RAPAMYCIN ANALOGS AS MTOR INHIBITORS

Abstract
The present disclosure relates to mTOR inhibitors. Specifically, the embodiments are directed to compounds and compositions inhibiting mTOR, methods of treating diseases mediated by mTOR, and methods of synthesizing these compounds.
Description
FIELD OF THE DISCLOSURE

The present disclosure relates to mTOR inhibitors. Specifically, the embodiments are directed to compounds and compositions inhibiting mTOR, methods of treating diseases mediated by mTOR, and methods of synthesizing these compounds.


BACKGROUND OF THE DISCLOSURE

The mammalian target of rapamycin (mTOR) is a serine-threonine kinase related to the lipid kinases of the phosphoinositide 3-kinase (PI3K) family. mTOR exists in two complexes, mTORC1 and mTORC2, which are differentially regulated, have distinct substrate specificities, and are differentially sensitive to rapamycin. mTORC1 integrates signals from growth factor receptors with cellular nutritional status and controls the level of cap-dependent mRNA translation by modulating the activity of key translational components such as the cap-binding protein and oncogene eIF4E.


mTOR signaling has been deciphered in increasing detail. The differing pharmacology of inhibitors of mTOR has been particularly informative. The first reported inhibitor of mTOR, Rapamycin is now understood to be an incomplete inhibitor of mTORC1. Rapamycin, is a selective mTORC1 inhibitor through the binding to the FK506 Rapamycin Binding (FRB) domain of mTOR kinase with the aid of FK506 binding protein 12 (FKBP12). The FRB domain of mTOR is accessible in the mTORC1 complex, but less so in the mTORC2 complex. Interestingly, the potency of inhibitory activities against downstream substrates of mTORC1 by the treatment of Rapamycin is known to be diverse among the mTORC1 substrates. For example, Rapamycin strongly inhibits phosphorylation of the mTORC1 substrate S6K and, indirectly, phosphorylation of the downstream ribosomal protein S6 which control ribosomal biogenesis. On the other hand, Rapamycin shows only partial inhibitory activity against phosphorylation of 4E-BP1, a major regulator of eIF4E which controls the initiation of CAP-dependent translation. As a result, more complete inhibitors of mTORC1 signaling are of interest.


A second class of “ATP-site” inhibitors of mTOR kinase, were reported. This class of mTOR inhibitor will be referred to as asTORi (ATP site TOR inhibitor). The molecules compete with ATP, the substrate for the kinase reaction, in the active site of the mTOR kinase (and are therefore also mTOR active site inhibitors). As a result, these molecules inhibit downstream phosphorylation of a broader range of substrates.


Although as mTOR inhibition may have the effect of blocking 4E-BP1 phosphorylation, these agents may also inhibit mTORC2, which leads to a block of Akt activation due to inhibition of phosphorylation of Akt S473.


Disclosed herein, inter alia, are mTORC1 inhibitors.


SUMMARY OF THE DISCLOSURE

The present disclosure relates to compounds capable of inhibiting the activity of mTOR. The present disclosure further provides a process for the preparation of compounds of the present disclosure, pharmaceutical preparations comprising such compounds and methods of using such compounds and compositions in the management of diseases or disorders mediated by mTOR.


The present disclosure provides compounds of Formula I-X:




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein:


R16 is selected from R1, R2, H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═N—R1, ═N—R2, ═O, —OR3, and ═N—OR3;


R28 is selected from R1, R2, —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from ═N—R1, ═N—R2, H, ═O, —OR3, ═N—OR3, ═N—NHR3, and N(R3)2;


R40 is selected from R1, R2, —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein the compound comprises one R1 or one R2;


R1 is -A-L1-B;


R2 is -A-C≡CH, -A-N3, -A-COOH, or -A-NHR3; and


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—, —OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,


-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,


wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;


wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, hydroxyl, —C(O)OR3, —C(O)N(R3)2, —N(R3)2, and alkyl substituted with —N(R3)2;


L1 is selected from




embedded image


embedded image


embedded image


embedded image


embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


embedded image


embedded image


embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H, (C1-C6)alkyl, —C(O)(C1-C6)alkyl, —C(O)NH-aryl, or —C(S)NH-aryl, wherein the alkyl is unsubstituted or substituted with —COOH, (C6-C10)aryl or —OH;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, —C(O)NR3-heteroaryl, or —C(O)NR3-heterocyclyl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 30; and


each r is independently 1, 2, 3, or 4;


provided that when R40 is R1, wherein R1 is -A-L1-B; L1 is




embedded image


then A is not —O(CH2)2—O(CH2)—.


The present disclosure provides compounds of Formula I-Xa:




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein:


R16 is selected from R1, R2, H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═N—R1, ═N—R2, ═O, —OR3, and ═N—OR3;


R28 is selected from R1, R2, —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from ═N—R1, ═N—R2, H, ═O, —OR3, ═N—OR3, ═N—NHR3, and N(R3)2;


R40 is selected from R1, R2, —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein the compound comprises one R1 or one R2;


R1 is -A-L1-B;


R2 is -A-C≡CH, -A-N3, -A-COOH, or -A-NHR3; and


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, hydroxyl, —C(O)OR3, —C(O)N(R3)2, —N(R3)2, and alkyl substituted with —N(R3)2;


L1 is selected from




embedded image


embedded image


embedded image


embedded image


embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H, (C1-C6)alkyl, —C(O)(C1-C6)alkyl, —C(O)NH-aryl, or —C(S)NH-aryl, wherein the alkyl is unsubstituted or substituted with —COOH, (C6-C10)aryl or —OH;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, —C(O)NR3-heteroaryl, or —C(O)NR3-heterocyclyl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 30; and


each r is independently 1, 2, 3, or 4;


provided that when R40 is R1, wherein R1 is -A-L1-B; L1 is




embedded image


then A is not —O(CH2)2—O(CH2)—


The present disclosure provides compounds of Formula I:




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein:


R16 is selected from R1, R2, H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═N—R1, ═N—R2, ═O, —OR3, and ═N—OR3;


R28 is selected from R1, R2, —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from ═N—R1, ═N—R2, H, ═O, —OR3, and ═N—OR3;


R40 is selected from R1, R2, —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein the compound comprises one R1 or one R2;


R1 is -A-L1-B;


R2 is -A-C≡CH, -A-N3, -A-COOH, or -A-NHR3; and


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl; L1 is selected from




embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4;


provided that when R40 is R1, wherein R1 is -A-L1-B; L1 is




embedded image


B is



embedded image


and B1 is custom-characterNR3—(C(R3)2)n—; then A is not —O(CH2)2—O(CH2)—.


The present disclosure provides compounds of Formula (Ia):




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein:


R16 is R1 or R2;


R26 is selected from ═O, —OR3, and ═N—OR3;


R28 is selected from —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from H, ═O, —OR3, and ═N—OR3;


R40 is selected from —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein R1 is -A-L1-B;


R2 is A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


L1 is selected from




embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4.


The present disclosure provides compounds of Formula (Ib):




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein:


R16 is selected from H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2,


—NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is ═N—R′ or ═N—R2;


R28 is selected from —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from H, ═O, —OR3, and ═N—OR3;


R40 is selected from —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3,


—S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein R1 is -A-L1-B;


R2 is A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl; L1 is selected from




embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4.


The present disclosure provides compounds of Formula (Ic):




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein:


R16 is selected from H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═O, —OR3, and ═N—OR3;


R28 is R1 or R2;


R32 is selected from H, ═O, —OR3, and ═N—OR3;


R40 is selected from —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3,


—S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein the compound comprises one R1 or one R2;


wherein R1 is -A-L1-B;


R2 is A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl; L1 is selected from




embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4.


The present disclosure provides compounds of Formula (Id):




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein:


R16 is selected from H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═O, —OR3, and ═N—OR3;


R28 is selected from —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is ═N—R1 or R2;


R40 is selected from —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3,


—S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein R1 is -A-L1-B;


R2 is A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


L1 is selected from




embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4.


The present disclosure provides compounds of Formula (Ie):




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein:


R16 is selected from H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═O, —OR3, and ═N—OR3;


R28 is selected from —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from H, ═O, —OR3, and ═N—OR3;


R40 is R1 or R2;


wherein R1 is -A-L1-B;


R2 is A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


L1 is selected from




embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


embedded image


embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4;


provided that when R40 is R1, wherein R1 is -A-L1-B; L1 is




embedded image


then A is not —O(CH2)2—O(CH2)—.


The present disclosure provides a method of treating a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more disclosed compounds. The present disclosure provides a method of preventing a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more disclosed compounds. The present disclosure provides a method of reducing the risk of a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more disclosed compounds.


Another aspect of the present disclosure is directed to pharmaceutical compositions comprising a compound of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X, or pharmaceutically acceptable salts and tautomers of any of the foregoing, and a pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier can further comprise an excipient, diluent, or surfactant. The pharmaceutical composition can be effective for treating, preventing, or reducing the risk of a disease or disorder mediated by mTOR a disease mediated by mTOR in a subject in need thereof.


Another aspect of the present disclosure relates to a compound of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X, or pharmaceutically acceptable salts and tautomers of any of the foregoing, for use in treating, preventing, or reducing the risk of a disease or disorder mediated by mTOR a disease mediated by mTOR in a subject in need thereof.


Another aspect of the present disclosure relates to the use of a compound of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X, or pharmaceutically acceptable salts and tautomers of any of the foregoing, in the manufacture of a medicament for in treating, preventing, or reducing the risk of a disease or disorder mediated by mTOR a disease mediated by mTOR in a subject in need thereof.


The present disclosure also provides compounds that are useful in inhibiting mTOR.







DETAILED DESCRIPTION OF THE DISCLOSURE

The present disclosure relates to mTOR inhibitors. Specifically, the embodiments are directed to compounds and compositions inhibiting mTOR, methods of treating diseases mediated by mTOR, and methods of synthesizing these compounds


The details of the disclosure are set forth in the accompanying description below. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present disclosure, illustrative methods and materials are now described. Other features, objects, and advantages of the disclosure will be apparent from the description and from the claims. In the specification and the appended claims, the singular forms also may include the plural unless the context clearly dictates otherwise. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. All patents and publications cited in this specification are incorporated herein by reference in their entireties.


Terms

The articles “a” and “an” are used in this disclosure and may refer to one or more than one (i.e., to at least one) of the grammatical object of the article. By way of example, “an element” may mean one element or more than one element.


The term “and/or” is used in this disclosure and may mean either “and” or “or” unless indicated otherwise.


The term “alkyl,” by itself or as part of another substituent, may mean, unless otherwise stated, a straight (i.e., unbranched) or branched non-cyclic carbon chain (or carbon), or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include di- and multivalent radicals, having the number of carbon atoms designated (i.e., C1-C10 means one to ten carbons). Examples of saturated hydrocarbon radicals may include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, (cyclohexyl)methyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like. An unsaturated alkyl group is one having one or more double bonds or triple bonds. Examples of unsaturated alkyl groups may include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers.


The term “alkylene,” by itself or as part of another substituent, may mean, unless otherwise stated, a divalent radical derived from an alkyl. Typically, an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, such as those groups having 10 or fewer carbon atoms.


The term “alkenyl” may mean an aliphatic hydrocarbon group containing a carbon-carbon double bond and which may be straight or branched having about 2 to about 6 carbon atoms in the chain. Certain alkenyl groups have 2 to about 4 carbon atoms in the chain. Branched may mean that one or more lower alkyl groups such as methyl, ethyl, or propyl are attached to a linear alkenyl chain. Exemplary alkenyl groups may include ethenyl, propenyl, n-butenyl, and i-butenyl. A C2-C6 alkenyl group is an alkenyl group containing between 2 and 6 carbon atoms.


The term “alkenylene,” by itself or as part of another substituent, may mean, unless otherwise stated, a divalent radical derived from an alkene.


The term “alkynyl” may mean an aliphatic hydrocarbon group containing a carbon-carbon triple bond and which may be straight or branched having about 2 to about 6 carbon atoms in the chain. Certain alkynyl groups have 2 to about 4 carbon atoms in the chain. Branched may mean that one or more lower alkyl groups such as methyl, ethyl, or propyl are attached to a linear alkynyl chain. Exemplary alkynyl groups may include ethynyl, propynyl, n-butynyl, 2-butynyl, 3-methylbutynyl, and n-pentynyl. A C2-C6 alkynyl group is an alkynyl group containing between 2 and 6 carbon atoms.


The term “alkynylene,” by itself or as part of another substituent, may mean, unless otherwise stated, a divalent radical derived from an alkyne.


The term “cycloalkyl” may mean monocyclic or polycyclic saturated carbon rings containing 3-18 carbon atoms. Examples of cycloalkyl groups may include, without limitations, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptanyl, cyclooctanyl, norboranyl, norborenyl, bicyclo[2.2.2]octanyl, or bicyclo[2.2.2]octenyl. A C3-C8 cycloalkyl is a cycloalkyl group containing between 3 and 8 carbon atoms. A cycloalkyl group can be fused (e.g., decalin) or bridged (e.g., norbornane).


A “cycloalkylene,” alone or as part of another substituent, may mean a divalent radical derived from a cycloalkyl.


The terms “heterocyclyl” or “heterocycloalkyl” or “heterocycle” may refer to monocyclic or polycyclic 3 to 24-membered rings containing carbon and heteroatoms taken from oxygen, phosphorous nitrogen, or sulfur and wherein there is not delocalized 7E electrons (aromaticity) shared among the ring carbon or heteroatoms. Heterocyclyl rings may include, but are not limited to, oxetanyl, azetadinyl, tetrahydrofuranyl, pyrrolidinyl, oxazolinyl, oxazolidinyl, thiazolinyl, thiazolidinyl, pyranyl, thiopyranyl, tetrahydropyranyl, dioxalinyl, piperidinyl, morpholinyl, thiomorpholinyl, thiomorpholinyl S-oxide, thiomorpholinyl S-dioxide, piperazinyl, azepinyl, oxepinyl, diazepinyl, tropanyl, and homotropanyl. A heteroycyclyl or heterocycloalkyl ring can also be fused or bridged, e.g., can be a bicyclic ring.


A “heterocyclylene” or “heterocycloalkylene,” alone or as part of another substituent, may mean a divalent radical derived from a “heterocyclyl” or “heterocycloalkyl” or “heterocycle.”


The term “aryl” may mean, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent, which can be a single ring or multiple rings (preferably from 1 to 3 rings) that are fused together (i.e., a fused ring aryl) or linked covalently. A fused ring aryl may refer to multiple rings fused together wherein at least one of the fused rings is an aryl ring.


An “arylene,” alone or as part of another substituent, may mean a divalent radical derived from an aryl.


The term “heteroaryl” may refer to aryl groups (or rings) that contain at least one heteroatom such as N, O, or S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. Thus, the term “heteroaryl” may include fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring). A 5,6-fused ring heteroarylene may refer to two rings fused together, wherein one ring has 5 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. Likewise, a 6,6-fused ring heteroarylene may refer to two rings fused together, wherein one ring has 6 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. And a 6,5-fused ring heteroarylene may refer to two rings fused together, wherein one ring has 6 members and the other ring has 5 members, and wherein at least one ring is a heteroaryl ring. A heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom. Non-limiting examples of aryl and heteroaryl groups may include phenyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3-pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinolyl, 5-isoquinolyl, 2-quinoxalinyl, 5-quinoxalinyl, 3-quinolyl, and 6-quinolyl. Substituents for each of the above noted aryl and heteroaryl ring systems are selected from the group of acceptable substituents described herein.


The term may also include multiple condensed ring systems that have at least one such aromatic ring, which multiple condensed ring systems are further described below. The term may also include multiple condensed ring systems (e.g., ring systems comprising 2, 3 or 4 rings) wherein a heteroaryl group, as defined above, can be condensed with one or more rings selected from heteroaryls (to form for example a naphthyridinyl such as 1,8-naphthyridinyl), heterocycles, (to form for example a 1, 2, 3, 4-tetrahydronaphthyridinyl such as 1, 2, 3, 4-tetrahydro-1,8-naphthyridinyl), carbocycles (to form for example 5,6,7, 8-tetrahydroquinolyl) and aryls (to form for example indazolyl) to form the multiple condensed ring system. The rings of the multiple condensed ring system can be connected to each other via fused, Spiro and bridged bonds when allowed by valency requirements. It is to be understood that the individual rings of the multiple condensed ring system may be connected in any order relative to one another. It is also to be understood that the point of attachment of a multiple condensed ring system (as defined above for a heteroaryl) can be at any position of the multiple condensed ring system including a heteroaryl, heterocycle, aryl or carbocycle portion of the multiple condensed ring system and at any suitable atom of the multiple condensed ring system including a carbon atom and heteroatom (e.g., a nitrogen).


A “heteroarylene,” alone or as part of another substituent, may mean a divalent radical derived from a heteroaryl.


Non-limiting examples of aryl and heteroaryl groups may include pyridinyl, pyrimidinyl, thiophenyl, thienyl, furanyl, indolyl, benzoxadiazolyl, benzodioxolyl, benzodioxanyl, thianaphthanyl, pyrrolopyridinyl, indazolyl, quinolinyl, quinoxalinyl, pyridopyrazinyl, quinazolinonyl, benzoisoxazolyl, imidazopyridinyl, benzofuranyl, benzothienyl, benzothiophenyl, phenyl, naphthyl, biphenyl, pyrrolyl, pyrazolyl, imidazolyl, pyrazinyl, oxazolyl, isoxazolyl, thiazolyl, furylthienyl, pyridyl, pyrimidyl, benzothiazolyl, purinyl, benzimidazolyl, isoquinolyl, thiadiazolyl, oxadiazolyl, pyrrolyl, diazolyl, triazolyl, tetrazolyl, benzothiadiazolyl, isothiazolyl, pyrazolopyrimidinyl, pyrrolopyrimidinyl, benzotriazolyl, benzoxazolyl, or quinolyl. The examples above may be substituted or unsubstituted and divalent radicals of each heteroaryl example above are non-limiting examples of heteroarylene. A heteroaryl moiety may include one ring heteroatom (e.g., O, N, or S). A heteroaryl moiety may include two optionally different ring heteroatoms (e.g., O, N, or S). A heteroaryl moiety may include three optionally different ring heteroatoms (e.g., O, N, or S). A heteroaryl moiety may include four optionally different ring heteroatoms (e.g., O, N, or S). A heteroaryl moiety may include five optionally different ring heteroatoms (e.g., O, N, or S). An aryl moiety may have a single ring. An aryl moiety may have two optionally different rings. An aryl moiety may have three optionally different rings. An aryl moiety may have four optionally different rings. A heteroaryl moiety may have one ring. A heteroaryl moiety may have two optionally different rings. A heteroaryl moiety may have three optionally different rings. A heteroaryl moiety may have four optionally different rings. A heteroaryl moiety may have five optionally different rings.


The terms “halo” or “halogen,” by themselves or as part of another substituent, may mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom. Additionally, terms such as “haloalkyl” may include monohaloalkyl and polyhaloalkyl. For example, the term “halo(C1-C4)alkyl” may include, but is not limited to, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.


The term “hydroxyl,” as used herein, means —OH.


The term “hydroxyalkyl” as used herein, may mean an alkyl moiety as defined herein, substituted with one or more, such as one, two or three, hydroxy groups. In certain instances, the same carbon atom does not carry more than one hydroxy group. Representative examples may include, but are not limited to, hydroxymethyl, 2-hydroxyethyl, 2-hydroxypropyl, 3-hydroxypropyl, 1-(hydroxymethyl)-2-methylpropyl, 2-hydroxybutyl, 3-hydroxybutyl, 4-hydroxybutyl, 2,3-dihydroxypropyl, 2-hydroxy-1-hydroxymethylethyl, 2,3-dihydroxybutyl, 3,4-dihydroxybutyl and 2-(hydroxymethyl)-3-hydroxypropyl.


The term “oxo,” as used herein, means an oxygen that is double bonded to a carbon atom.


A substituent group, as used herein, may be a group selected from the following moieties:


(A) oxo, halogen, —CF3, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —SO4H, —SO2NH2, —NHNH2, —ONH2, —NHC═(O)NHNH2, —NHC═(O)NH2, —NHSO2H, —NHC═(O)H, —NHC(O)—OH, —NHOH, —OCF3, —OCHF2, unsubstituted alkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, and


(B) alkyl, cycloalkyl, heterocyclyl, aryl, heteroaryl, substituted with at least one substituent selected from:


(i) oxo, halogen, —CF3, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —SO4H, —SO2NH2, —NHNH2, —ONH2, —NHC═(O)NHNH2, —NHC═(O)NH2, —NHSO2H, —NHC═(O)H, —NHC(O)—OH, —NHOH, —OCF3, —OCHF2, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, and


(ii) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, substituted with at least one substituent selected from:

    • (a) oxo, halogen, —CF3, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —SO4H, —SO2NH2, —NHNH2, —ONH2, —NHC═(O)NHNH2, —NHC═(O)NH2, —NHSO2H, —NHC═(O)H, —NHC(O)—OH, —NHOH, —OCF3, —OCHF2, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, and
    • (b) alkyl, heteroalkyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, substituted with at least one substituent selected from: oxo, halogen, —CF3, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —SO4H, —SO2NH2, —ONH2, —NHC═(O)NHNH2, —NHC═(O) NH2, —NHSO2H, —NHC═(O)H, —NHC(O)—OH, —NHOH, —OCF3, —OCHF2, unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl.


An “effective amount” when used in connection with a compound is an amount effective for treating or preventing a disease in a subject as described herein.


The term “carrier”, as used in this disclosure, encompasses carriers, excipients, and diluents and may mean a material, composition or vehicle, such as a liquid or solid filler, diluent, excipient, solvent or encapsulating material, involved in carrying or transporting a pharmaceutical agent from one organ, or portion of the body, to another organ, or portion of the body of a subject.


The term “treating” with regard to a subject, may refer to improving at least one symptom of the subject's disorder. Treating may include curing, improving, or at least partially ameliorating the disorder.


The term “prevent” or “preventing” with regard to a subject may refer to keeping a disease or disorder from afflicting the subject. Preventing may include prophylactic treatment. For instance, preventing can include administering to the subject a compound disclosed herein before a subject is afflicted with a disease and the administration will keep the subject from being afflicted with the disease.


The term “disorder” is used in this disclosure and may mean, and is used interchangeably with, the terms disease, condition, or illness, unless otherwise indicated.


The term “administer”, “administering”, or “administration” as used in this disclosure may refer to either directly administering a disclosed compound or pharmaceutically acceptable salt or tautomer of the disclosed compound or a composition to a subject, or administering a prodrug derivative or analog of the compound or pharmaceutically acceptable salt or tautomer of the compound or composition to the subject, which can form an equivalent amount of active compound within the subject's body.


A “patient” or “subject” is a mammal, e.g., a human, mouse, rat, guinea pig, dog, cat, horse, cow, pig, or non-human primate, such as a monkey, chimpanzee, baboon or rhesus.


Compounds

The present disclosure provides compounds having the structure of Formula (I),




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16, R26, R28, R32, and R40 are described as above.


In some embodiments, the compounds of Formula I are compounds of Formulae Ia, Ib, Ic, Id, Ie, or If, or pharmaceutically acceptable salts or tautomers thereof.


The present disclosure provides compounds having the structure of Formula (Ia),




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16, R26, R28, R32, and R40 are described as above.


The present disclosure provides compounds having the structure of Formula (Ib),




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16, R26, R28, R32, and R40 are described as above.


The present disclosure provides compounds having the structure of Formula (Ic),




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16, R26, R28, R32, and R40 are described as above.


The present disclosure provides compounds having the structure of Formula (Id),




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16, R26, R28, R32, and R40 are described as above.


The present disclosure provides compounds having the structure of Formula (Ie),




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16, R26, R28, R32, and R40 are described as above.


The present disclosure provides compounds having the structure of Formula (If),




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein:


R16 is selected from H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═O, —OR3, and ═N—OR3;


R28 is selected from —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, and —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from H, ═O, —OR3, and ═N—OR3; and


R40 is selected from —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


provided that compound does not comprise the combination of R16 is —OCH3; R26 is ═O; R28 is —OH; R32 is ═O; and R40 is —OH.


The present disclosure provides compounds having the structure of Formula I-X:




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16, R26, R28, R32, and R40 are described as above.


In some embodiments, the compounds of Formula I-X are represented by the structure of Formula I-Xa:




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16, R26, R28, R32, and R40 are described as above.


In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Ia-X):




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16 is R1 or R2.


In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Ib-X):




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R26 is ═N—R1 or ═N—R2.


In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Ic-X):




embedded image


or a pharmaceutically acceptable salt or tautomer thereof, wherein R28 is R1 or R2.


In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Id-X):




embedded image


or a pharmaceutically acceptable salt or tautomer thereof, wherein R32 is ═N—R1 or R2.


In some embodiments, the compounds of Formulae I, I-X, and I-Xa are represented by the structure of Formula (Ie-X):




embedded image


or a pharmaceutically acceptable salt or tautomer thereof, wherein R40 is R1 or R2.


In certain embodiments, the present disclosure provides compounds of Formulae Ia, Ib, Ic, Id, Ie, or If, or Formula I-X (including compounds of Formula I-Xa), where the stereochemistry is not determined, as shown below.




embedded image


and pharmaceutically acceptable salts and tautomers thereof, wherein R16, R26, R28, R32, and R40.


In certain embodiments, R16 is R1. In certain embodiments, R16 is R2. In certain embodiments, R10 is H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, or




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl.


In certain embodiments, R26 is ═N—R1. In certain embodiments, R26 is ═N—R2. In certain embodiments, R26 is ═O, —OR3, or ═N—OR3.


In certain embodiments, R28 is R1. In certain embodiments, R28 is R2. In certain embodiments, R28 is —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, and —OS(O)2N(R3)2, or —N(R3)S(O)2OR3.


In certain embodiments, R32 is ═N—R1. In certain embodiments, R32 is ═N—R2. In certain embodiments, R32 is H, ═O, —OR3, or ═N—OR3. In certain embodiments, R32 is, ═N—NHR3, and N(R3)2.


In certain embodiments, R40 is R1. In certain embodiments, R40 is R2. In certain embodiments, R40 is —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3,


—OS(O)2NHC(O)R3,




embedded image


In certain embodiments, the compound comprises R1. In certain embodiments, the compound comprises R2.


In certain embodiments, R2 is -A-C≡CH. In certain embodiments, R2 is -A-N3. In certain embodiments, R2 is -A-COOH. In certain embodiments, R2 is -A-NHR3.


In certain embodiments, A is absent. In certain embodiments, A is —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—, or —OC(O)NHSO2NH(C(R3)2)n—. In certain embodiments, A is —O(C(R3)2)n—. In certain embodiments, A is —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—.


In certain embodiments, A is —O(C(R3)2)n—(C6-C10)arylene-, —O(C(R3)2)n— heteroarylene-, or —OC(O)NH(C(R3)2)n—(C6-C10)arylene-. In certain embodiments, A is —O—(C6-C10)arylene- or —O-heteroarylene-.


In certain embodiments, A is -heteroarylene-(C6-C10)arylene-, —O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-, —O(C(R3)2)n-heteroarylene-heteroarylene-, —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—, —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—, —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—, or —O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—.


In certain embodiments, A is -heteroarylene-(C6-C10)arylene-(C6-C10)arylene-, -heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—, -heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—, —O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-, —O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—, —O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—, —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—, —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—, or —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—. In certain embodiments, A is —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—, —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—, or —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—. In certain embodiments, A is —O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-, —O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—, or —O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—. In certain embodiments, A is -heteroarylene-(C6-C10)arylene-(C6-C10)arylene-, -heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—, or -heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—.


In certain embodiments, A is -heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—, -heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—, -heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, or —O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-.


In certain embodiments, in A, the heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S. In certain embodiments, in A, heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S. In certain embodiments, the heteroarylene is 5-6-membered comprising 1-4 heteroatoms that is N. In certain embodiments, the heterocyclylene is 5-6-membered comprising 1-4 heteroatoms that is N.


In certain embodiments, in A, the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl. In certain embodiments, the arylene, heteroarylene, and heterocyclylene are substituted with alkyl, hydroxyalkyl, or haloalkyl. In certain embodiments, the arylene, heteroarylene, and heterocyclylene are substituted with alkoxy. In certain embodiments, the arylene, heteroarylene, and heterocyclylene are substituted with halogen or hydroxyl. In certain embodiments, the arylene, heteroarylene, and heterocyclylene are substituted with, —C(O)OR3, —C(O)N(R3)2, —N(R3)2, and alkyl substituted with —N(R3)2.


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


and q is zero.


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


embedded image


embedded image


embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, L1 is




embedded image


In certain embodiments, A ring is phenylene. In certain embodiments, A ring is 1, 3-phenylene. In certain embodiments, A ring is 1, 4-phenylene. In certain embodiments, A ring is 5-8 membered heteroarylene, such as 5-membered heteroarylene, 6-membered heteroarylene, 7-membered heteroarylene, or 8-membered heteroarylene.


In certain embodiments, B is




embedded image


In certain embodiments, B is




embedded image


In certain embodiments, B is




embedded image


In certain embodiments, B is




embedded image


In certain embodiments, B1 is




embedded image


In certain embodiments, B1 is




embedded image


In certain embodiments, B1 is




embedded image


wherein arylene are optionally substituted with haloalkyl.


In certain embodiments, B1 is




embedded image


In certain embodiments, B1 is




embedded image


In certain embodiments, B1 is




embedded image


In certain embodiments, B1 is




embedded image


In certain embodiments, B1 is




embedded image


In certain embodiments, in B1, the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl.


In certain embodiments, R3 is H. In certain embodiments, R3 is (C1-C6)alkyl. In certain embodiments, R3 is (C1-C6)alkyl optionally substituted with —COOH or (C6-C10)aryl. In certain embodiments, R3 is (C1-C6)alkyl substituted with —COOH. In certain embodiments, R3 is (C1-C6)alkyl substituted with (C6-C10)aryl. In certain embodiments, R3 is (C1-C6)alkyl substituted with OH.


In certain embodiments, R3 is —C(O)(C1-C6)alkyl. In certain embodiments, R3 is —C(O)NH-aryl. In certain embodiments, R3 is —C(S)NH-aryl.


In certain embodiments, R4 is H. In certain embodiments, R4 is (C1-C6)alkyl. In certain embodiments, R4 is halogen. In certain embodiments, R4 is 5-12 membered heteroaryl, 5-12 membered heterocyclyl, or (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl. In certain embodiments, R4 is —C(O)NR3-heterocyclyl. In certain embodiments, R4 is 5-12 membered heteroaryl, optionally substituted with —N(R3)2 or —OR3.


In certain embodiments, Q is C(R3)2. In certain embodiments, Q is O.


In certain embodiments, Y is C(R3)2. In certain embodiments, Y is a bond.


In certain embodiments, Z is H. In certain embodiments, Z is absent.


In certain embodiments, n is 1, 2, 3, 4, 5, 6, 7, or 8. In certain embodiments, n is 1, 2, 3, or 4. In certain embodiments, n is 5, 6, 7, or 8. In certain embodiments, n is 9, 10, 11, or 12.


In certain embodiments, o is 0, 1, 2, 3, 4, 5, 6, 7, or 8. In certain embodiments, o is 0, 1, 2, 3, or 4. In certain embodiments, o is 5, 6, 7, or 8. In certain embodiments, o is 9, 10, 11, or 12. In certain embodiments, o is one to 2.


In certain embodiments, p is 0, 1, 2, 3, 4, 5, or 6. In certain embodiments, p is 7, 8, 9, 10, 11, or 12. In certain embodiments, p is 0, 1, 2, or 3. In certain embodiments, p is 4, 5, or 6.


In certain embodiments, q is a number from zero to 10. In certain embodiments, q is 0, 1, 2, 3, 4, or 5. In certain embodiments, q is 6, 7, 8, 9, or 10. In certain embodiments, q is one to 7. In certain embodiments, q is one to 8. In certain embodiments, q is one to 9. In certain embodiments, q is 3 to 8.


In certain embodiments, q is a number from zero to 30. In certain embodiments, q is a number from zero to 26, 27, 28, 29, or 30. In certain embodiments, q is a number from zero to 21, 22, 23, 24, or 25. In certain embodiments, q is a number from zero to 16, 17, 18, 19, or 20. In certain embodiments, q is a number from zero to 11, 12,13, 14 or 15.


In certain embodiments, r is 1, 2, 3, or 4. In certain embodiments, r is 1. In certain embodiments, r is 2. In certain embodiments, r is 3. In certain embodiments, r is 4.


The present disclosure provides a compound of formula (I),




embedded image


having one, two, three, or four of the following features:


a) A is —O(C(R3)2)n— or —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—;


b) L1 is




embedded image


c) B is




embedded image


and


d) B1 is




embedded image


wherein the arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl.


The present disclosure provides a compound of formula (I),




embedded image


having one, two, three, or four of the following features:


a) A is —O(C(R3)2)n— or —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—;


b) L1 is




embedded image


c) B is




embedded image


and


d) B1 is




embedded image


wherein the arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl.


The present disclosure provides a compound of formula (I),




embedded image


having one, two, three, or four of the following features:


a) A is —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—;


b) L1 is




embedded image


c) B is




embedded image


and


d) B1 is




embedded image


wherein the arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl.


The present disclosure provides a compound of formula (I),




embedded image


having one, two, three, or four of the following features:


a) A is —O(C(R3)2)n—;


b) L1 is




embedded image


c) q is zero;


d) B is




embedded image


e) B1 is




embedded image


f) R4 is heteroaryl optionally substituted with —NH2; and


g) R26 is ═N—R1.


In certain embodiments, the present disclosure provide for the following compounds, and pharmaceutically acceptable salts and tautomers thereof,












Structure









embedded image







Example 1







embedded image







Example 2







embedded image







Example 3







embedded image







Example 4







embedded image







Example 5







embedded image







Example 6







embedded image







Example 7







embedded image







Example 8







embedded image







Example 9







embedded image







Example 10







embedded image







Example 11







embedded image







Example 12







embedded image







Example 13







embedded image







Example 14







embedded image







Example 15







embedded image







Example 16







embedded image







Example 17







embedded image







Example 18







embedded image







Example 19







embedded image







Example 20







embedded image







Example 21







embedded image







Example 22







embedded image







Example 23







embedded image







Example 24







embedded image







Example 25







embedded image







Example 26







embedded image







Example 27







embedded image







Example 28







embedded image







Example 29







embedded image







Example 30







embedded image







Example 31







embedded image







Example 32







embedded image







Example 33







embedded image







Example 34







embedded image







Example 35







embedded image







Example 36







embedded image







Example 37







embedded image







Example 38







embedded image







Example 39







embedded image







Example 40







embedded image







Example 41







embedded image







Example 42







embedded image







Example 43







embedded image







Example 44







embedded image







Example 45







embedded image







Example 46







embedded image







Example 47







embedded image







Example 48







embedded image







Example 49







embedded image







Example 50







embedded image







Example 51







embedded image







Example 52







embedded image







Example 53







embedded image







Example 54







embedded image







Example 55







embedded image







Example 56







embedded image







Example 57







embedded image







Example 58







embedded image







Example 59







embedded image







Example 60







embedded image







Example 61







embedded image







Example 62







embedded image







Example 63







embedded image







Example 64







embedded image







Example 65







embedded image







Example 66







embedded image







Example 67







embedded image







Example 68







embedded image







Example 69







embedded image







Example 70







embedded image







Example 71







embedded image







Example 72







embedded image







Example 73







embedded image







Example 74







embedded image







Example 75







embedded image







Example 76







embedded image







Example 77







embedded image







Example 78







embedded image







Example 79







embedded image







Example 80







embedded image







Example 81







embedded image







Example 82







embedded image







Example 83







embedded image







Example 84







embedded image







Example 85







embedded image







Example 86







embedded image







Example 87







embedded image







Example 88







embedded image







Example 89







embedded image







Example 90







embedded image







Example 91







embedded image







Example 92







embedded image







Example 93







embedded image







Example 94







embedded image







Example 95







embedded image







Example 96







embedded image







Example 97







embedded image







Example 98







embedded image







Example 99







embedded image







Example 100







embedded image







Example 101







embedded image







Example 102







embedded image







Example 103







embedded image







Example 104







embedded image







Example 105







embedded image







Example 106







embedded image







Example 107







embedded image







Example 108







embedded image







Example 109







embedded image







Example 110







embedded image







Example 111







embedded image







Example 112







embedded image







Example 113







embedded image







Example 114







embedded image







Example 115




embedded image







Example 116










embedded image







Example 117







embedded image







Example 118







embedded image







Example 119







embedded image







Example 120







embedded image







Example 121







embedded image







Example 122







embedded image







Example 123







embedded image







Example 124







embedded image







Example 125







embedded image







Example 126







embedded image







Example 127







embedded image







Example 128







embedded image







Example 129







embedded image







Example 130







embedded image







Example 131







embedded image







Example 132







embedded image







Example 133







embedded image







Example 134







embedded image







Example 135







embedded image







Example 136







embedded image







Example 137







embedded image







Example 138







embedded image







Example 139







embedded image







Example 140







embedded image







Example 141







embedded image







Example 142







embedded image







Example 143







embedded image







Example 144







embedded image







Example 145







embedded image







Example 146







embedded image







Example 147







embedded image







Example 148







embedded image







Example 149







embedded image







Example 150







embedded image







Example 151







embedded image







Example 152







embedded image







Example 153







embedded image







Example 154







embedded image







Example 155







embedded image







Example 156







embedded image







Example 157







embedded image







Example 158







embedded image







Example 159







embedded image







Example 160







embedded image







Example 161







embedded image







Example 162







embedded image







Example 163







embedded image







Example 164







embedded image







Example 165







embedded image







Example 166







embedded image







Example 167







embedded image







Example 168







embedded image







Example 169







embedded image







Example 170







embedded image







Example 171







embedded image







Example 172







embedded image







Example 173







embedded image







Example 174







embedded image







Example 175







embedded image







Example 176







embedded image







Example 177







embedded image







Example 178







embedded image







Example 179







embedded image







Example 180







embedded image







Example 181







embedded image







Example 182







embedded image







Example 183







embedded image







Example 184







embedded image







Example 185







embedded image







Example 186







embedded image







Example 187







embedded image







Example 188







embedded image







Example 189







embedded image







Example 190







embedded image







Example 191







embedded image







Example 192







embedded image







Example 193







embedded image







Example 194







embedded image







Example 195







embedded image







Example 196







embedded image







Example 197







embedded image







Example 198







embedded image







Example 199







embedded image







Example 200







embedded image







Example 201







embedded image







Example 202









The compounds of the disclosure may include pharmaceutically acceptable salts of the compounds disclosed herein. Representative “pharmaceutically acceptable salts” may include, e.g., water-soluble and water-insoluble salts, such as the acetate, amsonate (4,4-diaminostilbene-2,2-disulfonate), benzenesulfonate, benzonate, bicarbonate, bisulfate, bitartrate, borate, bromide, butyrate, calcium, calcium edetate, camsylate, carbonate, chloride, citrate, clavulariate, di hydrochloride, edetate, edisylate, estolate, esylate, fiunarate, gluceptate, gluconate, glutamate, glycollylarsanilate, hexafluorophosphate, hexylresorcinate, hydrabamine, hydrobromide, hydrochloride, hydroxynaphthoate, iodide, sethionate, lactate, lactobionate, laurate, magnesium, malate, maleate, mandelate, mesylate, methylbromide, methylnitrate, methylsulfate, mucate, napsylate, nitrate, N-methylglucamine ammonium salt, 3-hydroxy-2-naphthoate, oleate, oxalate, palmitate, pamoate, 1,1-methene-bis-2-hydroxy-3-naphthoate, einbonate, pantothenate, phosphate/diphosphate, picrate, polygalacturonate, propionate, p-toluenesulfonate, salicylate, stearate, subacetate, succinate, sulfate, sulfosalicylate, suramate, tannate, tartrate, teoclate, tosylate, triethiodide, and valerate salts.


“Pharmaceutically acceptable salt” may also include both acid and base addition salts. “Pharmaceutically acceptable acid addition salt” may refer to those salts which retain the biological effectiveness and properties of the free bases, which are not biologically or otherwise undesirable, and which may be formed with inorganic acids such as, but are not limited to, hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as, but not limited to, acetic acid, 2,2-dichloroacetic acid, adipic acid, alginic acid, ascorbic acid, aspartic acid, benzenesulfonic acid, benzoic acid, 4-acetamidobenzoic acid, camphoric acid, camphor-10-sulfonic acid, capric acid, caproic acid, caprylic acid, carbonic acid, cinnamic acid, citric acid, cyclamic acid, dodecylsulfuric acid, ethane-1,2-disulfonic acid, ethanesulfonic acid, 2-hydroxyethanesulfonic acid, formic acid, fumaric acid, galactaric acid, gentisic acid, glucoheptonic acid, gluconic acid, glucuronic acid, glutamic acid, glutaric acid, 2-oxo-glutaric acid, glycerophosphoric acid, glycolic acid, hippuric acid, isobutyric acid, lactic acid, lactobionic acid, lauric acid, maleic acid, malic acid, malonic acid, mandelic acid, methanesulfonic acid, mucic acid, naphthalene-1,5-disulfonic acid, naphthalene-2-sulfonic acid, 1-hydroxy-2-naphthoic acid, nicotinic acid, oleic acid, orotic acid, oxalic acid, palmitic acid, pamoic acid, propionic acid, pyroglutamic acid, pyruvic acid, salicylic acid, 4-aminosalicylic acid, sebacic acid, stearic acid, succinic acid, tartaric acid, thiocyanic acid, p-toluenesulfonic acid, trifluoroacetic acid, undecylenic acid, and the like.


“Pharmaceutically acceptable base addition salt” may refer to those salts that retain the biological effectiveness and properties of the free acids, which are not biologically or otherwise undesirable. These salts may be prepared from addition of an inorganic base or an organic base to the free acid. Salts derived from inorganic bases may include, but are not limited to, the sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum salts and the like. For example, inorganic salts may include, but are not limited to, ammonium, sodium, potassium, calcium, and magnesium salts. Salts derived from organic bases may include, but are not limited to, salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, such as ammonia, isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, diethanolamine, ethanolamine, deanol, 2-dimethylaminoethanol, 2-diethylaminoethanol, dicyclohexylamine, lysine, arginine, histidine, caffeine, procaine, hydrabamine, choline, betaine, benethamine, benzathine, ethylenediamine, glucosamine, methylglucamine, theobromine, triethanolamine, tromethamine, purines, piperazine, piperidine, N-ethylpiperidine, polyamine resins and the like.


Unless otherwise stated, structures depicted herein may also include compounds which differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structure except for the replacement of a hydrogen atom by deuterium or tritium, or the replacement of a carbon atom by 13C or 14C, or the replacement of a nitrogen atom by 15N, or the replacement of an oxygen atom with 17O or 18O are within the scope of the disclosure. Such isotopically labeled compounds are useful as research or diagnostic tools.


Methods of Synthesizing Disclosed Compounds

The compounds of the present disclosure may be made by a variety of methods, including standard chemistry. Suitable synthetic routes are depicted in the schemes given below.


The compounds of any of the formulae described herein may be prepared by methods known in the art of organic synthesis as set forth in part by the following synthetic schemes and examples. In the schemes described below, it is well understood that protecting groups for sensitive or reactive groups are employed where necessary in accordance with general principles or chemistry. Protecting groups are manipulated according to standard methods of organic synthesis (T. W. Greene and P. G. M. Wuts, “Protective Groups in Organic Synthesis”, Third edition, Wiley, New York 1999). These groups are removed at a convenient stage of the compound synthesis using methods that are readily apparent to those skilled in the art. The selection processes, as well as the reaction conditions and order of their execution, shall be consistent with the preparation of compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa), or pharmaceutically acceptable salts and tautomers of any of the foregoing.


Those skilled in the art will recognize if a stereocenter exists in any of the compounds of the present disclosure. Accordingly, the present disclosure may include both possible stereoisomers (unless specified in the synthesis) and may include not only racemic compounds but the individual enantiomers and/or diastereomers as well. When a compound is desired as a single enantiomer or diastereomer, it may be obtained by stereospecific synthesis or by resolution of the final product or any convenient intermediate. Resolution of the final product, an intermediate, or a starting material may be affected by any suitable method known in the art. See, for example, “Stereochemistry of Organic Compounds” by E. L. Eliel, S. H. Wilen, and L. N. Mander (Wiley-Interscience, 1994).


PREPARATION OF COMPOUNDS

The compounds described herein may be made from commercially available starting materials or synthesized using known organic, inorganic, and/or enzymatic processes.


The compounds of the present disclosure can be prepared in a number of ways well known to those skilled in the art of organic synthesis. By way of example, compounds of the disclosure can be synthesized using the methods described below, together with synthetic methods known in the art of synthetic organic chemistry, or variations thereon as appreciated by those skilled in the art. These methods may include but are not limited to those methods described below.


The term “tautomers” may refer to a set of compounds that have the same number and type of atoms, but differ in bond connectivity and are in equilibrium with one another. A “tautomer” is a single member of this set of compounds. Typically a single tautomer is drawn but it may be understood that this single structure may represent all possible tautomers that might exist. Examples may include enol-ketone tautomerism. When a ketone is drawn it may be understood that both the enol and ketone forms are part of the disclosure.


In addition to tautomers that may exist at all amide, carbonyl, and oxime groups within compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X, compounds in this family readily interconvert via a ring-opened species between two major isomeric forms, known as the pyran and oxepane isomers (FIG. 1 below). This interconversion can be promoted by magnesium ions, mildly acidic conditions, or alkylamine salts, as described in the following references: i) Hughes, P. F.; Musser, J.; Conklin, M.; Russo, R. 1992. Tetrahedron Lett. 33(33): 4739-32. ii) Zhu, T. 2007. U.S. Pat. No. 7,241,771; Wyeth. iii) Hughes, P. F. 1994. U.S. Pat. No. 5,344,833; American Home Products Corp. The scheme below shows an interconversion between the pyran and oxepane isomers in compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X.




embedded image


As this interconversion occurs under mild condition, and the thermodynamic equilibrium position may vary between different members of compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X, both isomers are contemplated for the compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X. For the sake of brevity, the pyran isomer form of all intermediates and compounds of Formula I (including compounds of Formulae Ia, Ib, Ic, Id, Ie, or If) or Formula I-X (including compounds of Formula I-Xa) or Formula Ia-X, Ib-X, Ic-X, Id-X, or Ie-X is shown.


General Assembly Approaches for Bifunctional Rapalogs

With reference to the schemes below, rapamycin is Formula II,




embedded image


where R16 is —OCH3; R26 is ═O; R28 is —OH; R32 is ═O; and R40 is —OH. A “rapalog” may refer to an analog or derivative of rapamycin. For example, with reference to the schemes below, a rapalog can be rapamycin that is substituted at any position, such as R16, R26, R28, R32, or R40. An active site inhibitor (AS inhibitor) is active site mTOR inhibitor. In certain embodiments, AS inhibitor is depicted by B, in Formula I or Formula I-X.


Assembly of Series 1 Bifunctional Rapalogs

An assembly approach to Series 1 bifunctional rapalogs is shown in Scheme 1 below. For these types of bifunctional rapalogs, Linker Type A may include variations where q=0 to 30 or 0 to 10, such as q=1 to 7. An alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations found in Table 1 in the Examples Section. A Type 1 mTOR active site inhibitor can attach to the linker via a primary or secondary amine, and may include variations in Table 2 in the Examples Section. This assembly sequence starts with reaction of the linker Type A with the amino terminus of an active site inhibitor, such as those in Table 2, to provide an intermediate A1. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide the Series 1 bifunctional rapalogs.




embedded image


Assembly of Series 2 Bifunctional Rapalogs

An assembly approach to Series 2 bifunctional rapalogs is shown in Scheme 2 below. For these types of bifunctional rapalogs, linker type B may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8; o=0 to 8, such as o=0 to 2; and Q is CH2 or O (when o>0). The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. The active site inhibitor can include variations in Table 2. This assembly sequence starts with reaction of the linker Type B with a cyclic anhydride to give Intermediate B1. The intermediate is then coupled to the amino terminus of an active site inhibitor, such as those in Table 2, to provide Intermediate B2. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide the Series 2 bifunctional rapalogs.




embedded image


The general assembly of Series 2 bifunctional rapalogs can be used to prepare combinations of the Type B linkers, the alkyne-containing rapalogs in Table 1, and the Type 1 active site inhibitors in Table 2.


Assembly of Series 3 Bifunctional Rapalogs

An assembly approach to Series 3 bifunctional rapalogs is shown in Scheme 3 below. For these types of bifunctional rapalogs, linker type B may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type B with a carboxylic acid of an active site inhibitor, such as those in Table 3 in the Examples Section, to provide Intermediate C1 (Scheme 3). Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide Series 3 bifunctional rapalogs.




embedded image


Assembly of Series 4 Bifunctional Rapalogs

An assembly approach to Series 4 bifunctional rapalogs is shown in Scheme 4 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4 in the Examples Section. This assembly sequence starts with reaction of the linker type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to provide Intermediate D1 (Scheme 4). The intermediate is then coupled to a nucleophilic amine containing active site inhibitor, such as those in Table 2, to provide Intermediate D2. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 4 bifunctional rapalogs. Another scheme for preparation of Series 4 bifunctional rapalogs is shown in Scheme 4A.




embedded image




embedded image


Assembly of Series 5 Bifunctional Rapalogs

An assembly approach to Series 5 bifunctional rapalogs is shown in Scheme 5 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker Type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to provide Intermediate E1 (Scheme 5). Then, the intermediate is coupled to a Type C linker, using standard peptide forming conditions, followed by carboxylic acid deprotection to provide Intermediate E2. The intermediate is then coupled to an amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate E3. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 5 bifunctional rapalogs.




embedded image


Assembly of Series 6 Bifunctional Rapalogs

An assembly approach to Series 6 bifunctional rapalogs is shown in Scheme 6 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to give Intermediate F1 (Scheme 6). The intermediate is then coupled to an amine containing linker, such as those found in Table 6 in the Examples Section, using standard peptide bond forming conditions followed by deprotection of the carboxylic acid to provide Intermediate F2. The intermediate is then coupled to an amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate F3. Finally, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 6 bifunctional rapalogs.




embedded image


Assembly of Series 7 Bifunctional Rapalogs

An assembly approach to Series 7 bifunctional rapalogs is shown in Scheme 7 below. For these types of bifunctional rapalogs, linker type A may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type D may include variations where o=0 to 10, such as o=1 to 8. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type D with a carboxylic acid of an active site inhibitor, such as those in Table 3 in the Examples Section, followed by N-deprotection to give Intermediate G1 (Scheme 7). Then, the intermediate is coupled to a type A linker, to provide Intermediate G2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 7 bifunctional rapalogs.




embedded image


Assembly of Series 8 Bifunctional Rapalogs

An assembly approach to Series 8 bifunctional rapalogs is shown in Scheme 8 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker type C with an azide containing pre-linker, such as those in Table 7 in the Examples Section, followed by carboxylic acid deprotection to give Intermediate H1 (Scheme 8). The intermediate is then coupled to the amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate H2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 8 bifunctional rapalogs.




embedded image


Assembly of Series 9 Bifunctional Rapalogs

An assembly approach to Series 9 bifunctional rapalogs is shown in Scheme 9 below. For these types of bifunctional rapalogs, Linker Type E may include variations where q=0 to 30 or 0 to 10, such as q=1 to 7. An azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations found in Table 4 in the Examples Section. A Type 1 mTOR active site inhibitor can attach to the linker via a primary or secondary amine, and may include variations in Table 2 in the Examples Section. This assembly sequence starts with reaction of the linker Type E with the amino terminus of an active site inhibitor, such as those in Table 2, to provide an intermediate I1. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 4, via 3+2 cycloadditions to provide the Series 9 bifunctional rapalogs.




embedded image


Assembly of Series 10 Bifunctional Rapalogs

An assembly approach to Series 10 bifunctional rapalogs is shown in Scheme 10 below. For these types of bifunctional rapalogs, linker type F includes variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type G includes variations where o=0 to 10, such as o=1 to 8. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker Type F with the amine of an active site inhibitor, such as those in Table 2 in the Examples Section. Then, the intermediate is coupled to a type G linker, to provide Intermediate J2. Finally, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 10 bifunctional rapalogs.




embedded image


Assembly of Series 11 Bifunctional Rapalogs

An assembly approach to Series 11 bifunctional rapalogs is shown in Scheme 11 below. For these types of bifunctional rapalogs, linker type A includes variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type C includes variations where o=0 to 10, such as o=1 to 8. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type A with the amine of a linker Type C, followed by deprotection of the carboxylic acid to provide Intermediate K1. Then, the intermediate is coupled an amine containing active site inhibitor, such as those found in Table 2, to provide Intermediate K2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 11 bifunctional rapalogs.




embedded image


Assembly of Series 12 Bifunctional Rapalogs

An assembly approach to Series 12 bifunctional rapalogs is shown in Scheme 12 below. For these types of bifunctional rapalogs, linker type H may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker type H with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by carboxylic acid deprotection to provide Intermediate L1. Then, the intermediate is coupled with an azide containing amine prelinker, which can be composed of a primary or seconday amine, such as those in Table 8, to provide Intermediate L2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 12 bifunctional rapalogs.




embedded image


Assembly of Series 13 Bifunctional Rapalogs

An assembly approach to Series 13 bifunctional rapalogs is shown in Scheme 13 below. For these types of bifunctional rapalogs, linker type I may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker type I with an alkyne containing pre-linker amine, which can be composed of a primary or secondary amine, such as those in Table 9 in the Examples Section, followed by N-deprotection to give Intermediate M1. The intermediate is then coupled to the carboxylic acid containing active site inhibitor, such as those in Table 3, using standard peptide bond forming conditions to provide Intermediate M2. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 13 bifunctional rapalogs.




embedded image


Assembly of Series 14 Bifunctional Rapalogs

An assembly approach to Series 14 bifunctional rapalogs is shown in Scheme 14 below. For this type of bifunctional rapalogs, linker type I may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The carboxylic acid moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The carboxylic acid moiety can be attached via a variety of linkage fragments including variations in Table 10. This assembly sequence starts with reaction of the linker type I with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by N-deprotection to provide Intermediate N1. The intermediate is then coupled to a carboxylic acid containing rapalog, such as those in Table 10 in the Examples Section, to provide Series 14 bifunctional rapalogs.




embedded image


Assembly of Series 15 Bifunctional Rapalogs

An assembly approach to Series 15 bifunctional rapalogs is shown in Scheme 15 below. For this type of bifunctional rapalogs, linker type J may include variations where q=0 to 30 or 0 to 10, such as q=3 to 8. The amino moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The amino moiety can be attached via a variety of linkage fragments including variations in Table 11. This assembly sequence starts with reaction of the linker type J with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by carboxylic acid deprotection to provide Intermediate O1. The intermediate is then coupled to an amine containing rapalog, such as those in Table 11 in the Examples Section, to provide Series 15 bifunctional rapalogs.




embedded image


Assembly of Series 16 Bifunctional Rapalogs

An assembly approach to Series 16 bifunctional rapalogs is shown in Scheme 16 below. For these types of bifunctional rapalogs, linker Type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The amine containing rapalog monomers may include those in Table 11. This assembly sequence starts with reaction of the linker Type C with a carboxylic acid of an active site inhibitor, such as those in Table 3, to provide Intermediate P1. Then, the intermediate is coupled to an amine containing rapalog, such as those in Table 11 in the Examples Section, to provide Series 16 bifunctional rapalogs.




embedded image


PHARMACEUTICAL COMPOSITIONS

In another aspect is provided a pharmaceutical composition including a pharmaceutically acceptable excipient and a compound, or pharmaceutically acceptable salt or tautomer thereof.


In embodiments of the pharmaceutical compositions, the compound, or pharmaceutically acceptable salt or tautomer thereof, may be included in a therapeutically effective amount.


Administration of the disclosed compounds or compositions can be accomplished via any mode of administration for therapeutic agents. These modes may include systemic or local administration such as oral, nasal, parenteral, transdermal, subcutaneous, vaginal, buccal, rectal or topical administration modes.


Depending on the intended mode of administration, the disclosed compounds or pharmaceutical compositions can be in solid, semi-solid or liquid dosage form, such as, for example, injectables, tablets, suppositories, pills, time-release capsules, elixirs, tinctures, emulsions, syrups, powders, liquids, suspensions, or the like, sometimes in unit dosages and consistent with conventional pharmaceutical practices. Likewise, they can also be administered in intravenous (both bolus and infusion), intraperitoneal, subcutaneous or intramuscular form, and all using forms well known to those skilled in the pharmaceutical arts.


Illustrative pharmaceutical compositions are tablets and gelatin capsules comprising a compound of the disclosure and a pharmaceutically acceptable carrier, such as a) a diluent, e.g., purified water, triglyceride oils, such as hydrogenated or partially hydrogenated vegetable oil, or mixtures thereof, corn oil, olive oil, sunflower oil, safflower oil, fish oils, such as EPA or DHA, or their esters or triglycerides or mixtures thereof, omega-3 fatty acids or derivatives thereof, lactose, dextrose, sucrose, mannitol, sorbitol, cellulose, sodium, saccharin, glucose and/or glycine; b) a lubricant, e.g., silica, talcum, stearic acid, its magnesium or calcium salt, sodium oleate, sodium stearate, magnesium stearate, sodium benzoate, sodium acetate, sodium chloride and/or polyethylene glycol; for tablets also; c) a binder, e.g., magnesium aluminum silicate, starch paste, gelatin, tragacanth, methylcellulose, sodium carboxymethylcellulose, magnesium carbonate, natural sugars such as glucose or beta-lactose, corn sweeteners, natural and synthetic gums such as acacia, tragacanth or sodium alginate, waxes and/or polyvinylpyrrolidone, if desired; d) a disintegrant, e.g., starches, agar, methyl cellulose, bentonite, xanthan gum, algiic acid or its sodium salt, or effervescent mixtures; e) absorbent, colorant, flavorant and sweetener; f) an emulsifier or dispersing agent, such as Tween 80, Labrasol, HPMC, DOSS, caproyl 909, labrafac, labrafil, peceol, transcutol, capmul MCM, capmul PG-12, captex 355, gelucire, vitamin E TGPS or other acceptable emulsifier; and/or g) an agent that enhances absorption of the compound such as cyclodextrin, hydroxypropyl-cyclodextrin, PEG400, PEG200.


Liquid, particularly injectable, compositions can, for example, be prepared by dissolution, dispersion, etc. For example, the disclosed compound is dissolved in or mixed with a pharmaceutically acceptable solvent such as, for example, water, saline, aqueous dextrose, glycerol, ethanol, and the like, to thereby form an injectable isotonic solution or suspension. Proteins such as albumin, chylomicron particles, or serum proteins can be used to solubilize the disclosed compounds.


The disclosed compounds can be also formulated as a suppository that can be prepared from fatty emulsions or suspensions; using polyalkylene glycols such as propylene glycol, as the carrier.


The disclosed compounds can also be administered in the form of liposome delivery systems, such as small unilamellar vesicles, large unilamellar vesicles and multilamellar vesicles. Liposomes can be formed from a variety of phospholipids, containing cholesterol, stearylamine or phosphatidylcholines. In some embodiments, a film of lipid components is hydrated with an aqueous solution of drug to a form lipid layer encapsulating the drug, as described for instance in U.S. Pat. No. 5,262,564, the contents of which are hereby incorporated by reference.


Disclosed compounds can also be delivered by the use of monoclonal antibodies as individual carriers to which the disclosed compounds are coupled. The disclosed compounds can also be coupled with soluble polymers as targetable drug carriers. Such polymers can include polyvinylpyrrolidone, pyran copolymer, polyhydroxypropylmethacrylamide-phenol, polyhydroxyethylaspanamidephenol, or polyethyleneoxidepolylysine substituted with palmitoyl residues. Furthermore, the disclosed compounds can be coupled to a class of biodegradable polymers useful in achieving controlled release of a drug, for example, polylactic acid, polyepsilon caprolactone, polyhydroxy butyric acid, polyorthoesters, polyacetals, polydihydropyrans, polycyanoacrylates and cross-linked or amphipathic block copolymers of hydrogels. In one embodiment, disclosed compounds are not covalently bound to a polymer, e.g., a polycarboxylic acid polymer, or a polyacrylate.


Parental injectable administration is generally used for subcutaneous, intramuscular or intravenous injections and infusions. Injectables can be prepared in conventional forms, either as liquid solutions or suspensions or solid forms suitable for dissolving in liquid prior to injection.


Another aspect of the disclosure relates to a pharmaceutical composition comprising a compound, or a pharmaceutically acceptable salt of tautomer thereof, of the present disclosure and a pharmaceutically acceptable carrier. The pharmaceutically acceptable carrier can further include an excipient, diluent, or surfactant.


Compositions can be prepared according to conventional mixing, granulating or coating methods, respectively, and the present pharmaceutical compositions can contain from about 0.1% to about 99%, from about 5% to about 90%, or from about 1% to about 20% of the disclosed compound by weight or volume.


In embodiments of the pharmaceutical compositions, the pharmaceutical composition may include a second agent (e.g. therapeutic agent). In embodiments of the pharmaceutical compositions, the pharmaceutical composition may include a second agent (e.g. therapeutic agent) in a therapeutically effective amount. In embodiments, the second agent is an anti-cancer agent. In embodiments, the second agent is an immunotherapeutic agent. In embodiments, the second agent is an immune-oncological agent. In embodiments, the second agent is an anti-autoimmune disease agent. In embodiments, the second agent is an anti-inflammatory disease agent. In embodiments, the second agent is an anti-neurodegenerative disease agent. In embodiments, the second agent is an anti-metabolic disease agent. In embodiments, the second agent is an anti-cardiovascular disease agent. In embodiments, the second agent is an anti-aging agent. In embodiments, the second agent is a longevity agent. In embodiments, the second agent is an agent for treating or preventing transplant rejection. In embodiments, the second agent is an agent for treating or preventing fungal infection. In embodiments, the second agent is immune system repressor. In embodiments, the second agent is an mTOR modulator. In embodiments, the second agent is an mTOR inhibitor. In embodiments, the second agent is an active site mTOR inhibitor. In embodiments, the second agent is a rapamycin. In embodiments, the second agent is a rapamycin analog. In embodiments, the second agent is an mTORCl pathway inhibitor.


mTOR and Methods of Treatment


The term “mTOR” may refer to the protein “mechanistic target of rapamycin (serine/threonine kinase)” or “mammalian target of rapamycin.” The term “mTOR” may refer to the nucleotide sequence or protein sequence of human mTOR (e.g., Entrez 2475, Uniprot P42345, RefSeq NM_004958, or RefSeq NP_004949) (SEQ ID NO: 1). The term “mTOR” may include both the wild-type form of the nucleotide sequences or proteins as well as any mutants thereof. In some embodiments, “mTOR” is wild-type mTOR. In some embodiments, “mTOR” is one or more mutant forms. The term “mTOR” XYZ may refer to a nucleotide sequence or protein of a mutant mTOR wherein the Y numbered amino acid of mTOR that normally has an X amino acid in the wildtype, instead has a Z amino acid in the mutant. In embodiments, an mTOR is the human mTOR. In embodiments, the mTOR has the nucleotide sequence corresponding to reference number GL206725550 (SEQ ID NO:2). In embodiments, the mTOR has the nucleotide sequence corresponding to RefSeq NM_004958.3 (SEQ ID NO:2). In embodiments, the mTOR has the protein sequence corresponding to reference number GL4826730 (SEQ ID NO: 1). In embodiments, the mTOR has the protein sequence corresponding to RefSeq NP_004949.1 (SEQ ID NO: 1). In embodiments, the mTOR has the following amino acid sequence:









(SEQ ID NO: 1)


MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVT





MELREMSQEESTRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEG





GNATRIGRFANYLRNLLPSNDPWMEMASKAIGRLAMAGDTFTAEYVEFE





VKRALEWLGADRNEGRRHAAVLVLRELAISVPTFFFQQVQPFFDNIFVA





VWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEEAEKGFD





ETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLV





HDKYCKDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMG





FGTSPSPAKSTLVESRCCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTIL





NLLPRLAAFRPSAFTDTQYLQDTMNHVLSCVKKEKERTAAFQALGLLSV





AVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDATVFTCISMLAR





AMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL





KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTL





GSFEFEGHSLTQFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLIS





GHAHVVSQTAVQVVADVLSKLLWGITDPDPDIRYCVLASLDERFDAHLA





QAENLQALFVALNDQVFEIRELAICTVGRLSSMNPAFVMPFLRKMLIQI





LTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALILKLKDP





DPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLA





KRQVALWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREA





IRVLGLLGALDPYKHKVNIGMIDQSRDASAVSLSESKSSQDSSDYSTSE





MLVNMGNLPLDEFYPAVSMVALMRIFRDQSLSHHHTMVVQAITFIFKSL





GLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLVSFVKSHIRPYM





DEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR





VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPL





PSRKAALETVDRLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLS





SLVFQLGKKYQIFIPMVNKVLVRHRINHQRYDVLICRIVKGYTLADEEE





DPLIYQHRMLRSGQGDALASGPVETGPMKKLHVSTINLQKAWGAARRVS





KDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNAAFVSC





WSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPL





RDDNGIVLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKL





QQPEAAAGVLEYAMKHFGELEIQATWYEKLHEWEDALVAYDKKMDTNKD





DPELMLGRMRCLEALGEWGQLHQQCCEKWTLVNDETQAKMARMAAAAAW





GLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDL





LDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIW





WERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLAL





AHKTLVLLLGVDPSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHM





QHFVQTMQQQAQHAIATEDQQHKQELHKLMARCFLKLGEWQLNLQGINE





STIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEAVLHYKHQNQARDEKK





KLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSPTPSP





LQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDY





GHWPDVNEALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLT





DIGRYHPQALIYPLTVASKSTTTARHNAANKILKNMCEHSNTLVQQAMM





VSEELIRVAILWHEMWHEGLEEASRLYFGERNVKGMFEVLEPLHAMMER





GPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAWDLYYHVFR





RISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAP





SLQVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNT





LLANDPTSLRKNLSIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREK





KKILLNIEHRIMLRMAPDYDHLTLMQKVEVFEHAVNNTAGDDLAKLLWL





KSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDRLSGKIL





HIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCHTV





MEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAG





QSVEILDGVELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQII





NRVRDKLTGRDFSHDDTLDVPTQVELLIKQATSHENLCQCYIGWCPFW






In embodiments, the mTOR is a mutant mTOR. In embodiments, the mutant mTOR is associated with a disease that is not associated with wildtype mTOR. In embodiments, the mTOR may include at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to the sequence above.


The term “mTORC1” may refer to the protein complex including mTOR and Raptor (regulatory-associated protein of mTOR). mTORC1 may also include MLST8 (mammalian lethal with SEC 13 protein 8), PRAS40, and/or DEPTOR. mTORC1 may function as a nutrient/energy/redox sensor and regulator of protein synthesis. The term “mTORC1 pathway” or “mTORC1 signal transduction pathway” may refer to a cellular pathway including mTORC1. An mTORC1 pathway includes the pathway components upstream and downstream from mTORC1. An mTORC1 pathway is a signaling pathway that is modulated by modulation of mTORC1 activity. In embodiments, an mTORC1 pathway is a signaling pathway that is modulated by modulation of mTORC1 activity but not by modulation of mTORC2 activity. In embodiments, an mTORC1 pathway is a signaling pathway that is modulated to a greater extent by modulation of mTORC1 activity than by modulation of mTORC2 activity.


The term “mTORC2” may refer to the protein complex including mTOR and RICTOR (rapamycin-insensitive companion of mTOR). mTORC2 may also include GβL, mSIN1 (mammalian stress-activated protein kinase interacting protein 1), Protor ½, DEPTOR, TTI1, and/or TEL2. mTORC2 may regulate cellular metabolism and the cytoskeleton. The term “mTORC2 pathway” or “mTORC2 signal transduction pathway” may refer to a cellular pathway including mTORC2. An mTORC2 pathway includes the pathway components upstream and downstream from mTORC2. An mTORC2 pathway is a signaling pathway that is modulated by modulation of mTORC2 activity. In embodiments, an mTORC2 pathway is a signaling pathway that is modulated by modulation of mTORC2 activity but not by modulation of mTORC1 activity. In embodiments, an mTORC2 pathway is a signaling pathway that is modulated to a greater extent by modulation of mTORC2 activity than by modulation of mTORC1 activity.


The term “rapamycin” or “sirolimus” may refer to a macrolide produced by the bacteria Streptomyces hygroscopicus. Rapamycin may prevent the activation of T cells and B cells. Rapamycin has the IUPAC name (3S,6R,7E,9R, 10R, 12R, 14S, 15E, 17E, 19E,21S,23S,26R,27R,34aS)-9, 10, 12, 13, 14,21,22,23,24,25,26,27,32,33,34,34a-hexadecahydro-9,27-dihydroxy-3-[(1R)-2-[(1 S,3R,4R)-4-hydroxy-3-methoxycyclohexyl]-1-methylethyl]-10,21-dimethoxy-6,8, 12, 14,20,26-hexamethyl-23,27-epoxy-3H-pyrido[2, 1-c][1,4]-oxaazacyclohentriacontine-1,5,11,28,29(4H,6H,31H)-pentone. Rapamycin has the CAS number 53123-88-9. Rapamycin may be produced synthetically (e.g., by chemical synthesis) or through use of a production method that does not include use of Streptomyces hygroscopicus.


“Analog” is used in accordance with its plain ordinary meaning within chemistry and biology and may refer to a chemical compound that is structurally similar to another compound (i.e., a so-called “reference” compound) but differs in composition, e.g., in the replacement of one atom by an atom of a different element, or in the presence of a particular functional group, or the replacement of one functional group by another functional group, or the absolute stereochemistry of one or more chiral centers of the reference compound, including isomers thereof. Accordingly, an analog is a compound that is similar or comparable in function and appearance but not in structure or origin to a reference compound.


The term “rapamycin analog” or “rapalog” may refer to analogs or derivatives (e.g., prodrugs) of rapamycin.


The terms “active site mTOR inhibitor” and “ATP mimetic” may refer to a compound that inhibits the activity of mTOR (e.g., kinase activity) and binds to the active site of mTOR (e.g., the ATP binding site, overlapping with the ATP binding site, blocking access by ATP to the ATP binding site of mTOR). Examples of active site mTOR inhibitors may include, but are not limited to, ΓNK128, PP242, PP121, MLN0128, AZD8055, AZD2014, NVP-BEZ235, BGT226, SF1126, Torin 1, Torin 2, WYE 687, WYE 687 salt (e.g., hydrochloride), PF04691502, PI-103, CC-223, OSI-027, XL388, KU-0063794, GDC-0349, and PKI-587. In embodiments, an active site mTOR inhibitor is an asTORi. In some embodiments, “active site inhibitor” may refer to “active site mTOR inhibitor.”


The term “FKBP” may refer to the protein Peptidyl-prolyl cis-trans isomerase. For non-limiting examples of FKBP, see Cell Mol Life Sci. 2013 September; 70(18):3243-75. In embodiments, “FKBP” may refer to “FKBP-12” or “FKBP 12” or “FKBP 1 A.” In embodiments, “FKBP” may refer to the human protein. Included in the term “FKBP” is the wildtype and mutant forms of the protein. In embodiments, “FKBP” may refer to the wildtype human protein. In embodiments, “FKBP” may refer to the wildtype human nucleic acid. In embodiments, the FKBP is a mutant FKBP. In embodiments, the mutant FKBP is associated with a disease that is not associated with wildtype FKBP. In embodiments, the FKBP includes at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to wildtype FKBP.


The term “FKBP-12” or “FKBP 12” or “FKBP1A” may refer to the protein “Peptidyl-prolyl cis-trans isomerase FKBP 1 A.” In embodiments, “FKBP-12” or “FKBP 12” or “FKBP 1 A” may refer to the human protein. Included in the term “FKBP-12” or “FKBP 12” or “FKBP 1 A” are the wildtype and mutant forms of the protein. In embodiments, “FKBP-12” or “FKBP 12” or “FKBP 1 A” may refer to the protein associated with Entrez Gene 2280, OMIM 186945, UniProt P62942, and/or RefSeq (protein) NP_000792 (SEQ ID NO:3). In embodiments, the reference numbers immediately above may refer to the protein, and associated nucleic acids, known as of the date of filing of this application. In embodiments, “FKBP-12” or “FKBP 12” or “FKBP 1 A” may refer to the wildtype human protein. In embodiments, “FKBP-12” or “FKBP 12” or “FKBP1A” may refer to the wildtype human nucleic acid. In embodiments, the FKBP-12 is a mutant FKBP-12. In embodiments, the mutant FKBP-12 is associated with a disease that is not associated with wildtype FKBP-12. In embodiments, the FKBP-12 may include at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to wildtype FKBP-12. In embodiments, the FKBP-12 has the protein sequence corresponding to reference number GI:206725550. In embodiments, the FKBP-12 has the protein sequence corresponding to RefSeq NP_000792.1 (SEQ ID NO:3).


The term “4E-BP1” or “4EBP1” or “EIF4EBP1” may refer to the protein “Eukaryotic translation initiation factor 4E-binding protein 1.” In embodiments, “4E-BP1” or “4EBP1” or “EIF4EBP 1” may refer to the human protein. Included in the term “4E-BP 1” or “4EBP 1” or “EIF4EBP1” are the wildtype and mutant forms of the protein. In embodiments, “4E-BP1” or “4EBP1” or “EIF4EBP1” may refer to the protein associated with Entrez Gene 1978, OMIM 602223, UniProt Q13541, and/or RefSeq (protein) NP_004086 (SEQ ID NO:4). In embodiments, the reference numbers immediately above may refer to the protein, and associated nucleic acids, known as of the date of filing of this application. In embodiments, “4E-BP 1” or “4EBP1” or “EIF4EBP1” may refer to the wildtype human protein. In embodiments, “4E-BP1” or “4EBP1” or “EIF4EBP1” may refer to the wildtype human nucleic acid. In embodiments, the 4EBP1 is a mutant 4EBP1. In embodiments, the mutant 4EBP1 is associated with a disease that is not associated with wildtype 4EBP1. In embodiments, the 4EBP1 may include at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to wildtype 4EBP1. In embodiments, the 4EBP1 has the protein sequence corresponding to reference number GL4758258. In embodiments, the 4EBP1 has the protein sequence corresponding to RefSeq NP_004086.1 (SEQ ID NO:4).


The term “Akt” may refer to the serine/threonine specific protein kinase involved in cellular processes such as glucose metabolism, apoptosis, proliferation, and other functions, also known as “protein kinase B” (PKB) or “Akt1.” In embodiments, “Akt” or “AM” or “PKB” may refer to the human protein. Included in the term “Akt” or “Akt1” or “PKB” are the wildtype and mutant forms of the protein. In embodiments, “Akt” or “Akt1” or “PKB” may refer to the protein associated with Entrez Gene 207, OMIM 164730, UniProt P31749, and/or RefSeq (protein) NP_005154 (SEQ ID NO:5). In embodiments, the reference numbers immediately above may refer to the protein, and associated nucleic acids, known as of the date of filing of this application. In embodiments, “Akt” or “Akt1” or “PKB” may refer to the wildtype human protein. In embodiments, “Akt” or “Akt1” or “PKB” may refer to the wildtype human nucleic acid. In embodiments, the Akt is a mutant Akt. In embodiments, the mutant Akt is associated with a disease that is not associated with wildtype Akt. In embodiments, the Akt may include at least one amino acid mutation (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 1 1, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, or 30 mutations) compared to wildtype Akt. In embodiments, the Akt has the protein sequence corresponding to reference number GI: 62241011. In embodiments, the Akt has the protein sequence corresponding to RefSeq NP_005154.2 (SEQ ID NO:5).


The present disclosure provides a method of treating a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more disclosed compositions or compounds. The present disclosure provides a method of preventing a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more disclosed compositions or compounds. The present disclosure provides a method of reducing the risk of a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more disclosed compositions or compounds.


In some embodiments, the disease is cancer or an immune-mediated disease. In some embodiments, the cancer is selected from brain and neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neuro cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors. In some embodiments, the disorder is liver cirrhosis. In some embodiments, the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.


The present disclosure provides a method of treating cancer comprising administering to the subject a therapeutically effective amount of one or more disclosed compositions or compounds. In some embodiments, the cancer is selected from brain and neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neuro cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors. In some embodiments, the disorder is liver cirrhosis.


The present disclosure provides a method of treating an immune-mediated disease comprising administering to the subject a therapeutically effective amount of one or more disclosed compositions or compounds. In some embodiments, the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.


The present disclosure provide a method of treating an age related condition comprising administering to the subject a therapeutically effective amount of one or more disclosed compositions or compounds. In certain embodiments, the age related condition is selected from sarcopenia, skin atrophy, muscle wasting, brain atrophy, atherosclerosis, arteriosclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, high blood pressure, erectile dysfunction, dementia, Huntington's disease, Alzheimer's disease, cataracts, age-related macular degeneration, prostate cancer, stroke, diminished life expectancy, impaired kidney function, and age-related hearing loss, aging-related mobility disability (e.g., frailty), cognitive decline, age-related dementia, memory impairment, tendon stiffness, heart dysfunction such as cardiac hypertrophy and systolic and diastolic dysfunction, immunosenescence, cancer, obesity, and diabetes.


In certain embodiments, the disclosed compositions or compounds can be used with regard to immunosenescence. Immunosenescence may refer to a decrease in immune function resulting in impaired immune response, e.g., to cancer, vaccination, infectious pathogens, among others. It involves both the host's capacity to respond to infections and the development of long-term immune memory, especially by vaccination. This immune deficiency is ubiquitous and found in both long- and short-lived species as a function of their age relative to life expectancy rather than chronological time. It is considered a major contributory factor to the increased frequency of morbidity and mortality among the elderly. Immunosenescence is not a random deteriorative phenomenon, rather it appears to inversely repeat an evolutionary pattern and most of the parameters affected by immunosenescence appear to be under genetic control. Immunosenescence can also be sometimes envisaged as the result of the continuous challenge of the unavoidable exposure to a variety of antigens such as viruses and bacteria. Immunosenescence is a multifactorial condition leading to many pathologically significant health problems, e.g., in the aged population. Age-dependent biological changes such as depletion of hematopoietic stem cells, an increase in PD1+ lymphocytes, a decline in the total number of phagocytes and NK cells and a decline in humoral immunity contribute to the onset of immunosenescence. In one aspect, immunosenescence can be measured in an individual by measuring telomere length in immune cells (See, e.g., U.S. Pat. No. 5,741,677). Immunosenescence can also be determined by documenting in an individual a lower than normal number of naive CD4 and/or CD8 T cells, T cell repertoire, the number of PD1-expressing T cells, e.g., a lower than normal number of PD-1 negative T cells, or response to vaccination in a subject greater than or equal to 65 years of age. In certain embodiments, mTORC1 selective modulation of certain T-cell populations may improve vaccine efficacy in the aging population and enhance effectiveness of cancer immunotherapy. The present disclosure provides a method of treating immunosenescence comprising administering to the subject a therapeutically effective amount of one or more disclosed compositions or compounds.


In an aspect is provided a method of treating a disease associated with an aberrant level of mTORC1 activity in a subject in need of such treatment. The disease may be caused by an upregulation of mTORC1. The method may include administering to the subject one or more compositions or compounds described herein. The method may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).


In an aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament is useful for treating a disease caused by an upregulation of mTORC1. The use may include administering to the subject one or more compositions or compounds described herein. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).


In an aspect is provided one or more compositions or compounds as described herein for use in the treatment of a disease caused by aberrant levels of mTORC1 activity in a subject in need of such treatment. The disease may be caused by an upregulation of mTORC1. The use may include administering to the subject one or more compositions or compounds described herein. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).


Upregulation of mTORC1 can result in an increased amount of mTORC1 activity compared to normal levels of mTORC1 activity in a particular subject or a population of healthy subjects. The increased amount of mTORC1 activity may result in, for example, excessive amounts of cell proliferation thereby causing the disease state.


The subject of treatment for the disease is typically a mammal. The mammal treated with the compound (e.g., compound described herein, mTORC1 modulator (e.g., inhibitor)) may be a human, nonhuman primate, and/or non-human mammal (e.g., rodent, canine).


In another aspect is provided a method of treating an mTORC1 activity-associated disease in a subject in need of such treatment, the method including administering one or more compositions or compounds as described herein, including embodiments (e.g., a claim, embodiment, example, table, figure, or claim) to the subject.


In another aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament may be useful for treating an mTORC1 activity-associated disease in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.


In another aspect is provided one or more compositions or compounds for use in the treatment of an mTORC1 activity-associated disease in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.


In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is cancer. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is an autoimmune disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is an inflammatory disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is a neurodegenerative disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is a metabolic disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is transplant rejection. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is fungal infection. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is a cardiovascular disease.


In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is aging. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is dying of an age-related disease. In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is an age-related condition. In certain embodiments, the age related condition is selected from the group consisting of sarcopenia, skin atrophy, muscle wasting, brain atrophy, atherosclerosis, arteriosclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, high blood pressure, erectile dysfunction, dementia, Huntington's disease, Alzheimer's disease, cataracts, age-related macular degeneration, prostate cancer, stroke, diminished life expectancy, impaired kidney function, and age-related hearing loss, aging-related mobility disability (e.g., frailty), cognitive decline, age-related dementia, memory impairment, tendon stiffness, heart dysfunction such as cardiac hypertrophy and systolic and diastolic dysfunction, immunosenescence, cancer, obesity, and diabetes. In certain embodiments, mTORC1 selective modulation of certain T-cell populations may improve vaccine efficacy in the aging population and enhance effectiveness of cancer immunotherapy. The present disclosure provides a method of treating immunosenescence comprising administering to the subject a therapeutically effective amount of one or more disclosed compounds.


In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is cancer (e.g., carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, solid cancers, lymphoid cancers; cancer of the kidney, breast, lung, bladder, colon, gastrointestinal, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, esophagus, liver; testicular cancer, glioma, hepatocarcinoma, lymphoma, including B-acute lymphoblastic lymphoma, non-Hodgkin's lymphomas (e.g., Burkitt's, Small Cell, and Large Cell lymphomas), Hodgkin's lymphoma, leukemia (including AML, ALL, and CML), multiple myeloma, and breast cancer (e.g., triple negative breast cancer)).


In embodiments, the mTORC1 activity-associated disease or disease associated with aberrant levels of mTORC1 activity is Acute Disseminated Encephalomyelitis (ADEM), Acute necrotizing hemorrhagic leukoencephalitis, Addison's disease, Agammaglobulinemia, Alopecia areata, Amyloidosis, Ankylosing spondylitis, Anti-GBM/Anti-TBM nephritis, Antiphospholipid syndrome (APS), Autoimmune angioedema, Autoimmune aplastic anemia, Autoimmune dysautonomia, Autoimmune hepatitis, Autoimmune hyperlipidemia, Autoimmune immunodeficiency, Autoimmune inner ear disease (AIED), Autoimmune myocarditis, Autoimmune oophoritis, Autoimmune pancreatitis, Autoimmune retinopathy, Autoimmune thrombocytopenic purpura (ATP), Autoimmune thyroid disease, Autoimmune urticaria, Axonal or neuronal neuropathies, Balo disease, Behcet's disease, Bullous pemphigoid, Cardiomyopathy, Castleman disease, Celiac disease, Chagas disease, Chronic fatigue syndrome, Chronic inflammatory demyelinating polyneuropathy (CIDP), Chronic recurrent multifocal ostomyelitis (CRMO), Churg-Strauss syndrome, Cicatricial pemphigoid/benign mucosal pemphigoid, Crohn's disease, Cogans syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis, CREST disease, Essential mixed cryoglobulinemia, Demyelinating neuropathies, Dermatitis herpetiformis, Dermatomyositis, Devic's disease (neuromyelitis optica), Discoid lupus, Dressier's syndrome, Endometriosis, Eosinophilic esophagitis, Eosinophilic fasciitis, Erythema nodosum, Experimental allergic encephalomyelitis, Evans syndrome, Fibromyalgia, Fibrosing alveolitis, Giant cell arteritis (temporal arteritis), Giant cell myocarditis, Glomerulonephritis, Goodpasture's syndrome, Granulomatosis with Polyangiitis (GPA) (formerly called Wegener's Granulomatosis), Graves' disease, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, Hemolytic anemia, Henoch-Schonlein purpura, Herpes gestationis, Hypogammaglobulinemia, Idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4-related sclerosing disease, Immunoregulatory lipoproteins, Inclusion body myositis, Interstitial cystitis, Juvenile arthritis, Juvenile diabetes (Type 1 diabetes), Juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, Linear IgA disease (LAD), Lupus (SLE), Lyme disease, chronic, Meniere's disease, Microscopic polyangiitis, Mixed connective tissue disease (MCTD), Mooren's ulcer, Mucha-Habermann disease, Multiple sclerosis, Myasthenia gravis, Myositis, Narcolepsy, Neuromyelitis optica (Devic's), Neutropenia, Ocular cicatricial pemphigoid, Optic neuritis, Palindromic rheumatism, PANDAS (Pediatric Autoimmune Neuropsychiatry Disorders Associated with Streptococcus), Paraneoplastic cerebellar degeneration, Paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, Pars planitis (peripheral uveitis), Pemphigus, Peripheral neuropathy, Perivenous encephalomyelitis, Pernicious anemia, POEMS syndrome, Polyarteritis nodosa, Type I, II, & III autoimmune polyglandular syndromes, Polymyalgia rheumatica, Polymyositis, Postmyocardial infarction syndrome, Postpericardiotomy syndrome, Progesterone dermatitis, Primary biliary cirrhosis, Primary sclerosing cholangitis, Psoriasis, Psoriatic arthritis, Idiopathic pulmonary fibrosis, Pyoderma gangrenosum, Pure red cell aplasia, Raynauds phenomenon, Reactive Arthritis, Reflex sympathetic dystrophy, Reiter's syndrome, Relapsing polychondritis, Restless legs syndrome, Retroperitoneal fibrosis, Rheumatic fever, Rheumatoid arthritis, Sarcoidosis, Schmidt syndrome, Scleritis, Scleroderma, Sjogren's syndrome, Sperm & testicular autoimmunity, Stiff person syndrome, Subacute bacterial endocarditis (SBE), Susac's syndrome, Sympathetic ophthalmia, Takayasu's arteritis, Temporal arteritis/Giant cell arteritis, Thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, Transverse myelitis, Type 1 diabetes, Ulcerative colitis, Undifferentiated connective tissue disease (UCTD), Uveitis, Vasculitis, Vesiculobullous dermatosis, Vitiligo, Wegener's granulomatosis (i.e., Granulomatosis with Polyangiitis (GPA), traumatic brain injury, arthritis, rheumatoid arthritis, psoriatic arthritis, juvenile idiopathic arthritis, multiple sclerosis, systemic lupus erythematosus (SLE), myasthenia gravis, juvenile onset diabetes, diabetes mellitus type 1, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, ankylosing spondylitis, psoriasis, Sjogren's syndrome, vasculitis, glomerulonephritis, auto-immune thyroiditis, Behcet's disease, Crohn's disease, ulcerative colitis, bullous pemphigoid, sarcoidosis, ichthyosis, Graves ophthalmopathy, inflammatory bowel disease, Addison's disease, Vitiligo, asthma, allergic asthma, acne vulgaris, celiac disease, chronic prostatitis, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, sarcoidosis, transplant rejection, interstitial cystitis, atherosclerosis, atopic dermatitis, Alexander's disease, Alper's disease, Alzheimer's disease, Amyotrophic lateral sclerosis, Ataxia telangiectasia, Batten disease (also known as Spielmeyer-Vogt-Sjogren-Batten disease), Bovine spongiform encephalopathy (BSE), Canavan disease, Cockayne syndrome, Corticobasal degeneration, Creutzfeldt-Jakob disease, frontotemporal dementia, Gerstmann-Straussler-Scheinker syndrome, Huntington's disease, HTV-associated dementia, Kennedy's disease, Krabbe's disease, kuru, Lewy body dementia, Machado-Joseph disease (Spinocerebellar ataxia type 3), Multiple sclerosis, Multiple System Atrophy, Narcolepsy, Neuroborreliosis, Parkinson's disease, Pelizaeus-Merzbacher Disease, Pick's disease, Primary lateral sclerosis, Prion diseases, Refsum's disease, Sandhoff s disease, Schilder's disease, Subacute combined degeneration of spinal cord secondary to Pernicious Anaemia, Schizophrenia, Spinocerebellar ataxia (multiple types with varying characteristics), Spinal muscular atrophy, Steele-Richardson-Olszewski disease, Tabes dorsalis, diabetes (e.g., type I or type II), obesity, metabolic syndrome, a mitochondrial disease (e.g., dysfunction of mitochondria or aberrant mitochondrial function), fungal infection, transplant rejection, or a cardiovascular disease (e.g., congestive heart failure; arrhythmogenic syndromes (e.g., paroxysomal tachycardia, delayed after depolarizations, ventricular tachycardia, sudden tachycardia, exercise-induced arrhythmias, long QT syndromes, or bidirectional tachycardia); thromboembolic disorders (e.g., arterial cardiovascular thromboembolic disorders, venous cardiovascular thromboembolic disorders, or thromboembolic disorders in the chambers of the heart); atherosclerosis; restenosis; peripheral arterial disease; coronary bypass grafting surgery; carotid artery disease; arteritis; myocarditis; cardiovascular inflammation; vascular inflammation; coronary heart disease (CHD); unstable angina (UA); unstable refractory angina; stable angina (SA); chronic stable angina; acute coronary syndrome (ACS); myocardial infarction (first or recurrent); acute myocardial infarction (AMI); myocardial infarction; non-Q wave myocardial infarction; non-STE myocardial infarction; coronary artery disease; ischemic heart disease; cardiac ischemia; ischemia; ischemic sudden death; transient ischemic attack; stroke; peripheral occlusive arterial disease; venous thrombosis; deep vein thrombosis; thrombophlebitis; arterial embolism; coronary arterial thrombosis; cerebral arterial thrombosis, cerebral embolism; kidney embolism; pulmonary embolism; thrombosis (e.g., associated with prosthetic valves or other implants, indwelling catheters, stents, cardiopulmonary bypass, hemodialysis); thrombosis (e.g., associated with atherosclerosis, surgery, prolonged immobilization, arterial fibrillation, congenital thrombophilia, cancer, diabetes, hormones, or pregnancy); or cardiac arrhythmias (e.g., supraventricular arrhythmias, atrial arrhythmias, atrial flutter, or atrial fibrillation).


In an aspect is provided a method of treating a disease including administering an effective amount of one or more compositions or compounds as described herein. In an aspect is provided one or more compositions or compounds as described herein for use as a medicament (e.g., for treatment of a disease). In an aspect is provided one or more compositions or compounds as described herein for use in the treatment of a disease (e.g., including administering an effective amount of one or more compositions or compounds as described herein). In embodiments, the disease is cancer. In embodiments, the disease is an autoimmune disease. In embodiments, the disease is an inflammatory disease. In embodiments, the disease is a neurodegenerative disease. In embodiments, the disease is a metabolic disease. In embodiments, the disease is fungal infection. In embodiments, the disease is transplant rejection. In embodiments, the disease is a cardiovascular disease.


In embodiments, the disease is cancer (e.g., carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, solid cancers, lymphoid cancers; cancer of the kidney, breast, lung, bladder, colon, ovarian, prostate, pancreas, stomach, brain, head and neck, skin, uterine, esophagus, liver; testicular cancer, glioma, hepatocarcinoma, lymphoma, including B-acute lymphoblastic lymphoma, non-Hodgkin's lymphomas (e.g., Burkitt's, Small Cell, and Large Cell lymphomas), Hodgkin's lymphoma, leukemia (including AML, ALL, and CML), multiple myeloma, and breast cancer (e.g., triple negative breast cancer)).


In embodiments, the disease is Acute Disseminated Encephalomyelitis (ADEM), Acute necrotizing hemorrhagic leukoencephalitis, Addison's disease, Agammaglobulinemia, Alopecia areata, Amyloidosis, Ankylosing spondylitis, Anti-GBM/Anti-TBM nephritis, Antiphospholipid syndrome (APS), Autoimmune angioedema, Autoimmune aplastic anemia, Autoimmune dysautonomia, Autoimmune hepatitis, Autoimmune hyperlipidemia, Autoimmune immunodeficiency, Autoimmune inner ear disease (AIED), Autoimmune myocarditis, Autoimmune oophoritis, Autoimmune pancreatitis, Autoimmune retinopathy, Autoimmune thrombocytopenic purpura (ATP), Autoimmune thyroid disease, Autoimmune urticaria, Axonal or neuronal neuropathies, Balo disease, Behcet's disease, Bullous pemphigoid, Cardiomyopathy, Castleman disease, Celiac disease, Chagas disease, Chronic fatigue syndrome, Chronic inflammatory demyelinating polyneuropathy (CIDP), Chronic recurrent multifocal ostomyelitis (CRMO), Churg-Strauss syndrome, Cicatricial pemphigoid/benign mucosal pemphigoid, Crohn's disease, Cogans syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis, CREST disease, Essential mixed cryoglobulinemia, Demyelinating neuropathies, Dermatitis herpetiformis, Dermatomyositis, Devic's disease (neuromyelitis optica), Discoid lupus, Dressler's syndrome, Endometriosis, Eosinophilic esophagitis, Eosinophilic fasciitis, Erythema nodosum, Experimental allergic encephalomyelitis, Evans syndrome, Fibromyalgia, Fibrosing alveolitis, Giant cell arteritis (temporal arteritis), Giant cell myocarditis, Glomerulonephritis, Goodpasture's syndrome, Granulomatosis with Polyangiitis (GPA) (formerly called Wegener's Granulomatosis), Graves' disease, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, Hemolytic anemia, Henoch-Schonlein purpura, Herpes gestationis, Hypogammaglobulinemia, Idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4-related sclerosing disease, Immunoregulatory lipoproteins, Inclusion body myositis, Interstitial cystitis, Juvenile arthritis, Juvenile diabetes (Type 1 diabetes), Juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, Linear IgA disease (LAD), Lupus (SLE), Lyme disease, chronic, Meniere's disease, Microscopic polyangiitis, Mixed connective tissue disease (MCTD), Mooren's ulcer, Mucha-Habermann disease, Multiple sclerosis, Myasthenia gravis, Myositis, Narcolepsy, Neuromyelitis optica (Devic's), Neutropenia, Ocular cicatricial pemphigoid, Optic neuritis, Palindromic rheumatism, PANDAS (Pediatric Autoimmune Neuropsychiatric Disorders Associated with Streptococcus), Paraneoplastic cerebellar degeneration, Paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, Pars planitis (peripheral uveitis), Pemphigus, Peripheral neuropathy, Perivenous encephalomyelitis, Pernicious anemia, POEMS syndrome, Polyarteritis nodosa, Type I, II, & III autoimmune polyglandular syndromes, Polymyalgia rheumatica, Polymyositis, Postmyocardial infarction syndrome, Postpericardiotomy syndrome, Progesterone dermatitis, Primary biliary cirrhosis, Primary sclerosing cholangitis, Psoriasis, Psoriatic arthritis, Idiopathic pulmonary fibrosis, Pyoderma gangrenosum, Pure red cell aplasia, Raynauds phenomenon, Reactive Arthritis, Reflex sympathetic dystrophy, Reiter's syndrome, Relapsing polychondritis, Restless legs syndrome, Retroperitoneal fibrosis, Rheumatic fever, Rheumatoid arthritis, Sarcoidosis, Schmidt syndrome, Scleritis, Scleroderma, Sjogren's syndrome, Sperm & testicular autoimmunity, Stiff person syndrome, Subacute bacterial endocarditis (SBE), Susac's syndrome, Sympathetic ophthalmia, Takayasu's arteritis, Temporal arteritis/Giant cell arteritis, Thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, Transverse myelitis, Type 1 diabetes, Ulcerative colitis, Undifferentiated connective tissue disease (UCTD), Uveitis, Vasculitis, Vesiculobullous dermatosis, Vitiligo, Wegener's granulomatosis (i.e., Granulomatosis with Polyangiitis (GPA), traumatic brain injury, arthritis, rheumatoid arthritis, psoriatic arthritis, juvenile idiopathic arthritis, multiple sclerosis, systemic lupus erythematosus (SLE), myasthenia gravis, juvenile onset diabetes, diabetes mellitus type 1, Guillain-Barre syndrome, Hashimoto's encephalitis, Hashimoto's thyroiditis, ankylosing spondylitis, psoriasis, vasculitis, glomerulonephritis, auto-immune thyroiditis, Behcet's disease, Crohn's disease, ulcerative colitis, bullous pemphigoid, sarcoidosis, ichthyosis, Graves ophthalmopathy, inflammatory bowel disease, Addison's disease, Vitiligo, asthma, allergic asthma, acne vulgaris, celiac disease, chronic prostatitis, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, sarcoidosis, transplant rejection, interstitial cystitis, atherosclerosis, atopic dermatitis, Alexander's disease, Alper's disease, Alzheimer's disease, Amyotrophic lateral sclerosis, Ataxia telangiectasia, Batten disease (also known as Spielmeyer-Vogt-Sjogren-Batten disease), Bovine spongiform encephalopathy (BSE), Canavan disease, Cockayne syndrome, Corticobasal degeneration, Creutzfeldt-Jakob disease, frontotemporal dementia, Gerstmann-Straussler-Scheinker syndrome, Huntington's disease, HTV-associated dementia, Kennedy's disease, Krabbe's disease, kuru, Lewy body dementia, Machado-Joseph disease (Spinocerebellar ataxia type 3), Multiple sclerosis, Multiple System Atrophy, Narcolepsy, Neuroborreliosis, Parkinson's disease, Pelizaeus-Merzbacher Disease, Pick's disease, Primary lateral sclerosis, Prion diseases, Refsum's disease, Sandhoff s disease, Schilder's disease, Subacute combined degeneration of spinal cord secondary to Pernicious Anaemia, Schizophrenia, Spinocerebellar ataxia (multiple types with varying characteristics), Spinal muscular atrophy, Steele-Richardson-Olszewski disease, Tabes dorsalis, diabetes (e.g., type I or type II), obesity, metabolic syndrome, a mitochondrial disease (e.g., dysfunction of mitochondria or aberrant mitochondrial function), fungal infection, transplant rejection, or a cardiovascular disease (e.g., congestive heart failure; arrhythmogenic syndromes (e.g., paroxysomal tachycardia, delayed after depolarizations, ventricular tachycardia, sudden tachycardia, exercise-induced arrhythmias, long QT syndromes, or bidirectional tachycardia); thromboembolic disorders (e.g., arterial cardiovascular thromboembolic disorders, venous cardiovascular thromboembolic disorders, or thromboembolic disorders in the chambers of the heart); atherosclerosis; restenosis; peripheral arterial disease; coronary bypass grafting surgery; carotid artery disease; arteritis; myocarditis; cardiovascular inflammation; vascular inflammation; coronary heart disease (CHD); unstable angina (UA); unstable refractory angina; stable angina (SA); chronic stable angina; acute coronary syndrome (ACS); myocardial infarction (first or recurrent); acute myocardial infarction (AMI); myocardial infarction; non-Q wave myocardial infarction; non-STE myocardial infarction; coronary artery disease; ischemic heart disease; cardiac ischemia; ischemia; ischemic sudden death; transient ischemic attack; stroke; peripheral occlusive arterial disease; venous thrombosis; deep vein thrombosis; thrombophlebitis; arterial embolism; coronary arterial thrombosis; cerebral arterial thrombosis, cerebral embolism; kidney embolism; pulmonary embolism; thrombosis (e.g., associated with prosthetic valves or other implants, indwelling catheters, stents, cardiopulmonary bypass, hemodialysis); thrombosis (e.g., associated with atherosclerosis, surgery, prolonged immobilization, arterial fibrillation, congenital thrombophilia, cancer, diabetes, hormones, or pregnancy); or cardiac arrhythmias (e.g., supraventricular arrhythmias, atrial arrhythmias, atrial flutter, or atrial fibrillation). In embodiments, the disease is a polycystic disease. In embodiments, the disease is polycystic kidney disease. In embodiments, the disease is stenosis. In embodiments, the disease is restenosis. In embodiments, the disease is neointimal proliferation. In embodiments, the disease is neointimal hyperplasia.


In another aspect is provided a method of treating aging in a subject in need of such treatment, the method including administering one or more compositions or compounds as described herein, including embodiments (e.g., a claim, embodiment, example, table, figure, or claim) to the subject. The present disclosure provides a method of treating immunosenescence comprising administering to the subject a therapeutically effective amount of one or more disclosed compounds or compositions.


In another aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament may be useful for treating aging in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.


In another aspect is provided one or more compositions or compounds disclosed herein for use in the treatment of aging in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.


In another aspect is provided a method of extending life span or inducing longevity in a subject in need of such treatment, the method including administering one or more compositions or compounds as described herein, including embodiments (e.g., a claim, embodiment, example, table, figure, or claim) to the subject.


In another aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament may be useful for extending life span or inducing longevity in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.


In another aspect is provided one or more compositions or compounds for use in extending life span or inducing longevity in a subject in need of such treatment. In embodiments, the use may include administering one or more compositions or compounds as described herein, including embodiments (e.g., an aspect, embodiment, example, table, figure, or claim) to the subject.


In an aspect is provided a method of treating a polycystic disease in a subject in need of such treatment. The polycystic disease may be polycystic kidney disease. The method may include administering to the subject one or more compositions or compounds described herein. The method may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).


In an aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament is useful for treating a polycystic disease. The polycystic disease may be polycystic kidney disease. The use may include administering to the subject one or more compositions or compounds described herein. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).


In an aspect is provided one or more compositions or compounds as described herein for use in the treatment of a polycystic disease in a subject in need of such treatment. The polycystic disease may be polycystic kidney disease. The use may include administering to the subject one or more compositions or compounds described herein. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).


In an aspect is provided a method of treating stenosis in a subject in need of such treatment. The stenosis may be restenosis. The method may include administering to the subject one or more compositions or compounds described herein. In embodiments the one or more compositions or compounds are administered in a drug eluting stent. The method may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).


In an aspect is provided one or more compositions or compounds as described herein for use as a medicament. In embodiments, the medicament is useful for treating stenosis. The stenosis may be restenosis. The use may include administering to the subject one or more compositions or compounds described herein. In embodiments the compound is administered in a drug eluting stent. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).


In an aspect is provided one or more compositions or compounds as described herein for use in the treatment of stenosis in a subject in need of such treatment. The stenosis may be restenosis. The use may include administering to the subject one or more compositions or compounds described herein. In embodiments the one or more compositions or compounds are administered in a drug eluting stent. The use may include administering to the subject a therapeutically effective amount of one or more compositions or compounds described herein (e.g., an mTORC1 modulator (e.g., inhibitor) as described above).


In embodiments, the disease is a disease described herein and the compound is a compound described herein and the composition is a composition described herein.


EXEMPLARY EMBODIMENTS

Some embodiments of the disclosure, the embodiments are of Embodiment I, represented below.


Embodiment I-1. A compound represented by Formula (I):




embedded image


or a pharmaceutically acceptable salt or tautomer thereof, wherein:


R16 is selected from R1, R2, H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═N—R1, ═N—R2, ═O, —OR3, and ═N—OR3;


R28 is selected from R1, R2, —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from ═N—R1, ═N—R2, H, ═O, —OR3, and ═N—OR3;


R40 is selected from R1, R2, —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein the compound comprises one R1 or one R2;


R1 is -A-L1-B;


R2 is -A-C≡CH, -A-N3, -A-COOH, or -A-NHR3; and


wherein


A is absent or selected from,


—(C(R3)2)n—,


—O(C(R3)2)n—,


—NR3(C(R3)2)n—,


—O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—,


—C(O)(C(R3)2)n—,


—C(O)NR3—,


—NR3C(O)(C(R3)2)n—,


—NR3C(O)O(C(R3)2)n—,


—OC(O)NR3(C(R3)2)n—,


—NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,


-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


L′ is selected from




embedded image


embedded image


embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


embedded image


embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4;


provided that when R40 is R1, wherein R1 is -A-L1-B; L1 is




embedded image


then A is not —O(CH2)2—O(CH2)—.


Embodiment I-2. A compound represented by Formula (Ia):




embedded image


or a pharmaceutically acceptable salt or tautomer thereof, wherein:


R16 is R1 or R2;


R26 is selected from ═O, —OR3, and ═N—OR3;


R28 is selected from —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from H, ═O, —OR3, and ═N—OR3;


R40 is selected from —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein R1 is -A-L1-B;


R2 is -A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


L1 is selected from




embedded image


embedded image


embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4.


Embodiment I-3. A compound represented by Formula (Ib):




embedded image


or a pharmaceutically acceptable salt or tautomer thereof, wherein:


R16 is selected from H, (C1-C6)alkyl, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is ═N—R1 or ═N—R2;


R28 is selected from —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from H, ═O, —OR3, and ═N—OR3;


R40 is selected from —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein R1 is -A-L1-B;


R2 is A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


L1 is selected from




embedded image


embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4.


Embodiment I-4. A compound represented by Formula (Ic):




embedded image


or a pharmaceutically acceptable salt or tautomer thereof, wherein:


R16 is selected from H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═O, —OR3, and ═N—OR3;


R28 is R1 or R2;


R32 is selected from H, ═O, —OR3, and ═N—OR3;


R40 is selected from —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3,


—S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein the compound comprises one R1 or one R2;


wherein R1 is -A-L1-B;


R2 is -A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


L1 is selected from




embedded image


embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


embedded image


as drawn, is bound to L1;


and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4.


Embodiment I-5. A compound represented by Formula (Id):




embedded image


or a pharmaceutically acceptable salt or tautomer thereof, wherein:


R16 is selected from H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═O, —OR3, and ═N—OR3;


R28 is selected from —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is ═N—R1 or R2;


R40 is selected from —OR3, —SR3, —N3, —N(R3)2, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, —OP(O)(OR3)2, —OP(O)(R3)2, —NR3C(O)R3, —S(O)R3, —S(O)2R3, —OS(O)2NHC(O)R3,




embedded image


wherein R1 is -A-L1-B;


R2 is -A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


L1 is selected from




embedded image


embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4.


Embodiment I-6. A compound represented by Formula (Ie):




embedded image


or a pharmaceutically acceptable salt or tautomer thereof, wherein:


R16 is selected from H, (C1-C6)alkyl, —OR3, —SR3, ═O, —NR3C(O)OR3, —NR3C(O)N(R3)2, —NR3S(O)2OR3, —NR3S(O)2N(R3)2, —NR3S(O)2R3, (C6-C10)aryl, and 5-7 membered heteroaryl, and




embedded image


wherein the aryl and heteroaryl is optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


R26 is selected from ═O, —OR3, and ═N—OR3;


R28 is selected from —OR3, —OC(O)O(C(R3)2)n, —OC(O)N(R3)2, —OS(O)2N(R3)2, and —N(R3)S(O)2OR3;


R32 is selected from H, ═O, —OR3, and ═N—OR3;


R40 is R1 or R2;


wherein R1 is -A-L1-B;


R2 is A-C≡CH, -A-N3, -A-COOH, or -A-NHR3;


wherein


A is absent or is selected from —(C(R3)2)n—, —O(C(R3)2)n—, —NR3(C(R3)2)n—, —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—, —C(O)(C(R3)2)n—, —C(O)NR3—, —NR3C(O)(C(R3)2)n—, —NR3C(O)O(C(R3)2)n—, —OC(O)NR3(C(R3)2)n—, —NHSO2NH(C(R3)2)n—,


—OC(O)NHSO2NH(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-,


—OC(O)NH(C(R3)2)n—(C6-C10)arylene-,


—O—(C6-C10)arylene-,


—O-heteroarylene-,

-heteroarylene-(C6-C10)arylene-,


—O(C(R3)2)n—(C6-C10)arylene-(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-NR3(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-(C6-C10)arylene-,


-heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


—O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—,


-heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, and


—O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-,

    • wherein heteroarylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S; heterocyclylene is 5-12 membered and contains 1-4 heteroatoms selected from O, N, and S;
    • wherein the arylene, heteroarylene, and heterocyclylene are optionally substituted with one or more substituents each independently selected from alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, and hydroxyl;


L1 is selected from




embedded image


embedded image


wherein the bond with variable position in the triazole is in the 4-position or 5-position, and wherein the A ring is phenylene or 5-8 membered heteroarylene;


B is selected from




embedded image


embedded image


as drawn, is bound to L1; and wherein the heteroaryl, heterocyclyl, and arylene are optionally substituted with alkyl, hydroxyalkyl, haloalkyl, alkoxy, halogen, or hydroxyl;


each R3 is independently H or (C1-C6)alkyl;


each R4 is independently H, (C1-C6)alkyl, halogen, 5-12 membered heteroaryl, 5-12 membered heterocyclyl, (C6-C10)aryl, wherein the heteroaryl, heterocyclyl, and aryl are optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl;


each Q is independently C(R3)2 or O;


each Y is independently C(R3)2 or a bond;


each Z is independently H or absent;


each n is independently a number from one to 12;


each o is independently a number from zero to 12;


each p is independently a number from zero to 12;


each q is independently a number from zero to 10; and


each r is independently 1, 2, 3, or 4;


provided that when R40 is R1, wherein R1 is -A-L1-B; L1 is




embedded image


B is



embedded image


and B1 is



embedded image


then A is not —O(CH2)2—O(CH2)—.


Embodiment I-7. The compound of any one of Embodiments I-1 to I-6, wherein the compound comprises R.


Embodiment I-8. The compound of any one of Embodiments I-1 to I-6, wherein the compound comprises R2.


Embodiment I-9. The compound of Embodiment I-8, wherein the compound comprises R2 is -A-C≡CH.


Embodiment I-10. The compound of Embodiment I-8, wherein the compound comprises R2 is -A-N3.


Embodiment I-11. The compound of Embodiment I-8, wherein the compound comprises R2 is -A-COOH.


Embodiment I-12. The compound of Embodiment I-8, wherein the compound comprises R2 is -A-NHR3.


Embodiment I-13. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R3)2)n—.


Embodiment I-14. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—.


Embodiment I-15. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—.


Embodiment I-16. The compound of any one of Embodiments I-1 to I-12, wherein A is -heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—, -heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—, -heteroarylene-(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—, or —O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-S(O)2NR3—(C6-C10)arylene-.


Embodiment I-17. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—, —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—, or —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-SO2(C(R3)2)n—.


Embodiment I-18. The compound of any one of Embodiments I-1 to I-12, wherein A is —O(C(R3)2)n-heteroarylene-heteroarylene-NR3—(C6-C10)arylene-, —O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-(C(R3)2)n—, or —O(C(R3)2)n-heteroarylene-heteroarylene-heterocyclylene-C(O)(C(R3)2)n—.


Embodiment I-19. The compound of any one of Embodiments I-1 to I-12, wherein A is -heteroarylene-(C6-C10)arylene-(C6-C10)arylene-, -heteroarylene-(C6-C10)arylene-heteroarylene-O(C(R3)2)n—, or -heteroarylene-(C6-C10)arylene-heteroarylene-(C(R3)2)n2—O(C(R3)2)n—.


Embodiment I-20. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L1 is




embedded image


Embodiment I-21. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L1 is




embedded image


Embodiment I-22. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L1 is




embedded image


Embodiment I-23. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L1 is




embedded image


Embodiment I-24. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L1 is




embedded image


Embodiment I-25. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L1 is




embedded image


Embodiment I-26. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L1 is




embedded image


Embodiment I-27. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-19, wherein L1 is




embedded image


Embodiment I-28. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-27, wherein B is




embedded image


Embodiment I-29. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-27, wherein B is




embedded image


Embodiment I-30. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-29, wherein B1 is




embedded image


Embodiment I-31. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-29, wherein B1 is




embedded image


Embodiment I-32. The compound of any one of Embodiments I-1 to I-7 and I-13 to I-31, wherein R4 is 5-12 membered heteroaryl, optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl.


Embodiment I-32A. A compound selected from the group consisting of:












Structure









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image









embedded image












or a pharmaceutically acceptable salt or isomer thereof.


Embodiment I-33. A pharmaceutical composition comprising a compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, and at least one of a pharmaceutically acceptable carrier, diluent, or excipient.


Embodiment I-34. A method of treating a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.


Embodiment I-35. A method of preventing a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.


Embodiment I-36. A method of reducing the risk of a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.


Embodiment I-37. The method of any one of Embodiments I-34 to I-36, wherein the disease is cancer or an immune-mediated disease.


Embodiment I-38. The method of Embodiment I-37, wherein the cancer is selected from brain and neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neuro cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors.


Embodiment I-39. The method of Embodiment I-37, wherein the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.


Embodiment I-40. A method of treating cancer comprising administering to the subject a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.


Embodiment I-41. The method of Embodiment I-40, wherein the cancer is selected from brain and neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neuro cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors.


Embodiment I-42. A method of treating an immune-mediated disease comprising administering to the subject a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.


Embodiment I-43. The method of Embodiment I-42, wherein the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.


Embodiment I-44. A method of treating an age related condition comprising administering to the subject a therapeutically effective amount of one or more compounds of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof.


Embodiment I-45. The method of Embodiment I-44, wherein the age related condition is selected from sarcopenia, skin atrophy, muscle wasting, brain atrophy, atherosclerosis, arteriosclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, high blood pressure, erectile dysfunction, dementia, Huntington's disease, Alzheimer's disease, cataracts, age-related macular degeneration, prostate cancer, stroke, diminished life expectancy, impaired kidney function, and age-related hearing loss, aging-related mobility disability (e.g., frailty), cognitive decline, age-related dementia, memory impairment, tendon stiffness, heart dysfunction such as cardiac hypertrophy and systolic and diastolic dysfunction, immunosenescence, cancer, obesity, and diabetes.


Embodiment I-46. A compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, for use in treating, preventing, or reducing the risk of a disease or condition mediated by mTOR.


Embodiment I-47. Use of a compound of any of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating, preventing, or reducing the risk of a disease or disorder mediated by mTOR.


Embodiment I-48. A compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, for use in treating cancer.


Embodiment I-49. Use of a compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating cancer.


Embodiment I-50. A compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, for use in treating an immune-mediated disease.


Embodiment I-51. Use of a compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating an immune-mediated disease.


Embodiment I-52. A compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, for use in treating an age related condition.


Embodiment I-53. Use of a compound of any one of Embodiments I-1 to I-32, or a pharmaceutically acceptable salt thereof, in the manufacture of a medicament for treating an age related condition.


EXAMPLES

The disclosure is further illustrated by the following examples and synthesis examples, which are not to be construed as limiting this disclosure in scope or spirit to the specific procedures herein described. It is to be understood that the examples are provided to illustrate certain embodiments and that no limitation to the scope of the disclosure is intended thereby. It is to be further understood that resort may be had to various other embodiments, modifications, and equivalents thereof which may suggest themselves to those skilled in the art without departing from the spirit of the present disclosure and/or scope of the appended claims.


Definitions used in the following examples and elsewhere herein are:

    • CH2Cl2, DCM Methylene chloride, Dichloromethane
    • CH3CN, MeCN Acetonitrile
    • DIPEA Diisopropylethyl amine
    • DMA Dimethylacetamide
    • DME Dimethoxyethane
    • DMF N,N-Dimethylformamide
    • EDCI 1-Ethyl-3-(3-dimethylaminopropyl)carbodiimide
    • EtOAc Ethyl acetate
    • h hour
    • H2O Water
    • HCl Hydrochloric acid
    • HOBt Hydroxybenzotriazole
    • HPLC High-performance liquid chromatography
    • LCMS Liquid chromatography-mass spectrometry
    • MeOH Methanol
    • MTBE Methyl tert-butyl ether
    • Na2SO4 Sodium sulfate
    • PEG Polyethylene glycol
    • TBDMS tert-butyldimethylsilyl
    • TFA Trifluoroacetic acid
    • THF Tetrahydrofuran
    • TMS Tetramethyl silane


General Assembly Approaches for Bifunctional Ranalogs

With reference to the schemes below, rapamycin is Formula II,




embedded image


where R16 is —OCH3; R26 is ═O; R28 is —OH; R32 is ═O; and R40 is —OH. A “rapalog” may refer to an analog or derivative of rapamycin. For example, with reference to the schemes below, a rapalog can be rapamycin that is substituted at any position, such as R16, R26, R28, R32, or R40. An active site inhibitor (AS inhibitor) is active site mTOR inhibitor. In certain embodiments, AS inhibitor is depicted by B, in Formula I or Formula I-X.


Assembly of Series 1 Bifunctional Rapalogs

An assembly approach to Series 1 bifunctional rapalogs is shown in Scheme 1 below. For these types of bifunctional rapalogs, Linker Type A may include variations where q=0 to 30 or 0 to 10, such as q=1 to 7. An alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations found in Table 1 in the Examples Section. A Type 1 mTOR active site inhibitor can attach to the linker via a primary or secondary amine, and may include variations in Table 2 in the Examples Section. This assembly sequence starts with reaction of the linker Type A with the amino terminus of an active site inhibitor, such as those in Table 2, to provide an intermediate A1. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide the Series 1 bifunctional rapalogs.




embedded image









TABLE 1





Alkyne containing rapalog monomers.


Alkyne containing rapalog









embedded image







Monomer 1







embedded image







Monomer 2







embedded image







Monomer 3







embedded image







Monomer 4







embedded image







Monomer 5







embedded image







Monomoer 6







embedded image







Monomer 7







embedded image







Monomer 8







embedded image







Monomer 9







embedded image







Monomer 10







embedded image







Monomer 11







embedded image







Monomer 12







embedded image







Monomer 13







embedded image







Monomer 14







embedded image







Monomer 15







embedded image







Monomer 16







embedded image







Monomer 17







embedded image







Monomer 18







embedded image







Monomer 19







embedded image







Monomer 20







embedded image







Monomer 21







embedded image







Monomer 22







embedded image







Monomer 23







embedded image







Monomer 24







embedded image







Monomer 25







embedded image







Monomer 26







embedded image







Monomer 27







embedded image







Monomer 28







embedded image







Monomer 29







embedded image







Monomer 30







embedded image







Monomer 31







embedded image







Monomer 32







embedded image







Monomer 33







embedded image







Monomer 34







embedded image







Monomer 35







embedded image







Monomer 36







embedded image







Monomer 37







embedded image







Monomer 38







embedded image







Monomer 39







embedded image







Monomer 40







embedded image







Monomer 41







embedded image







Monomer 42







embedded image







Monomer 43







embedded image







Monomer 44







embedded image







Monomer 45







embedded image







Monomer 46







embedded image







Monomer 47







embedded image







Monomer 48







embedded image







Monomer 49







embedded image







Monomer 50







embedded image







Monomer 51







embedded image







Monomer 52







embedded image







Monomer 53







embedded image







Monomer 54







embedded image







Monomer 86







embedded image







Monomer 87
















TABLE 2





Type 1 Active Site inhibitor.


Active Site inhibitor









embedded image







Monomer A







embedded image







Monomer B







embedded image







Monomer C







embedded image







Monomer D







embedded image







Monomer E







embedded image







Monomer F







embedded image







Monomer G







embedded image







Monomer H







embedded image







Monomer I







embedded image







Monomer J







embedded image







Monomer K







embedded image







Monomer L







embedded image







Monomer M







embedded image







Monomer N







embedded image







Monomer O







embedded image







Monomer P







embedded image







Monomer Q







embedded image







Monomer R







embedded image







Monomer S







embedded image







Monomer T







embedded image







Monomer U







embedded image







Monomer V







embedded image







Monomer W







embedded image







Monomer X







embedded image







Monomer Y







embedded image







Monomer Z







embedded image







Monomer AA







embedded image







Monomer AB







embedded image







Monomer AC







embedded image







Monomer AD









Assembly of Series 2 Bifunctional Rapalogs

An assembly approach to Series 2 bifunctional rapalogs is shown in Scheme 2 below. For these types of bifunctional rapalogs, linker type B may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8; o=0 to 8, such as o=0 to 2; and Q is CH2 or O (when o>0). The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. The active site inhibitor can include variations in Table 2. This assembly sequence starts with reaction of the linker Type B with a cyclic anhydride to give Intermediate B1. The intermediate is then coupled to the amino terminus of an active site inhibitor, such as those in Table 2, to provide Intermediate B2. Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide the Series 2 bifunctional rapalogs.




embedded image


Assembly of Series 3 Bifunctional Rapalogs

An assembly approach to Series 3 bifunctional rapalogs is shown in Scheme 3 below. For these types of bifunctional rapalogs, linker type B may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type B with a carboxylic acid of an active site inhibitor, such as those in Table 3 in the Examples Section, to provide Intermediate C1 (Scheme 3). Then, the intermediate is coupled to an alkyne containing rapalog, such as those from Table 1, via 3+2 cycloadditions to provide Series 3 bifunctional rapalogs.




embedded image









TABLE 3





Type 2 Active Site Inhibitors.


Active Site Inhibitor









embedded image







Monomer AE







embedded image







Monomer AF







embedded image







Monomer AG







embedded image







Monomer AH







embedded image







Monomer AI







embedded image







Monomer AJ









Assembly of Series 4 Bifunctional Rapalogs

An assembly approach to Series 4 bifunctional rapalogs is shown in Scheme 4 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4 in the Examples Section. This assembly sequence starts with reaction of the linker type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to provide Intermediate D1 (Scheme 4). The intermediate is then coupled to a nucleophilic amine containing active site inhibitor, such as those in Table 2, to provide Intermediate D2. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 4 bifunctional rapalogs.




embedded image









TABLE 4





Azide containing rapalog monomers.


Azide containing rapalog









embedded image

  Monomer 55








embedded image

  Monomer 56








embedded image

  Monomer 57








embedded image

  Monomer 58








embedded image

  Monomer 59








embedded image

  Monomer 60








embedded image

  Monomer 61








embedded image

  Monomer 62








embedded image

  Monomer 63








embedded image

  Monomer 64








embedded image

  Monomer 65








embedded image

  Monomer 66








embedded image

  Monomer 67








embedded image

  Monomer 68








embedded image

  Monomer 69








embedded image

  Monomer 70








embedded image

  Monomer 71








embedded image

  Monomer 72








embedded image

  Monomer 73








embedded image

  Monomer 74








embedded image

  Monomer 75








embedded image

  Monomer 88

















TABLE 5





Alkyne containing amine-reactive pre-linkers.


Alkyne containing block









embedded image

  Building Block A








embedded image

  Building Block B








embedded image

  Building Block C








embedded image

  Building Block D








embedded image

  Building Block E








embedded image

  Building Block F








embedded image

  Building Block G








embedded image

  Building Block H








embedded image

  Building block 1










Assembly of Series 5 Bifunctional Rapalogs

An assembly approach to Series 5 bifunctional rapalogs is shown in Scheme 5 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker Type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to provide Intermediate E1 (Scheme 5). Then, the intermediate is coupled to a Type C linker, using standard peptide forming conditions, followed by carboxylic acid deprotection to provide Intermediate E2. The intermediate is then coupled to an amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate E3. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 5 bifunctional rapalogs.




embedded image


Assembly of Series 6 Bifunctional Rapalogs

An assembly approach to Series 6 bifunctional rapalogs is shown in Scheme 6 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker type C with an amine-reactive alkyne-containing pre linker, such as those in Table 5 in the Examples Section, followed by carboxylic acid deprotection to give Intermediate F1 (Scheme 6). The intermediate is then coupled to an amine containing post-linker, such as those found in Table 6 in the Examples Section, using standard peptide bond forming conditions followed by deprotection of the carboxylic acid to provide Intermediate F2. The intermediate is then coupled to an amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate F3. Finally, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 6 bifunctional rapalogs.




embedded image









TABLE 6





Amine containing post-linkers.


Amine containing block









embedded image

  Building block J








embedded image

  Building block K










Assembly of Series 7 Bifunctional Rapalogs

An assembly approach to Series 7 bifunctional rapalogs is shown in Scheme 7 below. For these types of bifunctional rapalogs, linker type A may include variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type D may include variations where o=0 to 10, such as o=1 to 8. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type D with a carboxylic acid of an active site inhibitor, such as those in Table 3 in the Examples Section, followed by N-deprotection to give Intermediate G1 (Scheme 7). Then, the intermediate is coupled to a type A linker, to provide Intermediate G2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 7 bifunctional rapalogs.




embedded image


Assembly of Series 8 Bifunctional Rapalogs

An assembly approach to Series 8 bifunctional rapalogs is shown in Scheme 8 below. For these types of bifunctional rapalogs, linker type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker type C with an azide containing pre-linker, such as those in Table 7 in the Examples Section, followed by carbonxylic acid deprotection to give Intermediate H1 (Scheme 8). The intermediate is then coupled to the amine containing active site inhibitor, such as those in Table 2, using standard peptide bond forming conditions to provide Intermediate H2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 8 bifunctional rapalogs.




embedded image









TABLE 7





Azide containing amine-reactive pre-linkers.


Azide containing block









embedded image

  Building block L








embedded image

  Building block M








embedded image

  Building block N








embedded image

  Building block O








embedded image

  Building block P










Assembly of Series 9 Bifunctional Rapalogs

An assembly approach to Series 9 bifunctional rapalogs is shown in Scheme 9 below. For these types of bifunctional rapalogs, Linker Type F may include variations where q=0 to 30 or 0 to 10, such as q=1 to 7. An azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations found in Table 4 in the Examples Section. A Type 1 mTOR active site inhibitor can attach to the linker via a primary or secondary amine, and may include variations in Table 2 in the Examples Section. This assembly sequence starts with reaction of the linker Type E with the amino terminus of an active site inhibitor, such as those in Table 2, to provide an intermediate I1. Then, the intermediate is coupled to an azide containing rapalog, such as those from Table 4, via 3+2 cycloadditions to provide the Series 9 bifunctional rapalogs.




embedded image


Assembly of Series 10 bifunctional rapalogs


An assembly approach to Series 10 bifunctional rapalogs is shown in Scheme 10 below. For these types of bifunctional rapalogs, linker type F includes variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type G includes variations where o=0 to 10, such as o=1 to 8. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker Type F with the amine of an active site inhibitor, such as those in Table 2 in the Examples Section. Then, the intermediate is coupled to a type G linker, to provide Intermediate J2. Finally, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 10 bifunctional rapalogs.




embedded image


Assembly of Series 11 Bifunctional Rapalogs

An assembly approach to Series 11 bifunctional rapalogs is shown in Scheme 11 below. For these types of bifunctional rapalogs, linker type A includes variations where q=0 to 30 or 0 to 10, such as q=1 to 8, and linker type C includes variations where o=0 to 10, such as o=1 to 8. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker Type A with the amine of a linker Type C, followed by deprotection of the carboxylic acid to provide Intermediate K1. Then, the intermediate is coupled an amine containing active site inhibitor, such as those found in Table 2, to provide Intermediate K2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 11 bifunctional rapalogs.




embedded image


Assembly of Series 12 Bifunctional Rapalogs

An assembly approach to Series 12 bifunctional rapalogs is shown in Scheme 12 below. For these types of bifunctional rapalogs, linker type H may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The alkyne moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I-X). The alkyne moiety can be attached via a variety of linkage fragments including variations in Table 1. This assembly sequence starts with reaction of the linker type H with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by carboxylic acid deprotection to provide Intermediate L1. Then, the intermediate is coupled with an azide containing amine prelinker, which can be composed of a primary or seconday amine, such as those in Table 8, to provide Intermediate L2. Finally, the intermediate is coupled to an alkyne containing rapalog, such as those in Table 1, via 3+2 cycloadditions to provide Series 12 bifunctional rapalogs.




embedded image









TABLE 8





Azide containing amine pre-linkers.


Amine containing block









embedded image

  Building Block Q








embedded image

  Building block R








embedded image

  Building block S








embedded image

  Building block T








embedded image

  Building block U










Assembly of Series 13 Bifunctional Rapalogs

An assembly approach to Series 13 bifunctional rapalogs is shown in Scheme 13 below. For these types of bifunctional rapalogs, linker type I may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The azide moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The azide moiety can be attached via a variety of linkage fragments including variations in Table 4. This assembly sequence starts with reaction of the linker type I with an alkyne containing pre-linker amine, which can be composed of a primary or seconday amine, such as those in Table 9 in the Examples Section, followed by N-deprotection to give Intermediate M1. The intermediate is then coupled to the carboxylic acid containing active site inhibitor, such as those in Table 3, using standard peptide bond forming conditions to provide Intermediate M2. Then, the intermediate is coupled to an azide containing rapalog, such as those in Table 4, via 3+2 cycloadditions to provide Series 13 bifunctional rapalogs.




embedded image









TABLE 9





Alkyne containing pre-linker amines.


Alkyne containing amines









embedded image

  Building Block V








embedded image

  Building Block W








embedded image

  Building Block X








embedded image

  Building Block Y








embedded image

  Building Block Z








embedded image

  Building Block AA








embedded image

  Building Block AB








embedded image

  Building Block AC










Assembly of Series 14 Bifunctional Rapalogs

An assembly approach to Series 14 bifunctional rapalogs is shown in Scheme 14 below. For this type of bifunctional rapalogs, linker type I may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The carboxylic acid moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The carboxylic acid moiety can be attached via a variety of linkage fragments including variations in Table 10. This assembly sequence starts with reaction of the linker type I with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by N-deprotection to provide Intermediate N1. The intermediate is then coupled to a carboxylic acid containing rapalog, such as those in Table 10 in the Examples Section, to provide Series 14 bifunctional rapalogs.




embedded image









TABLE 10





Carboxylic acid containing rapalog monomers.


Carboxylic acid containing rapalog









embedded image

  Monomer 76








embedded image

  Monomer 77








embedded image

  Monomer 78








embedded image

  Monomer 79








embedded image

  Monomer 80










Assembly of Series 15 Bifunctional Rapalogs

An assembly approach to Series 15 bifunctional rapalogs is shown in Scheme 15 below. For this type of bifunctional rapalogs, linker type J may include variations where q=0 to 30 or 0 to 10, such as q=3 to 8. The amino moiety can be attached to the rapalog at R40, R16, R28, R32, or R26 positions (Formula I or Formula I-X). The amino moiety can be attached via a variety of linkage fragments including variations in Table 11. This assembly sequence starts with reaction of the linker type J with a nucleophilic amine containing active site inhibitor, such as those in Table 2, followed by carbonxylic acid deprotection to provide


Intermediate O1. The intermediate is then coupled to an amine containing rapalog, such as those in Table 11 in the Examples Section, to provide Series 15 bifunctional rapalogs.




embedded image









TABLE 11





Amine containing rapalog monomers.


Amine containing rapalog









embedded image

  Monomer 81








embedded image

  Monomer 82








embedded image

  Monomer 83








embedded image

  Monomer 84








embedded image

  Monomer 85










Assembly of Series 16 Bifunctional Rapalogs

An assembly approach to Series 16 bifunctional rapalogs is shown in Scheme 16 below. For these types of bifunctional rapalogs, linker Type C may include variations where q=0 to 30 or 0 to 10, such as q=1 to 9. The amine containing rapalog monomers may include those in Table 11. This assembly sequence starts with reaction of the linker Type C with a carboxylic acid of an active site inhibitor, such as those in Table 3, to provide Intermediate P1. Then, the intermediate is coupled to an amine containing rapalog, such as those in Table 11 in the Examples Section, to provide Series 16 bifunctional rapalogs.




embedded image


PREPARATION OF ACTIVE SITE INHIBITOR MONOMERS
Monomer A. 5-(4-amino-1-(4-(aminomethyl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate

To a solution of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3.8 g, 14.56 mmol, 1.0 equiv) in DMF (20 mL) was added NaH (582.27 mg, 14.56 mmol, 60% purity, 1.0 equiv) at 0° C. and the reaction solution was stirred at this temperature for 30 min, then tert-butyl 4-(bromomethyl)benzylcarbamate (4.59 g, 15.29 mmol, 1.05 equiv) was added to the reaction at 0° C. and the reaction solution was stirred at room temperature for 2 h. The solution was poured into H2O (80 mL) and the solid that precipitated out was filtered. The solid cake was washed with H2O (2×10 mL) and then dried under reduced pressure to give tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate (5 g, 7.68 mmol, 53% yield) as a yellow solid. LCMS (ESI) m/z: [M+Na] calcd for C18H21IN6O2: 503.07; found: 503.2.


Step 2: Synthesis of tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate

To a bi-phasic suspension of tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate (5 g, 7.68 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (2.40 g, 9.22 mmol, 1.2 equiv) and Pd(PPh3)4 (887.66 mg, 768.16 μmol, 0.1 equiv) in DME (100 mL) and H2O (50 mL) was added Na2CO3 (1.91 g, 23.04 mmol, 3.0 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was cooled to room temperature and filtered, the filtrate was extracted by EtOAc (3×50 mL). The organic phases were combined and washed with brine (10 mL), dried over Na2SO4, filtered, and the filtrate was concentrated under reduced pressure to give a residue. The residue was purified by silica gel chromatography (0→20% MeOH/EtOAc) to give tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate (4.5 g, 82% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C25H26N8O3: 487.22; found: 487.2.


Step 3: Synthesis of 5-(4-amino-1-(4-(aminomethyl)benzyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

To a solution of tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)benzylcarbamate (4.5 g, 6.29 mmol, 1.0 equiv) in DCM (50 mL) was added TFA (30.80 g, 270.12 mmol, 20 mL, 42.95 equiv) at 0° C. The reaction solution was stirred at room temperature for 2 h. The reaction solution was concentrated under reduced pressure to give a residue, which was dissolved in 10 mL of MeCN, then poured into MTBE (100 mL). The solid that precipitated was then filtered and the solid cake was dried under reduced pressure to give 5-[4-amino-1-[[4-(aminomethyl)phenyl]methyl]pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (2.22 g, 71% yield, TFA) as a yellow solid. LCMS (ESI)m/z: [M+H] calcd for C20H18N8O: 387.16; found: 387.1.


Monomer B. 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-6-ol trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-6-(benzyloxy)-1H-indole-1-carboxylate

To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (300 mg, 694 μmol, 1.0 equiv) and (6-(benzyloxy)-1-(tert-butoxycarbonyl)-1H-indol-2-yl)boronic acid (763 mg, 2.08 mmol, 3.0 equiv) in DMF (2.6 mL), EtOH (525 μL), and H2O (350 μL) were added Pd(OAc)2 (15.5 mg, 69 μmol, 0.1 equiv), triphenylphosphine (36.1 mg, 138 μmol, 0.2 equiv), and sodium carbonate (440 mg, 4.16 mmol, 6.0 equiv). The reaction was heated at 80° C. for 20 h, cooled to room temperature, and quenched with H2O (10 mL) and EtOAc (10 mL). The mixture was transferred to a separatory funnel and the aqueous phase was extracted with EtOAc (3×20 mL). The combined organic phase was washed with sat. aq. NaCl (1×20 mL), dried over Na2SO4, filtered, and concentrated under reduced pressure. The crude material was purified by silica gel chromatography (20→85% EtOAc/heptane) to provide the product (201 mg, 46% yield) as an orange solid. LCMS (ESI) m/z: [M+H] calcd for C29H33N7O3: 528.27; found 528.2.


Step 2: Synthesis of tert-butyl (4-(4-amino-3-(6-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

To a solution of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-6-(benzyloxy)-1H-indole-1-carboxylate (1.0 equiv) in EtOH is added Pd/C (10 mol %). The reaction is purged with H2 and the reaction allowed to stir under an atmosphere of H2 until consumption of starting material, as determined by LCMS. The reaction is then diluted with EtOAc, filtered over Celite, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford the desired product.


Step 3: Synthesis of 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-6-ol

To a solution of tert-butyl (4-(4-amino-3-(6-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) in anhydrous DCM is added TFA (50 equiv.) dropwise at 0° C. The reaction is stirred at 0° C. and warmed to room temperature. Once the reaction is complete, as determined by LCMS, the reaction is concentrated under reduced pressure. The residue is triturated with MeCN, then dropped into MTBE over 10 min. The supernatant is removed and the precipitate is collected by filtration under N2 to give 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-6-ol.


Monomer C. 5-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (5 g, 19.16 mmol, 1.0 equiv) in DMF (50.0 mL) was added NaH (766.22 mg, 19.16 mmol, 60% purity, 1.0 equiv) at 4° C. The mixture was stirred at 4° C. for 30 min. To the reaction mixture was added tert-butyl 6-(bromomethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (6.87 g, 21.07 mmol, 1.1 equiv) in DMF (30 mL) at 4° C. The mixture was stirred at room temperature for 2 h. The mixture was then cooled to 4° C. and H2O (400 mL) was added and the mixture was stirred for 30 min. The resulting precipitate was collected by filtration to give crude tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (9.7 g, 76% yield) as light yellow solid. The crude product was used for the next step directly.


Step 2: Synthesis of tert-butyl 6-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

To a bi-phasic suspension of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (9.7 g, 14.63 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (4.57 g, 17.55 mmol, 1.2 equiv), and Na2CO3 (7.75 g, 73.14d mmol, 5.0 equiv) in DME (120.0 mL) and H2O (60 mL) was added Pd(PPh3)4 (1.69 g, 1.46 mmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled to room temperature and partitioned between EtOAc (100 mL) and H2O (100 mL). The aqueous layer was separated and extracted with EtOAc (60 mL×2). The organic layers were combined, washed with brine (80 mL) and dried over anhydrous Na2SO4, filtered and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (1→100% EtOAc/petroleum ether, then 20→50% MeOH/EtOAc) to afford tert-butyl 6-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (4.5 g, 8.44 mmol, 58% yield) as light yellow solid.


Step 3: Synthesis of 5-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyramidin-3-yl)benzo[d]oxazol-2-amine

To neat TFA (32.5 mL, 438.97 mmol, 50.0 equiv) was added tert-butyl 6-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (4.5 g, 8.78 mmol, 1.0 equiv) at room temperature. The mixture was stirred for 30 min and then concentrated under reduced pressure. The oily residue was triturated with MeCN (8 mL), then dropped into MTBE (350 mL) over 10 min. The supernatant was removed and then the precipitate was collected by filtration under N2 to give 5-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (5.72 g, 10.54 mmol, over 100% yield, TFA) as light pink solid. LCMS (ESI) m/z: [M+H] calcd for C22H20N8O: 413.18; found 413.2.


Monomer D. 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-7-ol trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-methoxy-1H-indole-1-carboxylate

To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) and (1-(tert-butoxycarbonyl)-7-methoxy-1H-indol-2-yl)boronic acid (3.0 equiv) in DME and H2O are added Pd(PPh3)4 (0.1 equiv) and sodium carbonate (6.0 equiv). The reaction is heated at 80° C. until completion of reaction, as determined by LCMS and TLC analysis. The reaction is then quenched with H2O and EtOAc. The mixture is transferred to a separatory funnel and the aqueous phase is extracted with EtOAc. The organic phase is washed with sat. aq. NaCl, dried over Na2SO4, filtered, and concentrated under reduced pressure. The desired product is isolated after chromatography on silica gel.


Step 2: Synthesis of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-hydroxy-1H-indole-1-carboxylate

To a solution of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-methoxy-1H-indole-1-carboxylate (1.0 equiv) in DCM at −10° C. is added BBr3 (2.0 equiv). The reaction is allowed to stir until consumption of starting material as determined by LCMS. The reaction is quenched by slow addition of sat. aq. NaHCO3, transferred to a separatory funnel and the mixture is extracted with DCM. The organic phase was washed with sat. aq. NaCl, dried over Na2SO4, filtered, and concentrated under reduced pressure. The desired product is isolated after chromatography on silica gel.


Step 3: Synthesis of 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-7-ol

To a solution of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-hydroxy-1H-indole-1-carboxylate (1.0 equiv) in DCM at 0° C. is added TFA dropwise. The reaction is stirred at 0° C. and warmed to room temperature. Once the reaction is complete, as determined by LCMS, the reaction is concentrated under reduced pressure. The residue is triturated with MeCN, then dropped into MTBE over 10 min. The supernatant is removed and the precipitate is collected by filtration under N2 to give 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-7-ol.


Monomer E. 5-(4-amino-1-(piperidin-4-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate

To a solution of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3 g, 11.49 mmol, 1.0 equiv) in DMA (30 mL) was added tert-butyl 4-(bromomethyl)piperidine-1-carboxylate (3.36 g, 12.07 mmol, 1.05 equiv) and K2CO3 (4.77 g, 34.48 mmol, 3.0 equiv), then the reaction was stirred at 80° C. for 3 h. The reaction mixture was filtered to remove K2CO3 and the filtrate was poured into H2O (200 mL), a solid precipitated that was then filtered to give Cert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate (3 g, 6.55 mmol, 57% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C16H23IN6O2: 459.10; found 459.1.


Step 2: Synthesis of tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate

To a bi-phasic suspension of tert-butyl 4-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate (3 g, 6.55 mmol, 1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (2.04 g, 7.86 mmol, 1.2 equiv) and Na2CO3 (3.47 g, 32.73 mmol, 5.0 equiv) in DME (60 mL) and H2O (30 mL) was added Pd(PPh3)4 (756.43 mg, 654.60 μmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. Two batches were combined together. The reaction mixture was cooled and partitioned between EtOAc (500 mL) and H2O (500 mL). The aqueous layer was separated and extracted with EtOAc (3×300 mL). All the organic layers were combined, washed with brine (20 mL), dried over anhydrous Na2SO4, filtered, and the filtrate was concentrated under reduced pressure to give tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate (4.5 g, 74% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C23H28N8O3: 465.24; found 465.2.


Step 3: Synthesis of 5-(4-amino-1-(piperidin-4-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

A solution of tert-butyl 4-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)piperidine-1-carboxylate (2.5 g, 5.38 mmol, 1.0 equiv) in TFA (25 mL) was stirred at room temperature for 30 min. The reaction solution was concentrated under reduced pressure to remove TFA. The residue was added to MTBE (400 mL) and a solid precipitated, which was then filtered to give 5-(4-amino-1-(piperidin-4-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (2.7 g, over 100% yield, TFA) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C18H20N8O: 365.18; found 365.1.


Monomer F. 2-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl (4-(4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

To a solution of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 g, 2.31 mmol, 1.0 equiv) in dioxane (10.5 mL) and H2O (3.5 mL) was added (1-(tert-butoxycarbonyl)-5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)boronic acid (1.54 g, 2.78 mmol, 1.2 equiv), K3PO4 (1.47 g, 6.94 mmol, 3.0 equiv), Pd2(dba)3 (211.84 mg, 231.34 μmol, 0.1 equiv), and SPhos (189.95 mg, 462.69 μmol, 0.2 equiv) at room temperature under N2. The sealed tube was heated at 150° C. for 20 min in a microwave. This was repeated for 9 additional batches. The 10 batches were combined and the reaction mixture was cooled and partitioned between EtOAc (60 mL) and H2O (80 mL). The aqueous layer was separated and extracted with EtOAc (2×50 mL). The organic layers were combined, washed with brine (60 mL) and dried over anhydrous Na2SO4. The suspension was filtered and the filtrate was concentrated under reduced pressure. The crude material was purified by silica gel chromatography (1→75% EtOAc/petroleum ether). The desired fractions were combined and evaporated under reduced pressure to give tert-butyl (4-(4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (10 g, 60% yield) as a light yellow solid.


Step 2: Synthesis of tert-butyl (4-(4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

To a mixture of tert-butyl (4-(4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (10 g, 18.12 mmol, 1.0 equiv) in THF (100 mL) was added TBAF.3H2O (1 M, 54.37 mL, 3.0 equiv) in one portion at room temperature under N2. The mixture was stirred for 1 h and then H2O (100 mL) was added to the reaction mixture. The layers were separated and the aqueous phase was extracted with EtOAc (2×80 mL). The combined organic phase was washed with brine (100 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1→67% EtOAc/petroleum ether) to afford tert-butyl (4-(4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (7 g, 87% yield) as a light pink solid.


Step 3: Synthesis of 2-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1H-indol-5-ol

To TFA (50.0 mL, 675.26 mmol, 38.9 equiv) was added tert-butyl (4-(4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (7.6 g, 17.37 mmol, 1.0 equiv) at room temperature. The mixture was stirred for 40 min and was then concentrated under reduced pressure. The oily residue was triturated with MeCN (20 mL), then added dropwise into MTBE (300 mL) for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N2 to give 2-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1H-indol-5-ol (7.79 g, 91% yield, TFA) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C17H19N7O: 338.17; found 338.2.


Monomer G. 5-(4-amino-1-(azetidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)azetidine-1-carboxylate

To a solution of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (4 g, 15.32 mmol, 1.0 equiv), tert-butyl 3-(hydroxymethyl)azetidine-1-carboxylate (3.01 g, 16.09 mmol, 1.05 equiv) and PPh3 (6.03 g, 22.99 mmol, 1.5 equiv) in THF (80 mL) cooled to 0° C. was added DIAD (4.47 mL, 22.99 mmol, 1.5 equiv), dropwise. After the addition was complete, the reaction was stirred at room temperature for 14 h. The reaction was poured into H2O (200 mL) and then extracted with EtOAc (3×50 mL). The organic layers were combined and washed with brine (2×50 mL). The organic phase was dried over Na2SO4, filtered, the filtrate was concentrated under reduced pressure to give a residue. The residue was purified by silica gel chromatography (0→100% EtOAc/petroleum ether) to give tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl) azetidine-1-carboxylate (4.2 g, 64% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C14H19IN6O2: 431.07; found: 431.0.


Step 2: Synthesis of tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo [3,4-d]pyrimidin-1-yl)methyl)azetidine-1-carboxylate

To a bi-phasic suspension of tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)azetidine-1-carboxylate (4 g, 9.30 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (2.90 g, 11.16 mmol, 1.2 equiv) and Na2CO3 (4.93 g, 46.49 mmol, 5.0 equiv) in DME (100 mL) and H2O (50 mL) was added Pd(PPh3)4 (1.07 g, 929.71 μmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled to room temperature and filtered, and the filtrate was extracted by EtOAc (3×50 mL). The organic layers were combined and washed with brine (10 mL), dried over Na2SO4, filtered and the filtrate was concentrated under reduced pressure to give a residue. The residue was purified by silica gel chromatography (0→20% MeOH/EtOAc) to give tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)azetidine-1-carboxylate (3.5 g, 80% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C21H24N8O3: 437.20; found: 437.2.


Step 3: Synthesis of 5-(4-amino-1-(azetidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

To a solution of tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)azetidine-1-carboxylate (3.29 g, 6.87 mmol, 1.0 equiv) in DCM (20 mL) was added TFA (7.50 mL, 101.30 mmol, 14.7 equiv) at 0° C. The reaction was warmed to room temperature and stirred for 2 h. The reaction solution was concentrated under reduced pressure to give a residue. The residue was dissolved in MeCN (6 mL) and then poured into MTBE (80 mL). A solid precipitated, which was filtered and the solid cake was dried under reduced pressure to give 5-[4-amino-1-(azetidin-3-ylmethyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (4.34 g, over 100% yield, TFA) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C16H16N8O: 337.15; found: 337.1.


Monomer H. 5-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]-oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Monomer H was synthesized following the procedures outlined in Nature 2015, 534, 272-276, which is incorporated by reference in its entirety.


Monomer I. 5-(4-amino-1-(pyrrolidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)pyrrolidine-1-carboxylate

A suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (4.5 g, 17.24 mmol, 1.0 equiv), tert-butyl 3-(bromomethyl)pyrrolidine-1-carboxylate (4.78 g, 18.10 mmol, 1.05 equiv) and K2CO3 (7.15 g, 51.72 mmol, 3.0 equiv) in DMA (40 mL) was heated to 85° C. The reaction was stirred at 85° C. for 3 h, at which point the solution was cooled to room temperature. Then, H2O (80 mL) was added to the reaction, and a solid precipitated out. The mixture was filtered, and the solid cake was washed with H2O (2×40 mL), and then dried under reduced pressure to give tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)pyrrolidine-1-carboxylate (6 g, 78% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C15H21IN6O2: 445.08; found: 445.1.


Step 2: Synthesis of tert-butyl 3-[[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)pyrazolo[3,4-d] pyrimidin-1-yl]methyl]pyrrolidine-1-carboxylate

To a bi-phasic suspension of tert-butyl 3-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)pyrrolidine-1-carboxylate (4 g, 9.00 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (2.81 g, 10.80 mmol, 1.2 equiv) and Na2CO3 (4.77 g, 45.02 mmol, 5.0 equiv) in DME (120 mL) and H2O (60 mL) was added Pd(PPh3)4 (1.04 g, 900.35 μmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was cooled to room temperature and filtered and the filtrate was extracted with EtOAc (3×50 mL). The organic phases were combined and washed with brine (50 mL), dried over Na2SO4, filtered and concentrated under reduced pressure to give a residue. The residue was purified by silica gel chromatography (0→20% MeOH/EtOAc) to give tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)pyrrolidine-1-carboxylate (3 g, 64% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C22H26N8O3: 451.21, found: 451.2.


Step 3: Synthesis of 5-(4-amino-1-(pyrrolidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

To a solution of tert-butyl 3-((4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)pyrrolidine-1-carboxylate (3 g, 6.66 mmol, 1.0 equiv) in DCM (40 mL) was added TFA (20 mL) at 0° C., dropwise. The reaction mixture was warmed to room temperature and stirred for 2 h. The reaction solution was then concentrated under reduced pressure to give a residue. The residue was dissolved in MeCN (4 mL), then poured into MTBE (100 mL), and a solid precipitated out. The solid was filtered and the cake was dried under reduced pressure to give 5-(4-amino-1-(pyrrolidin-3-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (4.00 g, over 100% yield, TFA) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C17H18N8O: 351.17; found: 351.2.


Monomer J. 1-(4-aminobutyl)-3-(7-methoxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-aminetrifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-methoxy-1H-indole-1-carboxylate

To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) and (1-(tert-butoxycarbonyl)-7-methoxy-1H-indol-2-yl)boronic acid (3.0 equiv) in DME and H2O are added Pd(PPh3)4 (0.1 equiv) and sodium carbonate (6.0 equiv). The reaction is heated at 80° C. until completion of reaction, as determined by LCMS and TLC analysis. The reaction is then quenched with H2O and EtOAc. The mixture is transferred to a separatory funnel and the aqueous phase is extracted with EtOAc. The organic phase is washed with sat. aq. NaCl, dried over Na2SO4, filtered, and concentrated under reduced pressure. The desired product is isolated after chromatography on silica gel.


Step 2: Synthesis of 1-(4-aminobutyl)-3-(7-methoxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine

To a solution of tert-butyl 2-(4-amino-1-(4-((tert-butoxycarbonyl)amino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-7-hydroxy-1H-indole-1-carboxylate (1.0 equiv) in DCM at 0° C. is added TFA dropwise. The reaction is stirred at 0° C. and warmed to room temperature. Once the reaction is complete, as determined by LCMS, the reaction is concentrated under reduced pressure. The residue is triturated with MeCN, then dropped into MTBE over 10 min. The supernatant is removed and the precipitate is collected by filtration under N2 to give 1-(4-aminobutyl)-3-(7-methoxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine.


Monomer K 1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl (4-(4-amino-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (300 mg, 694 μmol, 1.0 equiv) in MeOH (14 mL) at 0° C. was added zinc dust (226 mg, 3.46 mmol, 5.0 equiv). Sat. aq. NH4Cl (14 mL) was added to the reaction mixture and the reaction was warmed to room temperature and stirred for 18 h. The reaction was quenched by EtOAc (40 mL) and H2O (10 mL) and the mixture was transferred to a separatory funnel. The aqueous phase was extracted with EtOAc (3×20 mL) and the combined organic phases were washed with sat. aq. NaHCO3 (15 mL), dried over Na2SO4, filtered, and concentrated under reduced pressure to provide the product (210 mg, 99% yield) as a light yellow solid that was used without further purification. LCMS (ESI) m/z: [M+H] calcd for C14H22N6O2: 307.19; found 307.1.


Step 2: Synthesis of 1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine

To a solution of tert-butyl (4-(4-amino-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (210 mg, 691 μmol) in DCM (3.5 mL) at 0° C. was added TFA (3.5 mL), dropwise. After 3 h, the reaction was warmed to room temperature and concentrated under reduced pressure to provide the trifluoroacetate salt of the product (220 mg, 99% yield) as a brown oil, which was used without further purification. LCMS (ESI) m/z: [M+H] calcd for C9H14N6: 207.13; found 207.1.


Monomer L. 1-[4-(piperazin-1-yl)-3-(trifluoromethyl)phenyl]-9-(quinolin-3-yl)-1H,2H-benzo[h]1,6-naphthyridin-2-one



embedded image


The preparation of this monomer has been previously reported in the literature. See the following references: i) Liu, Qingsong; Chang, Jae Won; Wang, Jinhua; Kang, Seong A.; Thoreen, Carson C.; Markhard, Andrew; Hur, Wooyoung; Zhang, Jianming; Sim, Taebo; Sabatini, David M.; et al From Journal of Medicinal Chemistry (2010), 53(19), 7146-7155. ii) Gray, Nathanael; Chang, Jae Won; Zhang, Jianming; Thoreen, Carson C.; Kang, Seong Woo Anthony; Sabatini, David M.; Liu, Qingsong From PCT Int. Appl. (2010), WO 2010044885A2, which are incorporated by reference in their entirety.


Monomer M. 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of 3-iodo-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine

A suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (10.5 g, 40.23 mmol, 1.0 equiv) in DMF (170.0 mL) was treated with Cs2CO3 (19.7 g, 60.34 mmol, 1.5 equiv) and [chloro(diphenyl)methyl]benzene (13.5 g, 48.27 mmol, 1.2 equiv) at room temperature. The reaction mixture was stirred at 70° C. for 4 h under a nitrogen atmosphere. The reaction mixture was added to H2O (1200 mL). The precipitate was filtered and washed with H2O. The residue was purified by silica gel chromatography (0→60% EtOAc/petroleum ether) to afford 3-iodo-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (15.40 g, 73.5% yield) as a white solid.


Step 2: Synthesis of 3-iodo-N,N-dimethyl-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine

To a suspension of NaH (2.98 g, 74.50 mmol, 60% purity, 2.5 equiv) in DMF (150 mL) was added the solution of 3-iodo-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (15.0 g, 29.80 mmol, 1.0 equiv) in DMF (50 mL) at 0° C. The mixture was stirred at 0° C. for 10 min. To the reaction mixture was then added iodomethane (16.92 g, 119.20 mmol, 7.42 mL, 4.0 equiv) at 0° C. The mixture was stirred at room temperature for 2 h, at which point H2O (1400 mL) was added at 0° C. The mixture was stirred for an additional 10 min at 0° C. The resulting precipitate was collected by filtration to give crude product, which was purified by silica gel chromatography (1%→25% EtOAc/petroleum ether) twice to afford 3-iodo-N,N-dimethyl-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (9.0 g, 89.0% yield) as a white solid.


Step 3: Synthesis of 3-iodo-N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine

To a cooled solution of TFA (19.1 mL, 258.1 mmol, 15.0 equiv) in DCM (100.0 mL) was added 3-iodo-N,N-dimethyl-1-trityl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (9.10 g, 17.12 mmol, 1.0 equiv) at 4° C. The mixture was stirred at room temperature for 1 h. The residue was poured into H2O (100 mL) and the aqueous phase was extracted with DCM (2×50 mL). To the aqueous phase was then added a saturated aqueous solution of NaHCO3 until the solution was pH 8. The resulting precipitate was collected by filtration to give 3-iodo-N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (3.40 g, 68.7% yield) as a white solid.


Step 4: Synthesis of tert-butyl (4-(4-(dimethylamino)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

To a suspension of 3-iodo-N,N-dimethyl-1H-pyrazolo[3,4-d]pyrimidin-4-amine (1.7 g, 5.88 mmol, 1.0 equiv) in DMF (20 mL) was added Na (247 mg, 6.17 mmol, 60% purity, 1.05 equiv) at 4° C. The mixture was stirred at 4° C. for 30 min. To the reaction mixture was then added tert-butyl N-(4-bromobutyl)carbamate (2.22 g, 8.82 mmol, 1.81 mL, 1.5 equiv) in DMF (10 mL) at 4° C. The mixture was stirred at room temperature for 2 h. To the mixture was then added H2O (100 mL) at 4° C. The mixture was stirred for an additional 30 min at 4° C. and the resulting precipitate was collected by filtration to give crude product. The residue was purified by silica gel chromatography (0→75% EtOAc/petroleum ether) to afford tert-butyl(4-(4-(dimethylamino)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (2.0 g, 56% yield) as a white solid.


Step 5: Synthesis of tert-butyl (4-(3-(2-aminobenzo[d]oxazol-5-yl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

To a bi-phasic suspension of tert-butyl (4-(4-(dimethylamino)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (4.0 g, 8.69 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (3.4 g, 13.03 mmol, 1.5 equiv), and Na2CO3 (4.6 g, 43.45 mmol, 5.0 equiv) in DME (80.0 mL) and H2O (40.0 mL) was added Pd(PPh3)4 (1.0 g, 868.98 μmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled and partitioned between EtOAc (300 mL) and H2O (600 mL). The aqueous layer was separated and extracted with EtOAc (2×100 mL). The organic layers were combined, washed with brine (2×60 mL) and dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The crude material was purified by silica gel column chromatography (50% EtOAc/hexanes followed by 20% MeOH/EtOAc). The desired fractions were combined and concentrated under reduced pressure to give tert-butyl (4-(3-(2-aminobenzo[d]oxazol-5-yl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyramidin-1-yl)butyl)carbamate (3.2 g, 78.9% yield) as a light brown solid.


Step 6: Synthesis of 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine

To TFA (20.82 mL, 281.27 mmol, 36.5 equiv) was added tert-butyl (4-(3-(2-aminobenzo[d]oxazol-5-yl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (3.6 g, 7.72 mmol, 1.0 equiv) at room temperature. The mixture was stirred for 30 min, at which point the mixture was concentrated under reduced pressure. The oily residue was triturated with MeCN (8 mL) and MTBE (60 mL) for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N2 to give 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (4.0 g, crude, TFA) as a light brown solid.


To 1M NaOH (107.2 mL, 14.7 equiv) was added 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (3.5 g, crude, TFA) at room temperature. The mixture was stirred for 10 min and then the aqueous phase was extracted with DCM (3×50 mL). The combined organic phase was washed with brine (50 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure. TFA (539.37 μL, 7.28 mmol, 1.0 equiv) was added and concentrated under reduced pressure. MeCN (10 mL) was then added, followed by MTBE (150 mL). The resulting precipitate was collected by filtration to give 5-(1-(4-aminobutyl)-4-(dimethylamino)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine (1.3 g, 36.6% yield, TFA) as a light brown product. LCMS (ESI) m/z: [M+H] calcd for C18H22N8O: 367.19; found 367.1.


Monomer N. 6-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo-[d]isoxazol-3-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl (6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]isoxazol-3-yl)carbamate

To a solution of tert-butyl (6-bromobenzo[d]isoxazol-3-yl)carbamate (1.0 equiv) in dioxane are added Pd(PPh3)4 (0.1 equiv), sodium carbonate (6.0 equiv), and bis(pinacolato)diboron (3.0 equiv). The reaction mixture is stirred and heated until completion of reaction, as determined by LCMS and TLC analysis. The reaction is cooled to room temperature, quenched with sat. aq. NaHCO3, and the mixture transferred to a separatory funnel. The aqueous phase is extracted with EtOAc and the organic phase is washed with sat. aq. NaCl, dried over Na2SO4, filtered, and concentrated under reduced pressure. The desired product was isolated after purification by silica gel chromatography.


Step 2: Synthesis of tert-butyl (4-(4-amino-3-(3-((tert-butoxycarbonyl)amino)benzo[d]isoxazol-6-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) and tert-butyl (6-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]isoxazol-3-yl)carbamate (3.0 equiv) in DME and H2O are added Pd(PPh3)4 (0.1 equiv) and sodium carbonate (6.0 equiv). The reaction is heated at 80° C. until completion of reaction, as determined by LCMS and TLC analysis. The reaction is then quenched with H2O and EtOAc. The mixture is transferred to a separatory funnel and the aqueous phase is extracted with EtOAc. The organic phase is washed with sat. aq. NaCl, dried over Na2SO4, filtered, and concentrated under reduced pressure. The desired product is isolated after chromatography on silica gel.


Step 3: Synthesis of 6-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo-[d]isoxazol-3-amine

To a solution of tert-butyl (4-(4-amino-3-(3-((tert-butoxycarbonyl)amino)benzo[d]isoxazol-6-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (1.0 equiv) in DCM at 0° C. is added TFA, dropwise. The reaction is stirred at 0° C. and warmed to room temperature. Once the reaction is complete, as determined by LCMS, the reaction is concentrated under reduced pressure. The residue is triturated with MeCN, then added dropwise into MTBE over 10 min. The supernatant is removed and the precipitate is collected by filtration under N2 to give 6-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo-[d]isoxazol-3-amine.


Monomer O. 4-(5-(4-morpholino-1-(1-(pyridin-3-ylmethyl)piperidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)-1H-indol-1-yl)butan-1-amine trifluoroacetic Acid Salt



embedded image


The synthesis of this monomer proceeds by alkylation of WAY-600 (CAS #1062159-35-6) with tert-butyl (4-bromobutyl)carbamate under basic conditions, followed by Boc-deprotection using TFA to produce the TFA salt.


Reference for preparation of WAY-600: Discovery of Potent and Selective Inhibitors of the Mammalian Target of Rapamycin (mTOR) Kinase: Nowak, P.; Cole, D. C.; Brooijmans, N.; Bursavich, M. G.; Curran, K. J.; Ellingboe, J. W.; Gibbons, J. J.; Hollander, I.; Hu, Y.; Kaplan, J.; Malwitz, D. J.; Toral-Barza, L.; Verheijen, J. C.; Zask, A.; Zhang, Yu, K. 2009; Journal of Medicinal Chemistry Volume 52, Issue 22, 7081-89, which is incorporated by reference in its entirety.


Monomer P. 2-(4-(8-(6-(aminomethyl)quinolin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-c]quinolin-1-yl)phenyl)-2-methylpropanenitrile trifluoroacetic Acid Salt



embedded image


embedded image


The synthesis of this monomer proceeds first by synthesis of the Suzuki reaction coupling partner (3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolane)quinolin-6-yl)-N-boc-methanamine starting from methyl 3-bromoquinoline-6-carboxylate. Reduction of the methyl ester with lithium aluminum hydride followed by Mitsunobu reaction with phthalimide and hydrazine cleavage provides the benzylic amine. Protection of the benzylic amine with di-tert-butyl dicarbonate followed by a Miyaura borylation reaction provides (3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolane)quinolin-6-yl)-N-boc-methanamine.


An SNAr reaction of 2-(4-aminophenyl)-2-methylpropanenitrile with 6-bromo-4-chloro-3-nitroquinoline provides the substituted amino-nitro-pyridine. Reduction of the nitro group with Raney-Ni under a hydrogen atmosphere followed by cyclization with trichloromethyl chloroformate provides the aryl-substituted urea. Substitution of the free N—H of the urea with methyl iodide mediated by tetrabutylammonium bromide and sodium hydroxide followed by Suzuki coupling of (3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolane)quinolin-6-yl)-N-boc-methanamine and then Boc-deprotection using TFA produces the TFA salt.


Reference for preparation of 2-[4-(8-bromo-3-methyl-2-oxo-2,3-dihydro-imidazo [4,5-c]quinolin-1-yl)-phenyl]-2-methyl-propionitrile: Vannucchi, A. M.; Bogani, C.; Bartalucci, N. 2016. JAK PI3K/mTOR combination therapy. U.S. Pat. No. 9,358,229. Novartis Pharma AG, Incyte Corporation, which is incorporated by reference in its entirety.


Monomer Q. 8-(6-methoxypyridin-3-yl)-3-methyl-1-[4-(piperazin-1-yl)-3-(trifluoromethyl)phenyl]-1H,2H,3H-imidazo[4,5-c]quinolin-2-one



embedded image


This monomer is a commercially available chemical known as BGT226(CAS #1245537-68-1). At the time this application was prepared, it was available for purchase from several vendors as the free amine.


Monomer R. 3-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-N-(4,5-dihydrothiazol-2-yl)benzamide trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of Cert-butyl (4-(4-amino-3-(3-((4,5-dihydrothiazol-2-yl)carbamoyl)phenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate

To a solution of (3-((4,5-dihydrothiazol-2-yl)carbamoyl)phenyl)boronic acid (500 mg, 1.15 mmol, 1.0 equiv) and tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (575 mg, 2.30 mmol, 2.0 equiv) in dioxane (19.1 mL), EtOH (3.8 mL), and H2O (2.3 mL) was added Pd(PPh3)4 (265 mg, 230 μmol, 0.2 equiv) and sodium carbonate (730 mg, 6.89 mmol, 6.0 equiv). The reaction mixture was sonicated until formation of a clear, yellow solution, which was subsequently heated at 80° C. for 14 h. The reaction was then diluted with sat. aq. NaCl (30 mL) and the mixture transferred to a separatory funnel. The aqueous phase was extracted with DCM (3×25 mL). The combined organic phases were dried over Na2SO4, filtered, and concentrated under reduced pressure: The desired product was isolated as a yellow solid (324 mg, 53% yield) after silica gel chromatography (0→15% MeOH/DCM). LCMS (ESI) m/z: [M+H] calcd for C24H30N8O3S: 511.22; found 511.2.


Step 2: Synthesis of 3-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-N-(4,5-dihydrothiazol-2-yl)benzamide

To a solution of tert-butyl (4-(4-amino-3-(3-((4,5-dihydrothiazol-2-yl)carbamoyl)phenyl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (324 mg, 614 μmol) in DCM (4.1 mL) at 0° C. was added TFA (1.5 mL), dropwise. After 1 h, the reaction was warmed to room temperature and concentrated under reduced pressure to provide the trifluoroacetate salt of the product as a yellow solid (320 mg, 99% yield). Used without further purification. LCMS (ESI) m/z: [M+H] calcd for C19H22N8OS: 411.16; found 411.1.


Monomer S. 2-(5-(4-morpholino-1-(1-(pyridin-3-ylmethyl)piperidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-6-yl)-1H-indol-3-yl)ethan-1-amine



embedded image


The synthesis of this monomer proceeds by condensation of 2,4,6-trichloropyrimidine-5-carbaldehyde with 3-((4-hydrazineylpiperidin-1-yl)methyl)pyridine hydrochloride. Reaction of the product with morpholine followed by a Suzuki reaction with boronic ester gives the Boc-protected amine. Final deprotection with TFA gives the monomer. This synthesis route follows closely to the reported preparation of highly related structures in the following references: i) Nowak, Pawel; Cole, Derek C.; Brooijmans, Natasja; Curran, Kevin J.; Ellingboe, John W.; Gibbons, James J.; Hollander, Irwin; Hu, Yong Bo; Kaplan, Joshua; Malwitz, David J.; et al From Journal of Medicinal Chemistry (2009), 52(22), 7081-7089. ii) Zask, Arie; Nowak, Pawel Wojciech; Verheijen, Jeroen; Curran, Kevin J.; Kaplan, Joshua; Malwitz, David; Bursavich, Matthew Gregory; Cole, Derek Cecil; Ayral-Kaloustian, Semiramis; Yu, Ker; et al From PCT Int. Appl. (2008), WO 2008115974 A2 20080925, which are incorporated by reference in their entirety.


Monomer T. 1-(4-aminobutyl)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine trifluoroacetic Acid Salt



embedded image


To a mixture of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)carbamate (496 mg, 1.14 mmol, 1.0 equiv) in DCM (5.7 mL) at 0° C. was added TFA (1.5 mL) dropwise. The reaction was allowed to stir at 0° C. for 1 h, at which time the reaction was concentrated under reduced pressure to provide a yellow solid (505 mg, 99% yield) which was taken on without further purification. LCMS (ESI) m/z: [M+H] calcd for C9H13IN6: 333.02; found 332.9.


Monomer U. 5-(4-amino-1-(4-(methylamino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl (4-hydroxybutyl)(methyl)carbamate

To a solution of 4-(methylamino)butan-1-ol (0.5 g, 4.85 mmol, 104.2 mL, 1.0 equiv) in DCM (10 mL) at room temperature was added Boc2O (1.06 g, 4.85 mmol, 1.11 mL, 1.0 equiv). The mixture was stirred for 3 h at room temperature and then the mixture was concentrated under reduced pressure at 30° C. The residue was purified by silica gel chromatography (100/1 to 3/1 petroleum ether/EtOAc) to afford Cert-butyl (4-hydroxybutyl)(methyl)carbamate (0.9 g, 91.4% yield) as a colorless oil.


Step 2: Synthesis of tert-butyl (4-bromobutyl)(methyl)carbamate

To a solution of tert-butyl (4-hydroxybutyl)(methyl)carbamate (0.9 g, 4.43 mmol, 1.0 equiv) in THF (20 mL) at room temperature was added PPh3 (2.21 g, 8.41 mmol, 1.9 equiv) and CBr4 (2.79 g, 8.41 mmol, 1.9 equiv). The mixture was stirred for 1 h and then the reaction mixture was filtered and concentrated. The residue was purified by silica gel chromatography (1/0 to 4/1 petroleum ether/EtOAc) to afford tert-butyl (4-bromobutyl)(methyl) carbamate (1.1 g, 93.3% yield) as a colorless oil.


Step 3: Synthesis of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) butyl) (methyl)carbamate

To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (0.9 g, 3.45 mmol, 1.0 equiv) in DMF (10 mL) at 4° C. was added NaH (137.92 mg, 3.45 mmol, 60% purity, 1.0 equiv). The mixture was stirred at 4° C. for 30 min and then a solution of tert-butyl (4-bromobutyl)(methyl)carbamate (1.01 g, 3.79 mmol, 25.92 mL, 1.1 equiv) in DMF (3 mL) was added. The mixture was stirred at room temperature for 3 h, at which point H2O (100 mL) was added. The aqueous phase was extracted with EtOAc (3×30 mL) and the combined organic phases were washed with brine (20 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to afford tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl) (methyl) carbamate (1.2 g, 78% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C15H23IN6O2: 447.10; found 447.1.


Step 4: Synthesis of tert-butyl (4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d] pyrimidin-1-yl)butyl)(methyl)carbamate

To a bi-phasic suspension of tert-butyl (4-(4-amino-3-iodo-1H-pyrazolo[3,4-d] pyrimidin-1-yl)butyl)(methyl)carbamate (1.2 g, 2.69 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (1.19 g, 3.23 mmol, 1.2 equiv), and Na2CO3 (1.42 g, 13.44 mmol, 5.0 equiv) in DME (20 mL) and H2O (10 mL) at room temperature was added Pd(PPh3)4 (310.71 mg, 268.89 μmol, 0.1 equiv) under N2. The mixture was stirred at 110° C. for 3 h and then the reaction mixture was cooled and partitioned between EtOAc (20 mL) and H2O (15 mL). The aqueous layer was separated and extracted with EtOAc (3×20 mL). The combined organic layers were washed with brine (2×20 mL), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure. The crude product was purified by silica gel chromatography (1/0 to 4/1 EtOAc/MeOH) to give tert-butyl (4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)(methyl) carbamate (0.78 g, 62.5% yield) as an orange solid


Step 5: Synthesis of 5-(4-amino-1-(4-(methylamino)butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl) benzo[d]oxazol-2-amine

A solution of tert-butyl(4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)(methyl)carbamate (0.78 g, 1.72 mmol, 1.0 equiv) in TFA (5 mL) at room temperature was stirred for 30 min. The solution was concentrated under reduced pressure and the oily residue was triturated with MeCN (1 mL) and then added to MTBE (100 mL). The supernatant was removed and then the precipitate was collected by filtration under N2 to give 5-(4-amino-1-(4-(methylamino) butyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine bis-trifluorosulfonate (0.959 g, 93% yield) as an orange solid. LCMS (ESI) m/z: [M+H] calcd for C17H20N8O: 353.18; found 353.1.


Monomer V. 1-(4-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl)-3-(trifluoromethyl)phenyl)-8-(6-methoxypyridin-3-yl)-3-methyl-1,3-dihydro-2H-imidazo[4,5-c]quinolin-2-one



embedded image


Step 1: Synthesis of tert-butyl N-tert-butoxycarbonyl-N-[(2-chloropyrimidin-5-yl)methyl]carbamate

To a solution of tert-butyl N-tert-butoxycarbonylcarbamate (7.33 g, 33.74 mmol, 1.0 equiv) in DMF (80 mL) was added NaH (1.62 g, 40.49 mmol, 60% purity, 1.2 equiv) at 0° C. The mixture was stirred at 0° C. for 30 min and then 5-(bromomethyl)-2-chloro-pyrimidine (7 g, 33.74 mmol, 1 equiv) was added. The reaction mixture was stirred at room temperature for 1.5 h and then the mixture was poured into sat. NH4Cl (300 mL) and stirred for 5 min. The aqueous phase was extracted with EtOAc (3×80 mL) and the combined organic phases were washed with brine (50 mL), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (20:1 to 1:1 petroleum ether/EtOAc) to afford tert-butyl N-tert-butoxycarbonyl-N-[(2-chloro pyrimidin-5-yl)methyl]carbamate (7.0 g, 60.3% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C15H22ClN3O4: 344.14; found 344.2.


Step 2: Synthesis of tert-butyl N-tert-butoxycarbonyl-N-[[2-[4-[4-[8-(6-methoxy-3-pyridyl)-3-methyl-2-oxo-imidazo[4,5-c]quinolin-1-yl]-2-(trifluoromethyl)phenyl]piperazin-1-yl]pyrimidin-5-yl]methyl]carbamate

To a solution of 8-(6-methoxy-3-pyridyl)-3-methyl-1-[4-piperazin-1-yl-3-(trifluoromethyl)phenyl]imidazo[4,5-c]quinolin-2-one (0.4 g, 748.32 μmol, 1.0 equiv) in MeCN (7 mL) was added tert-butyl N-tert-butoxycarbonyl-N-[(2-chloropyrimidin-5-yl)methyl]carbamate (514.55 mg, 1.50 mmol, 2.0 equiv) and K2CO3 (413.69 mg, 2.99 mmol, 4 equiv) at room temperature. The reaction mixture was stirred at 80° C. for 14 h and then the mixture was cooled to room temperature, filtered and concentrated to dryness. The residue was purified by washing with MTBE (5 mL) to give tert-butyl N-tert-butoxycarbonyl-N-[[2-[4-[4-[8-(6-methoxy-3-pyridyl)-3-methyl-2-oxo-imidazo[4,5-c]quinolin-1-yl]-2-(trifluoromethyl)phenyl]Piperazin-1-yl]pyrimidin-5-yl]methyl]carbamate (0.57 g, 90.5% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C43H46F3N9O6: 842.36; found 842.7.


Step 3: Synthesis of 1-[4-[4-[5-(aminomethyl)pyrimidin-2-yl]piperazin-1-yl]-3-(trifluoromethyl) phenyl]-8-(6-methoxy-3-pyridyl)-3-methyl-imidazo[4,5-c]quinolin-2-one

A solution of tert-butyl N-tert-butoxycarbonyl-N-[[2-[4-[4-[8-(6-methoxy-3-pyridyl)-3-methyl-2-oxo-imidazo[4,5-c]quinolin-1-yl]-2-(trifluoromethyl)phenyl]piperazin-1-yl]pyrimidin-5-yl]methyl]carbamate (0.95 g, 1.13 mmol, 1 equiv) in TFA (10 mL) was stirred at room temperature for 1 h, at which point the solvent was concentrated. The residue was dissolved in MeCN (10 mL) and then the solution was added to MTBE (150 mL), dropwise. The precipitate was collected to give 1-[4-[4-[5-(aminomethyl)pyrimidin-2-yl]piperazin-1-yl]-3-(trifluoromethyl)phenyl]-8-(6-methoxy-3-pyridyl)-3-methyl-imidazo[4,5-c]quinolin-2-one trifluoromethanesulfonate (0.778 g, 84.8% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C33H30F3N9O2: 642.26; found 642.4.


Monomer W. 1-(4-aminobutyl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)pyrazolo[3,4-d]pyrimidin-4-amine



embedded image


Step 1: Synthesis of tert-butyl N-[4-[4-amino-3-(1H-indol-5-yl)pyrazolo[3,4-d]pyrimidin-1-yl]butyl]carbamate

To a bi-phasic suspension of tert-butyl N-[4-(4-amino-3-iodo-pyrazolo[3,4-d]pyrimidin-1-yl)butyl]carbamate (8 g, 18.51 mmol, 1 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrrolo[2,3-b]pyridine (5.42 g, 22.21 mmol, 1.2 equiv) and Na2CO3 (9.81 g, 92.54 mmol, 5 equiv) in diglyme (160 mL) and H2O (80 mL) was added Pd(PPh3)4 (2.14 g, 1.85 mmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was cooled to room temperature, filtered and the filtrate was partitioned between EtOAc (500 mL) and H2O (500 mL). The aqueous layer was separated and extracted with EtOAc (3×300 mL). The organic layers were combined, washed with brine (20 mL) and dried over anhydrous Na2SO4, then filtered and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc then 4/1 EtOAc/MeOH) to give tert-butyl N-[4-[4-amino-3-(1H-indol-5-yl)pyrazolo[3,4-d]pyrimidin-1-yl]butyl]carbamate (6.6 g, 84.6% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C22H27N7O2: 422.22; found 423.3.


Step 2: Synthesis of 1-(4-aminobutyl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)pyrazolo[3,4-d]pyrimidin-4-amine

To tert-butyl N-[4-[4-amino-3-(1H-indol-5-yl)pyrazolo[3,4-d]pyrimidin-1-yl]butyl]carbamate (6.6 g, 15.66 mmol, 1 equiv) was added TFA (66 mL), which was then stirred at room temperature for 30 min. The reaction solution was concentrated under reduced pressure to remove TFA and then MTBE (400 mL) was added to the residue. The suspension was stirred for 15 min, at which point the yellow solid was filtered, and the solid cake dried under reduced pressure to give 1-(4-aminobutyl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)pyrazolo[3,4-d]pyrimidin-4-amine (10.2 g, 97.1% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C16H18N8: 323.17; found 323.1.


Monomer X. 2-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol 2,2,2-trifluoroacetate



embedded image


Step 1: Synthesis of tert-butyl 6-((4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

To a solution of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (1 g, 1.97 mmol, 1.0 equiv) in dioxane (10.5 mL) and H2O (3.5 mL) was added (1-(tert-butoxycarbonyl)-5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)boronic acid (1.16 g, 2.96 mmol, 1.5 equiv), K3PO4 (1.26 g, 5.92 mmol, 3.0 equiv), Pd2(dba)3 (180.85 mg, 197.50 μmol, 0.1 equiv), and SPhos (162.16 mg, 394.99 μmol, 0.2 equiv) at room temperature under N2. The sealed tube was heated at 150° C. for 20 min under microwave. The reaction mixture was then cooled and 6 separate batches were combined together. The reaction mixture was partitioned between EtOAc (100 mL) and H2O (100 mL). The aqueous layer was separated and extracted with EtOAc (3×80 mL). The organic layers were combined, washed with brine (100 mL) and dried over anhydrous Na2SO4. The solution was filtered and the filtrate was concentrated under reduced pressure. The crude material was purified by silica gel column chromatography (100/1 to 1/4 petroleum ether/EtOAc) to give tert-butyl 6-((4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (6.17 g, 82.9% yield) as a light yellow solid.


Step 2: Synthesis of tert-butyl 6-((4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

To a mixture of tert-butyl 6-((4-amino-3-(5-((tert-butyldimethylsilyl)oxy)-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (6.17 g, 9.86 mmol, 1.0 equiv) in THF (100 mL) was added tetrabutylammonium fluoride trihydrate (1 M, 10.84 mL, 1.1 equiv) in one portion at 0° C. under N2. The mixture was stirred at 0° C. for 1 h and was then added to H2O (100 mL). The aqueous phase was extracted with EtOAc (3×80 mL) and the combined organic phase was washed with brine (2×80 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/1 to 0/1 petroleum ether/EtOAc) to afford tert-butyl 6-((4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (4 g, 79.3% yield) as a light pink solid. LCMS (ESI) m/z: [M+H] calcd for C28H29N7O3: 512.24; found 512.3.


Step 3: Synthesis of 2-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol 2,2,2-trifluoroacetate

To a solution of tert-butyl 6-((4-amino-3-(5-hydroxy-1H-indol-2-yl)-1H-pyrazolo [3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (4.5 g, 8.80 mmol, 1.0 equiv) in MeOH (50 mL) was added HCl in MeOH (4 M, 50 mL, 22.7 equiv) at room temperature. The mixture was stirred at room temperature overnight and was then concentrated under reduced pressure. To the crude product was added EtOAc (100 mL) and the resulting precipitate was collected by filtration under N2 to give 2-(4-amino-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)-1H-indol-5-ol 2,2,2-trifluoroacetate (4.1 g, 85.0% yield, 3HCl) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C23H21N7O: 412.19; found 412.1.


Monomer Y. 3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine 2,2,2-trifluoroacetate



embedded image


Step 1: Synthesis of tert-butyl 6-(bromomethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

A solution of NBS (34.07 g, 191.39 mmol, 4 equiv) in THF (200 mL) was added in portions to a solution of tert-butyl 6-(hydroxymethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (12.6 g, 47.85 mmol, 1.0 equiv) and triphenylphosphine (37.65 g, 143.55 mmol, 3.0 equiv) in THF (200 mL) at 0° C. After the addition was complete, the mixture was stirred for 1 h at room temperature. EtOAc (150 mL) was added and the mixture was washed with H2O (200 mL) and brine (150 mL), dried over anhydrous Na2SO4 and concentrated under reduced pressure. The residue was purified by silica gel chromatography (100/1 to 10/1 petroleum ether/EtOAc) to afford tert-butyl 6-(bromomethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (8.56 g, 54.8% yield) as a light yellow solid.


Step 2: Synthesis of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl) methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (9.5 g, 36.40 mmol, 1.0 equiv) in DMF (110 mL) was added NaH (1.46 g, 36.40 mmol, 60% purity, 1.0 equiv) at 0° C. The mixture was stirred at 0° C. for 30 min at which point a solution of tert-butyl 6-(bromomethyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (12.47 g, 38.22 mmol, 1.05 equiv) in DMF (40 mL) was added at 0° C. The mixture was stirred at room temperature for 1 h and then H2O (1000 mL) was added at 0° C. The mixture stirred at 0° C. for 30 min and then the resulting precipitate was collected by filtration to give tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (17.8 g, 76.3% yield) as a light yellow solid, which was used the next step directly. LCMS (ESI) m/z: [M+H] calcd for C20H23IN6O2: 507.10; found 507.1.


Step 3: Synthesis of tert-butyl 6-((4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate

To a bi-phasic suspension of tert-butyl 6-((4-amino-3-iodo-1H-pyrazolo[3,4-d] pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (6.5 g, 10.14 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrrolo[2,3-b]pyridine (2.97 g, 12.16 mmol, 1.2 equiv), and Na2CO3 (5.37 g, 50.68 mmol, 5.0 equiv) in diglyme (100 mL) and H2O (50 mL) was added Pd(PPh3)4 (1.17 g, 1.01 mmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled and partitioned between EtOAc (100 mL) and H2O (100 mL). The aqueous layer was separated and extracted with EtOAc (2×100 mL). The combined organic phase was washed with brine (100 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (0/1 to 1/4 MeOH/EtOAc) to afford tert-butyl 6-((4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyramid in-1-yl) methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (3.77 g, 72.1% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C27H28N8O2: 497.24; found 497.3.


Step 4: Synthesis of 3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1-((1,2,3,4-tetrahydroiso quinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine 2,2,2-trifluoroacetate

tert-Butyl 6-((4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d] pyrimidin-1-yl)methyl)-3,4-dihydroisoquinoline-2(1H)-carboxylate (3.77 g, 7.59 mmol, 1.0 equiv) was added to TFA (85.36 mL, 1.15 mol, 151.8 equiv) at room temperature. The reaction mixture was stirred for 1 h. It was then concentrated under reduced pressure and the oily residue was triturated with MeCN (3 mL), then dropped into MTBE (200 mL) for 5 min. The supernatant was removed and then the precipitate was collected by filtration under N2 to give the product, which was dissolved in MeCN (20 mL), and finally concentrated under reduced pressure to give 3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1-((1,2,3,4-tetrahydroisoquinolin-6-yl)methyl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine 2,2,2-trifluoroacetate (4.84 g, 85.0% yield, 3TFA) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C22H20N8: 397.19; found 397.2.


Monomer Z. (4-((2-aminoethyl)sulfonyl)-3-fluoro-2-methylphenyl)(7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4]oxazepin-4(5H)-yl)methanone 2,2,2-trifluoroacetate



embedded image


embedded image


Step 1: Synthesis of methyl 3,4-difluoro-2-methylbenzoate

To a solution of 3,4-difluoro-2-methylbenzoic acid (2 g, 11.62 mmol, 1.0 equiv) in DMF (20 mL) was added K2CO3 (4.82 g, 34.86 mmol, 3.0 equiv) and iodomethane (3.26 mL, 52.29 mmol, 4.5 equiv) at room temperature. The mixture was stirred at room temperature for 3 h. The solution of methyl 3,4-difluoro-2-methylbenzoate in DMF (20 mL) was used directly in the next step.


Step 2: Synthesis of methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)thio)-3-fluoro-2-methylbenzoate

To a solution of methyl 3,4-difluoro-2-methylbenzoate (2.16 g, 11.28 mmol, 1.0 equiv) in DMF (20 mL) was added tert-butyl (2-mercaptoethyl)carbamate (2.0 g, 11.28 mmol, 1 equiv) and K2CO3 (3.12 g, 22.56 mmol, 2.0 equiv) at room temperature. The reaction was stirred at 110° C. for 12 h, at which point the mixture was added to H2O (50 mL). The aqueous solution was then extracted with EtOAc (3×30 mL) and the organic phase was combined and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 3/1 petroleum ether/EtOAc) to afford methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)thio)-3-fluoro-2-methylbenzoate (3.0 g, 76.0% yield) as light yellow solid.


Step 3: Synthesis of methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoate

To a solution of methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)thio)-3-fluoro-2-methylbenzoate (3.3 g, 9:61 mmol, 1.0 equiv), NaOH (2 M, 4.80 mL, 1.0 equiv), and NaHCO3(2.42 g, 28.83 mmol, 3.0 equiv) in acetone (30 mL) was added potassium peroxymonosulfate (12.35 g, 20.08 mmol, 2.1 equiv). The mixture was stirred for 12 h at room temperature and then the mixture was acidified to pH 5 by addition of 1N HCl. The aqueous layer was extracted with EtOAc (3×30 mL) and the combined organic phase was washed with brine (20 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 3/1 petroleum ether/EtOAc) to afford methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoate (2.1 g, 58.2% yield) as a yellow solid. LCMS (ESI) m/z: [M-56+H] calcd for C16H22FNO6S: 320.12; found 320.1.


Step 4: Synthesis of 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoic Acid

To a solution of methyl 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoate (2.1 g, 5.59 mmol, 1.0 equiv) in THF (20 mL), MeOH (10 mL) and H2O (10 mL) was added LiOH.H2O (704.16 mg, 16.78 mmol, 3.0 equiv) at room temperature. The reaction mixture was stirred at 40° C. for 4 h. The mixture was then concentrated under reduced pressure to remove THF and MeOH. The aqueous phase was neutralized with 0.5N HCl and was then extracted with EtOAc (5×20 mL). The combined organic phase was washed with brine (2×20 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure to give 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoic acid (2.01 g, 97.1% yield) as a white solid. LCMS (ESI) m/z: [M-100+H] calcd for C15H20FNO6S: 262.11; found 262.1.


Step 5: Synthesis of (4-(tert-butoxycarbonyl)-2,3,4,5-tetrahydrobenzo[f][1,4] oxazepin-7-yl)boronic Acid

To a solution of tert-butyl 7-bromo-2,3-dihydrobenzo[f][1,4]oxazepine-4(5H)-carboxylate (4 g, 12.19 mmol, 1.0 equiv) in THF (80 mL) at −60° C. was added B(OiPr)3 (4.58 g, 24.38 mmol, 5.60 mL, 2.0 equiv) followed by dropwise addition of n-BuLi (2.5 M, 12.19 mL, 2.5 equiv) in n-hexane. The reaction was stirred at −65° C. for 1 h. The reaction mixture was quenched with 1N HCl (12.25 mL) and allowed to warm to room temperature. The reaction mixture was extracted with EtOAc (3×30 mL), dried over anhydrous Na2SO4, filtered and concentrated under reduced pressure to give (4-(tert-butoxycarbonyl)-2,3,4,5-tetrahydrobenzo[f][1,4]oxazepin-7-yl)boronic acid (3.5 g, crude) as light yellow oil, which was used to the next step directly. LCMS (ESI) m/z: [M-100+H] calcd for C14H20BNO5: 194.15; found 194.2.


Step 6: Synthesis of tert-butyl 7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4] oxazepine-4(5H)-carboxylate

To a solution of (4-(tert-butoxycarbonyl)-2,3,4,5-tetrahydrobenzo[f][1,4]oxazepin-7-yl)boronic acid (4.2 g, 14.33 mmol, 1.0 equiv) in H2O (20 mL) and dioxane (60 mL) was added 5-bromopyridin-2-amine (2.48 g, 14.33 mmol, 1.0 equiv), Pd(dppf)Cl2.DCM (1.17. g, 1.43 mmol, 0.1 equiv) and TEA (4.35 g, 42.99 mmol, 5.98 mL, 3.0 equiv) at room temperature. The mixture was stirred at 85° C. for 12 h. The mixture was then cooled to room temperature and the residue was poured into H2O (15 mL). The aqueous phase was extracted with EtOAc (3×40 mL) and the combined organic phase was washed with brine (2×40 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 1/8 petroleum ether/EtOAc) to afford tert-butyl 7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4]oxazepine-4(5H)-carboxylate (3.3 g, 65.0% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C19H23N3O3: 342.18; found 342.2.


Step 7: Synthesis of 5-(2,3,4,5-tetrahydrobenzo[f][1,4]oxazepin-7-yl)pyridin-2-amine

To a solution of tert-butyl 7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4] oxazepine-4(5H)-carboxylate (3.3 g, 9.67 mmol, 1.0 equiv) in THF (40 mL) was added HCl in EtOAc (4 M, 100 mL, 41.38 equiv) at room temperature. The mixture was stirred for 3 h. The reaction mixture was filtered and the filter cake was washed with EtOAc (3×15 mL) and then dried under reduced pressure to give 5-(2,3,4,5-tetrahydrobenzo [f][1,4]oxazepin-7-yl)pyridin-2-amine (3 g, 95.1% yield, 2HCl) as a light yellow solid.


Step 8: Synthesis of tert-butyl (2-((4-(7-(6-aminopyridin-3-yl)-2,3,4,5-tetrahydrobenzo[f][1,4]oxazepine-4-carbonyl)-2-fluoro-3-methylphenyl)sulfonyl)ethyl)carbamate

To a solution of 4-((2-((tert-butoxycarbonyl)amino)ethyl)sulfonyl)-3-fluoro-2-methylbenzoic acid (690.08 mg, 1.91 mmol, 1.0 equiv) in DMF (10 mL) was added HATU (1.09 g, 2.86 mmol, 1.5 equiv) and DIPEA (1.66 mL, 9.55 mmol, 5 equiv). The reaction was stirred at room temperature for 30 min and then 5-(2,3,4,5-tetrahydrobenzo[f][1,4]oxazepin-7-yl)pyridin-2-amine (0.6 g, 1.91 mmol, 1.0 equiv, 2HCl) was added. The mixture was stirred for 2 h, at which point H2O (40 mL) was added. The mixture was stirred for 5 min and the resulting precipitate was collected by filtration to give the crude product. The residue was purified by silica gel chromatography (1/0 to 10/1 EtOAc/MeOH) to afford tert-butyl (2-((4-(7-(6-aminopyridin-3-yl)-2,3,4,5-tetrahydrobenzo[f][1,4] oxazepine-4-carbonyl)-2-fluoro-3-methylphenyl)sulfonyl)ethyl)carbamate (0.538 g, 47.4% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C29H33FN4O6S: 585.22; found 585.3.


Step 9: Synthesis of (4-((2-aminoethyl)sulfonyl)-3-fluoro-2-methylphenyl)(7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4]oxazepin-4(5H)-yl)methanone 2,2,2-trifluoroacetate

A solution tert-butyl (2-((4-(7-(6-aminopyridin-3-yl)-2,3,4,5-tetrahydrobenzo[f][1,4] oxazepine-4-carbonyl)-2-fluoro-3-methylphenyl)sulfonyl)ethyl)carbamate (0.538 g, 920.20 μmol, 1.0 equiv) in TFA (10.35 mL, 139.74 mmol, 151.85 equiv) was stirred at room temperature for 2 h. The solution was then concentrated under reduced pressure. The oily residue was triturated with MeCN (1 mL) and then dropped into MTBE (30 mL) for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N2 to give (4-((2-aminoethyl)sulfonyl)-3-fluoro-2-methylphenyl)(7-(6-aminopyridin-3-yl)-2,3-dihydrobenzo[f][1,4]oxazepin-4(5H)-yl)methanone 2,2,2-trifluoroacetate (0.50 g, 87.4% yield, TFA) as light brown solid. LCMS (ESI) m/z: [M+H] calcd for C24H25FN4O4S: 485.17; found 485.1.


Monomer AA. 5-(4-amino-1-(6-(piperazin-1-yl)pyrimidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of 1-(6-chloropyrimidin-4-yl)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine

To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (5 g, 19.16 mmol, 1.0 equiv) in DMF (60 mL) was added NaH (804.53 mg, 20.11 mmol, 60% purity, 1.05 equiv) at 0° C. The mixture was stirred at 0° C. for 30 min. To the reaction mixture was then added 4,6-dichloropyrimidine (3.42 g, 22.99 mmol, 1.2 equiv) at 0° C. The mixture was stirred at room temperature for 2.5 h, at which point the reaction mixture was added to H2O (600 mL). The suspension was then filtered to give the product (7.1 g, 99.2% yield) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C9H5ClIN7: 373.94; found 373.9.


Step 2: Synthesis of tert-butyl 4-(6-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)pyrimidin-4-yl)piperazine-1-carboxylate

To a solution of 1-(6-chloropyrimidin-4-yl)-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (5 g, 13.39 mmol, 1.0 equiv) and tert-butyl piperazine-1-carboxylate (2.99 g, 16.06 mmol, 1.2 equiv) in DMF (50 mL) was added K2CO3 (3.70 g, 26.77 mmol, 2.0 equiv). The reaction mixture was stirred at 100° C. for 4 h, at which point it was added to H2O (500 mL). The suspension was then filtered to give the product (6.2 g, 88.5% yield) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C18H22IN9O2: 524.09; found 524.2.


Step 3: Synthesis of tert-butyl 4-(6-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)pyrimidin-4-yl)piperazine-1-carboxylate

To a bi-phasic suspension of 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (3.08 g, 11.85 mmol, 1.0 equiv), tert-butyl 4-(6-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)pyrimidin-4-yl)piperazine-1-carboxylate (6.2 g, 11.85 mmol, 1.0 equiv) and Na2CO3 (6.28 g, 59.24 mmol, 5.0 equiv) in H2O (100 mL) and DME (200 mL) was added Pd(PPh3)4 (1.37 g, 1.18 mmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 24 h and then the mixture was filtered to give a solid cake. The solid was added to dioxane (20 mL) and stirred at 110° C. for 60 min, then filtered to give the product (3.5 g, 55.8% yield) as brown solid. LCMS (ESI) m/z: [M+H] calcd for C25H27N11O3: 530.24; found 530.3.


Step 4: Synthesis of 5-(4-amino-1-(6-(piperazin-1-yl)pyrimidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

A solution of tert-butyl 4-(6-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)pyrimidin-4-yl)piperazine-1-carboxylate (3.5 g, 6.61 mmol, 1.0 equiv) in TFA (35 mL) was stirred at room temperature for 1 h. The reaction solution was concentrated under reduced pressure and the resulting crude material was dissolved in MeCN (20 mL) and added dropwise to MTBE (500 mL). The resulting solid was then filtered to give the product (5.5 g, 91.9% yield, 4TFA) as brown solid. LCMS (ESI) m/z: [M+H] calcd for C20H19N11O: 430.19; found 430.1.


Monomer AB. 8-(6-methoxypyridin-3-yl)-3-methyl-1-(4-(4-(5,6,7,8-tetrahydropyrido[4,3-d]pyrimidin-2-yl)piperazin-1-yl)-3-(trifluoromethyl)phenyl)-1H-imidazo[4,5-c]quinolin-2(3H)-one trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 2-(4-(4-(8-(6-methoxypyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-c]quinolin-1-yl)-2-(trifluoromethyl)phenyl)piperazin-1-yl)-7,8-dihydropyrido[4,3-d]pyrimidine-6(5H)-carboxylate

To a mixture, of 8-(6-methoxypyridin-3-yl)-3-methyl-1-(4-(piperazin-1-yl)-3-(trifluoromethyl)phenyl)-1H-imidazo[4,5-c]quinolin-2(3H)-one (0.3 g, 561.24 μmol, 1.0 equiv) and tert-butyl 2-chloro-7,8-dihydropyrido[4,3-d]pyrimidine-6(5H)-carboxylate (151.38 mg, 561.24 μmol, 1.0 equiv) in DMF (5 mL) was added K2CO3 (193.92 mg, 1.40 mmol, 2.5 equiv). The mixture was stirred at 100° C. for 14 h, at which point H2O (20 mL) was added. The aqueous layer was extracted with EtOAc (3×40 mL) and the combined organic layers were concentrated under reduced pressure. The crude material was was purified by column chromatography (30/1 to 15/1 DCM/MeOH) to give the product (0.30 g, 69.6% yield) as a light-yellow solid. LCMS (ESI) m/z: [M+H] calcd for C40H40F3N9O4: 768.33; found 768.5.


Step 2: Synthesis of 8-(6-methoxypyridin-3-yl)-3-methyl-1-(4-(4-(5,6,7,8-tetrahydropyrido[4,3-d]pyrimidin-2-yl)piperazin-1-yl)-3-(trifluoromethyl)phenyl)-1H-imidazo[4,5-c]quinolin-2(3H)-one

A solution of Cert-butyl 2-(4-(4-(8-(6-methoxypyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-c]quinolin-1-yl)-2-(trifluoromethyl)phenyl)piperazin-1-yl)-7,8-dihydropyrido[4,3-d]pyrimidine-6(5H)-carboxylate (0.8 g, 1.04 mmol, 1.0 equiv) in TFA (8 mL) was stirred at room temperature for 2 h. The solvent was concentrated and the residue was dissolved in MeCN (5 mL), then the solution was added dropwise to MTBE (150 mL). The precipitate was filtered and the solid was dried under reduced pressure to give the product (600 mg, 70.6% yield, TFA) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C35H32F3N9O2: 668.27; found 668.3.


Monomer AC. 5-(4-amino-1-(piperidin-4-ylmethyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 4-((methylsulfonyl)oxy)piperidine-1-carboxylate

To a solution of tert-butyl 4-hydroxypiperidine-1-carboxylate (4 g, 19.87 mmol, 1.0 equiv) and TEA (3.87 mL, 27.82 mmol, 1.4 equiv) in DCM (40 mL) was added MsCl (2.15 mL, 27.82 mmol, 1.4 equiv) at 0° C. Then the reaction mixture was stirred at room temperature for 1 h. H2O (50 mL) was added and the aqueous phase was extracted with DCM (3×50 mL). The combined organic phase was washed with brine, dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the product (5.62 g, 101% crude yield) as yellow solid which was used directly in the next step.


Step 2: Synthesis of tert-butyl 4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate

To a suspension of 3-iodo-1H-pyrazolo[3,4-d]pyrimidin-4-amine (5 g, 19.16 mmol, 1.0 equiv) and tert-butyl 4-((methylsulfonyl)oxy)piperidine-1-carboxylate (5.62 g, 20.11 mmol, 1.05 equiv) in DMF (100 mL) was added K2CO3 (5.29 g, 38.31 mmol, 2.0 equiv). The mixture was stirred at 80° C. for 12 h. The reaction mixture was then added to H2O (400 mL) at 0° C. The resulting precipitate was filtered to give the product (5.0 g, 58.8% yield) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C15H21IN6O2: 445.09; found 445.1.


Step 3: Synthesis of tert-butyl 4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate

To a suspension of tert-butyl 4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate (5 g, 11.25 mmol, 1.0 equiv), 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzo[d]oxazol-2-amine (3.51 g, 13.51 mmol, 1.2 equiv) and Na2CO3 (5.96 g, 56.27 mmol, 5.0 equiv) in H2O (50 mL) and DME (100 mL) was added Pd(PPh3)4 (1.30 g, 1.13 mmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled to room temperature and filtered. The filtrate was partitioned between EtOAc (100 mL) and H2O (100 mL) and then the aqueous layer was separated and extracted with EtOAc (3×100 mL). The combined organic layer was washed with brine (20 mL) and dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The residue was triturated with EtOAc (30 mL) and filtered to give the product (3.6 g, 71.0% yield) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C22H26N8O3: 451.22; found 451.3.


Step 4: Synthesis of 5-(4-amino-1-(piperidin-4-yl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine trifluoroacetic Acid Salt

A solution of tert-butyl 4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate (1.4 g, 3.11 mmol, 1.0 equiv) in TFA (10 mL) was stirred at room temperature for 30 min. The reaction solution was concentrated under reduced pressure and the crude solid was dissolved in MeCN (20 mL). The solution was added dropwise to MTBE (100 mL) and the resulting solid was filtered to give the product (1.6 g, 85.8% yield, 2TFA) as yellow solid. LCMS (ESI) m/z: [M+H] calcd for C17H18N8O3: 351.17; found 351.1.


Monomer AD. 1-(piperidin-4-yl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine trifluoroacetic Acid Salt



embedded image


Step 1: Synthesis of tert-butyl 4-(4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate

To a suspension of 5-(4,4,5-trimethyl-1,3,2-dioxaborolan-2-yl)-1H-pyrrolo[2,3-b]pyridine (857.12 mg, 3.51 mmol, 1.2 equiv), tert-butyl 4-(4-amino-3-iodo-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate (1.3 g, 2.93 mmol, 1.0 equiv) and Na2CO3 (1.55 g, 14.63 mmol, 5.0 equiv) in DME (20 mL) and H2O (10 mL) was added Pd(PPh3)4 (338.13 mg, 292.62 μmol, 0.1 equiv) at room temperature under N2. The mixture was stirred at 110° C. for 3 h. The reaction mixture was then cooled to room temperature and filtered. The filtrate was partitioned between EtOAc (50 mL) and H2O (50 mL) and the aqueous layer was separated and extracted with EtOAc (3×50 mL). The combined organic layer were washed with brine, dried over anhydrous Na2SO4, filtered, and concentrated under reduced pressure. The residue was triturated with EtOAc (10 mL), filtered, the solid cake was dried under reduced pressure to give the product (1.0 g, 78.7% yield) as yellow solid.


Step 2: Synthesis of 1-(piperidin-4-yl)-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine trifluoroacetic Acid Salt

A solution of tert-butyl 4-(4-amino-3-(1H-pyrrolo[2,3-b]pyridin-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)piperidine-1-carboxylate (1.5 g, 3.45 mmol, 1.0 equiv) in TFA (10 mL) was stirred at room temperature for 30 min. The reaction solution was concentrated under reduced pressure and the crude residue was dissolved in MeCN (20 mL). The solution was added dropwise to MTBE (100 mL) and the resulting solid was filtered to give the product (1.19 g, 74.2% yield, TFA) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C17H18N8: 335.18; found 335.1.


Monomer AE. 4-amino-5-(2-aminobenzo[d]oxazol-5-yl)-5H-pyrimido[5,4-b]indole-7-carboxylic Acid



embedded image


This monomer can be prepared from 7-methyl-5H-pyrimido[5,4-b]indol-4-ol by benzylic oxidation to the carboxylic acid, conversion to the ethyl ester, followed by O-ethylation with triethyloxonium tetrafluoroboroate. Palladium-mediated arylation followed by ester hydrolysis and final ammonia-olysis provides the monomer.


Monomer AF. 4-amino-5-(2-aminobenzo[d]oxazol-5-yl)-5H-pyrimido[5,4-b]indole-8-carboxylic Acid



embedded image


This monomer can be prepared following a similar route as that to prepare the previous monomer, but using the isomeric starting material from 8-methyl-5H-pyrimido[5,4-b]indol-4-ol. Benzylic oxidation to the carboxylic acid, conversion to the ethyl ester, followed by O-ethylation with triethyloxonium tetrafluoroboroate and palladium-mediated arylation, followed by ester hydrolysis and final ammonia-olysis provides the monomer.


Monomer AG. 3-(2,4-bis((S)-3-methylmorpholino)-4a,8a-dihydropyrido[2,3-d]pyrimidin-7-yl)benzoic Acid



embedded image


Step 1: Synthesis of (3S)-4-[7-chloro-2-[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-4-yl]3-methyl-morpholine

To a solution of 2,4,7-trichloropyrido[2,3-d]pyrimidine (4.0 g, 17.06 mmol, 1.0 equiv) in DMA (10 mL) was added (3S)-3-methylmorpholine (4.31 g, 42.65 mmol, 2.5 equiv) and DIPEA (5.51 g, 42.65 mmol, 7.43 mL, 2.5 equiv). The reaction solution was heated to 70° C. for 48 h. The reaction suspension was cooled to room temperature, poured into cold H2O (50 mL) to precipitate out a solid. The solid was filtered and the filter cake was rinsed with H2O, and dried under reduced pressure to give the crude product, which was purified by column chromatography on silica gel (0→100% petroleum ether/EtOAc) to give (3S)-4-[7-chloro-2-[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-4-yl] 3-methyl-morpholine (3.5 g, 56.4% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C17H22ClN5O2: 364.15; found 364.2.


Step 2: Synthesis of 3-[2,4-bis[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-7-yl]benzoic acid

To a solution of (3S)-4-[7-chloro-2-[(3S)-3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-4-yl]-3-methyl-morpholine (2 g, 5.50 mmol, 1.0 equiv) and 3-boronobenzoic acid (1.09 g, 6.60 mmol, 1.2 equiv) in 1,4-dioxane (40 mL) was added a solution of K2CO3 (911.65 mg, 6.60 mmol, 1.2 equiv) in H2O (4 mL), followed by Pd(PPh3)4 (317.60 mg, 274.85 μmol, 0.05 equiv). The solution was degassed for 10 min and refilled with N2, then the reaction mixture was heated to 100° C. under N2 for 5 h. The reaction was cooled to room temperature and filtered. The filtrate was acidified by HCl (2N) to pH 3, and the aqueous layer was washed with EtOAc (3×20 mL). Then, the aqueous phase was concentrated under reduced pressure to give a residue, which was purified by column chromatography on silica gel (50%→100% petroleum ether/EtOAc) to give 3-[2,4-bis[(3S) -3-methylmorpholin-4-yl]pyrido[2,3-d]pyrimidin-7-yl]benzoic acid hydrochloride (2.5 g, 89.9% yield) as a yellow solid. LCMS (ESI) m/z: [M+H] calcd for C24H27N5O4: 450.21; found 450.2.


Reference for preparation of this monomer: Menear, K.; Smith, G. C. M.; Malagu, K.; Duggan, H. M. E.; Martin, N. M. B.; Leroux, F. G. M. 2012. Pyrido-, pyrazo- and pyrimido-pyrimidine derivatives as mTOR inhibitors. U.S. Pat. No. 8,101,602. Kudos Pharmaceuticals, Ltd, which is incorporated by reference in its entirety.


Monomer AH. (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]cyclohexane-1-carboxylic Acid



embedded image


This monomer, also known as OSI-027 (CAS #=936890-98-1), is a commercially available compound. At the time this application was prepared, it was available for purchase from several vendors.


Monomer AI. 2-(4-(4-(8-(6-methoxypyridin-3-yl)-3-methyl-2-oxo-2,3-dihydro-1H-imidazo[4,5-c]quinolin-1-yl)-2-(trifluoromethyl)phenyl)piperazin-1-yl)pyrimidine-5-carboxylic Acid



embedded image


Preparation of this monomer proceeds by reaction of BGT226 with methyl 2-chloropyrimidine-5-carboxylate, followed by ester hydrolysis, to give the titled Monomer.


Monomer AJ. 4-amino-5-{1H-pyrrolo[2,3-b]pyridin-5-yl}-5H-pyrimido[5,4-b]indole-8-carboxylic Acid



embedded image


This monomer can be prepared from 7-methyl-5H-pyrimido[5,4-b]indol-4-ol by benzylic oxidation to the carboxylic acid, conversion to the ethyl ester, followed by O-ethylation with triethyloxonium tetrafluoroboroate. Palladium-mediated arylation followed by ester hydrolysis and final ammonia-olysis provides the monomer.


Preparation of Pre- and Post-Linkers

Building Block A. 2-(4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic acid.




embedded image


Step 1: Synthesis of ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

To a solution of 5-bromo-2-(piperazin-1-yl)pyrimidine hydrochloride (7.5 g, 26.83 mmol, 1.0 equiv) and TEA (16.29 g, 160.96 mmol, 22.40 mL, 6.0 equiv) in dioxane (100 mL) was added ethyl 2-chloropyrimidine-5-carboxylate (5.01 g, 26.83 mmol, 1.0 equiv) at room temperature and then the reaction mixture was heated to 85° C. for 18 h. The mixture was cooled to room temperature, filtered and the solid cake was washed with H2O (2×50 mL). The residue was triturated with H2O (150 mL) and filtered, at which point the solid cake was washed with H2O (3×30 mL) to afford ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (8.18 g, 77.5% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C15H17BrN6O2: 393.06; found 393.2.


Step 2: Synthesis of ethyl 2-(4-(5-((trimethylsilyl)ethynyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

To a solution of ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (5 g, 12.71 mmol, 1.0 equiv) in DMF (200 mL) was added CuI (242.16 mg, 1.27 mmol, 0.1 equiv), Pd(PPh3)2Cl2 (892.46 mg, 1.27 mmol, 0.1 equiv), TEA (6.43 g, 63.57 mmol, 8.85 mL, 5.0 equiv) and ethynyltrimethylsilane (6.24 g, 63.57 mmol, 8.81 mL, 5.0 equiv) at room temperature under N2. The reaction mixture was stirred at 80° C. for 4 h then the mixture was cooled to room temperature. The reaction mixture was filtered, and the resulting solid cake was washed EtOAc (3×30 mL) and dried under reduced pressure to give ethyl 2-(4-(5-((trimethylsilyl)ethynyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (4.2 g, 80.5% yield) as a light gray solid. LCMS (ESI) m/z: [M+H] calcd for C20H26N6O2Si: 411.20; found 411.3.


Step 3: Synthesis of 2-(4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic Acid

To a solution of ethyl 2-(4-(5-((trimethylsilyl)ethynyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (4.2 g, 10.23 mmol, 1.0 equiv) in H2O (30 mL) and EtOH (30 mL) was added LiOH.H2O (2.15 g, 51.15 mmol, 5.0 equiv) at room temperature. The reaction mixture was stirred at 75° C. for 1.5 h and then the mixture was cooled to room temperature and concentrated under reduced pressure at 45° C. The reaction mixture was acidified with 1 N HCl and the resulting precipitate was collected by filtration to give 2-(4-(5-ethynylpyrimidin-2-yl) piperazin-1-yl)pyrimidine-5-carboxylic acid hydrochloride (3.0 g, 84.6% yield) as a brown solid. LCMS (ESI) m/z: [M+H] calcd for C15H14N6O2: 311.13; found: 311.2.


Building Block J. ethyl 2-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate



embedded image


Step 1: Synthesis of ethyl 2-(4-(5-(((tert-butoxycarbonyl)amino)methyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

To a 250 mL round bottom flask was added dichloro(dimethoxyethane) nickel (11.17 mg, 50.86 μmol, 0.02 equiv), 4,4′-di-tert-butyl-2,2′-bipyridine (13.65 mg, 50.86 μmol, 0.02 equiv), and THF (1.5 mL). The vial was capped and the resulting suspension was sonicated until the nickel and ligand were fully dissolved, yielding a pale green solution. The solvent was then removed under reduced pressure to give a fine coating of the ligated nickel complex. Once dry, ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (1 g, 2.54 mmol, 1.0 equiv), potassium (tert-butoxycarbonyl)amino)methyl)trifluoroborate (904.30 mg, 3.81 mmol, 1.5 equiv), Ir[dFCF3ppy]2(bpy)PF6 (28.53 mg, 25.43 μmol, 0.01 equiv) and Cs2CO3 (1.24 g, 3.81 mmol, 1.5 equiv) were added in succession. The vial was then capped and purged and evacuated four times. Under an Ar atmosphere, dioxane (100 mL) was introduced. The vial containing all the reagents was further sealed with parafilm and stirred for 4 h, approximately 4 cm away from three 7 W fluorescent light bulbs at room temperature. The three batches were combined together, the reaction mixture was filtered, and the solution was concentrated to dryness. The residue was purified by silica gel chromatography (10/1 to 0/1 petroleum ether/EtOAc) to afford ethyl 2-(4-(5-(((tert-butoxycarbonyl)amino)methyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (3.6 g, 80.4% yield) as a light yellow solid LCMS (ESI) m/z: [M+H] calcd for C21H29N7O4: 444.23; found 444.2.


Step 2: Synthesis of ethyl 2-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

To a mixture of ethyl 2-(4-(5-(((tert-butoxycarbonyl)amino)methyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (6.9 g, 15.56 mmol, 1.0 equiv) in DCM (100 mL) was added HCl/EtOAc (4 M, 80 mL, 20.6 equiv) in one portion at room temperature under N2. The mixture was stirred for 1.5 h and then the solution was then concentrated to dryness under reduced pressure. To the residue was added MTBE (100 mL) and the precipitate was collected by filtration under N2 to give ethyl 2-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate hydrochloride (5.9 g, 99.8% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C16H21N7O2: 344.18; found 344.1.


Building Block K. ethyl 2-(piperazin-1-yl)pyrimidine-5-carboxylate



embedded image


Step 1: Synthesis of ethyl 2-(4-(tert-butoxycarbonyl)piperazin-1-yl)pyrimidine-5-carboxylate

To a solution of tert-butyl piperazine-1-carboxylate (11.94 g, 53.59 mmol, 1.0 equiv, HCl) and ethyl 2-chloropyrimidine-5-carboxylate (10 g, 53.59 mmol, 1.0 equiv) in MeCN (100 mL) was added K2CO3 (7.41 g, 53.59 mmol, 1.0 equiv). The mixture was stirred at 80° C. for 17 h and then poured into H2O (200 mL). The mixture was filtered and the filter cake was washed with H2O (80 mL) and dried under reduced pressure to give the product (15.76 g, 82% yield) as a white solid.


Step 2: Synthesis of ethyl 2-(piperazin-1-yl)pyrimidine-5-carboxylate

To a solution of ethyl 2-(4-(tert-butoxycarbonyl)piperazin-1-yl)pyrimidine-5-carboxylate (15.7 g, 46.67 mmol, 1.0 equiv) in EtOAc (150 mL) was added HCl/EtOAc (150 mL) at 0° C. The resulting mixture was stirred at room temperature for 9 h. The reaction mixture was filtered and the filter cake was washed with EtOAc (100 mL). The solid was dried under reduced pressure to give the product (12.55 g, 96% yield, HCl) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C11H16N4O2: 237.14; found 237.3.


Building Block L. 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic acid



embedded image


Step 1: Synthesis of ethyl 2-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

To a solution of ethyl 2-(4-(5-bromopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (25 g, 63.57 mmol, 1.0 equiv) in DMSO (500 mL) was added B2pin2 (32.29 g, 127.15 mmol, 2.0 equiv), KOAc (18.72 g, 190.72 mmol, 3.0 equiv) and Pd(dppf)Cl2 (4.65 g, 6.36 mmol, 0.1 equiv) at room temperature. The mixture was stirred at 75° C. for 3 h, at which point the mixture was cooled to room temperature. DCM (500 mL) was added to the reaction mixture and the solution was filtered and concentrated. To the crude mixture was added H2O (1000 mL), then the precipitate was collected by filtration under N2 to give the crude product. The residue was triturated with (10/1 petroleum ether/EtOAc, 400 mL) and filtered to afford ethyl 2-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (25 g, 89.3% yield) as a brown solid. LCMS (ESI) m/z: [M+H] calcd for C21H29BN6O4: 441.23; found 441.1.


Step 2: Synthesis of ethyl 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

To a solution of ethyl 2-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (16 g, 36.34 mmol, 1.0 equiv) in DMSO (400 mL) was added NaN3 (3.54 g, 54.51 mmol, 1.5 equiv) and Cu(OAc)2 (660.03 mg, 3.63 mmol, 0.1 equiv). The solution was vigorously stirred at 55° C. under O2 (1 atm) for 1 h. To the mixture was added to H2O (2500 mL), and the resulting precipitate was collected by filtration to give the chide product as a black-brown solid. The residue was purified by silica gel chromatography (1/10 to 5/1 DCM/MeOH) to afford ethyl 2-(4-(5-azidopyrimidin-2-yl) piperazin-1-yl)pyrimidine-5-carboxylate (2.76 g, 21.4% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C15H17N9O2: 356.15; found 356.2.


Step 3: Synthesis of 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic Acid

To a solution of ethyl 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (3.38 g, 9.51 mmol, 1.0 equiv) in THF (60 mL), H2O (20 mL) and EtOH (20 mL) was added LiOH.H2O (598.66 mg, 14.27 mmol, 1.5 equiv) at room temperature. The reaction mixture was stirred at 65° C. for 50 min, at which point the mixture was cooled to room temperature and concentrated under reduced pressure at 45° C. to remove THF and EtOH. The mixture was acidified with 1N HCl to pH 7. The resulting precipitate was collected by filtration to give 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic acid (3 g, 96.4% yield).


Building Block M. ethyl 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate



embedded image


Step 1: Synthesis of tert-butyl 4-(5-bromopyrimidin-2-yl) -3-(hydroxymethyl) piperazine-1-carboxylate

To a solution of tert-butyl 3-(hydroxymethyl)piperazine-1-carboxylate (8.5 g, 39.30 mmol, 1.0 equiv) in DMF (120 mL) was added 5-bromo-2-chloropyrimidine (7.6 g, 39.30 mmol, 1.0 equiv) and DIPEA (20.54 mL, 117.90 mmol, 3.0 equiv). The mixture was stirred at 130° C. for 16 h. The mixture was poured into H2O (500 mL) and the aqueous phase was extracted EtOAc (3×150 mL). The combined organic phase was washed with saturated aqueous NH4Cl (2×150 mL), brine (2×150 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the crude product. The residue was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to give the product (12.6 g, 83% yield) as the yellow. oil. LCMS (ESI) m/z: [M+H] calcd for C14H21BrN4O3: 373.09; found 373.05.


Step 2: Synthesis of tert-butyl 4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate

To a solution of tert-butyl 4-(5-bromopyrimidin-2-yl)-3-(hydroxymethyl)piperazine-1-carboxylate (12.6 g, 33.76 mmol, 1.0 equiv) in DCM (150 mL) was added tert-butyl-chloro-diphenyl-silane (9.54 mL, 37.13 mmol, 1.1 equiv) and imidazole (4.60 g, 67.52 mmol, 2.0 equiv). The mixture was stirred at room temperature for 18 h. The reaction mixture was diluted with DCM (100 mL) and washed with saturated aqueous NaHCO3(2×80 mL), brine, dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to give the product (16.5 g, 66% yield) as the yellow oil. LCMS (ESI) m/z: [M+H] calcd for C30H39BrN4O3Si: 611.21; found 611.30.


Step 3: Synthesis of 5-bromo-2-(2-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine

To a solution of tert-butyl 4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate (41 g, 67.03 mmol, 1.0 equiv) in EtOAc (100 mL) was added HCl/EtOAc (350 mL), dropwise. The reaction mixture was stirred at room temperature for 3 h. The reaction mixture was then filtered and the filter cake was washed with EtOAc (100 mL). The solid cake was dried under reduced pressure to give the product (30.6 g, 75% yield, HCl) as a white soild. LCMS (ESI) m/z: [M+H] calcd for C25H31BrN4OSi: 511.16; found 511.2.


Step 4: Synthesis of ethyl 2-(4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine-5-carboxylate

To a suspension of 5-bromo-2-(2-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine(23.5 g, 42.88 mmol, 1.0 equiv, HCl) and ethyl 2-chloropyrimidine-5-carboxylate (8 g, 42.88 mmol, 1.0 equiv) in IPA (250 mL) was added DIPEA (22.41 mL, 128.65 mmol, 3.0 equiv), dropwise. The reaction mixture was stirred at 80° C. for 16 h. The mixture was then poured into H2O (500 mL) and the solution was filtered. The filter cake was washed with H2O (200 mL) and the solid was dried under reduced pressure. The crude product was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to the product (19.53 g, 68% yield) as a white solid.


Step 5: Synthesis of ethyl 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate

To a solution of ethyl 2-(4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine-5-carboxylate (15 g, 22.67 mmol, 1.0 equiv) in dioxane (150 mL) was added 4,4,4′,4′,5,5,5′,5′-octamethyl-2,2′-bi(1,3,2-dioxaborolane) (11.51 g, 45.34 mmol, 2.0 equiv), Pd(dppf)C12 (1.66 g, 2.27 mmol, 0.1 equiv) and KOAc (6.67 g, 68.01 mmol, 3 equiv). The mixture was stirred at 95° C. under N2 for 15 h. The reaction mixture was cooled to room temperature, filtered, and the filter cake was washed with EtOAc (60 mL). The resulting solution was concentrated under reduced pressure. The crude product was purified by silica gel chromatography (1/0 to 0/1 petroleum ether/EtOAc) to give the product (13 g, 76% yield) as white solid. LCMS (ESI) m/z: [M+H] calcd for C38H49BN6O5Si: 709.37 found 709.5.


Step 6: Synthesis of ethyl 2-(4-(5-azidopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)pyrimidine-5-carboxylate

To a solution of ethyl 2-(3-{[(tert-butyldiphenylsilyl)oxy]methyl}-4-[5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl]piperazin-1-yl)pyrimidine-5 carboxylate (750 mg, 1.05 mmol, 1.0 equiv) in DMSO (10 mL) was added copper(II) acetate (19.0 mg, 0.105 mmol, 0.1 equiv) and sodium azide (102 mg, 1.57 mmol, 1.5 equiv). The reaction mixture was placed under an O2 atmosphere (1 atm) and heated to 60° C. After 2.5 h, the reaction was cooled to room temperature and then added dropwise to H2O (125 mL) to give a fine brown solid, which was collected by filtration. The solid was washed with H2O (3×20 mL) and dried under reduced pressure to give the product (542 mg, 82% yield), which was used directly in next reaction. LCMS (ESI) m/z: [M+H] calcd for C32H37N9O3Si: 624.29; found 624.2.


Step 7: Synthesis of ethyl 2-(4-(5-azidopyrimidin-2-yl)-3-(hydroxymethyl)piperazin-1-yl)pyrimidine-5-carboxylate

To a solution of ethyl 2-[4-(5-azidopyrimidin-2-yl)-3-{[(tert-butyldiphenylsilyl)oxy]methyl}piperazin-1-yl]pyrimidine-5-carboxylate (478 mg, 0.7662 mmol, 1.0 equiv) in THF (5.1 mL) was added TBAF (1M in THF, 1.14 mmol, 1.14 mL, 1.5 equiv). The reaction mixture was stirred for 3.5 h, at which point the reaction was quenched with saturated NH4Cl (4 mL) and then diluted with EtOAc (20 mL) and H2O (20 mL). The separated organic phase was washed with H2O (3×30 mL) and the aqueous washes were extracted with EtOAc (15 mL). The combined organic phase was washed with brine (15 mL), dried with MgSO4, filtered, and concentrated to give the crude product as a brown oil. This material was combined With the crude product from a similar reaction (56 mgs) to give 490 mg of crude product which was purified by silica gel chromatography (0→25% EtOAc/hexanes) to give the product (166 mg, 50% yield) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C16H19N9O3: 386.17; found 386.1.


Step 8: Synthesis of 2-(4-(5-azidopyrimidin-2-yl)-3-(hydroxymethyl)piperazin-1-yl)pyrimidine-5-carboxylic Acid

To a solution of ethyl 2-[4-(5-azidopyrimidin-2-yl)-3-(hydroxymethyl)piperazin-1-yl]pyrimidine-5-carboxylate (154 mg, 0.3995 mmol, 1.0 equiv) in THF (1.26 mL) and EtOH (0.42 mL) was added a solution of LiOH.H2O (28.4 mg, 0.6791 mmol, 1.7 equiv) in H2O (0.42 mL). The resulting solution stirred at 65° C. for 1 h, at which time the reaction mixture was cooled to room temperature and then concentrated under reduced pressure. The solution was adjusted to pH 7 with the addition of 1N HCl. The solution was then concentrated and the residue dried under reduced pressure. To the residue was added 10% MeOH/DCM (20 mL) and the resulting suspension was stirred for 1 h and then filtered. The filtrate was concentrated to give a powder which was dried under reduced pressure to give the product (95 mg, 66% yield), which was used without further purification. LCMS (ESI) m/z: [M+H] calcd for C14H15N9O3: 358.14; found 358.1.


Building Block N. 2-[4-(5-azidopyrimidin-2-yl)-2-[(tert-butoxy)carbonyl]piperazin-1-yl]pyrimidine-5-carboxylic Acid



embedded image


This building block can be prepared by a process similar to that for Building Block L by utilizing tert-butyl piperazine-2-carboxylate.


Building Block O. 2-[(2R)-4-(5-azidopyrimidin-2-yl)-2-[bis({2-[(tert-butyldimethylsilyl)oxy]ethyl})carbamoyl]piperazin-1-yl]pyrimidine-5-carboxylic Acid



embedded image


embedded image


This building block can be prepared by a process similar to that for Building Block L, by utilizing (2R)-1,4-bis[(benzyloxy)carbonyl]piperazine-2-carboxylic acid.


Building Block P. 2-[(2S)-4-(5-azidopyrimidin-2-yl)-2-[(dimethylamino)methyl]piperazin-1-yl]pyrimidine-5-carboxylic Acid



embedded image


embedded image


This building block can be prepared by a process similar to that for Building Block L by utilizing dimethyl({[(2R)-piperazin-2-yl]methyl})amine.


Building Block Q. 5-azido-2-(piperazin-1-yl)pyrimidine



embedded image


Step 1: Synthesis of tert-butyl 4-(5-azidopyrimidin-2-yl)piperazine-1-carboxylate

Reference for preparation of tert-butyl 4-(5-azidopyrimidin-2-yl)piperazine-1-carboxylate from tert-butyl 4-(5-aminopyrimidin-2-yl)piperazine-1-carboxylate: Dorsch, D.; Muzerelle, M.; Burg-Dorf, L.; Wucherer-Plietker, M.; Czodrowski, P.; Esdar, C. 2017. Quinoline-2-one derivatives. WO 2017/121444. Merck Patent GmbH.


Step 2: Synthesis of 5-azido-2-(piperazin-1-yl)pyrimidine hydrochloride

To a solution of tert-butyl 4-(5-azidopyrimidin-2-yl)piperazine-1-carboxylate (252 mg, 0.8253 mmol, 1.0 equiv) in dioxane (3 mL) was added 4N HCl in dioxane (3 mL). After 5 min, the reaction solution became heterogeneous and was stirred overnight at room temperature. The next day the reaction mixture was concentrated under reduced pressure and placed under high vacuum to afford 5-azido-2-(piperazin-1-yl)pyrimidine hydrochloride as a light yellow powder (215 mg, 108% yield). LCMS (ESI) m/z: [M+H] calcd for C8H11N7: 206.12; found 206.1.


Building Block R. 5-azido-2-(2-{[(tert-butyldiphenylsilyl)oxy]methyl}piperazin-1-yl)pyrimidine



embedded image


This building block can be prepared by a process similar to that for Building block L by utilizing tert-butyl 4-(5-bromopyrimidin-2-yl)-3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate.


Building Block S. tert-butyl 4-(5-azidopyrimidin-2-yl)piperazine-2-carboxylate



embedded image


This building block can be prepared by a process similar to that for Building block L by utilizing 1,2-di-tert-butyl 4-(5-bromopyrimidin-2-yl)piperazine-1,2-dicarboxylate.


Building Block T. (2R)-4-(5-azidopyrimidin-2-yl)-N,N-bis({2-[(tert-butyldimethylsilyl)oxy]ethyl})piperazine-2-carboxamide



embedded image


This building block can be prepared by a process similar to that for Building block L by utilizing tert-butyl (2R)-2-[bis({2-[(tert-butyldimethylsilyl)oxy]ethyl})carbamoyl]-4-(5-bromopyrimidin-2-yl)piperazine-1-carboxylate.


Building Block U. (2R)-4-(5-azidopyrimidin-2-yl)-N,N-dimethylpiperazine-2-carboxamide



embedded image


This building block can be prepared by a process similar to that for Building block L by utilizing tert-butyl (2R)-4-(5-bromopyrimidin-2-yl)-2-(dimethylcarbamoyl)piperazine-1-carboxylate.


Preparation of Rapamycin Monomers
Intermediate 1. Synthesis of 40 (R)—O-m-bromobenzyl rapamycin



embedded image


To a dry reaction flask was added rapamycin (1.0 g, 1.09 mmol, 1.0 equiv) followed by heptanes (8.7 mL) and DCM (3.4 mL). 3-Bromobenzyl bromide (2.17 g, 8.72 mmol, 8.0 equiv) and silver(I) oxide (3.01 g, 13.0 mmol, 12.0 equiv) were added to the solution and the reaction flask was capped and heated at 60° C. until full consumption of rapamycin, as determined by LCMS analysis. The reaction was then cooled to room temperature, diluted with EtOAc (15 mL), filtered through Celite, and concentrated under reduced pressure to provide a yellow solid. Purification by chromatography on silica gel (10→40% EtOAc/heptanes) afforded the product (Intermediate 1) as a white solid (788 mg, 67% yield). LCMS (ESI) m/z: [M+Na] calcd for C58H84BrNO13: 1104.50; found 1104.5.


Intermediate 2. Synthesis of 40 (S)-(1-(5-(3-bromophenyl)-1,2,3-triazole)) rapamycin



embedded image


To an oven-dried reaction flask was added chloro(pentamethylcyclopentadienyl) (cyclooctadiene)ruthenium(II) (627.9 mg, 1.652 mmol, 0.4 equiv) followed by toluene (42 mL). The mixture was purged with N2 before adding 40(S)-azido rapamycin (3.55 g, 3.78 mmol, 1.0 equiv) and then 1-bromo-3-ethynylbenzene (1.325 g, 7.319 mmol, 1.9 equiv). The flask was purged with N2 and stirred at room temperature overnight. After stirring for 15 h the reaction mixture was concentrated under reduced pressure to a dark brown residue, diluted with DCM (50 mL), and passed through a plug of Magnesol®. The Magnesol® pad was washed twice with DCM and the filtrates concentrated under reduced pressure. Purification (2×) by silica gel chromatography (0→50% EtOAc/hexanes) afforded the product (Intermediate 2) as a grey/brown residue (1.72 g, 37% yield). LCMS (ESI) m/z: [M+Na] calcd for C59H83BrN4O12: 1141.51, 1143.51; found 1141.7, 1143.6.


Monomer 1. Synthesis of 40(R)—O-1-hexynyl rapamycin



embedded image


To an oven-dried reaction flask was added hex-5-yn-1-yl trifluoromethanesulfonate (5.14 g, 22.3 mmol, 4.0 equiv) followed by DCM (24.0 mL). The mixture was purged with N2 and cooled to 0° C. before adding 2,6-di-tert-butyl-4-methylpyridine (2.25 g, 11.0 mmol, 2.0 equiv) as a solid in one portion. After stirring 5 min, rapamycin (5.04 g, 5.5 mmol, 1.0 equiv) was added as a solid in one portion. The flask was purged with N2 and stirred at 0° C. for 45 min before it was warmed to room temperature and stirred for 18 h. The reaction mixture was diluted with DCM (100 mL) and washed with 100 mL each of sat. aqueous NaHCO3 and brine, then dried and concentrated to a green oil. The oil was loaded onto a frit containing silica gel (˜30 g) and eluted with 50% EtOAc in hexanes. The eluent was concentrated and purified by silica gel chromatography (0→10% acetone/DCM) to provide the product as a white foam (2.48 g). Re-purification by silica gel chromatography (0→35% EtOAc/hexanes) afforded the purified product as a white foam (1.90 g, 31% yield). LCMS (ESI) m/z: [M+Na] calcd for C57H87NO13: 1016.61; found 1016.5.


Monomer 2. Synthesis of 16-O-propargyl rapamycin



embedded image


The required intermediates can be prepared using methods described in the literature. The reported monomer can be prepared following the reported methods shown.


References for this: 1) Manipulation of the Rapamycin Effector Domain. Selective Nucleophilic Substitution of the C7 Methoxy Group: Luengo, Juan I.; Konialian-Beck, Arda; Rozamus, Leonard W.; Holt, Dennis A. 1994; Journal of Organic Chemistry, Volume 59, Issue 22, pp 6512-13. 2) Holt, D. A.; Clackson, T. P.; Rozamus, L.; Yang, W.; Gilman, M. Z. 1997; Materials and method for treating or preventing pathogenic fungal infection. WO98/02441. Ariad Pharmaceuticals, Inc. 3) Clackson, T. P.; et al. 1999. Regulation of biological events using multimeric chimeric proteins. WO 99/36553. Ariad Gene Therapeutics Inc., which are incorporated by reference in their entirety.


Monomer 3. Synthesis of 32(R)-methoxy-26-O-(prop-2-yn-1-yl) oxime rapamycin



embedded image


Step I: Synthesis of 32(R)-methoxy-28,40-bistriethylsilyl rapamycin

To a stirred solution of 32(R)-hydroxy-28,40-bistriethylsilyl rapamycin (3.83 g, 3.34 mmol, 1.0 equiv) in chloroform (95.8 mL) was added Proton Sponge® (7.17 g, 33.5 mmol, 10.0 equiv) along with freshly dried 4 A molecular sieves (4 g). The solution was stirred for 1 h prior to the addition of trimethyloxonium tetrafluoroborate (4.95 g, 33.5 mmol, 10.0 equiv, dried by heating under high vacuum at 50° C. for 1 h before use) at room temperature. The reaction mixture was stirred for 18 h, and then the reaction mixture was diluted with DCM and filtered through Celite. The filtrate was washed sequentially with aqueous 1 M HCl (2×), sat. aqueous NaHCO3 solution, then dried and concentrated under reduced pressure. Purification by silica gel chromatography (10→20% EtOAc/hexanes) afforded the desired product as a yellow oil that was contaminated with 3 wt. % Proton Sponge®. The residue was taken up in MTBE and washed with aqueous 1 M HCl, sat. aqueous NaHCO3 solution, dried, and then concentrated under reduced pressure to furnish a yellow foam (3.15 g, 81.2% yield). LCMS (ESI) m/z: [M-TES+H2O] calcd for C64H111NO13Si2: 1061.68; found 1061.9.


Step 2: Synthesis of 32(R)-methoxy rapamycin

To a stirred solution of 32(R)-methoxy-28,40-bistriethylsilyl rapamycin (1.11 g, 0.958 mmol, 1.0 equiv) in THF (12.6 mL) and pyridine (6.30 mL) in a plastic vial was added 70% HF-pyridine (2.22 mL, 76.6 mmol, 80.0 equiv) dropwise at 0° C. The reaction mixture was stirred at 0° C. for 20 min before being warmed to room temperature for 3 h, when HPLC showed complete consumption of starting material. The reaction mixture was cooled to 0° C. and poured slowly into ice cold sat. aqueous NaHCO3 solution (50 mL). The aqueous layer was extracted with EtOAc (3×) and the combined organics were washed with sat. aqueous NaHCO3 solution, brine, dried, and concentrated under reduced pressure. The yellow residue was dissolved in MeOH (5 mL) and added dropwise to H2O (50 mL) to produce a white precipitate. After stirring for 15 min the slurry was filtered on a medium porosity funnel and the cake washed with H2O (2×). The solids were then dissolved in MeCN (50 mL) and lyophilized overnight to provide the product as a white solid (780 mg, 87% yield). LCMS (ESI) m/z: [M+Na] calcd for C52H83NO13: 952.58; found 952.4.


Step 3: Synthesis of 32(R)-methoxy-26-O-(prop-2-yn-1-yl) oxime rapamycin

To a solution of 32(R)-methoxy rapamycin (780.0 mg, 0.838 mmol, 1.0 equiv) and 3-(aminooxy)prop-1-yne hydrochloride (450.9 mg, 4.192 mmol, 5.0 equiv) in pyridine (3.9 mL) was added dropwise HCl in 1,4-dioxane (4 M, 1.46 mL, 5.84 mmol, 7.0 equiv) over 1 min at room temperature. The reaction mixture was then heated at 50° C. for 36 h. Additional 3-(aminooxy)prop-1-yne hydrochloride (90.17 mg, 0.838 mmol, 1.0 equiv) and HCl in 1,4-dioxane (4 M, 1.04 mL, 4.16 mmol, 5.0 equiv) were added after the reaction had been cooled to room temperature. The reaction mixture was again heated at 50° C. and stirred for 72 h. The reaction mixture was added dropwise into H2O (70 mL) and cooled at 0° C. The resulting solid was filtered off, washed with H2O, and purified by silica gel chromatography (0→60% EtOAc/hexanes). The desired product was lyophilized to a white solid (414 mg, 50.2% yield, mixture of E/Z isomers). LCMS (ESI) m/z: [M+H2O] calcd for C55H86N2O13: 1000.6; found 1000.5.


Monomer 4. Synthesis of 32(R)-methoxy-26-O-(2-(2-(2-(prop-2-yn-1-yloxy)ethoxy)ethoxy)ethyl) oxime rapamycin



embedded image


To a solution of 32(R)-methoxy rapamycin (120.0 mg, 0.129 mmol, 1.0 equiv) and O-(2-{2-[2-(prop-2-yn-1-yloxy)ethoxy]ethoxy}ethyl)hydroxylamine (100.0 mg, 0.492 mmol, 3.8 equiv) in pyridine (0.5 mL) was added HCl in 1,4-dioxane (4 M, 0.16 mL, 0.645 mmol, 5.0 equiv) dropwise and then the reaction mixture was heated to 50° C. for 18 h. MeOH (0.1 mL) was added to the heterogeneous solution along with additional HCl in 1,4-dioxane (4 M, 0.16 mL, 0.645 mmol, 5.0 equiv) and heating at 50° C. continued for 72 h. The reaction was cooled to room temperature, diluted with DCM, washed with sat. aqueous NaHCO3 solution, dried, and concentrated under reduced pressure. Purification by silica gel chromatography (40→80% EtOAc/hexanes) and lyophilization from MeCN furnished the product as a white solid (60 mg, 41% yield, mixture of E/Z isomers). LCMS (ESI) m/z: [M+Na] calcd for C61H98N2O16: 1137.68; found 1137.7.


Monomer 5. Synthesis of 40(R)—O-(7-octynyl) rapamycin



embedded image


To a dry reaction vessel is added oct-7-yn-1-yl trifluoromethanesulfonate (4.0 equiv) followed by anhydrous DCM. The mixture is purged with N2 and cooled to sub-ambient temperature before addition of 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) as a solid in one portion. Rapamycin (1.0 equiv) is then added as a solid in one portion. The reaction is stirred and, upon consumption of rapamycin, diluted with DCM and washed with sat. aqueous NaHCO3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na2SO4, filtered and concentrated. The crude product mixture was purified by silica gel chromatography to afford product.


Monomer 6. Synthesis of 32(R)-hydroxy-26-O-(prop-2-yn-1-yl) oxime rapamycin



embedded image


To a dry reaction flask was added 32(R)-hydroxy rapamycin (2.74 g, 2.99 mmol, 1.0 equiv) and 3-(aminooxy)prop-1-yne hydrochloride (1.608 g, 14.95 mmol, 5.0 equiv), followed by pyridine (13.9 mL, 172 mmol, 57.5 equiv). 4M HCl in dioxane (7.48 mL, 29.9 mmol, 10 equiv) was added dropwise over 1 min and then the reaction was heated to 50° C. MeOH (3.5 mL, 86 mmol, 29 equiv) was added after the reaction mixture reached 50° C. and the solution was stirred for 72 h. The reaction mixture was concentrated under reduced pressure to ˜5 mL total volume before being added dropwise to H2O (50 mL). Solids precipitated from solution and then the mixture was decanted to remove the aqueous layer and the remaining material was washed with H2O (25 mL). The crude solid was dissolved in EtOAc (50 mL) and washed with 1M HCl (25 mL), sat. NaHCO3(25 mL), and brine (25 mL). The organic phase was concentrated under reduced pressure to provide a yellow foam. Purification by chromatography on silica gel (0→60% EtOAc/hexanes) afforded the product as a yellow foam (1.49 g, 45% yield, mixture of E/Z isomers). LCMS (ESI) m/z: [M+H] calc for C54H84N2O13: 969.61; found 969.8.


Monomer 7. Synthesis of 32(R)-hydroxy-26-O-(2-(2-(2-(prop-2-yn-1-yloxy)ethoxy)ethoxy)ethyl) oxime rapamycin



embedded image


To a solution of 32(R)-hydroxy rapamycin (1.0 equiv) and O-(2-(2-(2-(prop-2-yn-1-yloxy)ethoxy)ethoxy)ethyl)hydroxylamine hydrochloride (5.0 equiv) in pyridine is added dropwise HCl in 1,4-dioxane (7.0 equiv) over 1 min. The reaction mixture is heated at 50° C. During the reaction course, additional O-(2-(2-(2-(prop-2-yn-1-yloxy)ethoxy)ethoxy) ethyl)hydroxylamine hydrochloride (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated at 50° C. and stirred until consumption of 32(R)-hydroxy rapamycin. The reaction mixture is then added dropwise into H2O and cooled to 0° C. The resulting solid is filtered off, washed with H2O, and purified by silica gel chromatography to afford product.


Monomer 8. Synthesis of 28(R)—O-(5-hexynyl) rapamycin



embedded image


The synthesis proceeds first by the alkylation of C40-O-TBDMS protected rapamycin with hex-5-yn-1-yl trifluoromethanesulfonate and DIPEA and then desilation under acidic conditions with an acetic acid/THF/H2O solution.


Reference for preparation of C40-O-TBDMS protected rapamycin: Abel, M.; Szweda, R.; Trepanier, D.; Yatscoff, R. W.; Foster, R. T. 2004. Rapamycin carbohydrate derivatives. WO 2004/101583. Isotechnica International Inc., which is incorporated by reference in its entirety.


Monomer 9. Synthesis of 40(R)—O-(3-(2-ethynylpyrimidin-5-yl)propyl) rapamycin



embedded image


To a dry reaction vessel is added 3-(2-ethynylpyrimidin-5-yl)propyl trifluoromethanesulfonate (4.0 equiv) followed by anhydrous DCM. The mixture is purged with N2 and cooled to sub-ambient temperature before addition of 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) as a solid in one portion. Rapamycin (1.0 equiv) is then added as a solid in one portion. The reaction is stirred and, upon consumption of rapamycin, diluted with DCM and washed with sat. aqueous NaHCO3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na2SO4, filtered and concentrated to dryness. The crude product mixture was purified by silica gel chromatography to afford product.


Monomer 10. Synthesis of 32(R)-hydroxy 26-O-(p-ethynylbenzyl) oxime rapamycin



embedded image


Step 1: Synthesis of 2-[(4-ethynylbenzyl)oxy]-1H-isoindole-1,3(2H)-dione

A mixture of N-hydroxyphthalimide (1.94 g, 11.9 mmol, 1.05 equiv), triphenylphosphine (3.12 g, 11.9 mmol, 1.05 equiv), and (4-ethynylphenyl)methanol (1.50 g, 11.3 mmol, 1.0 equiv) in THF (28.2 mL) at 0° C. was treated with DIAD (2.35 mL, 11.9 mmol, 1.05 equiv) dropwise over 5 min. The reaction mixture turned yellow and became homogenous during the addition. The yellow reaction mixture was stirred for 5 min before being warmed to room temperature. A precipitate formed as the reaction proceeded. After stirring overnight, HPLC indicated the starting material had been consumed. The slurry was filtered and the resulting yellowish solid was washed twice with MTBE. The filtrate was concentrated to a solid that was triturated with MTBE. The solids were filtered off and washed again with MTBE. The combined solids were dried under reduced pressure to afford the product (2.66 g) as a yellow solid that was of sufficient purity for use in the next step. LCMS (ESI) m/z: [M+Na] calcd for C17H11NO3: 300.06; found 300.0.


Step 2: Synthesis of 1-[(aminooxy)methyl]-4-ethynylbenzene hydrochloride

A slurry of 2-[(4-ethynylbenzyl)oxy]-1H-isoindole-1,3(2H)-dione (2.66 g, 9.59 mmol, 1.0 equiv) in DCM (25.0 mL) was treated with N-methylhydrazine (0.510 mL, 9.59 mmol, 1.0 equiv) at room temperature. The reaction mixture turned dark yellow and remained a slurry. After 30 min, HPLC indicated the starting material had been consumed and a new product was present. The mixture was cooled to 0° C., stirred for 10 min, and the solids were filtered, and the filter cake was washed with cold DCM. The filtrate was concentrated and diluted with MTBE. Any solids that formed were filtered and washed with MTBE. The combined filtrate was treated with 2.0M HCl in ether (4.80 mL, 9.59 mmol) dropwise to give a thick, yellow slurry. After stirring for 5 min the HCl salt was filtered, washed with MTBE, and dried under the nitrogen press to afford the product as a light yellow solid that was suitable for use in the next step.


Step 3: Synthesis of 32(R)-hydroxy 26-O-(p-ethynylbenzyl) oxime rapamycin

A solution of 32(R)-hydroxy rapamycin (930.0 mg, 1.015 mmol, 1.0 equiv) in pyridine (4.7 mL) was treated with 1-[(aminooxy)methyl]-4-ethynylbenzene hydrochloride (745.6 mg, 4.060 mmol, 4.0 equiv) followed by pyridine hydrochloride (1.173 g, 10.15 mmol, 10.0 equiv) in one portion. The reaction mixture was heated to 45° C. for 48 h at which point HPLC indicated the starting material had been consumed. The mixture was added dropwise to H2O (50 mL), yielding a gummy mixture. The mixture was extracted with EtOAc (3×25 mL) and the combined organic phases were washed with 25 mL portions of 1M HCl, sat. NaHCO3 solution, and brine. The solution was dried over Na2SO4, filtered, and concentrated to yield the crude product. The residue was absorbed onto C18 silica gel and purified by reverse phase combiflash chromatography (150 g RP column eluting with MeCN/H2O w/0.1% formic acid, both solvents cooled in an ice bath) to yield the product as a yellow oil that was a mixture of E/Z isomers. The product was taken up in 95% aq MeCN and lyophilized to yield an off white solid. LCMS (ESI) m/z: [M+H] calcd for C60H88N2O13: 1045.64; found 1045.5.


Monomer 11. Synthesis of 40(S)—N-propargylcarbamate rapamycin



embedded image


Alkyne-containing monomer can be prepared from the previously reported rapamycin C40-epi-amine by reacting with propargyl chloroformate as shown above.


Reference for preparation of rapamycin C40-epi-amine: Or, Y. S.; Luly, J. R.; Wagner, R. 1996. Macrolide Immunomodulators. U.S. Pat. No. 5,527,907. Abbott Laboratories, which is incorporated by reference in its entirety.


Monomer 12. Synthesis of 32(R)-methoxy 26-O-(p-ethynylbenzyl) oxime rapamycin



embedded image


To a solution of 32(R)-methoxy rapamycin in pyridine is added 1-[(aminooxy)methyl]-4-ethynylbenzene hydrochloride followed by solid pyridine hydrochloride in one portion. The reaction mixture is heated at 45° C. until the starting material is consumed, as indicated by HPLC analysis. The mixture is added dropwise to H2O, yielding a gummy mixture. The mixture is extracted with three portions of EtOAc and the combined organic phase is washed with 1M HCl, sat. NaHCO3 solution, and brine. The solution was dried over Na2SO4, filtered, and concentrated to yield the crude product. The residue is absorbed onto C18 silica gel and purified by reverse phase combiflash chromatography to yield the product.


Monomer 13. Synthesis of 40-O-propargyl sulfamidecarbamate rapamycin



embedded image


The monomer can be prepared from the previously described chlorosulfonamide as shown above.


Reference for formation and reaction of the chlorosulfonamide derivative: Sun, C. L.; Li, X. 2009. Rapamycin analogs as anti-cancer agents. WO 2009/131631. Poinard Pharmaceuticals Inc., which is incorporated by reference in its entirety.


Monomer 14



embedded image


Step 1: Synthesis of 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pent-4-yn-1-one

Potassium t-butoxide (411 mg, 3.67 mmol, 1.2 equiv) was dissolved in MeOH (15 mL) and then 2-(piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (1 g, 3.06 mmol, 1 equiv) was added to free base the salt. The reaction stirred for 15 min and then was concentrated to a yellow solid. The solid and 4-pentynoic acid (329 mg, 3.36 mmol, 1.1 equiv) were dissolved in DMF (15.3 mL). Then DIPEA (2.65 mL, 15.3 mmol, 5 equiv) was added and the reaction was cooled to 0° C. Next diphenylphosphoryl azide (924 mg, 3.36 mmol, 1.1 equiv) was added. The reaction stirred for 1 h at 0° C. The reaction was diluted with. EtOAc, washed with brine, dried over Na2SO4, filtered, and concentrated under reduced pressure to afford the product as a white solid (1.6 g, 83% yield). LCMS (ESI) m/z: [M+H] calcd for C19H27BN4O3: 371.23; found 371.1.


Step 2: Synthesis of 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)-5-(trimethylsilyl)pent-4-yn-1-one

Zinc triflate (3.52 g, 9.71 mmol, 2.4 equiv) was placed into a vial and placed under a nitrogen balloon: Next DCM (8.10 mL) was added followed by triethylamine (2.24 mL, 16.2 mmol, 4 equiv). The reaction was heated at 30° C. for 30 min. Then 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)pent-4-yn-1-one (1.5 g, 4.05 mmol, 1 equiv) was dissolved in DCM (8.10 mL) and added to the reaction. The reaction stirred for 1 h and then chlorotrimethylsilane (2.04 mL, 16.2 mmol, 4 equiv) was added. The reaction stirred at 30° C. for 2 h. The reaction was diluted with DCM, washed with NH4Cl, Na2CO3, and brine, dried over Na2SO4, filtered, and concentrated under reduced pressure to afford the product as an orange solid (1.2 g, 66% yield). LCMS (ESI) m/z: [M+H] calcd for C22H35BN4O3Si: 443.26; found 443.2.


Step 3: Coupling of substituted pyrimidinylpiperazine to Intermediate 2

Intermediate 2 (0.35 g, 0.3120 mmol, 1 equiv) and 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)-5-(trimethylsilyl)pent-4-yn-1-one (172 mg, 0.3899 mmol, 1.25 equiv) were dissolved in dioxane (3.11 mL). Next XPhos Pd G2 (98.1 mg, 0.1248 mmol, 0.4 equiv) and silver(I) oxide (216 mg, 0.936 mmol, 3 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was concentrated under reduced pressure and the crude reaction mixture purified by silica gel chromatography (0→10% MeOH/DCM) to yield the product as a brown solid (0.425 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C75H106N8O13Si: 1355.77; found 1355.8.


Step 4: Desilylation

To a solution of rapamycin TMS alkyne (0.425 g, 0.3137 mmol, 1 equiv) in THF (3.13 mL) in a plastic vial was added pyridine (2.09 mL). The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (731 μL, 28.2 mmol, 90 equiv) was added. The reaction stirred at 0° C. for 10 min and then was stirred at room temperature for 4 h. The reaction was dripped into a cooled (0° C.) NaHCO3 solution, extracted with EtOAc, washed with NaHCO3 and brine, dried over Na2SO4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0→10% MeOH/DCM) afforded the product as a brown solid (0.21 g, 52% yield). LCMS (ESI) m/z: [M+H] calcd for C72H98N8O13: 1283.73; found 1283.7.


Monomer 15. Synthesis of 40(S)—N2-propargyl-sufuric diamido rapamycin



embedded image


A solution of 40(S)-azido rapamycin (1.0 equiv) and triphenylphosphine (1.0 equiv) in THF and H2O is prepared in a dry reaction vessel. The reaction is heated until consumption of azido-rapamycin as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature and concentrated under reduced pressure. The reaction mixture is then suspended in anhydrous MeCN and to this suspension is added 3-methyl-1-(N-(prop-2-yn-1-yl)sulfamoyl)-1H-imidazol-3-ium trifluoromethanesulfonate (1.5 equiv.) and triethylamine (5.0 equiv). The reaction is heated until the starting material was consumed and then cooled to room temperature, diluted with H2O and EtOAc. The reaction mixture is transferred to a separatory funnel, and the organic layer is washed with brine. The organic layer is dried over Na2SO4, filtered, concentrated under reduced pressure and then purified by silica gel chromatography to afford product.


Monomer 16



embedded image


Step 1: Synthesis of 2-(4-(but-3-yn-1-ylsulfonyl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine

A solution of 2-(piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (1.6 g, 4.90 mmol, 1.0 equiv) and triethylamine (2.72 mL, 19.6 mmol, 4.0 equiv) in DCM (24.5 mL) was stirred at 0° C. for 15 min. But-3-yne-1-sulfonyl chloride (640 μL, 5.88 mmol, 1.2 equiv) was then added dropwise into the reaction. The reaction was allowed to warm to room temperature and stirred for 18 h. The reaction was diluted with DCM, washed with H2O and then brine, dried over Na2SO4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0→50% EtOAc/heptane) afforded the product as a white solid (0.768 g, 39% yield). LCMS (ESI) m/z: [M+H] calcd for C18H27BN4O4S: 407.19; found 407.1.


Step 2: Synthesis of 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-(4-((4-(trimethylsilyl)but-3-yn-1-yl)sulfonyl)piperazin-1-yl)pyrimidine

A mixture of zinc triflate (1.38 g, 3.81 mmol, 24.0 equiv) and triethylamine (885 μL, 6.36 mmol, 4.0 equiv) in DCM (3.18 mL) was stirred at 30° C. for 30 min. A solution of 2-(4-(but-3-yn-1-ylsulfonyl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (0.650 g, 1.59 mmol, 1.0 equiv) in DCM (3.18 mL) was added to the reaction. The reaction was stirred for 1 h at 30° C. and then chlorotrimethylsilane (806 μL, 6.36 mmol, 4.0 equiv) was added. The reaction mixture was stirred at 30° C. for an additional 6 h, at which point the reaction was diluted with DCM, was washed with NH4Cl and brine, dried over Na2SO4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0→50% EtOAc/heptane) afforded the product as a white solid (0.433 g, 57% yield). LCMS (ESI) m/z: [M+H] calcd for C21H35BN4O4SSi: 479.23; found 479.2.


Step 3: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 2

Intermediate 2 (0.35 g, 0.3120 mmol, 1 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-(4-((4-(trimethylsilyl)but-3-yn-1-yl)sulfonyl)piperazin-1-yl)pyrimidine (186 mg, 0.3899 mmol, 1.25 equiv) were dissolved in dioxane (3.11 mL). Next XPhos Pd G2 (98.1 mg, 0.1248 mmol, 0.4 equiv) and silver(I) oxide (216 mg, 0.936 mmol, 3 equiv) were added. The reaction was heated at 60° C. for 24 h. The reaction was concentrated under reduced pressure and the crude reaction mixture purified by silica gel chromatography (0→10% MeOH/DCM) to yield the product as a brown solid (0.64 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C74H106N8O14SSi: 1391.74; found 1391.6.


Step 4: Desilylation

To a solution of rapamycin TMS alkyne (0.64 g, 0.4601 mmol, 1 equiv) in THF (4.60 mL) in a plastic vial was added pyridine (3.06 mL). The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (1.07 mL, 41.4 mmol, 90 equiv) was added. The reaction stirred at 0° C. for 10 min and then was stirred at room temperature for 4 h. The reaction was dripped into a cooled (0° C.) NaHCO3 solution, extracted with EtOAc, washed with NaHCO3 and brine, dried over Na2SO4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0→10% MeOH/DCM) afforded the product as a brown solid (0.256 g, 42% yield). LCMS (ESI) m/z: [M+H] calcd for C71H98N8O14S: 1319.70; found 1319.6.


Monomer 17. Synthesis of 40(S)—O-(5-heptynyl) rapamycin



embedded image


Alkyne-containing monomer can be prepared from the previously reported rapamycin C40 triflate derivative as shown above.


Reference for formation of triflate and displacement by alcohols: 1) Or, Y. S.; Luly, J. R.; Wagner, R. 1996. Macrolide immunomodulators. U.S. Pat. No. 5,527,907. Abbott Laboratories. 2) Rane, D. S.; Vyas, R. G. 2012. Process for preparation of 42-O-(heteroalkoxyalkyl) rapamycin compounds with anti-proliferative properties. WO 2012/017449. Meril Life Sciences PVT. LTD, which are incorporated by reference in their entirety.


Monomer 18



embedded image


Step 1: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 1

Intermediate 1 (0.4 g, 0.3698 mmol, 1 equiv) and 1-(4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazin-1-yl)-5-(trimethylsilyl)pent-4-yn-1-one (204 mg, 0.462 mmol, 1.25 equiv) were dissolved in dioxane (3.69 mL). Next XPhos Pd G2 (116 mg, 0.1479 mmol, 0.4 equiv) and silver(I) oxide (254 mg, 1.10 mmol, 3 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was concentrated under reduced pressure and the crude reaction mixture purified by silica gel chromatography (0→10% MeOH/DCM) to yield the product as a brown solid (0.377 g, 77% yield). LCMS (ESI) m/z: [M+H] calcd for C74H107N5O14Si: 1318.77; found 1318.6.


Step 2: Desilylation

To a solution of rapamycin TMS alkyne (0.377 g, 0.2860 mmol, 1 equiv) dissolved in THF (2.85 mL) in a plastic vial was added pyridine (1.90 mL). The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (667 μL, 25.7 mmol, 90 equiv) was added. The reaction stirred at 0° C. for 10 min and then was stirred at room temperature for 4 h. The reaction was dripped into a cooled (0° C.) NaHCO3 solution, extracted with EtOAc, washed with NaHCO3 and brine, dried over Na2SO4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0→10% MeOH/DCM) afforded the product as a brown solid (0.377 g, 77% yield). LCMS (ESI) m/z: [M+H] calcd for C71H99N5O14: 1246.73; found 1246.7.


Monomer 19. Synthesis of 40-O-(3-(2-propargyloxy)pyrimidin-5yl) rapamycin



embedded image


To a solution of Intermediate 1 (1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-((3-(trimethylsilyl)prop-2-yn-1-yl)oxy)pyrimidine (3.0 equiv) in dioxane is added Ag2O (9.0 equiv) and XPhos Pd G2 (40 mol %). The reaction is capped and heated at 60° C. until full consumption of aryl bromide as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature, filtered over Celite, and concentrated under reduced pressure. The crude product mixture is subsequently purified by silica gel chromatography to afford the silylated monomer.


Step 2

The product from the first reaction is dissolved in THF and pyridine. To this solution is added 70% HF-pyridine dropwise at 0° C. The reaction mixture is stirred at 0° C. and then warmed to room temperature. The reaction is stirred at room temperature and after LCMS analysis shows consumption of starting material the reaction mixture is cooled to 0° C. and poured slowly into ice cold sat. aq. NaHCO3. This aqueous layer is extracted with EtOAc and the organic layer is dried over Na2SO4, filtered, and concentrated under reduced pressure. This crude product mixture is purified to afford product.


Monomer 20



embedded image


Step 1

To a solution of Intermediate 2 (1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-((3-(trimethylsilyl)prop-2-yn-1-yl)oxy)pyrimidine (3.0 equiv) in dioxane is added Ag2O (9.0 equiv) and XPhos Pd G2 (40 mol %). The reaction is capped and heated at 60° C. until full consumption of aryl bromide as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature, filtered over Celite, and concentrated under reduced pressure. The crude product mixture is subsequently purified by silica gel chromatography to afford the silylated monomer.


Step 2

The product from the first reaction is dissolved in THF and pyridine. To this solution is added 70% HF-pyridine dropwise at 0° C. The reaction mixture is stirred at 0° C. and then warmed to room temperature. The reaction is stirred at room temperature and after LCMS analysis shows consumption of starting material the reaction mixture is cooled to 0° C. and poured slowly into ice cold sat. aq. NaHCO3. This aqueous layer is extracted with EtOAc and the organic layer is dried over Na2SO4, filtered, and concentrated under reduced pressure. This crude product mixture is purified to afford product.


Monomer 21



embedded image


Step 1

To a solution of Intermediate 2 (1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-N-(3-(trimethylsilyl)prop-2-yn-1-yl)pyrimidin-2-amine (3.0 equiv) in dioxane is added Ag2O (9.0 equiv) and XPhos Pd G2 (40 mol %). The reaction is capped and heated to 60° C. until full consumption of aryl bromide as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature, filtered over Celite, and concentrated under reduced pressure. The crude product mixture is subsequently purified by silica gel chromatography to afford silylated monomer.


Step 2

The product from the first reaction is dissolved in THF and pyridine. To this solution is added 70% HF-pyridine dropwise at 0° C. The reaction mixture is stirred at 0° C. and then warmed to room temperature. The reaction is stirred at room temperature and after LCMS analysis shows consumption of starting material the reaction mixture is cooled to 0° C. and poured slowly into ice cold sat. aq. NaHCO3. This aqueous layer is extracted with EtOAc and the organic layer is dried over Na2SO4, filtered, and concentrated under reduced pressure. The resultant mixture is purified to afford product.


Monomer 22. Synthesis of 40-O-(3-(2-(4-(but-3-yn-1-ylsulfonyl)piperazin-1-yl)pyrimidin-5-yl)benzyl) rapamycin



embedded image


Step 1: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 1

Intermediate 1 (0.35 g, 0.3226 mmol, 1.0 equiv) and 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-(4-((4-(trimethylsilyl)but-3-yn-1-yl)sulfonyl)piperazin-1-yl)pyrimidine (192 mg, 0.403 mmol, 1.25 equiv) were charged to a reaction flask and dissolved in dioxane (3.22 mL). XPhosPd G2 (101 mg, 0.129 mmol, 0.4 equiv) and silver(I) oxide (224 mg, 0.968 mmol, 3.0 equiv) were then charged to the reaction, which was then heated at 60° C. for 24 h. The reaction was concentrated under reduced pressure and the crude reaction mixture purified by silica gel chromatography (0→10% MeOH/DCM) to yield the product as a brown solid (0.5 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C73H107N5O15SSi: 1354.73; found 1354.7.


Step 2: Desilylation

To a solution of rapamycin TMS alkyne (0.5 g, 0.369 mmol) in THF (3.69 mL) and pyridine (2.46 mL) at 0° C. was added HF-pyridine (70:30) (861 μL, 33.2 mmol). The reaction was stirred at 0° ° C. for 10 min and then stirred at room temperature for 4 h. The reaction was dripped into a cooled (0° C.) NaHCO3 solution, extracted with EtOAc, washed with NaHCO3 and brine, dried over Na2SO4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0→10% MeOH/DCM) afforded the product as a brown solid (0.25 g, 53% yield). LCMS (ESI) m/z: [M+H] calcd for C70H99N5O15S: 1282.69; found 1282.6.


Monomer 23. Synthesis of 40(S)-(1-(5-(3-(1,2,3-triazol-5-yl)phenyl)-2-(4-(prop-2-yn-1-yl)piperazin-1-yl)pyrimidine rapamycin



embedded image


Step 1: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 2

Intermediate 2 (0.4 g, 0.358 mmol, 1.0 equiv) and TMS-2-(4-(prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (178 mg, 0.447 mmol, 1.25 equiv) were dissolved in dioxane (3.57 mL). Next, silver(I) oxide (247 mg, 1.07 mmol, 3.0 equiv) and XPhosPd G2 (112 mg, 0.143 mmol, 0.4 equiv) were added. The reaction was heated at 60° C. for 24 h. The reaction was diluted with EtOAc, washed with NH4Cl and brine, dried over Na2SO4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0→5% MeOH/DCM) to yield the crude product as a brown solid (0.4 g, 86% yield). LCMS (ESI) m/z: [M+H] calcd for C73H104N8O12Si: 1313.76; found 1313.9.


Step 2: Desilylation

Rapamycin TMS alkyne (0.350 g, 0.266 mmol, 1.0 equiv) was dissolved in THF (2.65 mL) and pyridine (1.77 mL) in a plastic vial. The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (412 μL, 15.9 mmol, 60.0 equiv) was added. The reaction was stirred at 0° C. for 10 min and then stirred at room temperature for 5 h. The reaction was dripped into a cooled (0° C.) NaHCO3 solution, extracted with EtOAc, washed with NaHCO3 and brine, dried over Na2SO4, filtered, and concentrated to an oil. The oil was purified by silica gel chromatography (0→10% MeOH/DCM) to yield the product as a brown solid (0.292 g, 88% yield). LCMS (ESI) m/z: [M+H] calcd for C70H96N8O12: 1241.72; found 1241.7.


Monomer 24. Synthesis of 40-O-(3-(2-(4-(prop-2-yn-1-yl)piperazin-1-yl)pyrimidin-5-yl)benzyl) rapamycin



embedded image


Step 1: Synthesis of 2-(piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine hydrochloride

To a solution of tert-butyl 4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazine-1-carboxylate (2 g, 5.12 mmol, 1 equiv) in dioxane (8.73 mL) was added HCl (4M in dioxane) (12.8 mL, 51.2 mmol, 10 equiv). The reaction stirred for 2 h at room temperature and concentrated to a solid. The crude material was suspended in DCM and concentrated under reduced pressure twice and then dried under reduced pressure for 18 h to yield the product as a yellow solid (1.7 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C14H23BN4O2: 291.19; found 291.1.


Step 2: Synthesis of 5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-2-(4-(3-(trimethylsilyl)prop-2-yn-1-yl)piperazin-1-yl)pyrimidine

Potassium t-butoxide (452 mg, 4.03 mmol, 1.2 equiv) was dissolved in MeOH (10 mL) and then 2-(piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (1.1 g, 3.36 mmol, 1 equiv) was added. The reaction stirred for 15 min at room temperature and then was concentrated to a yellow solid. The yellow solid and 3-(trimethylsilyl)propargyl bromide (602 μL, 3.69 mmol, 1.1 equiv) were suspended in MeCN (13.4 mL). Next potassium carbonate (649 mg, 4.70 mmol, 1.4 equiv) was added. The reaction was stirred at room temperature for 24 h. The reaction was diluted with EtOAc, washed with NH4C1 and brine, dried over Na2SO4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0→50% EtOAc/heptane) to yield the product as a white solid (0.350 g, 25% yield). LCMS (ESI) m/z: [M+H] calcd for C20H33BN4O2Si: 401.25; found 401.1.


Step 3: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 1

Intermediate 1 (0.37 g, 0.3419 mmol, 1 equiv) and TMS-2-(4-(prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (171 mg, 0.4273 mmol, 1.25 equiv) were dissolved in dioxane (3.41 mL). Next, silver(I) oxide (236 mg, 1.02 mmol, 3 equiv) and XPhosPd G2 (107 mg, 0.1367 mmol, 0.4 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was diluted with EtOAc, washed with NH4Cl and brine, dried over Na2SO4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0→5% MeOH/DCM) to yield the product as a brown solid (0.230 g, 50% yield). LCMS (ESI)m/z: [M+H] calcd for C72H105N5O13Si: 1276.75; found 1276.6.


Step 4: Desilylation

Rapamycin TMS alkyne (0.232 g, 0.182 mmol, 1 equiv) was dissolved in THF and pyridine (606 μL) in a plastic vial. The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (282 μL, 10.9 mmol, 60 equiv) was added. The reaction stirred at 0° C. for 10 min and then at room temperature for 3 h. The reaction was dripped into a cooled (0° C.) NaHCO3 solution, extracted with EtOAc, washed with NaHCO3 and brine, dried over Na2SO4, filtered, and concentrated to an oil. The oil was purified by silica gel chromatography (0→10% DCM/MeOH) to yield the product as a yellow solid (0.130 g, 60% crude yield). LCMS (ESI) m/z: [M+Na] calcd for C69H97N5O13: 1226.70; found 1226.7.


Monomer 25. Synthesis of 16(S)-furanyl-40-O-(5-hexynyl) rapamycin



embedded image


To a stirred solution of freshly purified hex-5-yn-1-yl trifluoromethanesulfonate (0.969 g, 4.21 mmol, 4.0 equiv) in DCM (4 mL) at 0° C. was added solid 2,6-di-tert-butyl-4-methylpyridine (0.432 g, 2.10 mmol, 2.0 equiv) in one portion. The light yellow mixture was stirred for 5 min before solid 16(S)-furanyl rapamycin (1.00 g, 1.05 mmol, 1.0 equiv) was added in one portion. The yellow reaction mixture was then allowed to warm to room temperature overnight. After 18 h the solution was diluted with DCM and washed with sat. aqueous NaHCO3 solution, brine, dried, and concentrated under pressure. Purification by silica gel chromatography (0→45% EtOAc/hexanes) provided the desired product (0.10 g, 9% yield) as a white foam. LCMS (ESI) m/z: [M+Na] calcd for C60H87NO13: 1052.61; found 1052.6.


Monomer 26. Synthesis of 16(S)-methyl carbamate-40-O-(5-hexynyl) rapamycin



embedded image


To a stirred solution of freshly purified hex-5-yn-1-yl trifluoromethanesulfonate (0.416 g, 1.81 mmol, 4.0 equiv) in 2.0 mL of DCM at 0° C. was added solid 2,6-di-tert-butyl-4-methylpyridine (0.278 g, 1.35 mmol 3.0 equiv) in one portion. The light yellow mixture was stirred for 5 min before solid 16(S)-methyl carbamate rapamycin (0.425 g, 0.444 mmol, 1.0 equiv) was added in one portion. The yellow reaction mixture was then allowed to warm to room temperature. After 18 h the reaction mixture was diluted with EtOAc and filtered through Celite. The filtrate was washed with sat. aqueous NaHCO3 solution, brine, dried, and concentrated under reduced pressure. Purification by silica gel chromatography (0→→30% acetone/hexanes) provided the desired product (0.12 g, 26% yield) as a white foam. LCMS (ESI) m/z: [M+Na] calcd for C58H88N2O14: 1059.61; found 1059.5.


Monomers 27 and 28



embedded image


Step 1

To a dry reaction flask is added CIG-modified rapamycin (1.0 equiv) followed by heptanes and DCM. 3-Bromobenzyl bromide (8.0 equiv) and silver(I) oxide (12.0 equiv) are added to the solution and the reaction flask is capped and heated until full consumption of C16-modified rapamycin, as determined by LCMS analysis. The reaction is then cooled to room temperature, diluted with EtOAc, filtered through Celite, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford the product of Step 1.


Step 2

The product of step 1 (1.0 equiv) is dissolved in dioxane. To this solution is added the pinacol boronate substrate (3.0 equiv), followed by Ag2O (9.0 equiv) and XPhos Pd G2 (40 mol %). The reaction is capped and heated until consumption of the rapamycin-based starting material. At this point, the reaction mixture is cooled to room temperature, filtered over Celite, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford the product of step 2.


Step 3

The product of step 2 (1.0 equiv) is dissolved in THF and pyridine and cooled to 0° C. 70% HF-pyridine is added dropwise to the reaction. Following complete addition, the reaction is stirred at 0° C. and then at room temperature. Upon reaction completion, as determined by LCMS analysis, the reaction is cooled to 0° C. and poured slowly into ice cold sat. aq. NaHCO3. This aqueous layer is extracted with EtOAc and the organic layer is dried over Na2SO4, filtered, and concentrated under reduced pressure. This crude product mixture is purified to afford product.


Monomer 29. Synthesis. of 40-O-(3-(2-(3-(hydroxymethyl)-4-(prop-2-yn-1-yl)piperazin-1-yl)pyrimidin-5-yl)benzyl) rapamycin



embedded image


embedded image


Step 1: Synthesis of tert-butyl 2-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate

To a solution of tert-butyl 2-(hydroxymethyl)piperazine-1-carboxylate (5 g, 23.1 mmol, 1.0 equiv) in DCM (12.8 mL) was added tert-butyl(chloro)diphenylsilane (7.61 g, 27.7 mmol, 1.2 equiv) and imidazole (3.45 g, 50.8 mmol, 2.2 equiv). The reaction stirred for 18 h at room temperature. The reaction was loaded directly onto a silica gel column and purified by normal phase chromatography (0→10% MeOH/DCM) to yield the product as a white solid (10 g, 95% yield). LCMS (ESI) m/z: [M+H] calcd for C26H38N2O3Si: 455.27; found 455.2.


Step 2: Synthesis of tert-butyl 4-(5-bromopyrimidin-2-yl)-2-(((tert-butyldiphenylsilyl)oxy)-methyl)piperazine-1-carboxylate

2,5-Dibromopyrimidine (4.32 g, 18.2 mmol, 1.0 equiv) and tert-butyl 2-(((tert-butyldiphenylsilyl)oxy)methyl)piperazine-1-carboxylate (10 g, 21.9 mmol, 1.2 equiv) were dissolved in MeCN (91.0 mL). Next potassium carbonate (5.04 g, 36.5 mmol, 2.0 equiv) was added. The reaction was heated at 75° C. for 4 h. The reaction was then filtered and concentrated under reduced pressure to a white foam. The foam was purified by silica gel chromatography (0→5% EtOAc/heptane) to yield the product as a white solid (10.2 g, 92% yield). LCMS (ESI) m/z: [M+H] calcd for C30H39BrN4O3Si: 611.20; found 611.0.


Step 3: Synthesis of tert-butyl 2-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazine-1-carboxylate

To a solution of tert-butyl 4-(5-bromopyrimidin-2-yl)-2-(((tert-butyldiphenylsilyl)oxy)-methyl)piperazine-1-carboxylate (8.2 g, 13.4 mmol, 1.0 equiv) and bis(pinacolato)diboron (5.07 g, 20.0 mmol, 1.5 equiv) in dioxane (107 mL) was added potassium acetate (3.93 g, 40.1 mmol, 3.0 equiv) and bis(triphenylphosphine)palladium(II) dichloride (1.88 g, 2:68 mmol, 0.2 equiv). The reaction was heated to 80° C. for 6 h. The reaction was diluted with EtOAc, washed with NH4Cl and brine, dried over Na2SO4, filtered, and concentrated under reduced pressure. Purification by chromatography on silica gel (0→30% EtOAc/heptane) afforded the product as a white solid (7.6 g, 69% yield). LCMS (ESI) m/z: [M+H] calcd for C36H51BN4O5Si: 659.38; found 659.3.


Step 4: Synthesis of 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine hydrochloride

tert-Butyl 2-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidin-2-yl)piperazine-1-carboxylate (7.6 g, 11.5 mmol, 1.0 equiv) was dissolved in dioxane (19.6 mL). Next HCl (4M in dioxane) (28.5 mL, 114 mmol, 10.0 equiv) was added. the reaction stirred for 2 h and then concentrated under reduced pressure to a solid. The solid was suspended in DCM and concentrated twice under reduced pressure. The solid was then dried under reduced pressure for 18 h to yield the product as a yellow solid (8.22 g, 100% yield). LCMS (ESI) m/z: [M+H] calcd for C31H43BN4O3Si: 559.32; found 559.2.


Step 5: Synthesis of 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(3-(trimethylsilyl)prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine

To a solution of potassium t-butoxide (123 mg, 1.10 mmol, 1.2 equiv) in MeOH (10 mL) was added 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine hydrochloride (1.5 g, 2.52 mmol, 1.0 equiv). The reaction was stirred for 15 min and was concentrated under reduced pressure. The subsequent free based amine and 3-(trimethylsilyl)propargyl bromide (534 μL, 3.27 mmol, 1.3 equiv) were suspended in MeCN (10.0 mL). Potassium carbonate (1.04 g, 7.56 mmol, 3.0 equiv) was added to the reaction and the mixture was stirred at room temperature for 18 h. The reaction was filtered and the solid washed with EtOAc. The filtrate was concentrated and purified by silica gel chromatography (0→50% EtOAc/heptane) to yield the product as a white solid (0.77 g, 46% yield). LCMS (ESI) m/z: [M+H] calcd for C37H53BN4O3Si2: 669.38; found 669.3.


Step 6: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 1

Intermediate 1 (0.35 g, 0.323 mmol, 1 equiv) and 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(3-(trimethylsilyl)prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (269 mg, 0.403 mmol, 1.25 equiv) were dissolved in dioxane (3.22 mL). Next XPhosPd G2 (101 mg, 0.129 mmol, 0.4 equiv) and silver(I) oxide (224 mg, 0.968 mmol, 3 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was diluted with EtOAc, washed with NH4Cl and brine, dried over Na2SO4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0→10% MeOH/DCM) to yield the product as a brown solid (0.350 g, 70% yield). LCMS (ESI) m/z: [M+H] calcd for C89H125N5O14Si2: 1544.88; found 1544.90.


Step 7: Desilylation

To a solution of rapamycin TMS alkyne (0.5 g, 0.3235 mmol, 1 equiv) in THF (3.23 mL) and pyridine (2.15 mL) at 0° C. was added HF-pyridine (70:30) (755 μL, 29.1 mmol, 90 equiv). The reaction stirred at 0° C. for 10 min and then stirred at room temperature for 6 h. The reaction was dripped into a cooled (0° C.) NaHCO3 solution, extracted with EtOAc, washed with NaHCO3 and brine, dried over Na2SO4, filtered, and concentrated understood an oil. The oil was purified by silica gel chromatography (0%→10% MeOH/DCM) to yield the product as a brown solid (0.115 g, 29% yield). LCMS (ESI) m/z: [M+H] calcd for C70H99N5O14: 1234.72; found 1234.7.


Monomer 30



embedded image


Step 1: Coupling of Substituted Pyrimidinylpiperazine to Intermediate 2

Intermediate 2 (0.4 g, 0.3576 mmol, 1.0 equiv) and 2-(3-(((tert-butyldiphenylsilyl)oxy)methyl)-4-(3-(trimethylsilyl)prop-2-yn-1-yl)piperazin-1-yl)-5-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)pyrimidine (298 mg, 0.447 mmol, 1.25 equiv) were dissolved in dioxane (3.57 mL). Next XPhosPd G2 (112 mg, 0.143 mmol, 0.4 equiv) and silver(I) oxide (247 mg, 1.07 mmol, 3.0 equiv) were added. The reaction was heated to 60° C. for 24 h. The reaction was diluted with EtOAc, washed with NH4C1 and brine, dried over Na2SO4, filtered, and concentrated to a foam. The foam was purified by silica gel chromatography (0→0.5% MeOH/DCM) to yield the product as a brown solid (0.530 g, 94% yield). LCMS (ESI) m/z: [M+H] calcd for C90H124N8O13Si2: 1581.89; found 1581.85.


Step 2: Desilylation

Rapamycin alkyne (0.55 g, 0.348 mmol, 1.0 equiv) was dissolved in THF (3.47 mL) and pyridine (2.31 mL) in a plastic vial. The reaction was cooled to 0° C. in an ice bath. Next HF-pyridine (70:30) (812 μL, 31.3 mmol, 90.0 equiv) was added. The reaction stirred at 0° C. for 10 min and then was stirred at room temperature for 6 h. The reaction was dripped into a cooled (0° C.) NaHCO3 solution, extracted with EtOAc, washed with NaHCO3 and brine, dried over Na2SO4, filtered, and concentrated to an oil. The oil was purified by silica gel chromatography (0→10% MeOH/DCM) to yield the product as a brown solid (0.530 g, 94% yield). LCMS (ESI) m/z: [M+H] calcd for C71H98N8O13: 1271.73; found 1271.6.


Monomers 74, 75, 31, and 32



embedded image


Step 1

To a dry reaction flask is added C16-modified rapamycin (1.0 equiv) followed by 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) and DCM. The reaction is cooled to −10° C. and trifluoromethanesulfonic anhydride (1.2 equiv) is added dropwise to reaction. After stirring for 30 min, sodium azide (4.8 equiv) is added to the reaction as a solid in one portion. Upon full consumption of rapamycin starting material, the reaction is quenched slowly with sat. aq. NaHCO3 and allowed to warm to room temperature. The reaction mixture is transferred to a separatory funnel and the organic layer washed with sat. aq. NaCl. The organic layer is dried over Na2SO4, filtered, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford product of step 1.


Step 2

The product of step 1 (1.0 equiv) and triphenylphosphine (1.0 equiv) are dissolved in THF. H2O is added to solution. The reaction is heated until consumption of azido-rapamycin as determined by LCMS and/or TLC analysis. The reaction is then cooled to room temperature and concentrated under reduced pressure. The resulting residue is purified by silica gel chromatography to afford the product of step 2, namely either monomer depending on choice of starting material.


Step 3

The product of step 2 is then suspended in anhydrous MeCN and to this suspension is added propargyl chloroformate (1.5 equiv) and triethylamine (5.0 equiv). The reaction is heated and monitored by TLC and LCMS. Upon completion of reaction, the reaction is diluted with H2O and EtOAc. The reaction mixture is transferred to a separatory funnel, and the organic layer is washed with brine. The organic layer is dried over Na2SO4, filtered, concentrated under reduced pressure and then purified by silica gel chromatography to afford product, namely either monomer depending on choice of starting material.


Monomer 33. Synthesis of 40-O-(3′-ethynyl-[1,1′-biphenyl]-3-yl) rapamycin



embedded image


The synthesis is carried out by Suzuki cross-coupling of Intermediate 1 with trimethyl((3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethynyl)silane, followed by TMS-cleavage using HF-pryidine to give the titled Monomer.


Monomer 34. Synthesis of 40(S)-(1-(5-(3′-ethynyl-[1,1′-biphenyl]-3-yl)-1,2,3-triazole) rapamycin



embedded image


Step 1: Coupling of trimethyl((3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethynyl)silane to Intermediate 2

To an oven-dried reaction flask was added Intermediate 2 (0.10 g, 89.2 μmol, 1 equiv) followed by dioxane (900 μL). Trimethyl((3-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)ethynyl)silane (80.1 mg, 267 μmol, 3.0 equiv), XPhos Pd G2 (28.0 mg, 35.6 μmol, 0.4 equiv), and silver(I) oxide (185 mg, 802 μmol, 9.0 equiv) were sequentially added to the reaction solution. The reaction mixture was heated to 60° C. until full consumption of the starting material, as determined by LCMS analysis. The reaction mixture was cooled to room temperature, diluted with EtOAc (2 mL), and filtered through a plug of Celite. The filtrate was concentrated under reduced pressure to provide a brown oil. Purification by normal phase chromatography (0→55% EtOAc/heptanes) provided a white solid (41.9 mg, 39% yield). LCMS (ESI) m/z: [M+H] calcd for C70H96N4O12Si: 1213.69; found 1213.7.


Step 2: Desilylation

To a plastic vial was added the product of step 1 (30 mg, 24.7 μmol, 1 equiv), THF (493 μL), and pyridine (82 μL). The reaction solution was cooled to 0° C. and then HF-pyridine (38.3 μL, 1.5 mmol, 1.5 equiv) was added. The reaction solution was stirred at 0° C. for 10 min and then stirred at room temperature until full consumption of the starting material, as determined by LC-MS analysis. The reaction solution was poured into a saturated solution of NaHCO3 at 0° C. The resulting solution was extracted with EtOAc (3×10 mL), and the organic layers were washed with sat. NaHCO3 and brine, dried with Na2SO4, and filtered. The filtrate was concentrated under reduced pressure to provide an oil. Purification by normal phase chromatography (0→60% EtOAc/heptane) provided a white solid (10.4 mg, 37% yield). LCMS (ESI) m/z: [M+H] calcd for C67H88N4O12: 1141.65; found 1141.6.


Monomer 35. Synthesis of 40(R)—O-(propargyl carbamate) rapamycin



embedded image


A solution of 40(R) 4-nitrophenyl carbonate rapamycin (2.42 g, 2.24 mmol, 1 equiv) in DCM (77 mL) was cooled to 0° C. and treated dropwise with a solution of propargylamine (0.72 mL, 11.2 mmol, 5.0 equiv) in DCM (9.7 mL). The reaction mixture was stirred and allowed to warm to room temperature over 1 h followed by stirring at room temperature while monitoring the reaction by HPLC. After 49 h, the reaction was concentrated to a yellow, viscous oil which was purified by flash chromatography (25→45% EtOAc/DCM) to yield the product (1.00 g, 44% yield) as a colorless viscous oil that formed a glass/stiff foam under reduced pressure. LCMS (ESI) m/z: [M+H2O] calcd for C55H82N2O14: 1012.60; found 1012.6; m/z [M+HCO2] calcd for C56H82N2O14: 1039.57; found 1039.8.


Monomers 36 and 37



embedded image


Step 1

To a dry reaction flask is added C16-modified rapamycin (1.0 equiv) followed by triethylamine (5.0 equiv) and DCM. The solution is cooled to −78° C. and 4-nitrophenylchloroformate (1.5 equiv) is added in a single portion. The reaction is stirred at −78° C., followed by warming to room temperature. Upon completion of the reaction, as determined by LCMS analysis, the reaction is diluted with H2O and DCM. The mixture is transferred to a separatory funnel and the organic layer washed with sat. aq. NaCl, dried over Na2SO4, filtered, and concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to give the product of step 1.


Step 2

The product of step 1 (1.0 equiv) is dissolved in DCM. A solution of propargylamine (5.0 equiv) and pyridine (5.0 equiv) in DCM is added to the reaction dropwise and the reaction mixture stirred while warming to room temperature. Upon consumption of rapamycin starting material, as determined by LCMS and TLC analysis, the reaction is concentrated under reduced pressure. The resultant residue is purified by silica gel chromatography to afford the product of step 2.


Monomer 38. Synthesis of 32-O-(prop-2-yn-1-yl) oxime rapamycin



embedded image


To a solution of rapamycin (200.0 mg, 0.219 mmol, 1 equiv) in MeOH (5.00 mL) was added sequentially sodium acetate (0.0718 g, 0.875 mmol) and 3-(aminooxy)prop-1-yne hydrochloride (0.0941 g, 0.875 mmol, 4.0 equiv) at room temperature. The reaction was stirred at room temperature for 72 h. The reaction mixture was diluted with EtOAc (20 mL) and washed with 20 mL portions of H2O and brine. The solution was dried over Na2SO4, filtered, and concentrated. The resulting residue was purified via combiflash chromatography (0÷80% EtOAc/hex) to yield the Z isomer followed by the E isomer, both as colorless oils. Both products were taken up separately in 95% aq MeCN and lyophilized to white powders. Z isomer: LCMS (ESI) m/z: [M+Na] calcd for C54H82N2O13Na: 989.57; found 989.5. E isomer: LCMS (ESI) m/z [M+Na] calcd for C54H82N2O13: 989.57; found 989.5.


Monomer 39



embedded image


The preparation of the monomer proceeds by reacting rapamycin with prop-2-yn-1-yl carbamate in the presence of TFA.


Monomer 40. Synthesis of 28-proparygylcarbamate rapamycin



embedded image


The preparation of the monomer proceeds from the known C28-paranitrophenylcarbonate of rapamycin by reacting with propargylamine in the presence of pyridine.


Reference for preparation of C28-p-nitrophenylcarbonate intermediate: Abel, M.; Szweda, R.; Trepanier, D.; Yatscoff, R. W.; Foster, R. T. 2007. Rapamycin carbohydrate derivatives. U.S. Pat. No. 7,160,867, which is incorporated by reference in its entirety.


Monomer 41. Synthesis of 40(S)-(1-(5-(3-ethynylphenyl)-1,2,3-triazole)) rapamycin



embedded image


To an oven-dried reaction flask was added chloro(pentamethylcyclopentadienyl) (cyclooctadiene)ruthenium(II) (37.0 mg, 0.0975 mmol, 0.46 equiv) followed by toluene (2.35 mL). The mixture was purged with N2 before adding 40(S)-azido rapamycin (0.200 g, 0.212 mmol, 1.0 equiv) and then 1,3-diethynylbenzene (0.0534 g, 0.424 mmol, 2.0 equiv). The flask was purged with N2 and stirred at 60° C. overnight. After stirring for 15 h the reaction mixture was concentrated to a dark brown residue. Purification by silica gel chromatography (10→60% EtOAc/hexanes) afforded the product as a grey residue (0.077 g, 34% yield). LCMS (ESI) m/z: [M+H] calcd for C61H84N4O12: 1065.62; found 1065.6.


Monomer 42. Synthesis of 16(S)-(2,4,6-trimethoxyphenyl) 40(R)—O-(1-hexynyl) rapamycin



embedded image


To a stirred solution of 16(S)-(2,4,6-trimethoxyphenyl) rapamycin (0.090 g, 0.0856 mmol, 1 equiv) in chloroform (0.34 mL) at −40° C. was added DIPEA (0.745 mL, 4.28 mmol, 50 equiv) followed by hex-5-yn-1-yl trifluoromethanesulfonate (0.200 g, 0.868 mmol, 10.1 equiv). After 15 min at −40° C., the solution was warmed to room temperature and then heated to 60° C. for 18 h. The reaction was cooled to room temperature and diluted with H2O (20 mL) and EtOAc (15 mL). The layers were separated and the aqueous layer was extracted with EtOAc (3×). The combined organic layers were dried with MgSO4, filtered, and concentrated to provide a red oil. The crude material was purified by silica gel chromatography (0→60% EtOAc/heptane) to afford the product as a white solid (0.041 g, 43% yield). LCMS (ESI) m/z: [M+H] calcd for C65H95NO15: 1130.68; found 1130.7.


Monomers 43. Synthesis of 32(R)-ethoxy-26-O-(prop-2-yn-1-yl) oxime rapamycin



embedded image


Step 1: Synthesis of 32(R)-ethoxy-28,40-bistriethylsilyl rapamycin

A solution of 32-hydroxy-28,40-bistriethylsilyl rapamycin (773 mg, 0.675 mmol, 1.0 equiv) in chloroform (19 mL) was treated with N,N,N′,N′-tetramethyl-1,8-naphthalenediamine (1.85 g, 8.63 mmol, 12.8 equiv) along with freshly dried 4 Å molecular sieves. The mixture was stirred for 1 h at room temperature and treated with triethyloxonium tetrafluoroborate (1.51 g, 7.95 mmol, 11.8 equiv) in one portion at room temperature. The reaction mixture was stirred for 3 h, at which point the reaction mixture was diluted with DCM and filtered through Celite, washing the filter pad with additional DCM. The combined filtrates were washed twice with 1M HCl, once with saturated NaHCO3 solution, and dried over Na2SO4. The solution was filtered and concentrated to a residue. The crude residue was treated with MTBE and filtered to remove polar insoluble material. The filtrate was concentrated and purified by silica gel chromatography (5→25% EtOAc/hex) to afford the product as a foam (516 mg, 65% yield). LCMS (ESI) m/z: [M+Na] calcd for C65H113NO13Si2 1194.77; found 1194.6.


Step 2: Synthesis of 32(R)-ethoxy rapamycin

32(R)-ethoxy-28,40-bistriethylsilyl rapamycin (131 mg, 0.112 mmol, 1.0 equiv) was dissolved in THF (1.3 mL), cooled to 0° C. and treated with pyridine (271 μL, 3.35 mmol, 3.4 equiv) followed by HF-pyridine (51 μL, 1.8 mmol, 1.8 equiv). The reaction flask was capped and stored in the fridge for 3 days, at which point the reaction mixture was poured into 20 mL cold saturated NaHCO3 solution and the aqueous layer extracted with EtOAc (3×20 mL). The combined organic layers were washed with 1M HCl (2×20 mL), saturated NaHCO3 solution (20 mL), and brine. The solution was dried over Na2SO4, filtered, and concentrated. The residue was taken up in MeOH (1.5 mL) and added dropwise to H2O (20 mL), the product flask was rinsed with additional MeOH (0.5 mL), which was added dropwise to the slurry. The solids were filtered through a glass frit and washed with additional H2O to provide the product as a white powder (53 mg, 51% yield). LCMS (ESI) m/z: [M+Na] calcd for C53H85NO13: 966.59; found 966.5.


Step 3: Synthesis of 32(R)-ethoxy-26-O-(prop-2-yn-1-yl) oxime rapamycin

To a solution of 32(R)-ethoxy rapamycin (1.49 g, 1.53 mmol, 1.0 equiv) and 3-(aminooxy)prop-1-yne hydrochloride (849 mg, 7.89 mmol, 5.2 equiv) in pyridine (7.5 mL) was added 4M HCl in 1,4-dioxane (2.76 mL, 11.04 mmol, 7.2 equiv), dropwise. The reaction mixture was then heated to 50° C. for 3 days. The mixture was cooled to ambient temperature and then added dropwise to H2O. The resulting solids were filtered, washed with H2O and taken up in EtOAc. The organic layer was washed sequentially with 1 M HCl, sat. NaHCO3 solution, and brine, dried over Na2SO4, and concentrated to a thick viscous oil. The oil was purified by silica gel chromatography (2:3→4:1 EtOAc/hexanes) to afford the desired product as a white solid (640 mg, 42% yield, mixture of E/Z isomers). LCMS (ESI) m/z: [M+Na] calcd for C56H88N2O13: 1019.62; found 1019.8.


Monomer 44. Synthesis of 32(R)-methoxy 40(R)—O-(1-hexynyl) rapamycin



embedded image


A solution of hex-5-yn-1-yl trifluoromethanesulfonate (2.12 g, 9.20 mmol, 4.0 equiv) in DCM (7.6 mL) was cooled at 0° C. and treated with 2,6-di-tert-butyl-4-methylpyridine (1.89 g, 9.20 mmol, 4.0 equiv) in one portion. After stirring for 5 min, the reaction mixture was treated with 32(R)-methoxy rapamycin (2.14 g, 2.30 mmol, 1.0 equiv) in one portion. The reaction mixture was stirred at 0° C. for 15 min followed by warming to room temperature. After 24 h at room temperature the reaction mixture was diluted with DCM (100 mL) and the organic phase was washed with sat, NaHCO3 solution, H2O, and brine and then dried over Na2SO4. The solution was filtered and concentrated to yield a light yellow viscous oil. The crude material was purified by silica gel chromatography (20-50% EtOAc/hex) to afford the desired product as a colorless foam (0.73 g, 31% yield). LCMS (ESI) m/z: [M+Na] calcd for C58H91NO13: 1032.64; found: 1032.7.


Monomer 45. Synthesis of 40(R)—O-1-(3,3-dimethylhex-5-ynyl) rapamycin



embedded image


Step 1: Synthesis of 3,3-dimethylhex-5-yn-1-yl trifluoromethane sulfonate

To a dry reaction flask was added 3,3-dimethylhex-5-yn-1-ol (0.62 g, 4.9 mmol, 1.0 equiv) followed by DCM (4.8 mL) before being cooled to −60° C. Trifluoromethanesulfonic anhydride (0.95 mL, 5.66 mmol, 1.1 equiv) was added to the reaction, dropwise, while maintaining the temperature below −60° C. After 45 min at −60° C., the reaction was quenched by pouring the mixture into cold sat. KH2PO4 (100 mL). The layers were separated and the organic layer was concentrated under reduced pressure to give a red/brown oil. The crude oil was purified by filtography on 10 g silica (100 mL 50% EtOAc/hexanes) to yield a brown oil (0.92 g, 72% yield).


Step 2: Synthesis of 40(R)—O-1-(3,3-dimethylhex-5-ynyl) rapamycin

To a solution of freshly purified 3,3-dimethylhex-5-yn-1-yl trifluoromethane sulfonate (0.91 g, 3.5 mmol, 4.0 equiv) in DCM (6.8 mL) at 0° C. was added 2,6-di-tert-butyl-4-methylpyridine (0.36 g, 1.7 mmol, 2.0 equiv) in one portion. After stirring for 20 min, rapamycin (0.80 g, 0.88 mmol, 1.0 equiv) was added and the mixture was stirred at 0° C. for 1 h before warming to room temperature and stirring overnight. The reaction mixture was diluted with DCM (100 mL) and then washed with sat. NaHCO3 (100 mL) and brine (100 mL). The organic layer was concentrated under reduced pressure to yield a green residue. Purification by silica gel chromatography (0→10% acetone/DCM) followed by re-purification by reverse phase chromatography (MeCN/H2O) afforded the product as an off-white residue (0.071 g, 8% yield). LCMS (ESI) m/z: [M+Na] calcd for C59H91NO13: 1044.64; found 1044.5.


Monomer 46. Synthesis of 32-acetohydrazone 40(R)—O-(1-hexynyl) rapamycin



embedded image


The reported monomer can be prepared following the reported methods shown.


Reference for this transformation: Failli, A. A.; Steffan, R. J. 1991. Rapamycin Hydrazones. U.S. Pat. No. 5,120,726. American Home Products Corporation, which is incorporated by reference in its entirety.


Monomer 47. Synthesis of 32-phenylsemicarbazone 40(R)—O-(1-hexynyl) rapamycin



embedded image


The reported monomer can be prepared following the reported methods shown.


Reference for this transformation: Failli, A. A.; Steffan, R. J. 1991. Rapamycin Hydrazones. U.S. Pat. No. 5,120,726. American Home Products Corporation, which is incorporated by reference in its entirety.


Monomer 48. Synthesis of 32-phenylsemithiocarbazone 40(R)—O-(1-hexynyl) rapamycin



embedded image


The reported monomer can be prepared following the reported methods shown.


Reference for this transformation: Failli, A. A.; Steffan, R. J. 1991. Rapamycin Hydrazones. U.S. Pat. No. 5,120,726. American Home Products Corporation, which is incorporated by reference in its entirety.


Monomer 49. Synthesis of 32-hydrazone 40(R)—O-(1-hexynyl) rapamycin



embedded image


To a solution of 40-(R)—O-(1-hexynyl) rapamycin (0.900 g, 0.905 mmol, 1.0 equiv) in MeOH (12.4 mL) was added a 1M solution of hydrazine hydrate (2.72 mmol, 3.0 equiv) in MeOH. The reaction mixture was stirred at room temperature overnight. The reaction mixture was then concentrated under reduced pressure to provide a tan viscous oil. The crude material was purified by silica gel chromatography (0→5% MeOH/DCM) to give the product (127 mg, 14% yield) as a white stiff foam. LCMS (ESI) m/z: [M+Na] calcd for C57H89N3O12: 1030.63; found: 1030.6.


Monomer 50. Synthesis of 32-amino 40(R)—O-(1-hexynyl) rapamycin



embedded image


The reported monomer can be prepared following the reported methods shown.


Reference for this transformation: Watanabe, M.; Tanaka, K.; Mild, T.; Murata, K. Process for Preparing Amine Compound. US20120065426. Kanto Kagaku Kabushiki Kaisha, which is incorporated by reference in its entirety.


Monomer 51. Synthesis: of 32-O-methyl oxime 40(R)—O-(1-hexynyl) rapamycin



embedded image


To a solution of 40(R)—O-(1-hexynyl) rapamycin (400 mg, 0.402 mmol, 1.0 equiv) in MeOH (9.19 mL) was added sodium acetate (132 mg, 1.61 mmol, 4.0 equiv) followed by methoxylamine hydrochloride (134 mg, 1.61 mmol, 4.0 equiv) in one portion at room temperature. The reaction mixture was stirred at room temperature overnight, at which point the reaction mixture was diluted with H2O (15 mL) and extracted with EtOAc (2×20 mL). The combined organic phase was washed with H2O, brine and dried over MgSO4. The solution was filtered and concentrated under reduced pressure to provide a colorless foam. The crude material was purified by reverse phase chromatography (10% to 100% MeCN/H2O). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders to afford both the Z-oxime (180 mg, 44.6% yield) and the E-oxime (50 mg, 12.4% yield). LCMS (ESI) m/z: [M+Na] calcd for C58H90N2O13: 1045.63; found: 1046.0.


Monomer 52. Synthesis of 32-O-benzyl oxime 40(R)—O-(1-hexynyl) rapamycin



embedded image


To a solution of 40(R)—O-(1-hexynyl) rapamycin (0.50 g, 0.50 mmol, 1.0 equiv) in MeOH (11.5 mL) was added sodium acetate (0.17 g, 2.0 mmol, 4.0 equiv) and O-benzylhydroxylamine hydrochloride (0.33 g, 2.1 mmol, 4.0 equiv). After 7 h the reaction mixture was diluted with H2O (60 mL) and extracted with EtOAc (2×80 mL). The organic phase was washed with H2O, brine, dried with MgSO4, and concentrated under reduced pressure to provide a colorless oil. The crude material was purified by chromatography on silica gel (0→50% EtOAc/hexanes) to afford the product (180 mg, 32.6% yield) as a clear colorless oil. LCMS (ESI) m/z: [M+H] calcd for C64H94N2O13: 1099.68; found 1099.9.


Monomer 53. Synthesis of 32(R)-hydroxy 40(R)—O-(1-hexynyl) rapamycin



embedded image


To a solution of hex-5-yn-1-yl trifluoromethanesulfonate (4.25 g, 18.5 mmol, 4.0 equiv) in DCM (15.2 mL) at 0° C. was added 2,6-di-tert-butyl-4-methylpyridine (3.79 g, 18.5 mmol, 4.0 equiv). After stirring for 5 min, the reaction mixture was treated with 32(R)-hydroxy-rapamycin (4.23 g, 4.62 mmol, 1.0 equiv) and the reaction was stirred at 0° C. for 15 min followed by warming to room temperature. After 23 h, the reaction mixture was diluted with DCM (100 mL) and the organic phase was washed with 100 mL portions of sat NaHCO3 solution, H2O, brine and dried over Na2SO4. The solution was filtered and concentrated to yield a dark green viscous oil. The crude material was purified by silica gel chromatography (10→60% acetone/hexane) to provide the product (1.30 g, 28% yield) as a tan solid/stiff foam. LCMS (ESI) m/z: [M+Na] calcd for C57H89NO13: 1018.62; found: 1018.5.


Monomer 54. Synthesis of 32-oxime 40(R)—O-(1-hexynyl) rapamycin



embedded image


To a solution of 40(R)-(hex-5-yn-1-yloxy)-rapamycin (400 mg, 0.402 mmol, 1.0 equiv) in MeOH (9.2 mL) was added sodium acetate (132 mg, 1.61 mmol, 4.0 equiv) followed by hydroxylamine hydrochloride (112 mg, 1.61 mmol, 4.0 equiv) at room temperature. After 40 h, the reaction mixture was diluted with H2O (40 mL) and extracted with EtOAc (2×25 mL). The combined organic phase was dried over Na2SO4, filtered, and concentrated to yield a colorless glass/stiff foam. The crude product was purified by reverse phase chromatography (10→100% MeCN/H2O). The two separate E/Z oxime isomers were isolated to afford both the more polar oxime isomer (60.8 mg, 15.4% yield) and the less polar oxime isomer (45.6 mg, 11.5% yield) as white solids. LCMS (ESI) (more polar isomer) m/z: [M+Na] calcd for C57H88N2O13: 1031.62; found: 1031.6; LCMS (ESI) (less polar-isomer) m/z: [M+Na] calcd for C57H88N2O13: 1031.62; found: 1031.6.


Monomer 55. Synthesis of 40(S)-azido rapamycin



embedded image


Reference for the synthesis of the known monomer: Wang, B.; Zhao, J. Z. 2014; Rapamycin analogs and methods for making same. WO2014082286. Hangzhou Zylox Pharma Co., Ltd, which is incorporated by reference in its entirety.


Monomers 56 and 62. Synthesis of of 40(R)-(m-azidobenzyl) ether and 40(R)-(p-azidobenzyl) ether rapamycin



embedded image


To a dry reaction flask is added rapamycin followed by heptanes and DCM. 3-Azidobenzylamine or 4-azidobenzylamine and silver(I) oxide are to the solution and the reaction flask is capped and heated to 60° C. until full consumption of rapamycin, as determined by LCMS analysis. The reaction is then cooled to room temperature, diluted with EtOAc, filtered through Celite, and concentrated under reduced pressure to provide a solid. Purification by chromatography on silica gel provides the product.


Monomer 57. Synthesis of of 32(R)-hydroxy 26-O-(p-azidobenzyl) oxime rapamycin



embedded image


To a solution of 32(R)-hydroxy rapamycin (1.0 equiv) and O-(4-azidobenzyl)hydroxylamine (5.0 equiv) in pyridine is added HCl in 1,4-dioxane (7.0 equiv), dropwise over 1 min, at room temperature. The reaction mixture is heated to 50° C. During the reaction course, additional O-(4-azidobenzyl)hydroxylamine (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated at 50° C. and stirred until consumption of 32(R)-hydroxy rapamycin. The reaction mixture is then added dropwise into H2O and cooled to 0° C. The resulting solid is filtered off, washed with H2O, and purified by silica gel chromatography to afford product.


Monomer 58 and 60. Synthesis of 40(R)-(m-azidobenzyl)carbamate and 40(R)-(p-azidobenzyl)carbamate rapamycin



embedded image


The monomers can be prepared by reacting the corresponding azidobenzylamines, in the presence of pyridine, with the C40-p-nitrophenylcarbonate derivative of rapamycin.


Monomer 59. Synthesis of of 32(R)-methoxy 26-O-(p-azidobenzyl) oxime rapamycin



embedded image


To a solution of 32(R)-methoxy rapamycin (1.0 equiv) and O-(4-azidobenzyl)hydroxylamine (5.0 equiv) in pyridine is added HCl in 1,4-dioxane (7.0 equiv), dropwise over 1 min. The reaction mixture is heated to 50° C. During the course of the reaction, additional O-(4-azidobenzyl)hydroxylamine (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to rt. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-methoxy rapamycin. The reaction mixture is then added dropwise into H2O and cooled to 0° C. The resulting solid is filtered off, washed with H2O, and purified by silica gel chromatography to afford product.


Monomer 61. Synthesis of of 32(R)-hydroxy 26-O-(m-azidobenzyl) oxime rapamycin



embedded image


To a solution of 32(R)-hydroxy rapamycin (1.0 equiv) and O-(3-azidobenzyl)hydroxylamine (5.0 equiv) in pyridine is added HCl in 1,4-dioxane (7.0 equiv), dropwise over 1 min. The reaction mixture is heated to 50° C. During the course of the reaction, additional O-(3-azidobenzyl)hydroxylamine (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-hydroxy rapamycin. The reaction mixture is then added dropwise into H2O and cooled to 0° C. The resulting solid is filtered off, washed with H2O, and purified by silica gel chromatography to afford product.


Monomer 63. Synthesis of of 32(R)-methoxy 26-O-(m-azidobenzyl) oxime rapamycin



embedded image


To a solution of 32(R)-methoxy rapamycin (1.0 equiv) and O-(3-azidobenzyl)hydroxylamine (5.0 equiv) in pyridine is added HCl in 1,4-dioxane (7.0 equiv), dropwise over 1 min. The reaction mixture is heated to 50° C. During the course of the reaction, additional O-(3-azidobenzyl)hydroxylamine (1.0 equiv) and HCl in 1,4-dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-methoxy rapamycin. The reaction mixture is then added dropwise into H2O and cooled to 0° C. The resulting solid is filtered off, washed with H2O, and purified by silica gel chromatography to afford product.


Monomer 64



embedded image


To a dry reaction vessel is added 3-(4-azidophenyl)propyl trifluoromethanesulfonate (4.0 equiv) followed by anhydrous DCM. The mixture is purged with N2 and cooled to sub-ambient temperature before addition of 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) as a solid in one portion. Rapamycin (1.0 equiv) is then added as a solid in one portion. The reaction is stirred and, upon consumption of rapamycin, diluted with DCM and and washed with sat. aqueous NaHCO3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na2SO4, filtered and concentrated. The crude product mixture was purified by silica gel chromatography to afford product.


Monomer 65



embedded image


To a dry reaction vessel is added 6-azidohexyl trifluoromethanesulfonate (4.0 equiv) followed by anhydrous DCM. The mixture is purged with N2 and cooled to sub-ambient temperature before addition of 2,6-di-tert-butyl-4-methylpyridine (2.0 equiv) as a solid in one portion. Rapamycin (1.0 equiv) is then added as a solid in one portion. The reaction is stirred and, upon consumption of rapamycin, diluted with DCM and washed with sat. aqueous NaHCO3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na2SO4, filtered and concentrated. The crude product mixture was purified by silica gel chromatography to afford product.


Monomer 66. Synthesis of 16-furan 40(S)-azido rapamycin



embedded image


To a dry reaction flask was added 40(S)-azido rapamycin (0.56 g, 0.59 mmol, 1.0 equiv) and furan (0.89 mL, 12.2 mmol, 21 equiv), followed by DCM (24 mL). The reaction mixture was cooled to −40° C. before adding TFA (0.77 mL, 9.96 mmol, 17 equiv). After 3 h the reaction mixture was diluted with DCM (50 mL) and washed with sat. NaHCO3 (30 mL). The organic layer was dried with MgSO4 and concentrated under reduced pressure to provide a yellow foam. Purification by silica gel chromatography (0→45% EtOAc/hexanes) afforded the product as a yellow foam (0.16 g, 27.8% yield). LCMS (ESI) m/z: [M+Na] calcd for C54H78N4O12: 997.55; found 997.5.


Monomer 67. Synthesis of 16-methyl carbamate 40(S)-azido rapamycin



embedded image


To a dry reaction vessel is added 40(S)-azido rapamycin and methyl chloroformate followed by anhydrous DCM. The mixture is purged with N2 and cooled to −40° C. before addition of TFA. The reaction is stirred and, upon consumption of the starting material, diluted with DCM and washed with sat. aqueous NaHCO3 solution. The organic layer is washed with sat. aq. NaCl, dried over Na2SO4, filtered and concentrated. The crude product mixture was purified by silica gel chromatography to afford product.


Monomer 68. Synthesis of 32(R)-methoxy 40(S)-azido rapamycin



embedded image


To a dry reaction flask was added 32(R)-methoxy rapamycin (0.28 g, 0.30 mmol, 1.0 equiv) and 2,6-lutidine (74 μL, 0.64 mmol, 2.1 equiv), followed by DCM (8.4 mL). The reaction mixture was coded to −10° C. and then trifluoromethanesulfonic anhydride (65 μL, 0.38 mmol, 1.3 equiv) was added. After 45 min, tetrabutyl ammonium azide (0.38 g, 1.33 mmol, 4.4 equiv) was added and the reaction was warmed to room temperature while stirring overnight. The reaction mixture was diluted with EtOAc (30 mL) and washed with pH 7 phosphate buffer (2×10 mL) then the organic layer was dried with MgSO4 and concentrated under reduced pressure to provide a yellow oil. Purification by silica gel chromatography (0→45% EtOAc/hexanes) afforded the product as a clear colorless oil (0.20 g, 67% yield). LCMS (ESI) m/z: [M+Na] calcd for C52H82N4O12: 977.58; found 977.7.


Monomer 69. Synthesis of 32(R)-ethoxy 40(S)-azido rapamycin



embedded image


To a dry flask was added 32(R)-ethoxy rapamycin (1.02 g, 1.08 mmol, 1.0 equiv) and 2,6-lutidine (0.26 mL, 2.3 mmol, 2.1 equiv), followed by DCM (30 mL). The reaction mixture was cooled to −10° C. and then trifluoromethanesulfonic anhydride (0.23 mL, 1.4 mmol, 1.3 equiv) was added to the mixture, dropwise. After 45 min, tetrabutylammonium azide (1.35 g, 4.74 mmol, 4.4 equiv) was added in one portion to the reaction mixture, which was then stirred overnight while warming to room temperature. The reaction mixture was diluted with EtOAc (100 mL), poured into a separatory funnel and washed with pH 7 phosphate buffer (2×10 mL). The organic layer was dried over Na2SO4, filtered and the solvent removed under reduced pressure to afford a clear yellow oil. Purification by silica gel chromatography (2/3 to 3/2 EtOAc/hexanes) to afford a yellow oil. Lyophilization then provided an off-white powder (540 mg, 52% yield). LCMS (ESI) m/z: [M+Na] calcd for C53H84N4O12: 991.60; found 991.8.


Monomer 70. Synthesis of 32(R)-hydroxy 40(S)-azido rapamycin



embedded image


Step 1: Synthesis of 32(R)-hydroxy rapamycin

A solution of 32(R)-hydroxy-28,40-bistriethylsilyl rapamycin (3.64 g, 3.18 mmol, 1 equiv) in THF (41.8 mL) was treated with pyridine (20.8 mL, 258 mmol, 81 equiv) and the reaction mixture was cooled to 0° C. The solution was treated dropwise with HF-pyridine (70:30; 4.60 mL, 159 mmol, 50 equiv) and the reaction mixture was stirred at 0° C. for 20 min followed by warming to room temperature. After 5 h, the reaction mixture was cooled back to 0° C. and carefully added to ice cold sat. NaHCO3 solution (400 mL). The mixture was extracted with EtOAc (2×100 mL) and the organic phases were washed with 75 mL portions of H2O, sat. NaHCO3 solution and brine. The organic solution was dried over Na2SO4, filtered and concentrated to yield a light yellow oil that produced a stiff foam under reduced pressure. The crude material was purified by silica gel chromatography (20→40% acetone/hex) to yield the desired product as a white amorphous solid (1.66 g, 57% yield). LCMS (ESI) m/z: [M+Na] calcd for C51H81NO13: 938.56; found: 938.7; m/z: [M−H] calcd for C51H81NO13: 914.56; found: 914.7.


Step 2: Synthesis of 32(R)-hydroxy 40(S)-azido rapamycin

32(R)-Hydroxy rapamycin (245 mg, 0.267 mmol, 1.0 equiv) was dissolved in MeCN (6.0 mL) and the solution was treated with ˜1.0 g 4 Å powdered molecular sieves. The mixture was stirred for 1 h, at which point the mixture was filtered through a fritted funnel, washing the frit with MeCN (1.4 mL). The solution was treated with 2,6-lutidine (65.0 μL, 0.562 mmol, 2.1 equiv) and cooled to −10° C. The reaction mixture was treated with trifluoromethanesulfonic anhydride (58.5 μL, 0.348 mmol, 1.3 equiv), dropwise. The reaction mixture was stirred at −10° C. for 60 min during which time the reaction mixture became light pink. Tetrabutylammonium azide (335 mg, 1.18 mmol, 4.4 equiv) was added in one portion and the reaction mixture was stirred overnight while warming to room temperature. After 19 h, the reaction mixture was diluted with EtOAc (40 mL) and washed with pH 7 phosphate buffer (2×20 mL). The organic phase was dried over Na2SO4, filtered and concentrated to a light tan viscous oil that was placed under high vac to remove lutidine. The crude material was purified by silica gel chromatography (10→30% acetone/hex) to yield the desired product as a white solid (159 mg, 63% yield). LCMS (ESI) m/z: [M+Na] calcd for C51H80N4O12: 963.57; found: 963.5; m/z: [M+HCO2] calcd for C51H80N4O12: 985.57; found: 985.8.


Monomer 71. Synthesis of 32-O-(methyl) oxime 40(S)-azido rapamycin



embedded image


To a solution of 40(S)-azido rapamycin (820 mg, 0.87 mmol, 1 equiv) in MeOH (20 mL) was added sodium acetate (0.286 g, 3.49 mmol, 4.0 equiv) and methoxylamine hydrochloride (0.292 g, 3.49 mmol, 4.0 equiv) at room temperature. After stirring overnight, the reaction was diluted with EtOAc and washed with H2O, brine, dried over Na2SO4, and concentrated to afford a white foam. The foam was purified by reverse phase chromatography (1/4 to 9/1 MeCN/H2O, no TFA). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders affording both the Z-oxime (510 mg, 60% yield) and the E-oxime (190 mg, 22% yield). LCMS (ESI) m/z: [M+Na] calcd for C52H81N5O12: 990.58; found 991.0.


Monomer 72. Synthesis of 32-O-(benzyl) oxime 40(S)-azido rapamycin



embedded image


To a solution of 40(S)-azido rapamycin (1.05 g, 1.12 mmol, 1.0 equiv) in MeOH (26 mL) was added sodium acetate (0.367 g, 4.47 mmol, 4.0 equiv) and O-benzylhydroxylamine hydrochloride (0.714 g, 4.47 mmol, 4.0 equiv) at room temperature. The reaction was left for 2 days, at which point the reaction was diluted with EtOAc and washed with H2O, brine, dried over Na2SO4, and concentrated to afford a white foam. The foam was purified by reverse phase chromatography (1/4 to 9/1 MeCN/H2O, no TFA). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders to afford both the Z-oxime (620 mg, 53% yield) and the E-oxime (130 mg, 11% yield). LCMS (ESI) m/z: [M+Na] calcd for C58H85N5O12: 1066.61; found 1066.9.


Monomer 73. Synthesis of 32-O-(tert-butyl) oxime 40(S)-azido rapamycin



embedded image


To a solution of 40(S)-azido rapamycin (1.05 g, 1.12 mmol, 1.0 equiv) in MeOH (26 mL) was added sodium acetate (0.367 g, 4.47 mmol, 4.0 equiv) and 2-(aminooxy)-2-methylpropane hydrochloride (0.562 g, 4.47 mmol, 4.0 equiv) at room temperature. The reaction was stirred for 2 days, at which point the reaction was diluted with EtOAc and washed with H2O, brine, dried over Na2SO4, and concentrated to afford a white foam. The foam was purified by reverse phase chromatography (1/4 to 9/1 MeCN/H2O, no TFA). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders to afford both the Z-oxime (390 mg, 34% yield) and the E-oxime (70 mg, 6% yield). LCMS (ESI) m/z: [M+Na] calcd for C55H87N5O12: 1032.62; found 1032.9.


Monomer 74. Synthesis of 32-oxime 40(S)-azido rapamycin



embedded image


To a solution of 40(S)-azido rapamycin (0.26 g, 0.27 mmol, 1.0 equiv) in MeOH (6.5 mL) was added sodium acetate (0.092 g, 1.1 mmol, 4.0 equiv) and hydroxylamine hydrochloride (0.076 g, 1.1 mmol, 4 equiv) at room temperature. The reaction was stirred overnight, at which point the reaction was diluted with H2O (30 mL) and extracted with EtOAc (2×40 mL). The organic phase was washed with 40 mL portions of H2O and brine before drying with MgSO4 and concentrating under reduced pressure to provide a colorless oil. The crude material was purified by reverse phase chromatography (0→100% MeCN:H2O, no TFA). The two separate E/Z oxime isomers were isolated and each lyophilized to white powders to afford both the major oxime isomer (110 mg, 42.7% yield) and the minor oxime isomer (54 mg. 21.0% yield). LCMS (ESI) m/z: [M+Na] calcd for C51H79N5O12: 976.56; found 976.7.


Monomer 75. Synthesis of 32-O-(carboxymethyl) oxime 40(S)-azido rapamycin



embedded image


To a solution of 40(S)-azido rapamycin (1.22 g, 1.30 mmol, 1.0 equiv) in MeOH (31 mL) was added sodium acetate (0.44 g, 5.4 mmol, 4.0 equiv) and carboxymethoxylamine hemihydrochloride (1.1 g, 5.1 mmol, 4 equiv) at room temperature. The reaction was stirred overnight, at which point the reaction was diluted with H2O (75 mL) and extracted with EtOAc (2×100 mL). The organic phase was washed with 100 mL portions of H2O and brine before drying with MgSO4 and concentrating under reduced pressure to provide a colorless oil. The crude material was purified by reverse phase chromatography (0→100% MeCN/H2O, no TFA). The two separate E/Z oxime isomers were isolated to afford both the major oxime isomer as a clear colorless oil (51 mg, 3.9% yield) and the minor oxime isomer (30 mg, 2.3% yield). LCMS (ESI) m/z: [M+Na] calcd for C53H81N5O14: 1034.57; found 1034.8.


Monomer 76. Synthesis of 32(R)-hydroxy 26-O-(carboxymethyl) oxime rapamycin



embedded image


To a dry reaction flask was added 32(R)-hydroxy rapamycin (3.39 g, 3.70 mmol, 1.0 equiv) and carboxymethoxylamine hemihydrochloride (1.62 g, 7.40 mmol, 2.0 equiv), followed by pyridine (18 mL) at room temperature. Pyridine hydrochloride (2.99 g, 25.9 mmol, 7.0 equiv) was added and then the reaction mixture was heated to 50° C. After 1.5 days, the solvent was removed under reduced pressure and the semisolid material was purified by reverse phase chromatography (15→90% MeCN/H2O, no TFA) to afford the product, a mixture of E/Z oxime isomers, as a white powder (1.51 g, 41% yield). LCMS (ESI) m/z: [M+Na] calcd for C53H84N2O15: 1011.58; found 1011.6.


Monomer 77. Synthesis of 32(R)-methoxy 26-O-(carboxymethyl) oxime rapamycin



embedded image


To a dry reaction flask was added 32(R)-methoxy rapamycin (118 mg, 0.127 mmol, 1.0 equiv) and carboxymethoxylamine hemihydrochloride (137 mg, 0.634 mmol, 5.0 equiv), followed by pyridine (0.59 mL) at room temperature. Pyridine hydrochloride (0.103 g, 0.888 mmol, 7.0 equiv) was added and then the reaction mixture was heated to 50° C. After 1.5 days, the reaction mixture was cooled to room temperature and added dropwise into H2O (25 mL) followed by cooling the mixture to 0° C. The precipitated solid was filtered, washed with H2O twice and dried to afford the product, a mixture of E/Z oxime isomers, as a white powder (99 mg, 77% yield). LCMS (ESI) m/z: [M−H] calcd for C54H86N2O15: 1001.59; found 1001.7.


Monomer 78. Synthesis of 32-O-(carboxymethyl) oxime rapamycin



embedded image


To a solution of rapamycin and O-(carboxymethyl)hydroxylamine hemihydrochloride in MeOH is added sodium acetate. The reaction mixture is then stirred at room temperature until full consumption of rapamycin, as determined by LCMS analysis. To the reaction mixture is then added H2O and DCM. The layers are separated and the aqueous layer extracted with DCM. The organic layers are dried over Na2SO4, filtered and purified by silica gel chromatography.


Reference for preparation of the monomer: Zheng, Y. F.; Wei, T. Q.; Sharma, M. 2016. Sandwich assay design for small molecules. WO2016100116 A1. Siemens Healthcare Diagnostics Inc., which is incorporated by reference in its entirety.


Monomer 79. Synthesis of 28-O-(carboxymethyl) ether rapamycin



embedded image


Synthesis of the monomer proceeds first by the alkylation of C40—O-TBDMS protected rapamycin with iodoacetic acid and silver(I) oxide and then desilyation under acidic conditions with an acetic acid/THF/H2O solution.


Reference for preparation of C40—O-TBDMS protected rapamycin: Abel, M.; Szweda, R.; Trepanier, D.; Yatscoff, R. W.; Foster, R. T. 2004. Rapamycin carbohydrate derivatives. WO 2004/101583. Isotechnica International Inc., which is incorporated by reference in its entirety.


Monomer 80. Synthesis of 40(R)—O-(carboxymethyl) ether rapamycin



embedded image


Synthesis of the monomer proceeds by the alkylation of rapamycin with iodoacetic acid and silver(I) oxide.


Monomer 81. Synthesis of 32(R)-hydroxy 26-O-(1-butylamine) oxime rapamycin



embedded image


To a solution of 32(R)-hydroxy rapamycin (1.0 equiv) and (9H-fluoren-9-yl)methyl (4-(aminooxy)butyl)carbamate (5.0 equiv) in pyridine is added HCl in dioxane (7.0 equiv), dropwise over 1 min at room temperature. The reaction mixture is heated to 50° C. During the course of the reaction, additional (9H-fluoren-9-yl)methyl (4-(aminooxy)butyl)carbamate (5.0 equiv) (1.0 equiv) and HCl in dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-hydroxy rapamycin. The reaction mixture is then added dropwise into H2O and cooled to 0° C. The resulting solid was filtered off, washed with H2O, and purified to afford product.


Monomer 82. Synthesis of 32(R)-methoxy 26-O-(1-butylamine) oxime rapamycin



embedded image


To a solution of 32(R)-methoxy rapamycin (1.0 equiv) and (9H-fluoren-9-yl)methyl (4-(aminooxy)butyl)carbamate (5.0 equiv) in pyridine is added HCl in dioxane (7.0 equiv), dropwise over 1 min. The reaction mixture is heated to 50° C. During the course of the reaction, additional (9H-fluoren-9-yl)methyl (4-(aminooxy)butyl)carbamate (5.0 equiv) (1.0 equiv) and HCl in dioxane (5.0 equiv) are added after the reaction is cooled to room temperature. The reaction mixture is again heated to 50° C. and stirred until consumption of 32(R)-methoxy rapamycin. The reaction mixture is then added dropwise into H2O and cooled to 0° C. The resulting solid is filtered off, washed with H2O, and purified to afford product.


Monomer 83. Synthesis of 40(S)-amino rapamycin



embedded image


Synthesis of the monomer proceeds by the reduction of 40(S)-azido rapamycin with triphenylphosphine.


Monomer 84. Synthesis of 16-furan 40(S)-amino rapamycin



embedded image


Synthesis of the monomer proceeds by the reduction of C16-furan 40(S)-azido rapamycin with triphenylphosphine.


Monomer 85. Synthesis of 16-methyl carbamate 40(S)-amino rapamycin



embedded image


Synthesis of the monomer proceeds by the reduction of C16-methyl carbamate 40(S)-azido rapamycin with triphenylphosphine.


Monomer 86. Synthesis of 32-deoxy 40(R)—O-1-hexynyl rapamycin



embedded image


Starting with 32-deoxy rapamycin rather than rapamycin, monomer 86 can be prepared following the procedure used to prepare monomer 1.


Monomer 87. Synthesis of 32-deoxy 26-O-(prop-2-yn-1-yl) oxime rapamycin



embedded image


Starting with 32-deoxy rapamycin rather than 32(R)-hydroxy rapamycin, monomer 87 can be prepared following the procedure used to prepare monomer 6.


Monomer 88. Synthesis of 32-deoxy 40(S)-azido rapamycin



embedded image


Starting with 32-deoxy rapamycin rather than 32(R)-methoxy rapamycin, monomer 88 can be prepared following the procedure used to prepare monomer 68.


GENERAL PROCEDURES AND SPECIFIC EXAMPLES
General Procedure 1: Coupling of an Amine-Containing Active Site Inhibitor with Azide Containing N-Hydroxysuccinimide Esters



embedded image


To a 0.035 M solution of amine salt (1.0 equiv) in DMF was added N-hydroxysuccinimide ester (1.25 equiv), followed by slow addition of triethylamine (3.5 equiv). The solution was: allowed to stir at room temperature under N2 atmosphere until consumption of the amine salt, as indicated by LCMS analysis. The reaction was concentrated under reduced pressure and purified by chromatography on silica gel to afford product.


Intermediate A1-1: Synthesis of 1-(4-(4-(1-azido-3,6,9,12,15,18,21,24-octaoxaheptacosan-27-oyl)piperazin-1-yl)-3-(trifluoromethyl)phenyl)-8-(6-methoxypyridin-3-yl)-3-methyl-1,3-dihydro-2H-imidazo[4,5-c]quinolin-2-one



embedded image


To a solution of 8-(6-methoxypyridin-3-yl)-3-methyl-1-(4-(piperazin-1-yl)-3-(trifluoromethyl)-phenyl)-1,3-dihydro-2H-imidazo[4,5-c]quinolin-2-one (50 mg, 93.6 μmol 1.0 equiv) in DMF (2.67 mL) was added 2,5-dioxopyrrolidin-1-yl 1-azido-3,6,9,12,15,18,21,24-octaoxaheptacosan-27-oate (65.4 mg, 116 μmol), followed by slow addition of triethylamine (46 μL, 327 μmol, 3.5 equiv). The reaction was stirred for 12 h and then concentrated under reduced pressure. The product was isolated after chromatography on silica gel (0→5% MeOH/DCM). LCMS (ESI) m/z: [M+H] calcd for C47H61F3N9O11: 984.44; found 984.5.


Following the General Procedure 1, but using the appropriate amine salt and azide functionalized N-hydroxysuccinimide ester, the additional intermediates in Table 12 were prepared.









TABLE 12







Additional azides prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW















embedded image

  Intermediate A1-1

C47H60F3N9O11
[M + H] = 984.44
[M + H] = 984.5







embedded image

  Intermediate A1-2

C43H52F3N9O9
[M + H] = 896.39
[M + H] = 896.5







embedded image

  Intermediate A1-3

C31H45N11O8
[M + H] = 700.35
[M + H] = 700.3







embedded image

  Intermediate A1-4

C29H41N11O7
[M + H] = 656.33
[M + H] = 656.3







embedded image

  Intermediate A1-5

C27H37N11O6
[M + H] = 612.30
[M + H] = 612.3







embedded image

  Intermediate A1-6

C25H33N11O5
[M + H] = 568.27
[M + H] = 568.3







embedded image

  Intermediate A1-7

C23H29N11O4
[M + H] = 524.25
[M + H] = 524.2







embedded image

  Intermediate A1-8

C38H57N11O10S
[M + H] = 860.41
[M + H] = 860.8







embedded image

  Intermediate A1-9

C34H49N11O8S
[M + H] = 772.36
[M + H] = 772.3







embedded image

  Intermediate A1-10

C28H48IN9O9
[M + H] = 782.27
[M + H] = 782.1







embedded image

  Intermediate A1-11

C28H49N9O9
[M + H] = 656.37
[M + H] = 656.3







embedded image

  Intermediate A1-12

C24H41N9O7
[M + H] = 568.32
[M + H] = 568.8







embedded image

  Intermediate A1-13

C37H57N11O10
[M + H] = 816.44
[M + H] = 816.4







embedded image

  Intermediate A1-14

C33H49N11O8
[M + H] = 728.38
[M + H] = 728.3







embedded image

  Intermediate A1-15

C36H54N10O10
[M + H] = 787.41
[M + H] = 787.8







embedded image

  Intermediate A1-16

C32H46N10O8
[M + H] = 699.36
[M + H] = 699.2







embedded image

  Intermediate A1-17

C35H53H11O10
[M + H] = 788.41
[M + H] = 788.4







embedded image

  Intermediate A1-18

C3SH53N11O9
[M + H] = 772.41
[M + H] = 772.3







embedded image

  Intermediate A1-19

C31H45N11O7
[M + H] = 684.36
[M + H] = 684.3







embedded image

  Intermediate A1-20

C36H55N11O10
[M + H] = 802.42
[M + H] = 802.2







embedded image

  Intermediate A1-21

C32H47N11O8
[M + H] = 714.37
[M + H] = 714.3







embedded image

  Intermediate A1-22

C35H51N11O10
[M + H] = 786.39
[M + H] = 786.4







embedded image

  Intermediate A1-23

C31H43N11O8
[M + H] = 698.34
[M + H] = 698.3




embedded image

  Intermediate A1-24

C36H53N11O10
[M + H] = 800.41
[M + H] = 800.3




embedded image

  Intermediate A1-25

C32H45N1108
[M + H] = 712.35
[M + H] = 712.3







embedded image

  Intermediate A1-26

C37H55N11O10
[M + H] = 814.42
[M + H] = 814.3







embedded image

  Intermediate A1-27

C33H47N11O8
[M + H] = 726.37
[M + H] = 726.3







embedded image

  Intermediate A1-28

C39H53N11O10
[M + H] = 836.41
[M + H] = 836.3







embedded image

  Intermediate A1-29

C35H45N11O8
[M + H] = 748.35
[M + H] = 748.2







embedded image

  Intermediate A1-30

C41H55N11O10
[M + H] = 862.42
[M + H] = 862.3







embedded image

  Intermediate A1-31

C37H47N11O8
[M + H] = 774.37
[M + H] = 774.3







embedded image

  Intermediate A1-32

C47H51F3N8O8
[M + H] = 913.39
[M + H] = 913.3







embedded image

  Intermediate A1-33

C48H57F3N12O9
[M + H] = 1003.44
[M + H] = 1003.4







embedded image

  Intermediate A1-34

C39H54N14O10
[M + H] = 879.42
[M + H] = 879.3







embedded image

  Intermediate A1-35

C43H60FN7O13S
[M + H] = 934.41
[M + H] = 934.3







embedded image

  Intermediate A1-36

C67H117N11O26
[M + H] = 1492.83
[M + H] = 1492.8









General Procedure 2: Synthesis of a Bivalent Rapamycin Analog Via Cu-Catalyzed Cycloaddition



embedded image


To a 0.005M solution of alkynyl modified rapamycin (1.0 equiv) in MeOH was added the organoazide reagent (1.25 equiv) at 0° C. 1M aq. CuSO4 (3.7 equiv) was added to the reaction, followed by slow addition of 1M aq. sodium ascorbate (5.0 equiv). The reaction was allowed to stir from 0° C. to room temperature, until consumption of alkyne, as indicated by LCMS. The reaction mixture was concentrated under reduced pressure, diluted with DMSO, H2O, and formic acid, and purified by reverse phase HPLC to afford the product after lyophilization.


Example 1: Synthesis of Series 1 Bivalent Rapamycin Analog



embedded image


To a solution of Monomer 1 (125 mg, 125 μmol, 1.0 equiv) in MeOH (25 mL) was added A1-17 (118 Mg, 150 μmol, 1.25 equiv). The reaction was cooled to 0° C. and 1M aq. CuSO4 (462 μL, 462 μmol, 3.7 equiv) was slowly added, followed by dropwise addition of 1M aq. sodium ascorbate (625 mL, 625 μmol, 5.0 equiv). The reaction was stirred under a N2 atmosphere from 0° C. to room temperature for 12 h. The reaction was then concentrated under reduced pressure, diluted with DMSO (3 mL), H2O (600 μL), and formic acid (30 μL) and purified by reverse phase HPLC (10→40→65% MeCN+0.1% formic acid/H2O+0.1% formic acid). Lyophilization of pure fractions provided product as a white solid (78.4 mg, 35% yield). LCMS (ESI) m/z: [M+H] calcd for C92H140N12O23: 1782.02; found 1781.8.


Following General Procedure 2, but using the appropriate alkynyl modified rapamycin and organoazide, the Series 1 bivalent analogs in Table 13 were synthesized:









TABLE 13







Series 1 Bivalent Analogs











Molecular
Calculated
Observed


Structure
Formula
MW
MW















embedded image

  Example 1

C92H140N12O23
[M + H] = 1782.02
[M + H] = 1781.8







embedded image

  Example 2

C86H128N12O20
[M + H] = 1649.94
[M + H] = 1650.0







embedded image

  Example 3

CssH132N12O21
[M + H] = 1693.97
[M + H] = 1694.0







embedded image

  Example 4

C85H135IN10O22
[M + H] = 1775.89
[M + H] = 1775.9







embedded image

  Example 5

C85H136N10O22
[M + H] = 1649.99
[M + H] = 1649.7







embedded image

  Example 6

C81H128N10O20
[M + H] = 1561.94
[M + H] = 1561.9







embedded image

  Example 7

C93H140N12O23
[M + H] = 1794.02
[M + H] = 1793.9







embedded image

  Example 8

C89H132N12O21
[M + H] = 1705.97
[M + H] = 1705.8







embedded image

  Example 9

C93H142N12O24
[M + H] = 1812.03
[M + H] = 1811.8







embedded image

  Example 10

C89H134N12O22
[M + Na] = 1745.97
[M + Na] = 1746.0







embedded image

  Example 11

C104H147F3N10O24
[M + H] = 1978.06
[M +H] = 1977.9







embedded image

  Example 12

C84H127N13O20
[M + H] = 1638.94
[M + H] = 1639.0







embedded image

  Example 13

C86H131N13O21
[M + H] = 1682.97
[M + H] = 1682.7







embedded image

  Example 14

C86H131N13O21
[M + H] = 1682.97
[M + H] = 1682.9







embedded image

  Example 15

C86H131N13O21
[M + H] = 1682.97
[M + H] = 1682.9







embedded image

  Example 16

C82H123N13O19
[M + H] = 1594.91
[M + H] = 1594.8







embedded image

  Example 17

C90H139N13O23
[M + H] = 1771.02
[M + H] = 1770.8







embedded image

  Example 18

C95H140N12O23
[M + H] = 1818.02
[M + H] = 1818.8







embedded image

  Example 19

C91H132N12O21
[M + H] = 1729.97
[M + H] = 1730.9







embedded image

  Example 20

C98H138N16O20
[M + H] = 1860.04
[M + H] = 1860.05







embedded image

  Example 21

C96H134N16O19
[M + Na] = 1837.99
[M + Na] = 1837.9







embedded image

  Example 22

C94H130N16O18
[M + H] = 1771.98
[M + H] = 1772.05







embedded image

  Example 23

C99H140N16O21
[M + Na] = 1912.03
[M + Na] = 1912.7







embedded image

  Example 24

C97H136N16O20
[M + Na] = 1868.00
[M + Na] = 1868.7







embedded image

  Example 25

C95H132N16O19
[M + Na] = 1823.98
[M + Na] = 1823.6







embedded image

  Example 26

C97H136N16O21S
[M + H] = 1893.98
[M + H] = 1894.1







embedded image

  Example 27

C95H132N16O2OS
[M + H] = 1849.96
[M + H] = 1850.0







embedded image

  Example 28

C93H128N16O19S
[M + H] = 1805.93
[M + H] = 1806.0







embedded image

  Example 29

C99H137N19O19
[M + Na] = 1919.03
[M + Na] = 1919.6







embedded image

  Example 30

C97H133N19O18
[M + Na] = 1875.01
[M + Na] = 1875.0







embedded image

  Example 31

C95H129N19O17
[M + Na] = 1830.98
[M + Na] = 1830.9







embedded image

  Example 32

C100H139N19O20
[M + H] = 1927.04
[M + H] = 1927.1







embedded image

  Example 33

C98H135N19O19
[M + Na] = 1905.02
[M + Na] = 1904.8







embedded image

  Example 34

C96H131N19O18
[M + H] = 1839.00
[M + H] = 1839.1







embedded image

  Example 35

C96H131N19O19S
[M + H] = 1886.97
[M + H] = 1887.1







embedded image

  Example 36

C94H127N19O18S
[M + H] = 1842.94
[M + H] = 1843.2







embedded image

  Example 37

C97H133N19O20S
[M + H] = 1916.98
[M + H] = 1917.1







embedded image

  Example 38

C93H141N13O24
[M + H] = 1825.03
[M + H] = 1825.0







embedded image

  Example 39

C89H133N13O22
[M + H] = 1736.98
[M + H] = 1737.0







embedded image

  Example 40

C95H144N12O23S
[M + H] = 1854.03
[M + H] = 1853.8







embedded image

  Example 41

C91H136N12O21S
[M + H] = 1765.97
[M + H] = 1765.9







embedded image

  Example 42

C93H141N11O23
[M + H] = 1781.03
[M + H] = 1781.0







embedded image

  Example 43

C89H133N11O21
[M + H] = 1692.98
[M + H] = 1692.9







embedded image

  Example 44

C100H139F3N10O22
[M + H] = 1890.01
[M + H] = 1890.0







embedded image

  Example 45

C107H147F3N10O24
[M + H]/2 = 1007.03
[M + H] = 1007.0







embedded image

  Example 46

C96H132N16O19
[M + H] = 1813.99
[M + H] = 1813.9







embedded image

  Example 47

C94H128N16O18
[M + H] = 1769.97
[M + H] = 1770.1







embedded image

  Example 48

C97H131N19O18
[M + H] = 1851.0
[M + H] = 1851.0







embedded image

  Example 49

C95H127N19O17
[M + H] = 1806.97
[M + H] = 1806.9







embedded image

  Example 50

C89H137N13O23
[M + H] = 1757.00
[M + H] = 1756.9







embedded image

  Example 51

C8SH129N13O21
[M + H] = 1668.95
[M + H] = 1668.9







embedded image

  Example 52

C97H136F3N11O22
[M + H] = 1864.99
[M + H] = 1864.9







embedded image

  Example 53

C92H139N11O24
[M + H] = 1783.01
[M + H] = 1782.9







embedded image

  Example 54

C90H135N12O22
[M + H] = 1735.98
[M + H] = 1735.8







embedded image

  Example 55

C89H136N12O21
[M + H] = 1710.00
[M + H] = 1709.9







embedded image

  Example 56

C92H138N12O23
[M + H] = 1780.01
[M + H] = 1779.8







embedded image

  Example 57

C88H130N12O21
[M + H] = 1691.96
[M + H] = 1691.6







embedded image

  Example 58

C94H144N12O23
[M + H] = 1810.05
[M + H] = 1810.0







embedded image

  Example 59

C90H136N12O21
[M + H] = 1722.00
[M +H] = 1722.0







embedded image

  Example 60

C86H127N13O22
[M + H] = 1694.93
[M + HJ = 1694.8







embedded image

  Example 61

C90H135N13O24
[M + H] = 1782.98
[M + H] = 1782.9







embedded image

  Example 62

C96H137N15O22
[M + H] = 1853.01
[M + H] = 1853.2







embedded image

  Example 63

C89H135N13O23
[M + H] = 1754.99
[M + HI = 1754.9







embedded image

  Example 64

C91H141N13O23
[M + H] = 1785.03
[M + H] = 1785.4







embedded image

  Example 65

C87H133N13O21
[M + H] = 1696.98
[M + H] = 1696.9







embedded image

  Example 66

C105H144F3N13O22
[M + H] = 1997.06
[M + H] = 1997.3







embedded image

  Example 67

C104H138F3N9O21
[M + H] = 1907.00
[M + H] = 1906.7







embedded image

  Example 68

C88H132N12O20
[M + H] = 1677.98
[M + H] = 1677.9







embedded image

  Example 69

C92H140N12O22
[M + H] = 1766.03
[M + H] = 1765.9









General Procedure 3: Synthesis of a Bivalent Rapamycin Analog Via Cu-Catalyzed Cycloaddition



embedded image


In the above scheme, “-spacer-” is meant to be in any appropriate position on the compound, as allowed.


To a 0.01M solution of alkynyl modified rapamycin (1.0 equiv) in DMSO was added the organoazide reagent (2.0 equiv). To the reaction was then added tetrakis(acetonitrile)copper(I) hexafluorophosphate (2.0 equiv) followed by TBTA (4.0 equiv). The reaction was allowed to stir until consumption of alkyne, as indicated by LCMS. The reaction mixture was then diluted with DMSO and formic acid, and purified by reverse phase HPLC to afford the product after lyophilization.


Example 70: Synthesis of Series 1 Bivalent Rapamycin Analog



embedded image


To a solution of Monomer 44 (20 mg, 19.7 μmol, 1.0 equiv) and A1-19 (26.9 mg, 39.4 μmol, 2.0 equiv) in DMSO (1.96 mL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (14.6 mg, 39.4 μmol, 2.0 equiv) followed by TBTA (41.8 mg, 78.8 μmol, 4.0 equiv). The reaction stirred for 3 h and was then diluted with DMSO (2 mL) and formic acid (1 mL) and purified by reverse phase HPLC (10→40→95% MeCN+0.1% formic acid/H2O+0.1% formic acid). Lyophilization of pure fractions provided product as a white solid (11.7 mg, 35% yield). LCMS (ESI) m/z: [M+H] calcd for C89H136N12O20: 1694.01; found 1694.4.


Following General Procedure 3, but using the appropriate alkynyl modified rapamycin and organoazide, the Series 1 bivalent analogs in Table 14 were synthesized:









TABLE 14





Series 1 Bivalent Analogs

















Molecular


Structure
Formula







embedded image


C89H136N12O20







embedded image


C94H142N12O24







embedded image


C105H148F3N11O25







embedded image


C101H140F3N11O23







embedded image


C90H134N12O21







embedded image


C100H148N12O25







embedded image


C96H141N11O23







embedded image


C93H144N12O23







embedded image


C101H144F3N11O24







embedded image


C89H137N13O22







embedded image


C85H129N13O20







embedded image


C93H141N13O23







embedded image


C93H144N12O22







embedded image


C93H142N12O23







embedded image


C89H134N12O21







embedded image


C96H140N12O23







embedded image


C92H132N12O21







embedded image


C95H139N13O23







embedded image


C98H142N12O23







embedded image


C94H134N12O21







embedded image


C94H142N12O23







embedded image


C90H134N12O21







embedded image


C99H146N12O23







embedded image


C86H130N12O21







embedded image


C90H138N12O23







embedded image


C96H141N15O23







embedded image


C100H147FN8O26S







embedded image


C124H204N12O39







embedded image


C92H142N14O22






Calculated


Structure
MW







embedded image


[M + H] = 1694.01







embedded image


[M + H] = 1824.03







embedded image


[M + H]/2 = 1010.54







embedded image


[M + H] = 1933.02







embedded image


[M + H] = 1719.99







embedded image


[M + H] = 1918.08







embedded image


[M + H] = 1817.03







embedded image


[M + H] = 1798.05







embedded image


[M + H] = 1953.04







embedded image


[M + H] = 1741.01







embedded image


[M + H] = 1652.96







embedded image


[M + H] = 1809.03







embedded image


[M + H] = 1782.06







embedded image


[M + H] = 1796.04







embedded image


[M + H] = 1707.99







embedded image


[M + H] = 1830.02







embedded image


[M + H] = 1741.97







embedded image


[M + H] = 1831.02







embedded image


[M + H] = 1856.04







embedded image


[M + H] = 1767.99







embedded image


[M + H] = 1808.04







embedded image


[M + H] = 1719.99







embedded image


[M + H] = 1872.07







embedded image


[M + H] = 1677.96







embedded image


[M + H] = 1756.01







embedded image


[M + H] = 1873.04







embedded image


[M + H] = 1928.02







embedded image


[M + 2H]/2 = 1244.22







embedded image


[M + H] = 1796.05






Observed


Structure
MW







embedded image


[M + H] = 1694.4







embedded image


[M + H] = 1824.1







embedded image


[M + H]/2 = 1010.3







embedded image


[M + H] = 1933.0







embedded image


[M + H] = 1720.0







embedded image


[M + H] = 1918.0







embedded image


[M + H] = 1817.2







embedded image


[M + H] = 1798.4







embedded image


[M + H] = 1953.1







embedded image


[M + H] = 1741.1







embedded image


[M + H] = 1652.9







embedded image


[M + H] = 1809.0







embedded image


[M + H] = 1782.1







embedded image


[M + H] = 1796.05







embedded image


[M + H] = 1708.0







embedded image


[M + H] = 1829.9







embedded image


[M + H] = 1741.8







embedded image


[M + H] = 1830.7







embedded image


[M + H] = 1856.0







embedded image


[M + H] = 1767.9







embedded image


[M + H] = 1808.1







embedded image


[M + H] = 1719.8







embedded image


[M + H] = 1871.9







embedded image


[M + H] = 1667.8







embedded image


[M + H] = 1755.9







embedded image


[M + H] = 1873.1







embedded image


[M + H] = 1928.3







embedded image


[M + 2H]/2 = 1244.3







embedded image


[M + H] = 1796.0









General Procedure 4: Extension of Amino-Terminal Peg Unit by Reaction with a Cyclic Anhydride to Prepare Intermediates B1



embedded image


To a reaction vial was added the amino-peg-azide linker section (1.0 equiv) followed by DCM, such that concentration of this reagent was 0.27 M. The cyclic anhydride (1.09 mmol, 1.0 equiv) and trimethylamine (0.1 equiv) were sequentially added to the reaction solution. The reaction vial was capped and stirred at room temperature overnight. The resulting reaction mixture was concentrated under reduced pressure to yield a colorless foamy residue. Purification by silica gel chromatography provides the desired Intermediates B1.


Intermediate B1-1: Synthesis of 1-azido-13-oxo-3,6,9-trioxa-12-azahexadecan-16-oic Acid



embedded image


To a reaction vial was added 2-(2-(2-(2-azidoethoxy)ethoxy)ethoxy)ethanamine (250 mg, 1.09 mmol, 1.0 equiv) followed by DCM (4 mL). Dihydrofuran-2,5-dione (109 mg, 1.09 mmol, 1.0 equiv) and trimethylamine (11.0 mg, 109 μmol, 0.1 equiv) were sequentially added to the reaction solution. The reaction vial was capped and stirred at room temperature for 18 h. The reaction mixture was concentrated under reduced pressure to yield a colorless foamy residue. Purification by silica gel chromatography (0→5% MeOH/DCM) provided the product, 1-azido-13-oxo-3,6,9-trioxa-12-azahexadecan-16-oic acid, as a colorless oil (250 mg, 72% yield). LCMS (ESI) m/z: [M−H] calcd for C12H22N4O6: 317.15; found 316.8.


Following the General Procedure 4, but using the appropriate cyclic anhydride and amino-peg precursor, the additional Intermediates B1 in Table 15 were prepared.









TABLE 15







Additional carboxylic acid linker Intermediates B1 prepared.











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C12H22N4O6
[M − H] = 317.15
[M − H] = 316.8







embedded image


C14H26N4O7
[M − H] = 361.17
[M − H] = 360.8







embedded image


C13H24N4O6
[M − H] = 331.16
[M − H] = 330.8







embedded image


C15H28N4O7
[M − H] = 375.19
[M − H] = 374.8







embedded image


C14H26N4O6
[M − H] = 345.18
[M − H] = 344.8







embedded image


C16H30N4O7
[M − H] = 389.20
[M − H] = 388.8







embedded image


C16H30N4O8
[M + H] = 407.21
[M + H] = 407.1









General Procedure 5: Coupling of an Amine-Containing Active Site Inhibitor with Intermediates B1 to Prepare Intermediates B2



embedded image


To a 0.18 M suspension of carboxylic acid (1.0 equiv) in DMF was added amine salt (1.0 equiv), HOBt hydrate (1.2 equiv), diisopropylethylamine (2.5 equiv), and EDCI HCl (1.2 equiv). The reaction was stirred at room temperature under N2 atmosphere for 14 h and then concentrated under reduced pressure, and the resulting residue was azeotroped with toluene (3×). Purification by chromatography on silica gel afforded the product.


Intermediate B2-1: Synthesis of N1-(4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)-N4-(2-(2-(2-(2-azidoethoxy)ethoxy)ethoxy)ethyl)succinamide



embedded image


To a suspension of 1-azido-13-oxo-3,6,9-trioxa-12-azahexadecan-16-oic acid (116 mg, 364 μmol, 1.0 equiv) in DMF (2 mL) was added 5-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]oxazol-2-amine, TFA salt (164 mg, 364 μmol, 1.0 equiv), HOBt hydrate (66.7 mg, 436 μmol, 1.2 equiv), diisopropylethylamine (157 μL, 909 μmol, 2.5 equiv), and then EDCI HCl (83.5 mg, 436 μmol, 1.2 equiv). The reaction mixture was stirred under N2 atmosphere overnight at room temperature. The reaction mixture was concentrated under reduced pressure removing as much of the DMF as possible and then azeotroped with toluene three times. Purification by silica gel chromatography (0→20% MeOH/DCM) provided the product, N1-(4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)-N4-(2-(2-(2-(2-azidoethoxy)ethoxy)ethoxy) ethyl)succinamide, as a tan colored gummy solid (58 mg, 25% yield). LCMS (ESI) m/z: [M+H] calcd for C28H38N12O6: 639.30; found 639.2.


Following General Procedure 5 above, but using the appropriate carboxylic acid linker section from Table 15, the Intermediates B2 in Table 16 were prepared.









TABLE 16







Additional active site inhibitor containing Intermediates B2 prepared.












Calcu-
Ob-



Molecular
lated
served


Structure
Formula
MW
MW







embedded image


C28H38N12O6
[M + H] = 639.30
[M + H] = 639.2







embedded image


C30H42N12O7
[M + H] = 683.34
[M + H] = 683.2







embedded image


C29H40N12O6
[M + H] = 653.33
[M + H] = 653.3







embedded image


C31H44N12O7
[M + H] = 697.35
[M + H] = 697.3







embedded image


C30H42N12O6
[M + H] = 667.34
[M + H] = 667.3







embedded image


C32H46N12O7
[M + H] = 711.37
[M + H] = 711.3







embedded image


C32H46N12O8
[M + H] = 727.36
[M + H] = 727.3









Following General Procedure 2 above, but using the appropriate Intermediates B2 from Table 16, the Series 2 bifunctional rapamycin analog in Table 17 were prepared.









TABLE 17





Series 2 Bivalent Compounds

















Molecular


Structure
Formula







embedded image


C85H125N13O19







embedded image


C87H129N13O20







embedded image


C86H127N13O19







embedded image


C88H131N13O20







embedded image


C87H129N13O19







embedded image


C89H133N13O20







embedded image


C86H130N14O20







embedded image


C87H132N14O21






Calculated


Structure
MW







embedded image


[M + H] = 1632.93







embedded image


[M + H] = 1676.95







embedded image


[M + H] = 1646.94







embedded image


[M + H] = 1690.97







embedded image


[M + H] = 1660.96







embedded image


[M + H] = 1704.99







embedded image


[M + H] = 1679.97







embedded image


[M + H] = 1709.98






Observed


Structure
MW







embedded image


[M + H] = 1632.9







embedded image


[M + H] = 1676.6







embedded image


[M + H] = 1646.8







embedded image


[M + H] = 1690.8







embedded image


[M + H] = 1660.7







embedded image


[M + H] = 1704.8







embedded image


[M + H] = 1679.9







embedded image


[M + H] = 1709.9









General Procedure 6: Coupling of an Carboxylic Acid-Containing Active Site Inhibitor with Azide Containing PEG-Amine



embedded image


To a 0.18 M suspension of carboxylic acid (1.0 equiv) in DMA was added PEG-amine (1.8 equiv), DIPEA (4.0 equiv) and PyBOP (1.8 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The reaction mixture was then purified by reverse phase HPLC to afford the product after lyophilization.


Intermediate C1-1: Synthesis of (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]-N-(20-azido-3,6,9,12,15,18-hexaoxaicosan-1-yl)cyclohexane-1-carboxamide



embedded image


To a solution of (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]cyclohexane-1-carboxylic acid (50 mg, 123 μmol, 1.0 equiv) and 20-azido-3,6,9,12,15,18-hexaoxaicosan-1-amine (77.4 mg, 221 μmol, 1.8 equiv) in DMA (1.22 mL) was added DIPEA (85.4 μL, 491 μmol, 4.0 equiv) followed by PyBOP (82.7 mg, 159 μmol, 1.8 equiv). The reaction was stirred at room temperature for 2 h. The crude reaction mixture was then purified by reverse phase HPLC (10→100% MeCN/H2O). Lyophilization of pure fractions provided product as a white solid (47.2 mg, 52% yield). LCMS (ESI) m/z: [M+H] calcd for C35H50N10O8: 739.39; found 739.4.


Following the General Procedure 6, but using the appropriate carboxylic acid and azide functionalized amine, the additional Intermediates C1 in Table 18 were prepared.









TABLE 18







Additional active site inhibitor containing Intermediates C1 prepared.











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C35H50N10O8
[M + H] = 739.39
[M + H] = 739.4







embedded image


C42H63N9O11
[M + H] = 870.47
[M + H] = 870.4







embedded image


C39H58N10O10
[M + H] = 827.44
[M + H] = 827.4









Following General Procedure 3, but using the appropriate alkynyl modified rapamycin and Intermediates C1 from Table 18, the Series 3 bivalent analogs in Table 19 were synthesized:









TABLE 19





Series 3 Bivalent Analogs

















Molecular


Structure
Formula







embedded image


C92H137N11O21







embedded image


C99H150N10O24







embedded image


C96H145N11O23






Calculated


Structure
MW







embedded image


[M + H] = 1733.01







embedded image


[M + H] = 1864.09







embedded image


[M + H] = 1821.06






Observed


Structure
MW







embedded image


[M + H] = 1733.8







embedded image


[M + H] = 1863.8







embedded image


[M + H] = 1720.9









General Procedure 7: Coupling of an Amine-Reactive Alkyne Containing Pre-Linker and Amine Containing Ester to Prepare Intermediates D1



embedded image


Step 1

To a 0.14M solution of carboxylic acid (1.25 equiv) in DMF was added HATU (1.9 equiv) and DIPEA (3.75 equiv) followed by amino-PEG-ester (1.0 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The mixture was poured into H2O and the aqueous phase was extracted with DCM. The combined organic phases were washed with brine, dried with anhydrous Na2SO4, filtered and the filtrate was concentrated in vacuum. The residue was purified by silica gel chromatography to afford the product.


Step 2

A 0.67M solution of ester (1 equiv) in TFA was allowed to stir until consumption of ester, as indicated by LCMS. The reaction mixture was quenched with a 0.24M solution of DIPEA in DCM at 0° C., followed by NH4Cl. The aqueous phase was extracted with DCM, and the combined organic phases were dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the product.


Intermediate D1-4: Synthesis of 3-[2-[2-[2-[2-[[2-[4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl]pyrimidine-5-carbonyl]amino]ethoxy]ethoxy]ethoxy]ethoxy]propanoic Acid



embedded image


Step 1

To a solution of 2-[4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl]pyrimidine-5-carboxylic acid (8.5 g, 24.51 mmol, 1.25 equiv, HCl) in DMF (170 mL) was added HATU (13.98 g, 36.77 mmol, 1.9 equiv) and DIPEA (12.81 mL, 73.54 mmol, 3.75 equiv). After stirring for 30 min, tert-butyl 3-[2-[2-[2-(2-aminoethoxy)ethoxy]ethoxy]ethoxy]propanoate (6.30 g, 19.61 mmol, 1.0 equiv) was added to the reaction mixture, at which point the reaction mixture was stirred for an additional 30 min at room temperature. The reaction mixture was quenched with NH4Cl (100 mL) and the aqueous phase was extracted with EtOAc (3×150 mL). The combined organic phases were washed with brine (20 mL), dried with anhydrous Na2SO4, filtered and concentrated in vacuum to give crude product. The crude product was purified by silica gel chromatography (25/1 to 4/1 DCM/MeOH) to give the product (6.3 g, 54.2% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C30H43N7O7: 614.33; found 614.4.


Step 2

A solution of tert-butyl 3-[2-[2-[2-[2-[[2-[4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl]pyrimidine-5-carbonyl]amino]ethoxy]ethoxy]ethoxy]ethoxy]propanoate (3.3 g, 5.38 mmol, 1.0 equiv) in TFA (8 mL) was stirred at room temperature for 5 min. To the reaction mixture was added a solution of DIPEA (18.8 mL) in DCM (80 mL) at 0° C., then NH4Cl (100 mL) was added to the reaction mixture. The aqueous phase was extracted with DCM (10×200 mL). The combined organic phases were dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure to give the product (3 g, 80% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C26H35N7O7: 558.27; found 558.2.


Following the General Procedure 7, but using the appropriate PEG-ester, the additional Intermediates D1 in Table 20 were prepared:









TABLE 20





Additional alkynes prepared



















Calcu-



Molecular
lated


Structure
Formula
MW







embedded image


C20H23N7O4
[M + H] = 426.19







embedded image


C22H27N7O5
[M + H] = 470.22







embedded image


C24H31N7O6
[M + H] = 514.24







embedded image


C26H35N7O7
[M + H] = 558.27







embedded image


C28H39N7O8
[M + H] = 602.29












Observed


Structure
MW







embedded image


[M + H] = 426.1







embedded image


[M + H] = 470.2







embedded image


[M + H] = 514.2







embedded image


[M + H] = 558.2







embedded image


[M + H] = 602.4









General Procedure 8: Coupling of an Alkyne Containing Acid and Amine-Containing Active Site Inhibitor



embedded image


To a 0.16M solution of carboxylic acid (1.0 equiv) in DMF was added HATU (1.5 equiv) and DIPEA (3.0 equiv). The reaction was allowed to stir for 30 min, and then the reaction was cooled to 0° C. and the amine-containing active site inhibitor (1.0 equiv) was added. The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The reaction mixture was then purified by reverse phase HPLC to afford the product.


Intermediate D2-7: Synthesis of N-[2-[2-[2-[2-[3-[4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)pyrazolo[3,4-d]pyrimidin-1-yl]butylamino]-3-oxo-propoxy]ethoxy]ethoxy]ethoxy]ethyl]-2-[4-(5-ethynylpyrimidin-2-yl)piperazin-1-yl]pyrimidine-5-carboxamide



embedded image


To a solution of 3-[2-[2-[2-[2-[[2-[4-(5-ethynylpyrimidin-2-yl) piperazin-1-yl] pyrimidine-5-carbonyl] amino]ethoxy]ethoxy]ethoxy]ethoxy]propanoic acid (1.8 g, 3.23 mmol, 1.0 equiv) in DMF (20 mL) was added HATU (1.84 g, 4.84 mmol, 1.5 equiv), and DIPEA (1.25 g, 9.68 mmol, 1.69 mL, 3.0 equiv). The mixture was stirred at room temperature for 30 min, and then the reaction mixture was cooled to 0° C. and 5-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (1.09 g, 3.23 mmol, 1.0 equiv) was added. The reaction was stirred at room temperature for 1 hr, and then H2O (10 mL) was added. The reaction was purified by prep-HPLC (25→45% MeCN/H2O (10 mM NH4OAc)) to give the product (0.5 g, 17.6% yield) as light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C42H51N15O7: 878.42; found 878.3.


Following the General Procedure 8, but using the appropriate amine-containing active site inhibitor and alkyne functionalized carboxylic acids from Table 20, the additional Intermediates D2 in Table 21 were prepared:









TABLE 21







Additional active site inhibitor containing Intermediates D2 prepared.











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C36H39N15O4
[M + H] = 746.34
[M + H] = 746.3







embedded image


C37H40N14O4
[M + H] = 745.34
[M + H] = 745.3







embedded image


C38H43N15O5
[M + H] = 790.36
[M + H] = 790.3







embedded image


C39H44N14O5
[M + H] = 789.37
[M + H] = 789.3







embedded image


C40H47N15O6
[M + H] = 834.39
[M + H] = 834.2







embedded image


C41H48N14O6
[M + H] = 833.40
[M + H] = 833.3







embedded image


C42H51N15O7
[M + H] = 878.42
[M + H] = 878.3







embedded image


C43H52N14O7
[M + H] = 877.42
[M + H] = 877.4







embedded image


C48H53N15O7
[M + H] = 952.43
[M + H] = 952.5







embedded image


C44H55N15O8
[M + H] = 922.44
[M + H] = 922.3







embedded image


C45H56N14O8
[M + H] = 921.45
[M + H] = 921.4









General Procedure 9: Synthesis of a Bivalent Rapamycin Analog Via Cu-Catalyzed Cycloaddition



embedded image


To a 0.05M solution of azido modified rapamycin (1.0 equiv) in DMSO was added the organoalkyne reagent (2.0 equiv). To the reaction was then added tetrakis(acetonitrile)copper(I) hexafluorophosphate (2.0 equiv) followed by TBTA (4.0 equiv). The reaction was allowed to stir until consumption of alkyne, as indicated by LCMS. The reaction mixture was then diluted with DMSO and formic acid, and purified by reverse phase HPLC to afford the product after lyophilization.


Example 115: Synthesis of Series 4 Bivalent Rapamycin Analog



embedded image


To a solution of Cao-azido rapamycin (20 mg, 21.3 μmol, 1.0 equiv) and D2-7 (37.3 mg, 42.6 μmol, 2.0 equiv) in DMSO (425 μL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (15.8 mg, 42.6 μmol, 2.0 equiv) followed by TBTA (45.1 mg, 85.2 μmol, 4.0 equiv). The reaction stirred for 6 h and was then purified by reverse phase HPLC (10→40→95% MeCN+0.1% formic acid/H2O+0.1% formic acid). Lyophilization of pure fractions provided product (8.31 mg, 21.5% yield) as a white solid. LCMS (ESI) m/z: [M+Na] calcd for C93H129N19O19: 1838.96; found 1838.8.


Following General Procedure 9, but using the appropriate azido modified rapamycin and Intermediates D2 from Table 21, the Series 4 bivalent analogs in Table 22 were synthesized:









TABLE 22





Series 4 Bivalent Analogs

















Molecular


Structure
Formula







embedded image


C87H117N19O16







embedded image


C88H118N18O16







embedded image


C89H121N19O17







embedded image


C90H122N18O17







embedded image


C91H125N19O18







embedded image


C92H126N18O18







embedded image


C93H129N19O19







embedded image


C94H130N18O19







embedded image


C99H131N19O19







embedded image


C95H133N19O20







embedded image


C96H134N18O20






Calculated


Structure
MW







embedded image


[M + H] = 1684.90







embedded image


[M + H] = 1683.91







embedded image


[M + H] = 1728.93







embedded image


[M + H] = 1727.93







embedded image


[M + H] = 1772.95







embedded image


[M + H] = 1771.96







embedded image


[M + Na] = 1838.96







embedded image


[M + H] = 1815.98







embedded image


[M + H] = 1890.99







embedded image


[M + H] = 1861.01







embedded image


[M + H] = 1860.01






Observed


Structure
MW







embedded image


[M + H] = 1684.75







embedded image


[M + H] = 1684.0







embedded image


[M + H] = 1728.7







embedded image


[M + H] = 1727.9







embedded image


[M + H] = 1772.7







embedded image


[M + H] = 1771.8







embedded image


[M + Na] = 1838.8







embedded image


[M + H] = 1815.9







embedded image


[M + H] = 1891.2







embedded image


[M + H] = 1861.0







embedded image


[M + H] = 1859.8









General Procedure 10: Coupling of an Amine-Reactive Alkyne Containing Pre-Linker and Amine Containing PEG-Ester



embedded image


Step 1

To a 0.3M solution of amine (1.0 equiv) in DCM at 0° C. was added DIPEA (1.3 equiv) followed by amine-reactive pre-linker (1.05 equiv). The reaction was allowed to stir until consumption of PEG-amine. The mixture was poured into H2O and the aqueous phase was extracted with DCM. The combined organic phases were washed with NH4Cl, brine, dried with anhydrous Na2SO4, filtered and the filtrate was concentrated in vacuum. The residue was purified by silica gel chromatography to afford the product.


Step 2

A 1.58M solution of ester (1 equiv) in TFA was allowed to stir until consumption of the ester, as indicated by LCMS. The reaction mixture was reduced under reduced pressure and the resulting residue was purified by silica gel chromatography to afford the product.


Intermediate E1-2: Synthesis of 1-{[(prop-2-yn-1-yloxy)carbonyl]amino}-3,6,9,12-tetraoxapentadecan-15-oic Acid



embedded image


Step 1

To a solution of tert-butyl 1-amino-3,6,9,12-tetraoxapentadecan-15-oate (14.5 g, 45.11 mmol, 1.0 equiv) and DIPEA (10.22 mL, 58.65 mmol, 1.3 equiv) in DCM (150 mL) was added prop-2-yn-1-yl carbonochloridate (5.61 g, 47.37 mmol, 1.05 equiv) at 0° C. The reaction solution was stirred at room temperature for 2 h, at which point the mixture was poured into ice-H2O (200 mL) and stirred for 5 min. The aqueous phase was extracted with DCM (3×100 mL). The combined organic phase was washed with aqueous NH4Cl (2×80 mL), brine (100 mL), dried with anhydrous Na2SO4, filtered and concentrated in vacuo. The residue was purified by silica gel chromatography (1/0 to 1/1 petroleum ether/EtOAc) to afford tert-butyl 5-oxo-4,9,12,15,18-pentaoxa-6-azahenicos-1-yn-21-oate (13.5 g, 74.2% yield) as light yellow oil.


Step 2

To tert-butyl 5-oxo-4,9,12,15,18-pentaoxa-6-azahenicos-1-yn-21-oate (15 g, 37.18 mmol, 1.0 equiv) was added TFA (23.45 mL, 316.70 mmol, 8.52 equiv) at room temperature. The reaction was stirred for 5 min and then the mixture was concentrated under reduced pressure at 45° C. The residue was purified by silica gel chromatography (0/1 to 1/20 MeOH/EtOAc) to afford the product (12 g, 92.9% yield) as light yellow oil.


Following the General Procedure 10, but using the appropriate amine-reactive pre-linker and amine functionalized ester, the additional Intermediates E1 in Table 23 were prepared:









TABLE 23







Additional carbonxylic acid linker Intermediates E1 prepared.











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C13H21NO7
[M + Na] = 326.12
[M + Na] = 326.1







embedded image


C15H25NO8
[M + H] = 348.17








embedded image


C15H25NO6
[M + H] = 316.18
[M + H] = 316.0







embedded image


C17H29NO7
[M + H] = 360.20
[M + H] = 360.1







embedded image


C18H23NO6
[M + H] = 350.16
[M + H] = 350.2







embedded image


C20H27NO7
[M + H] = 394.19
[M + H] = 394.3









General Procedure 11: Coupling of an Alkyne Containing Acid and Amine Containing Ester



embedded image


Step 1

To a 0.14M solution of carboxylic acid (1.0 equiv) in DCM was added HATU (1.5 equiv) and DIPEA (3.0 equiv). The mixture was stirred for 1 h, then amino-PEG-ester (1.0 equiv) was added. The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The mixture was poured into H2O and the aqueous phase was extracted with DCM. The combined organic phases were washed with brine, dried with anhydrous Na2SO4, filtered and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography to afford the product.


Step 2

A 1.58M solution of ester (1 equiv) in TFA was allowed to stir until consumption of the ester, as indicated by LCMS. The reaction mixture was concentrated under reduced pressure and the resulting residue was purified by silica gel chromatography to afford the product.


Intermediate E2-4: Synthesis of 5,21-dioxo-4,9,12,15,18,25,28,31,34-nonaoxa-6,22-diazaheptatriacont-1-yn-37-oic Acid



embedded image


Step 1

To a solution of E1-2 (5 g, 14.39 mmol, 1.0 equiv) in DCM (100 mL) was added HATU (8.21 g, 21.59 mmol, 1.5 equiv) and DIPEA (7.52 mL, 43.18 mmol, 3.0 equiv). The mixture was stirred at room temperature for 1 h, then tert-butyl 1-amino-3,6,9,12-tetraoxapentadecan-15-oate (4.63 g, 14.39 mmol, 1.0 equiv) was added to the mixture. The reaction mixture was stirred for 2 h and was then poured into H2O (100 mL) and stirred for 5 min. The aqueous phase was extracted with DCM (2×50 mL) and the combined organic phases were washed with 0.5 N HCl (3×50 mL), saturated aqueous NaHCO3(2×50 mL), brine (50 mL), dried with anhydrous Na2SO4, filtered and concentrated under reduced pressure. The residue was purified by silica gel chromatography (1/0 to 12/1 EtOAc/MeOH) to afford tert-butyl 5,21-dioxo-4,9,12,15,18,25,28,31,34-nonaoxa-6,22-diazaheptatriacont-1-yn-37-oate (8.5 g, 90.7% yield) as a light yellow oil.


Step 2

A solution of tert-butyl 5,21-dioxo-4,9,12,15,18,25,28,31,34-nonaoxa-6,22-diazaheptatriacont-1-yn-37-oate (8.5 g, 13.06 mmol, 1.0 equiv) in TFA (8.24 mL, 111.27 mmol, 8.52 equiv) was stirred at room temperature for 5 min. The mixture was concentrated under reduced pressure at 45° C. The residue was purified by silica gel chromatography (0/1 to 1/10 MeOH/EtOAc) to afford the product (4.76 g, 60.4% yield) as light yellow oil. LCMS (ESI) m/z: [M+H] calcd for C26H46N2O13: 595.31; found 595.4.


Following the General Procedure 11, but using the appropriate alkyne-containing carboxylic acid from Table 23 and amine functionalized ester, the additional Intermediates E2 in Table 24 were prepared:









TABLE 24







Additional alkynes prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C20H34N2O10
[M − H] = 461.21
[M − H] = 461.2







embedded image


C22H38N2O11
[M + H] = 505.24
[M + H] = 505.2







embedded image


C24H42N2O12
[M + H] = 551.28
[M + H] = 551.4







embedded image


C26H46N2O13
[M + H] = 595.31
[M + H] = 595.4







embedded image


C22H38N2O9
[M − H] = 473.25
[M − H] = 473.2







embedded image


C24H42N2O10
[M + H] = 519.29
[M + H] = 519.2







embedded image


C26H46N2O11
[M + H] = 563.32
[M + H] = 563.3







embedded image


C28H50N2O12
[M + H] = 607.34
[M + H] = 607.2







embedded image


C25H36N2O9
[M + H] = 509.25
[M + H] = 509.2







embedded image


C27H40N2O10
[M + H] = 553.28
[M + H] = 553.2







embedded image


C29H44N2O11
[M + H] = 597.30








embedded image


C31H48N2O12
[M + H] = 641.33
[M + H] = 641.4









General Procedure 12: Coupling of an Acid and Amine Containing Active Site Inhibitor



embedded image


To a 0.1M solution of carboxylic acid (1.0 equiv) in dioxane was added amine-containing active site inhibitor (1.8 equiv) and DIPEA (3.0 equiv), followed by PyBOP (1.3 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The reaction mixture was then purified by silica gel chromatography to afford the product.


Intermediate E3-7: Synthesis of prop-2-yn-1-yl N-(14-{[14-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)-3,6,9,12-tetraoxatetradecan-1-yl]carbamoyl}-3,6,9,12-tetraoxatetradecan-1-yl)carbamate



embedded image


To a solution of E2-4 (0.1 g, 0.1681 mmol, 1.0 equiv) in dioxane (1.68 mL) was added 5-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (131 mg, 0.3025 mmol, 1.8 equiv) followed by DIPEA (87.7 μL, 0.5043 mmol, 3.0 equiv). Finally, PyBOP (113 mg, 1.3 equiv) was added. The reaction was stirred for 4 h and then purified by silica gel chromatography (0%→20% DCM/MeOH). LCMS (ESI) m/z: [M+H] calcd for C42H62N10O13: 915.46; found 915.3.


Following the General Procedure 12, but using the appropriate alkyne-containing carboxylic acid from Table 24 and amine-containing active site inhibitor, the additional Intermediates E3 in Table 25 were prepared:









TABLE 25







Additional active site inhibitor containing Intermediates E3 prepared.












Calcu-
Ob-



Molecular
lated
served


Structure
Formula
MW
MW







embedded image


C36H50N10O10
[M + H] = 783.38
[M + H] = 783.5





Intermediate E3-1







embedded image


C37H51N9O10
[M + H] = 782.38
[M + H] = 782.3





Intermediate E3-2










embedded image


C38H54N10O11
[M + H] = 827.41
[M + H] = 827.4





Intermediate E3-3










embedded image


C39H55N9O10
[M + H] = 826.41
[M + H] = 826.4





Intermediate E3-4










embedded image


C40H58N10O12
[M + H] = 871.43
[M + H] = 871.3





Intermediate E3-5










embedded image


C41H59N9O12
[M + H] = 870.44
[M + H] = 870.3





Intermediate E3-6










embedded image


C42H62N10O13
[M + H] = 915.46
[M + H] = 915.3





Intermediate E3-7










embedded image


C43H63N9O13
[M + H] = 914.46
[M + H] = 914.4





Intermediate E3-8










embedded image


C38H54N10O9
[M + H] = 795.42
[M + H] = 795.5





Intermediate E3-9










embedded image


C39H55N9O9
[M + H] = 794.42
[M + H] = 794.6





Intermediate E3-10










embedded image


C40H58N10O10
[M + H] = 839.44
[M + H] = 839.3





Intermediate E3-11










embedded image


C41H59N9O10
[M + H] = 838.45
[M + H] = 838.4





Intermediate E3-12










embedded image


C43H63N9O11
[M + H] = 882.47
[M + H] = 882.4





Intermediate E3-13










embedded image


C42H62N10O11
[M + H] = 883.47
[M + H] = 883.4





Intermediate E3-14










embedded image


C44H66N10O12
[M + H] = 927.49
[M + H] = 927.5





Intermediate E3-15










embedded image


C45H67N9O12
[M + H] = 926.50
[M + H] = 926.4





Intermediate E3-16










embedded image


C41H52N10O9
[M + H] = 829.40
[M + H] = 829.3





Intermediate E3-17










embedded image


C43H56N10O10
[M + H] = 873.43
[M + H] = 873.4





Intermediate E3-19










embedded image


C44H57N9O10
[M + H] = 872.43
[M + H] = 872.3





Intermediate E3-20










embedded image


C45H60N10O11
[M + H] = 917.45
[M + H] = 917.4





Intermediate E3-21










embedded image


C46H61N9O11
[M + H] = 916.46
[M + H] = 916.4





Intermediate E3-22










embedded image


C47H64N10O12
[M + H] = 961.48
[M + H] = 961.5





Intermediate E3-23










embedded image


Ca48H65N9O12
[M + H] = 960.48
[M + H] = 960.4





Intermediate E3-24









Intermediate E3-25: Synthesis of N-{2-[2-(2-{2-[(2-{2-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}(methyl)carbamoyl)ethoxy]ethoxy}ethyl)(methyl)carbamoyl]ethoxy}ethoxy)eth oxy]ethyl}-N-methylhex-5-ynamide



embedded image


To a suspension of tetrabutylammonium bromide (16.1 mg, 50.0 μmol, 0.4 equiv) and potassium hydroxide (31.5 mg, 562 μmol, 4.5 equiv) in THF (1.25 mL) was added E3-9 (100 mg, 125 μmol, 1.0 equiv) followed by methyl iodide (34.9 μL, 562 μmol, 4.5 equiv). After stirring for 21 h, H2O (0.2 mL) was added. The reaction mixture was purified by silica gel chromatography (0→20% MeOH/DCM) to afford the product (17.1 mg, 16% yield). LCMS (ESI) m/z: [M+H] calcd for C41H60N10O9: 837.46; found 837.4.









TABLE 26







Additional active site inhibitor containing Intermediates E3 prepared.











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C41H60N10O9
[M + H] = 837.46
[M + H] = 837.4





Intermediate E3-25









Example 125: Synthesis of Series 5 Bivalent Rapamycin Analog



embedded image


To a solution of 40(S)-azido rapamycin (25.0 mg, 26.6 μmol, 1.0 equiv) and E3-7 (48.6 mg, 53.2 μmol, 2.0 equiv) in DMSO (532 μL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (19.8 mg, 53.2 μmol, 2.0 equiv) followed by TBTA (56.4 mg, 106.4 μmol, 4.0 equiv). The reaction stirred for 6 h and was then purified by reverse phase HPLC (10→40→95% MeCN+0.1% formic acid/H2O+0.1% formic acid). Lyophilization of pure fractions provided the product (11.6 mg, 23.5% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C93H140N14O25: 1854.02; found 1853.7.


Following General Procedure 3, but using the appropriate azide modified rapamycin and Intermediates E3 from Table 25 and Table 26, the Series 5 bivalent analogs in Table 27 were synthesized:









TABLE 27







Series 5 Bivalent Analogs












Calcu-
Ob-



Molecular
lated
served


Structure
Formula
MW
MW







embedded image


C87H128N14O22
[M + Na] = 1743.92
[M + Na] = 1743.9





Example 120










embedded image


C88H129N13O22
[M + H] = 1720.95
[M + H] = 1720.9





Example 121










embedded image


C89H132N14O23
[M + H] = 1765.97
[M + H] = 1766.1





Example 122










embedded image


C90H133N13O23
[M + H] = 1764.97
[M + H] = 1764.8





Example 123










embedded image


C91H136N14O24
[M + H] = 1809.99
[M + H] = 1809.8





Example 124










embedded image


C93H140N14O25
[M + H] = 1854.02
[M + H] = 1853.7





Example 125










embedded image


C92H137N13O24
[M + H] = 1809.00
[M + H] = 1808.9





Example 126










embedded image


C94H141N13O25
[M + H] = 1853.02
[M + H] = 1852.8





Example 127










embedded image


C89H132N14O21
[M + H] = 1733.98
[M + H] = 1734.0





Example 128










embedded image


C90H133N13O21
[M + H] = 1732.98
[M + H] = 1732.9





Example 129










embedded image


C91H136N14O22
[M + H] = 1778.00
[M + H] = 1778.0





Example 130










embedded image


C92H137N13O22
[M + H] = 1777.01
[M + H] = 1777.0





Example 131










embedded image


C93H140N14O23
[M + H] = 1822.03
[M + H] = 1822.1





Example 132










embedded image


C94H141N13O23
[M + H] = 1821.03
[M + H] = 1821.0





Example 133










embedded image


C95H144N14O24
[M + H] = 1866.06
[M + H] = 1865.9





Example 134










embedded image


C96H145N13O24
[M + H] = 1865.06
[M + H] = 1865.0





Example 135










embedded image


C92H130N14O21
[M + H] = 1767.96
[M + H] = 1767.9





Example 136










embedded image


C94H134N14O22
[M + H] = 1811.99
[M + H] = 1812.1





Example 137










embedded image


C95H135N13O22
[M + H] = 1810.99
[M + H] = 1811.1





Example 138










embedded image


C96H138N14O23
[M + H] = 1856.01
[M + H] = 1856.0





Example 139










embedded image


C97H139N13O23
[M + H] = 1855.02
[M + H] = 1854.9





Example 140










embedded image


C98H142N14O24
[M + H] = 1900.04
[M + H] = 1899.9





Example 141










embedded image


C99H143N13O24
[M + H] = 1899.04
[M + H] = 1899.0





Example 142










embedded image


C88H132N14O22
[M + H] = 1737.97
[M + H] = 1737.8





Example 143










embedded image


C89H133N13O22
[M + H] = 1736.98
[M + H] = 1736.7





Example 144










embedded image


C90H136N14O23
[M + H] = 1782.00
[M + H] = 1782.0





Example 145










embedded image


C91H137N13O23
[M + H] = 1781.00
[M + H] = 1780.9





Example 146










embedded image


C89H134N14O22
[M + H] = 1751.99
[M + H] = 1751.9





Example 147










embedded image


C90H135N13O22
[M + H] = 1750.99
[M + H] = 1750.9





Example 148










embedded image


C91H138N14O23
[M + H] = 1796.01
[M + H] = 1795.9





Example 149










embedded image


C92H139N13O23
[M + H] = 1795.02
[M + H] = 1794.8





Example 150










embedded image


C88H131N15O22
[M + H] = 1750.97
[M + H] = 1750.9





Example 151










embedded image


C89H132N14O22
[M + H] = 1749.97
[M + H] = 1749.9





Example 152










embedded image


C90H135N15O23
[M + H] = 1794.99
[M + H] = 1794.8





Example 153










embedded image


C94H135N15O22
[M + H] = 1827.00
[M + H] = 1826.9





Example 154










embedded image


C95H136N14O22
[M + H] = 1826.00
[M + H] = 1825.9





Example 155










embedded image


C96H139N15O23
[M + H] = 1871.02
[M + H] = 1870.9





Example 156










embedded image


C97H140N14O23
[M + H] = 1870.03
[M + H] = 1869.9





Example 157










embedded image


C91H137N15O22
[M + H] = 1793.01
[M + H] = 1792.9





Example 158










embedded image


C92H138N14O22
[M + H] = 1792.02
[M + H] = 1791.9





Example 159










embedded image


C93H141N15O23
[M + H] = 1837.04
[M + H] = 1836.9





Example 160










embedded image


C94H142N14O23
[M + H] = 1836.05
[M + H] = 1836.0





Example 161










embedded image


C90H136N14O21
[M + H] = 1750.01
[M + H] = 1749.8





Example 162










embedded image


C91H137N13O21
[M + H] = 1749.01
[M + H] = 1748.8





Example 163










embedded image


C92H140N14O22
[M + H] = 1794.03
[M + H] = 1793.9





Example 164










embedded image


C91H138N14O21
[M + H] = 1764.02
[M + H] = 1763.9





Example 165










embedded image


C92H139N13O21
[M + H] = 1763.03
[M + H] = 1762.9





Example 166










embedded image


C93H142N14O22
[M + H] = 1808.05
[M + H] = 1808.0





Example 167










embedded image


C94H143N13O22
[M + H] = 1807.05
[M + H] = 1807.0





Example 168










embedded image


C90H135N15O21
[M + H] = 1763.00
[M + H] = 1762.9





Example 169










embedded image


C91H136N14O21
[M + H] = 1762.01
[M + H] = 1761.9





Example 170










embedded image


C92H139N15O22
[M + H] = 1807.03
[M + H] = 1807.0





Example 171










embedded image


C93H140N14O22
[M + H] = 1806.03
[M + H] = 1805.9





Example 172










embedded image


C96H139N15O21
[M + H] = 1839.03
[M + H] = 1838.9





Example 173










embedded image


C98H143N15O22
[M + H] = 1883.06
[M + H] = 1883.0





Example 174










embedded image


C99H144N14O22
[M + H] = 1882.07
[M + H] = 1881.9





Example 175










embedded image


C93H141N15O21
[M + H] = 1805.05
[M + H] 1804.9





Example 176










embedded image


C95H145N15O22
[M + H] = 1849.08
[M + H] = 1848.9





Example 177










embedded image


C96H146N14O22
[M + H] = 1848.08
[M + H] = 1847.9





Example 178










embedded image


C93H141N13O22
[M + H] = 1793.04
[M + H] = 1792.9





Example 179










embedded image


C92H138N14O21
[M + H] = 1776.02
[M + H] = 1775.8





Example 180









Following the General Procedure 10, but using the appropriate amine-reactive pre-linker and amine functionalized ester, the additional Intermediates F1 in Table 28 were prepared:









TABLE 28







Additional carboxylic acid linker Intermediates F1 prepared.











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C11H17NO6
[M + H] = 260.11






Intermediate Fl-1










embedded image


C13H21NO7
[M + Na] = 326.12
[M + Na] = 326.1





Intermediate F1-2










embedded image


C15H25NO8
[M + H] = 348.17






Intermediate F1-3









General Procedure 13: Coupling of an Alkyne Containing Acid and Amine Containing Post-Linker



embedded image


Step 1

To a 0.2M solution of carboxylic acid (1.3 equiv) in DMF was added HATU (1.9 equiv) and DIPEA (5.0 equiv). The mixture was stirred for 1 h, then amino-containing post-linker (1.0 equiv) was added. The reaction was allowed to stir until consumption of amine-linker, as indicated by LCMS. The mixture was poured into H2O and the precipitate was collected by filtration under N2 to give crude product. The residue was purified by silica gel chromatography to afford the product.


Step 2

To a 0.02M solution of ester (1.0 equiv) in THF/EtOH/H2O (2:1:1) was added LiOH.H2O (2.0 equiv) at room temperature. The reaction mixture was stirred until consumption of the ester, as indicated by LCMS. The mixture was concentrated under reduced pressure to remove THF and EtOH. The aqueous phase was neutralized with aqueous HCl (0.5 N) and then the precipitate was collected by filtration under N2 to give product.


Intermediate F2-3: Synthesis of 4-(4-(5-(3,19-dioxo-6,9,12,15,20-pentaoxa-2,18-diazatricos-22-yn-1-yl)pyrimidin-2-yl)piperazin-1-yl)benzoic Acid



embedded image


Step 1

To a solution of F1-3 (4.40 g, 12.66 mmol, 1.3 equiv) in DMF (60 mL) was added HATU (7.04 g, 18.51 mmol, 1.9 equiv) and DIPEA (8.48 mL, 48.70 mmol, 5 equiv), the mixture was stirred at room temperature for 1 h, then ethyl 2-(4-(5-(aminomethyl)pyrimidin-2-yl)piperazin-1-yl) pyrimidine-5-carboxylate (3.7 g, 9.74 mmol, 1.0 equiv, HCl) was added. The reaction was stirred for 3 h and was then poured into H2O (300 mL) and stirred for 10 min. The precipitate was collected by filtration under N2 to give the crude product as brown solid. The residue was purified by silica gel chromatography (1/1 to 0/1 petroleum ether/EtOAc, then 1/0 to 15/1 DCM/MeOH) to afford ethyl 2-(4-(5-(3,19-dioxo-6,9,12,15,20-pentaoxa-2,18-diazatricos-22-yn-1-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (4.7 g, 70.2% yield) as white solid. LCMS (ESI) m/z: [M+H] calcd for C31H44N8O9: 673.32; found 673.3.


Step 2

To a solution of ethyl 2-(4-(5-(3,19-dioxo-6,9,12,15,20-pentaoxa-2,18-diazatricos-22-yn-1-yl)pyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylate (5.38 g, 8.00 mmol, 1.0 equiv) in THF (270 mL) EtOH (135 mL) and H2O (135 mL) was added LiOH.H2O (671.13 mg, 15.99 mmol, 2.0 equiv) at 25° C. The reaction mixture was stirred at 25° C. for 20 h. The mixture was concentrated under reduced pressure to remove THF and EtOH. The aqueous phase was neutralized with aqueous HCl (0.5 N) and then the precipitate was collected by filtration under N2 to give 4-(4-(5-(3,19-dioxo-6,9,12,15,20-pentaoxa-2,18-diazatricos-22-yn-1-yl)pyrimidin-2-yl)piperazin-1-yl)benzoic acid (4.34 g, 79.9% yield) as white solid. LCMS (ESI) m/z: [M+H] calcd for C29H40N8O9: 645.30; found 645.1.


Following the General Procedure 13, but using the appropriate alkyne-containing carboxylic acid from Table 28 and amine functionalized ester, the additional Intermediates F2 in Table 29 were prepared:









TABLE 29







Additional alkynes prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C25H32N8O7
[M + H] = 557.25
[M + H] = 557.1





Intermediate F2-1










embedded image


C27H36N8O8
[M + H] = 601.27
[M + H] = 601.4





Intermediate F2-2










embedded image


C29H40N8O9
[M + H] = 645.30
[M + H] = 645.1





Intermediate F2-3












Intermediate F3-5: Synthesis of prop-2-yn-1-yl N-(14-{[(2-{4-[5-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)pyrimidin-2-yl]piperazin-1-yl}pyrimidin-5-yl)methyl]carbamoyl}-3,6,9,12-tetraoxatetradecan-1-yl)carbamate



embedded image


To a solution of F2-3 (0.1 g, 0.1551 mmol, 1.0 equiv) in dioxane (1.55 mL) was added 5-[4-amino-1-(4-aminobutyl)pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amine (121 mg, 0.2791 mmol, 1.8 equiv) followed by DIPEA (80.9 μL, 0.4653 mmol, 3.0 equiv). Finally, PyBOP (104 mg, 0.2016 mmol, 1.3 equiv) was added. The reaction stirred for 4 h and then purified by silica gel chromatography (0%→20% DCM/MeOH). LCMS (ESI) m/z: [M+H] calcd for C45H56N16O9: 965.45; found 965.4.


Following the General Procedure 12, but using the appropriate alkyne-containing carboxylic acid from Table 29 and amine-containing active site inhibitor, the additional Intermediates F3 in Table 30 were prepared:









TABLE 30







Additional alkynes prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C41H48N16O7
[M + H] = 877.40
[M + H] = 877.4





Intermediate F3-1










embedded image


C42H49N15O7
[M + H] = 876.40
[M + H] = 876.3





Intermediate F3-2










embedded image


C43H52N16O8
[M + H] = 921.42
[M + H] = 921.4





Intermediate F3-3










embedded image


C44H53N15O8
[M + H] = 920.43
[M + H] = 920.4





Intermediate F3-4










embedded image


C45H56N16O9
[M + H] = 965.45
[M + H] = 965.4





Intermediate F3-5










embedded image


C46H57N15O9
[M + H] = 964.45
[M + H] = 964.4





Intermediate F3-6









Example 185: Synthesis of Series 6 Bivalent Rapamycin Analog



embedded image


embedded image


To a solution of 40(S)-azido rapamycin (25.0 mg, 26.6 μmol, 1.0 equiv) and F3-5 (51.3 mg, 53.2 μmol, 2.0 equiv) in DMSO (532 μL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (19.8 mg, 53.2 μmol, 2.0 equiv) followed by TBTA (56.4 mg, 106.4 μmol, 4.0 equiv). The reaction stirred for 6 h and was then purified by reverse phase HPLC (10→40→95% MeCN+0.1% formic acid/H2O+0.1% formic acid). Lyophilization of pure fractions provided product (11.6 mg, 22.7% yield) as a white solid. LCMS (ESI) m/z: [M+H] calcd for C96H134N20O21: 1904.01; found 1903.9.


Following General Procedure 3, but using the appropriate azide modified rapamycin and Intermediates F3, the Series 6 bivalent analogs in Table 31 were synthesized:









TABLE 31







Series 6 Bivalent Analogs











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C92H126N20O19
[M + H] = 1815.96
[M + H] = 1816.0





Example 181










embedded image


C93H127N19O19
[M + H] = 1814.96
[M + H] = 1814.9





Example 182










embedded image


C94H13N20O20
[M + H] = 1859.98
[M + H] = 1860.0





Example 183










embedded image


C95H131N19O20
[M + H] = 1858.99
[M + H] = 1859.1





Example 184










embedded image


C96H134N20O21
[M + H] = 1904.01
[M + H] = 1903.9





Example 185










embedded image


C97H135N19O21
[M + H] = 1903.02
[M + H] = 1902.9





Example 186









General Procedure 14: Coupling of an Amine and a Carboxylic Acid Containing Active Site Inhibitor



embedded image


Step 1

To a 0.18M solution of carboxylic acid (1.0 equiv) and amino-PEG (1.1 equiv) in pyridine was added EDC (1.1 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The pyridine was removed under reduced pressure and the resulting residue was dissolved in DCM and washed with H2O. The aqueous phase was extracted with DCM and the combined organic phases were dried with anhydrous MgSO4, filtered and the filtrate was concentrated under reduced pressure. The residue was purified by silica gel chromatography to afford the product.


Step 2

A 0.03M solution of Boc protected amine (1 equiv) in DCM was added TFA (80 equiv). The reaction was allowed to stir until consumption of the starting material, as indicated by LCMS. The reaction mixture was concentrated under reduced pressure and the resulting residue to afford the product.


Intermediate G1-2: Synthesis of (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]-N-(2-{2-[2-(2-aminoethoxy)ethoxy]ethoxy}ethyl)cyclohexane-1-carboxamide



embedded image


Step 1

To a solution of trans-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[5,1-f][1,2,4]triazin-7-yl]cyclohexanecarboxylic acid (75.0 mg, 0.184 mmol, 1.0 equiv) and N-Boc-2,2′-[oxybis(ethylenoxy)]diethylamine (59.1 mg, 0.202 mmol, 1.1 equiv) in pyridine (1 mL) was added EDC (39.8 mg, 0.208 mmol, 1.1 equiv). After stirring overnight, the pyridine was removed under reduced pressure. The resulting residue was dissolved in DCM (30 mL) and washed with H2O (30 mL). The aqueous layer was back extracted with DCM (30 mL) and the combined organic phases were dried with MgSO4, filtered, and concentrated under reduced pressure. The crude material was purified by prep-TLC (60% acetone/hexanes) to provide the product (92.9 mg, 73% yield) as a light brown residue. LCMS (ESI) m/z: [M+H] calcd for C34H48N8O7: 681.37; found 681.4.


Step 2

To a solution of tert-butyl N-(2-{2-[2-(2-{[(1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]cyclohexyl]formamido}ethoxy)ethoxy]ethoxy}ethyl)carbamate (92.9 mg, 0.136 mmol, 1 equiv) in DCM (4 mL) at 0° C. was added TFA (0.8 mL, 10 mmol, 80 equiv). The mixture was stirred at 0° C. for 45 min, then warmed to room temperature. After 30 min at room temperature the solvent was removed under reduced pressure. The residue was diluted with DCM (5 mL) and concentrated to provide the product (125.0 mg, 100% yield) as a yellow residue. LCMS (ESI) m/z: [M+H] calcd for C29H40N8O5: 581.32; found 581.4.


Following the General Procedure 14, but using the appropriate alkyne-containing carboxylic acid and amine functionalized PEG, the additional Intermediates G1 in Table 32 were prepared:









TABLE 32







Additional amines prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C27H36N8O4
[M + H] = 537.29
[M + H] = 537.5





Intermediate G1-1










embedded image


C29H40N8O5
[M + H] = 581.32
[M + H] = 581.4





Intermediate G1-2









Intermediate G2-2: Synthesis of 1-azido-N-(2-{2-[2-(2-{[(1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]cyclohexyl]formamido}ethoxy)ethoxy]ethoxy}ethyl)-3,6,9,12-tetraoxapentadecan-15-amide



embedded image


To a solution of azido-PEG4-NHS ester (66.1 mg, 0.170 mmol, 1.25 equiv) and (1r,4r)-4-[4-amino-5-(7-methoxy-1H-indol-2-yl)imidazo[4,3-f][1,2,4]triazin-7-yl]-N-(2-{2-[2-(2-aminoethoxy)ethoxy]ethoxy}ethyl)cyclohexane-1-carboxamide (94.5 mg, 0.136 mmol, 1.0 equiv) in DMF (2.8 mL) was added TEA (94 μL, 0.68 mmol, 5.0 equiv), dropwise at room temperature. The reaction was stirred for 50 min and then the solvent was removed under reduced pressure to afford a yellow oil. The crude material was purified by prep-TLC (10% MeOH/DCM) to provide the product (91.2 mg, 78% yield) as a yellow oil. LCMS (ESI) m/z: [M+H] calcd for C40H59N11O10: 854.45; found 854.5.


Following the General Procedure 1, but using the appropriate amine from Table 32 and azide functionalized N-hydroxysuccinimide ester, the additional Intermediates G2 in Table 33 were prepared:









TABLE 33







Additional active site inhibitor containing Intermediates G2 prepared.











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C38H55N11O9
[M + Na] = 832.41
[M + Na] = 832.3





Intermediate G2-1










embedded image


C40H59N11O10
[M + H] = 854.45
[M + H] = 854.5





Intermediate G2-2









Following General Procedure 3, but using the appropriate alkyne modified rapamycin and Intermediates G2, the Series 7 bivalent analogs in Table 34 were synthesized:









TABLE 34







Series 7 Bivalent Analogs












Calcu-
Ob-



Molecular
lated
served


Structure
Formula
MW
MW







embedded image


C95H142N12O22
[M + H] = 1804.04
[M + H] = 1803.9





Example 187










embedded image


C96H146N12O22
[M + H] = 1820.08
[M + H] = 1820.2





Example 188










embedded image


C97H146N12O23
[M + H] = 1848.07
[M + H] = 1848.3





Example 189










embedded image


C98H150N12O23
[M + H] = 1864.10
[M + H] = 1864.3





Example 190









General Procedure 15: Coupling of an Amine-Reactive Azide Containing Pre-Linker and Amine Containing Ester



embedded image


Step 1

To a 0.12M solution of carboxylic acid (1.0 equiv) in DMF was added DIPEA (3.0 equiv) and HATU (1.5 equiv) followed by amino-PEG-ester (1.5 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The mixture was poured into H2O and the precipitate was isolated by filteration. The crude material was purified by silica gel chromatography to afford the product.


Step 2

To a 0.03M solution of ester (1.0 equiv) in THF/H2O/MeOH (4:1:1) was added LiOH.H2O (1.50 equiv) at room temperature. The reaction was allowed to stir until consumption of the ester, as indicated by LCMS, at which point the reaction mixture was diluted with H2O and the mixture was acidified with aqueous HCl (0.5M) to pH 7. The precipitate was filtered and the filter cake was washed with H2O, and dried under reduced pressure to give crude product. The crude product was dissolved in TFA and was then evaporated under reduced pressure. The oily residue was triturated with MeCN, then dropped into MTBE for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N2 to give the product.


Intermediate H1-1: Synthesis of 3-[2-({2-[4-(5-azidopyrimidin-2-yl)piperazin-1-yl]pyrimidin-5-yl}formamido)ethoxy]propanoic Acid



embedded image


Step 1

To a solution of 2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxylic acid (796.12 mg, 2.43 mmol, 1.0 equiv) in DMF (20 mL) was added DIPEA (1.27 mL, 7.30 mmol, 3.0 equiv) and HATU (1.39 g, 3.65 mmol, 1.5 equiv) at room temperature, after 1 h, methyl 3-(2-aminoethoxy)propanoate (0.67 g, 3.65 mmol, 1.5 equiv, HCl) was added to the mixture. The reaction mixture was stirred for 20 min, at which point the mixture was poured into H2O (200 mL) and stirred for 5 min. The supernatant was removed and then the precipitate was collected by filtration under N2 to give the crude product. The residue was purified by silica gel chromatography (1/1 to 0/1 petroleum ether/EtOAc) to afford the product (0.8 g, 1.68 mmol, 69.0% yield) as a light yellow solid. LCMS (ESI) m/z: [M+Na] calcd for C19H24N10O4: 479.2; found 479.1.


Step 2

To a solution of methyl 3-(2-(2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxamido)ethoxy)propanoate (0.8 g, 1.75 mmol, 1.0 equiv) in THF (40 mL), H2O (10 mL) and MeOH (10 mL) was added LiOH.H2O (0.11 g, 2.62 mmol, 1.50 equiv) at room temperature. The reaction mixture was stirred for 3 h, at which point the mixture was concentrated under reduced pressure to remove THF and MeOH. To the residue was added H2O (50 mL) and the mixture was acidified with aqueous HCl (0.5M) to pH 7. The precipitate was filtered and the filter cake was washed with H2O (20 mL), and dried under reduced pressure to give crude product. The crude product was dissolved in TFA (3 mL) and was then evaporated under reduced pressure. The oily residue was triturated with MeCN (1 mL), then dropped into MTBE (20 mL) for 10 min. The supernatant was removed and then the precipitate was collected by filtration under N2 to give the product (0.368 g, 34.5% yield, TFA) as a light yellow solid. LCMS (ESI) m/z: [M+H] calcd for C18H22N10O4: 443.19; found 443.1.


Following the General Procedure 15, but using the appropriate amine and acid, the additional Intermediates H1 in Table 35 were prepared:









TABLE 35







Additional azides prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW















embedded image


C18H22N10O4
[M + H] = 443.19
[M + H] = 443.1







embedded image


C20H26N10O5
[M + H] = 487.22
[M + H] = 487.2







embedded image


C22H30N10O6
[M + H] = 531.24
[M + H] = 531.2







embedded image


C19H24N10O5
[M + H] = 473.20









Intermediate H2-1: Synthesis of N-(2-(3-((4-(4-amino-3-(2-aminobenzo[d]oxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl)butyl)amino)-3-oxopropoxy)ethyl)-2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxamide



embedded image


To a solution of 3-(2-(2-(4-(5-azidopyrimidin-2-yl)piperazin-1-yl)pyrimidine-5-carboxamido)ethoxy)propanoic acid (100 mg, 185 μmol, 1.0 equiv) and 5-{4-amino-1-pentyl-1H-pyrazolo[3,4-d]pyrimidin-3-yl}-1,3-benzoxazol-2-amine (99.9 mg, 221 μmol, 1.2 equiv) in DMA (1.84 mL) was added DIPEA (112 μL, 647 μmol, 3.5 equiv) followed by HOBt hydrate (42.2 mg, 221 μmol, 1.2 equiv) and EDCI HCl (42.3 mg, 221 μmol, 1.2 equiv). The reaction was stirred at room temperature for 7 h, at which point the reaction mixture was diluted with DMSO and purified by reverse phase prep-HPLC (10→100% MeCN/H2O to provide the product (28.4 mg, 20% yield). LCMS (ESI) m/z: [M+H] calcd for C34H38N18O4: 763.34; found 763.3.


Following the General Procedure 5, but using the appropriate amine-containing active site inhibitor and Intermediate H1, the additional Intermediates H2 in Table 36 were prepared:









TABLE 36





Additional active site inhibitor containing Intermediates H2 prepared.



















Calcu-



Molecular
lated


Structure
Formula
MW







embedded image


C34H38N18O4
[M + H] = 763.34







embedded image


C36H42N18O5
[M + H] = 807.37







embedded image


C38H46N18O6
[M + H] = 851.39







embedded image


C35H40N18O5
[M + H] = 793.35












Observed


Structure
MW







embedded image


[M + H] = 763.3







embedded image


[M + H] = 807.3







embedded image


[M + H] = 851.4







embedded image


[M + H] = 793.3









Following General Procedure 3, but using the appropriate alkyne modified rapamycin and Intermediates H2, the Series 8 bivalent analogs in Table 37 were synthesized:









TABLE 37







Series 8 Bivalent Analogs












Calcu-
Ob-



Molecular
lated
served


Structure
Formula
MW
MW







embedded image


C88H122N20O17
[M + H] = 1731.94
[M + H] = 1731.9







embedded image


C90H126N20O18
[M + H] = 1775.96
[M + H] = 1776.1







embedded image


C92H130N20O19
[M + H] = 1819.99
[M + H] = 1820.0







embedded image


C89H124N20O18
[M + H] = 1761.95
[M + H] = 1761.9









General Procedure 16: Coupling of an Alkyne Containing Carboxylic Acid and an Amine Containing Active Site Inhibitor



embedded image


To a 0.1M solution of amine containing active site inhibitor (1.8 equiv) in DMA was added carboxylic acid (1.0 equiv), DIPEA (3.0 equiv), and finally PyBOP (1.3 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The reaction mixture was then purified by reverse phase prep-HPLC to afford the product.


Intermediate I1-1: Synthesis of N-{4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl] butyl}-4,7,10,13,16,19,22,25,28,31-decaoxatetratriacont-33-ynamide

To a solution of {4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}amino 2,2,2-trifluoroacetate (770 mg, 1.71 mmol, 1.8 equiv) in DMA (9.52 mL) was added 4,7,10,13,16,19,22,25,28,31-decaoxatetratriacont-33-ynoic acid (500 mg, 953 μmol, 1.0 equiv), DIPEA (495 μL, 2.85 mmol, 3.0 equiv), and finally PyBOP (640 mg, 1.23 mmol, 1.3 equiv). After stirring overnight the the crude reaction mixture was purified by reverse phase chromatography (10→100% MeCN/H2O) to provide the product (105.1 mg, 13% yield). LCMS (ESI) m/z: [M+H] calcd for C40H60N8O12: 845.44; found 845.3.


Following the General Procedure 16, but using the appropriate amine-containing active site inhibitor and carboxylic acid containing PEG, the additional Intermediates I1 in Table 38 were prepared:









TABLE 38





Additional alkynes prepared

















Molecular


Structure
Formula







embedded image


C40H60N8O12







embedded image


C41H61N7O12






Calculated


Structure
MW







embedded image


[M + H] = 845.44







embedded image


[M + H] = 844.45






Observed


Structure
MW







embedded image


[M + H] = 845.3







embedded image


[M + H] = 844.3









Example 195: Synthesis of Series 9 Bivalent Rapamycin Analog



embedded image


To a solution 40(S)-azido rapamycin (105 mg, 124 μmol, 3.0 equiv) in DMSO (4.12 mL) was added tetrakis(acetonitrile)copper(I) hexafluorophosphate (30.7 mg, 82.6 μmol, 2.0 equiv) followed by TBTA (87.5 mg, 165 μmol, 4.0 equiv). After stirring for 4 h the crude reaction mixture was purified by reverse phase chromatography (40→100% MeCN/H2O) to provide the product (11.0 mg, 14.9% yield). LCMS (ESI) m/z: [M+H] calcd for C91H138N12O24: 1784.00; found 1784.7.


Following General Procedure 9, but using the appropriate azide modified rapamycin and Intermediates I1, the Series 9 bivalent analogs in Table 39 were synthesized:









TABLE 39





Series 9 Bivalent Analogs



















Calcu-



Molecular
lated


Structure
Formula
MW







embedded image


C91H138N12O24
[M + H] = 1784.00







embedded image


C92H139N11O24
[M + H] = 1783.01












Observed


Structure
MW







embedded image


[M + H] = 1784.7







embedded image


[M + H] = 1783.2









Intermediate J1-1: N-{4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}-1-hydroxy-3,6,9,12-tetraoxapentadecan-15-amide



embedded image


To a solution of 1-hydroxy-3,6,9,12-tetraoxapentadecan-15-oic acid (97 mg, 364 μmol, 1.65 equiv) and 5-[4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl]-1,3-benzoxazol-2-amonium trifluoroacetate (100 mg, 221 μmol, 1.0 equiv) in DMA (2.20 mL) was added DIPEA (153 μL, 884 μmol, 4.0 equiv) followed by PyBOP (149 mg, 287 μmol, 1.3 equiv). The reaction was stirred at room temperature for 3 h then purified by silica gel chromatography (0→30% MeOH/DCM) to afford the product (77.4 mg, 60% yield). LCMS (ESI) m/z: [M+H] calcd for C27H38N8O7: 587.30; found 587.2.









TABLE 40







Additional alcohols prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C27H38N8O7
[M + H] = 587.30
[M + H] = 587.2









Intermediate J2-1: 14-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)-3,6,9,12-tetraoxatetradecan-1-yl 4,7,10,13-tetraoxahexadec-15-ynoate



embedded image


To a solution of 4,7,10,13-tetraoxahexadec-15-ynoic acid (37.4 mg, 144 μmol, 1.1 equiv) in DMA (1 mL) was added EDC (50.7 mg, 262 μmol, 2.0 equiv) followed by 4-dimethylaminopyridine (32.0 mg, 262 μmol, 2.0 equiv). The resulting suspension was stirred for 5 minutes, then N-{4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}-1-hydroxy-3,6,9,12-tetraoxapentadecan-15-amide (77.4 mg, 131 μmol, 1.0 equiv) in DMA (1.6 mL) was added. The reaction mixture was stirred at room temperature for 24 h then purified by silica chromatography (0→20% MeOH/DCM) to afford the product. LCMS (ESI) m/z: [M+H] calcd for C39H56N8O12: 829.41; found 829.3.









TABLE 41







Additional alkynes prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C39H56N8O12
[M + H] = 829.41
[M + H] = 829.3









Following General Procedure 3, but using the appropriate azide modified rapamycin and Intermediates J2, the Series 10 bivalent analogs in Table 42 were synthesized:









TABLE 42





Series 10 Bivalent Analogs



















Calcu-



Molecular
lated


Structure
Formula
MW







embedded image


C90H134N12O24
[M + H] = 1767.97












Observed


Structure
MW







embedded image


[M + H] = 1767.7









Following General Procedure 7, but using the appropriate NHS ester-PEG-azide and amine containing PEG-tert-butyl ester, the Intermediates K1 in Table 43 were synthesized:









TABLE 43







Additional carboxylic acids prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C18H34N4O9
[M + H] = 451.24
[M + H] = 451.4









Following General Procedure 1, but using the appropriate Intermediate K1 and amine containing active site inhibitor, the Intermediates K2 in Table 44 were synthesized:









TABLE 44





Additional azides prepared

















Molecular


Structure
Formula







embedded image


C34H50N12O9







embedded image


C35H51N11O9






Calculated


Structure
MW







embedded image


[M + H] = 771.39







embedded image


[M + H] = 770.40









Observed


Structure
MW







embedded image


[M + H] = 771.3







embedded image


[M + H] = 770.4









Following General Procedure 3, but using the appropriate alkyne modified rapamycin and Intermediates K2, the Series 11 bivalent analogs in Table 45 were synthesized:









TABLE 45





Series 11 Bivalent Analogs


















Molecular
Calculated


Structure
Formula
MW







embedded image


C91H137N13O22
[M + H] = 1765.01







embedded image


C92H138N12O22
[M + H] = 1764.01












Observed


Structure
MW







embedded image


[M + H] = 1964.9







embedded image


[M + H] = 1763.8









General Procedure 17: Coupling of an Ester Containing Carboxylic Acid and an Amine Containing Active Site Inhibitor



embedded image


Step 1

To a 0.10 M solution of carboxylic acid PEG (1.0 equiv) in DMF was added an amine containing active site inhibitor (1.8 equiv) followed by DIPEA (3.0 equiv) and PyBOP (1.3 equiv). The reaction was allowed to stir until consumption of carboxylic acid, as indicated by LCMS. The mixture was then purified by silica gel chromatography to afford the product.


Step 2

A 0.08M solution of ester (1 equiv) in DCM was added TFA (80 equiv). The solution was allowed to stir until consumption of the ester, as indicated by LCMS. The reaction mixture was concentrated under reduced pressure and then lyophilized from MeCN to give the product.


Intermediate L1-1: Synthesis of 3-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)ethoxy]propanoic Acid



embedded image


Step 1: Synthesis of tert-butyl 3-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)ethoxy]propanoate

To a solution of 3-[3-(tert-butoxy)-3-oxopropoxy]propanoic acid (250 mg, 1.14 mmol, 1.0 equiv) in DMF (11.3 mL) was added 5-(4-amino-1-(4-aminobutyl)-1H-pyrazolo[3,4-d]pyrimidin-3-yl)benzo[d]-oxazol-2-amine trifluoroacetic acid salt (927 mg, 2.05 mmol, 1.8 equiv), DIPEA (595 μL, 3.42 mmol, 3.0 equiv), and PyBOP (769 mg, 1.48 mmol, 1.3 equiv). The resulting solution was stirred at room temperature for 3 h. The crude product was purified by silica gel chromatography (0→20% MeOH/DCM) to afford the product as a pink oil. The product was repurified by silica gel chromatography (0→15% MeOH/DCM) to afford the product (245 mg, 40% yield) as a pink solid. LC-MS (ESI) m/z: [M+H] calcd for C26H34N8O5: 539.28; found 539.2.


Step 2: Synthesis of 3-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)ethoxy]propanoic Acid

To a solution of tert-butyl 3-[2-({4-[4-amino-3-(2-amino-1,3-benzoxazol-5-yl)-1H-pyrazolo[3,4-d]pyrimidin-1-yl]butyl}carbamoyl)ethoxy]propanoate (133 mg, 0.2469 mmol, 1.0 equiv) in DCM (3 mL) was added TFA (1.5 mL). The resulting homogenous solution was stirred at room temperature for 3 h. The reaction mixture was concentrated under reduced pressure. The product was dissolved in MeCN and lyophilized to give the product (222 mg, 150%) as a light pink tacky solid. LC-MS (ESI) m/z: [M+H] calcd for C22H26N8O5: 483.21; found 483.1.


Following General Procedure 17, but using the appropriate carboxylic acid-PEG-ester and amine containing active site inhibitor, the Intermediates L1 in Table 46 were synthesized:









TABLE 46







Additional carboxylic acids prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C22H26N8O5
[M + H] = 483.21
[M + H] = 483.1







embedded image


C26H34N8O7
[M + H] = 571.27
[M + H] = 571.2









Following General Procedure 1, but using the appropriate Intermediate L1 and amine containing pre-linker, the Intermediates L2 in Table 47 were synthesized:









TABLE 47







Additional azides prepared











Molecular
Calculated
Observed


Structure
Formula
MW
MW







embedded image


C30H35N15O4
[M + H] = 670.31
[M + H] = 670.2







embedded image


C34H43N15O6
[M + H] = 758.36
[M + H] = 758.2









Following General Procedure 3, but using the appropriate alkyne modified rapamycin and Intermediates L2, the Series 12 bivalent analogs in Table 48 were synthesized:









TABLE 48





Series 12 Bivalent Analogs

















Molecular


Structure
Formula







embedded image


C84H119N17O17







embedded image


C88H127N17O19






Calculated


Structure
MW







embedded image


[M + H] = 1638.90







embedded image


[M + H] = 1726.96






Observed


Structure
MW







embedded image


[M + H] = 1638.7







embedded image


[M + H] = 1726.8









Biological Examples

Cell Based AlphaLISA Assays for Determining IC50 for Inhibition of P-Akt (S473), P-4E-BP1 (T37/46), and P-P70S6K (T389) in MDA-MB-468 Cells


mTOR Kinase Cellular Assay


To measure functional activity of mTORC1 and mTORC2 in cells the phosphorylation of 4EBP1 (Thr37/46) and P70S6K (Thr389), and AKT1/2/3 (Ser473) was monitored using AlphaLisa SureFire Ultra Kits (Perkin Elmer). MDA-MB-468 cells (ATCC® HTB-132) were cultured in 96-well tissue culture plates and treated with compounds in the disclosure at concentrations varying from 0.017-1,000 nM for two to four hours at 37° C. Incubations were terminated by removal of the assay buffer and addition of lysis buffer provided with the assay kit. Samples were processed according to the manufacturer's instructions. The Alpha signal from the respective phosphoproteins was measured in duplicate using a microplate reader (Envision, Perkin-Elmer or Spectramax M5, Molecular Devices). Inhibitor concentration response curves were analyzed using normalized IC50 regression curve fitting with control based normalization.


As an example, measured IC50 values for selected compounds are reported below:
















IC50 for Inhibition of mTORC1 and mTORC2




Substrate Phosphorylation (nM)













p-P70S6K-
p-4E-BP1-
p-AKT1/2/3-



Compound
(T389)
(T37/46)
(S473)















MLN-128
1.4
16
3.7



Rapamycin
0.2
>1,000
>1,000



Example 1
0.3
1.0
3.9









As an example, measured pIC50 values for selected compounds are reported below:
















pIC50 for Inhibition of mTORC1 and




mTORC2 Substrate Phosphorylation













P-P70S6K-
P-4E-BP1-
p-AKT 1/2/3 -



Example
(T389)
(T37/46)
(S473)






 1
+++
+++
+++



 2
+++
++
+



 3
+++
+++
++



 4
+++
−
−



 5
+++
+
−



 6
+++
−
−



 7
+++
+++
+++



 8
+++
+++
++



 9
+++
−
−



 10
+++
−
−



 11
+++
+++
+++



 12
−
−
−



 13
++
++
+



 14
++
++
+



 15
++
++
+



 16
−
−
−



 17
++
++
+



 18
+++
+++
+++



 19
+++
+
+



 19
+++
+++
++



 20
+++
+++
++



 21
+++
+++
++



 22
+++
+++
++



 23
+++
+++
+++



 24
+++
+++
++



 25
+++
+++
++



 26
+++
+++
++



 27
+++
+++
++



 28
+++
+++
++



 29
+++
+++
++



 30
+++
+++
++



 31
+++
+++
++



 32
++
++
++



 33
++
++
++



 34
++
++
+



 35
+++
+++
++



 36
+++
++
++



 37
+++
+++
++



 38
++
++
+



 39
++
+
+



 40
+++
+++
+



 41
+++
++
−



 42
+++
+++
++



 43
+++
+
+



 44
+++
+++
+++



 45
+++
+++
+++



 46
+++
+++
++



 47
+++
+++
++



 48
+++
+++
++



 49
+++
+++
+



 50
++
++
+



 51
++
++
+



 52
+++
++
++



 53
+++
+++
++



 54
++
−
−



 55
+++
++
+



 56
+++
+++
+++



 57
+++
+++
++



 58
+++
+++
+++



 59
+++
+++
++



 60
+++
+++
++



 61
++
++
++



 62
−
−
−



 63
+
+
+



 64
+++
++
+



 65
++
++
+



 66
+++
+++
+++



 67
+++
+++
+++



 68
+++
++
+



 69
+++
+++
++



 70
++
−
−



 71
++
++
−



 72
+++
+++
+++



 73
+++
+++
+++



 74
++
−
−



 75
++
+
+



 76
+++
+++
++



 77
+++
+++
++



 78
+++
++
++



 79
+++
++
+



 80
+++
++
+



 81
++
++
+



 82
+++
++
+



 83
+++
+++
+++



 84
+++
+++
++



 85
+++
+++
++



 86
+++
+++
++



 87
+++
++
−



 88
+++
+++
++



 89
+++
+++
++



 90
+++
+++
+++



 91
+++
+++
+++



 92
+++
++
+



 93
++
++
−



 94
++
++
−



 95
+++
+++
++



 96
+++
+++
++



 97
++
++
++



 99
+++
++
++



100
+++
+
++



101
+++
+++
++



102
+++
++
++



103
+++
+++
++



104
++
+
+



105
++
++
+



106
+++
+++
++



107
+++
+++
+++



108
+++
+++
++



109
+++
−
−



110
+++
+
−



111
+++
+
+



112
+++
−
−



113
+++
+++
++



114
+++
−
−



115
+++
+++
+++



116
+++
++
−



117
+++
−
−



118
+++
+++
++



119
+++
−
−



120
++
++
+



121
++
+
−



122
++
++
++



123
++
++
+



124
++
++
++



125
++
++
++



126
++
++
+



127
++
++
+



128
++
++
+



129
++
+
−



130
++
++
++



131
++
+
+



132
++
++
+



133
++
++
+



134
++
++
++



135
++
++
+



136
++
++
+



137
++
++
+



138
++
−
+



139
++
++
++



140
++
++
+



141
++
++
++



142
++
++
+



143
++
+
−



144
+
−
−



145
++
+
−



146
++
−
−



147
+
+
−



148
+
−
−



149
++
+
+



150
+
+
−



151
+
+
−



152
+
−
−



153
++
+
−



154
−
−
−



155
−
−
−



156
−
−
−



157
−
−
−



158
−
−
−



159
+++
−
−



160
+
−
+



161
−
−
−



162
++
+
−



163
+
−
−



164
+++
++
+



165
++
+
−



166
−
−
−



167
++
+
+



168
+
+
−



169
+
−
−



170
+
−
−



171
+
+
−



172
+
−
−



173
+
−
−



174
+
−
−



175
−
−
−



176
+
−
−



177
+
−
−



178
+
−
−



179
++
+
−



180
++
−
−



181
+++
+++
++



182
+++
−
−



183
+++
+++
++



184
+++
+++
++



185
+++
+++
++



186
+++
++
+



187
+++
+++
++



188
+++
+++
+



189
+++
+++
++



190
+++
++
+



191
+++
+++
−



192
+++
++
−



193
+++
++
−



194
+++
−
−



195
++
++
++



196
++
++
+



197
++
++
+



198
+++
+++
++



199
+++
+++
+



200
++
−
+



201
+++
++
+










Note:


pIC50 (p-P70S6K-(T389))








≥9
+++


9 > pIC50 ≥ 8
++


8 > pIC50 ≥ 6
+


<6
−







pIC50 (p-4E-BPl-(T37/46) or p-AKTl/2/3-(S473))








≥8.5
+++


8.5 > pIC50 ≥ 7.5
++


7.5 > pIC50 ≥ 6.0
+


<6
−






EQUIVALENTS

While the present disclosure has been described in conjunction with the specific embodiments set forth above, many alternatives, modifications and other variations thereof will be apparent to those of ordinary skill in the art. All such alternatives, modifications and variations are intended to fall within the spirit and scope of the present disclosure.

Claims
  • 1. A compound represented by Formula I-X:
  • 2-3. (canceled)
  • 4. The compound of claim 1, represented by Formula (Ia-X):
  • 5. The compound of claim 1, represented by Formula (Ib-X):
  • 6. The compound of claim 1, represented by Formula (Ic-X):
  • 7. The compound of claim 1, represented by Formula (Id-X):
  • 8. The compound of claim 1, represented by Formula (Ie-X):
  • 9. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein the compound comprises R1.
  • 10. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein the compound comprises R2.
  • 11-14. (canceled)
  • 15. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein A is —O(C(R3)2)n—.
  • 16. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein A is —O(C(R3)2)n—[O(C(R3)2)n]o—O(C(R3)2)p—.
  • 17. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein A is —O(C(R3)2)n—(C6-C10)arylene-heteroarylene-heterocyclylene-(C(R3)2)n—.
  • 18-21. (canceled)
  • 22. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein L1 is
  • 23. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein L1 is
  • 24. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein L1 is
  • 25-35. (canceled)
  • 36. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein B is
  • 37. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein B is
  • 38. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein B1 is NR3—(C(R3)2)n—.
  • 39. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein B1 is
  • 40. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein R4 is 5-12 membered heteroaryl, optionally substituted with —N(R3)2, —OR3, halogen, (C1-C6)alkyl, —(C1-C6)alkylene-heteroaryl, —(C1-C6)alkylene-CN, or —C(O)NR3-heteroaryl.
  • 41. The compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, wherein R4 is heteroaryl optionally substituted with —NH2 or —OR3.
  • 42. A compound selected from the group consisting of:
  • 43. A pharmaceutical composition comprising a compound of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof, and at least one of a pharmaceutically acceptable carrier, diluent, or excipient.
  • 44. A method of treating, preventing, or reducing the risk of a disease or disorder mediated by mTOR comprising administering to the subject suffering from or susceptible to developing a disease or disorder mediated by mTOR a therapeutically effective amount of one or more compounds of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof.
  • 45-49. (canceled)
  • 50. A method of treating cancer comprising administering to the subject a therapeutically effective amount of one or more compounds of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof.
  • 51. The method of claim 50, wherein the cancer is selected from the group consisting of brain tumors, neurovascular tumors, head and neck cancers, breast cancer, lung cancer, mesothelioma, lymphoid cancer, stomach cancer, kidney cancer, renal carcinoma, liver cancer, ovarian cancer, ovary endometriosis, testicular cancer, gastrointestinal cancer, prostate cancer, glioblastoma, skin cancer, melanoma, neurological cancers, spleen cancers, pancreatic cancers, blood proliferative disorders, lymphoma, leukemia, endometrial cancer, cervical cancer, vulva cancer, prostate cancer, penile cancer, bone cancers, muscle cancers, soft tissue cancers, intestinal or rectal cancer, anal cancer, bladder cancer, bile duct cancer, ocular cancer, gastrointestinal stromal tumors, and neuro-endocrine tumors.
  • 52. A method of treating an immune-mediated disease comprising administering to the subject a therapeutically effective amount of one or more compounds of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof.
  • 53. The method of claim 52, wherein the immune-mediated disease is selected from resistance by transplantation of heart, kidney, liver, medulla ossium, skin, cornea, lung, pancreas, intestinum tenue, limb, muscle, nerves, duodenum, small-bowel, or pancreatic-islet-cell; graft-versus-host diseases brought about by medulla ossium transplantation; rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroiditis, multiple sclerosis, myasthenia gravis, type I diabetes, uveitis, allergic encephalomyelitis, and glomerulonephritis.
  • 54. A method of treating an age related condition comprising administering to the subject a therapeutically effective amount of one or more compounds of claim 1, or a pharmaceutically acceptable salt, oxepane isomer, stereoisomer, or tautomer thereof.
  • 55. The method of claim 54, wherein the age related condition is selected from the group consisting of sarcopenia, skin atrophy, muscle wasting, brain atrophy, atherosclerosis, arteriosclerosis, pulmonary emphysema, osteoporosis, osteoarthritis, high blood pressure, erectile dysfunction, dementia, Huntington's disease, Alzheimer's disease, cataracts, age-related macular degeneration, prostate cancer, stroke, diminished life expectancy, impaired kidney function, and age-related hearing loss, aging-related mobility disability, cognitive decline, age-related dementia, memory impairment, tendon stiffness, heart dysfunction, immunosenescence, cancer, obesity, and diabetes.
  • 56-63. (canceled)
  • 64. The method of claim 55, wherein the aging-related mobility disability is frailty.
  • 65. The method of claim 55, wherein the heart dysfunction is cardiac hypertrophy, systolic dysfunction, and diastolic dysfunction.
CROSS REFERENCE TO RELATED APPLICATIONS

This application claims the benefit of U.S. Provisional Application No. 62/500,410, filed May 2, 2017, the contents of which are incorporated herein by reference in its entirety.

Provisional Applications (1)
Number Date Country
62500410 May 2017 US
Continuations (2)
Number Date Country
Parent 16669319 Oct 2019 US
Child 17693225 US
Parent PCT/US2018/030531 May 2018 US
Child 16669319 US