8Trp16Glu22Val25-GLP-1(7-37) and analogs thereof.
- 31. The process according to claim 29, wherein said protein is selected from the group consisting of: K30R-GLP-2(1-33); S5K-GLP-2(1-33); S7K-GLP-2(1-33); D8K-GLP-2(1-33); E9K-GLP-2(1-33); M10K-GLP-2(1-33); N11K-GLP-2(1-33); T12K-GLP-2(1-33); 113K-GLP-2(1-33); L14K-GLP-2(1-33); D15K-GLP-2(1-33); N16K-GLP-2(1-33); L17K-GLP-2(1-33); A18K-GLP-2(1-33); D21K-GLP-2(1-33); N24K-GLP-2(1-33); Q28K-GLP-2(1-33); S5K/K30R-GLP-2(1-33); S7K/K30R-GLP-2(1-33); D8K/K30R-GLP-2(1-33); E9K/K30R-GLP-2(1-33); M10K/K30R-GLP-2(1-33); N11K/K30R-GLP-2(1-33); T12K/K30R-GLP-2(1 -33); I13K/K30R-GLP-2(1-33); L14K/K30R-GLP-2(1-33); D15K/K30R-GLP-2(1-33); N16K/K30R-GLP-2(1-33); L17K/K30R-GLP-2(1-33); A18K/K30R-GLP-2(1-33); D21 K/K30R-GLP-2(1-33); N24K/K30R-GLP-2(1-33); Q28K/K30R-GLP-2(1-33); K30R/D33K-GLP-2(1-33); D3E/K30R/D33E-GLP-2(1-33); D3E/S5K/K30R/D33E-GLP-2(1-33); D3E/S7K/K30R/D33E-GLP-2(1-33); D3E/D8K/K30R/D33E-GLP-2(1-33); D3E/E9K/K30R/D33E-GLP-2(1-33); D3E/M10K/K30R/D33E-GLP-2(1-33); D3E/N11K/K30R/D33E-GLP-2(1-33); D3E/T12K/K30R/D33E-GLP-2(1-33); D3E/I13K/K30R/D33E-GLP-2(1-33); D3E/L14K/K30R/D33E-GLP-2(1-33); D3E/D15K/K30R/D33E-GLP-2(1 -33); D3E/N 16K/K30R/D33E-GLP-2(1-33); D3E/L 17K/K30R/D33E-GLP-2(1-33); D3E/A18K/K30R/D33E-GLP-2(1 -33); D3E/D21 K/K30R/D33E-GLP-2(1-33); D3E/N24K/K30R/D33E-GLP-2(1-33); D3E/Q28K/K30R/D33E-GLP-2(1-33); and precursors thereof
- 32. The process according to claim 21, wherein said protein is exendin-3, exendin4 or analogs thereof and precursors of any of the foregoing.
- 33. The process according to claim 32, wherein said protein is ZP-10 (HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK-NH2).
Priority Claims (1)
Number |
Date |
Country |
Kind |
PA 2002 01422 |
Sep 2002 |
DK |
|
CROSS REFERENCE TO RELATED APPLICATIONS:
[0001] This application claims priority under 35 U.S.C. 119 of Danish Application No. PA 2002 01422 filed Sep. 25, 2002 and of U.S. Provisional Application No. 60/413,729 filed Sep. 26, 2002, the contents of which are fully incorporated herein by reference.
Provisional Applications (1)
|
Number |
Date |
Country |
|
60413729 |
Sep 2002 |
US |