Patent Application
20210393794
The present invention relates to a compound as well as methods for the preparation and applications thereof, and in particular relates to a class of cysteine-modified antibody-toxin conjugates (TDCs) and to methods for the preparation and applications thereof.
Antibody drug conjugates (ADCs) represent a currently hot area in the field of targeted therapy, with two drugs already approved in the U.S., Adcetris and Kadcyla, showing good clinical efficacy, and more than 50 ADCs are currently being investigated as part of clinical phase studies. The novel cysteine-modified antibody-toxin conjugate (TDC) disclosed in this patent has the advantage of better drug homogeneity and fewer side effects compared to non-fixed-point coupled ADCs, and have been shown to perform significantly better than non-fixed-point coupled ADCs in preclinical studies.
For the cysteine-modified antibody-toxin conjugate (TDC) constituted by the present invention, corresponding cysteine insertion sites comprise one or more sites selected from the following 15 insertion sites: Light Chain Position 110 (Kabat number, with amino acid sequence EIKRTCVAAPS (SEQ ID NO:45)), Light Chain Position 111 (Kabat number, with amino acid sequence IKRTVCAAPSV (SEQ ID NO:46)), Light Chain Position 142 (Kabat number, with amino acid sequence NNFYPCREAKV (SEQ ID NO:47)), Heavy Chain Position 254 (with amino acid sequence ISRTPCEVTCV (SEQ ID NO:48)), Heavy Chain Position 255 (with amino acid sequence SRTPECVTCVV (SEQ ID NO:49)), Heavy Chain Position 258 (with amino acid sequence PEVTCCVVVDV (SEQ ID NO:50)), Heavy Chain Position 259 (with amino acid sequence EVTCVCVVDVS (SEQ ID NO:51)), Heavy Chain Position 354 (with amino acid sequence PSRDECLTKNQ (SEQ ID NO:52)), Heavy Chain Position 355 (with amino acid sequence SRDELCTKNQV (SEQ ID NO:53)), Heavy Chain Position 357 (with amino acid sequence DELTKCNQVSL (SEQ ID NO:54)), Heavy Chain Position 378 (with amino acid sequence IAVEWCESNGQ (SEQ ID NO:55)), Heavy Chain Position 379 (with amino acid sequence AVEWECSNGQP (SEQ ID NO:56)), Heavy Chain Position 386 (with amino acid sequence GQPENCNYKTT (SEQ ID NO:57)), Heavy Chain Position 387 (with amino acid sequence QPENNCYKTTP (SEQ ID NO:58)), and heavy chain position 410 (with amino acid sequence KLTVDCKSRWQ (SEQ ID NO:59)). Antibodies that contain one or more of the cysteine insertion mutations described above maintain the ability of their parental antibody to bind to corresponding antigens (affinity). By performing antibody-toxin conjugate (TDCs) fixed-point coupling between a cysteine sulfhydryl group subject to light-chain insertion and/or a cysteine sulfhydryl group subject to heavy-chain insertion, a toxin to antibody ratio (DAR) of 1.6 to 2.0 or 3.2 to 4.0 can be realized.
3.9 g (0.03 mol) of 6-aminocaproic acid and 3.5 g (0.036 mol) of 1.2 eq maleic anhydride were added to 30 ml of glacial acetic acid. The reaction solution was stirred at 120° C. for 4 to 6 hours. After the reaction was complete, heating was stopped and the solution was allowed to cool to room temperature naturally. The solution was then concentrated under reduced pressure at 60° C. to remove most of the acetic acid. The brownish yellow viscous liquid thus obtained was poured into water, ethyl acetate extraction was performed at 20 ml×3 and the organic layers were combined. The organic layer was washed with water and saturated salt water in succession, dried with anhydrous sodium sulfate and filtered, and the filtrate was concentrated under reduced pressure to obtain a brownish yellow oily substance, after which 50 ml of water was added and stirring was performed, resulting in the precipitation of an off-white solid, which was filtered and dried at 50° C. under reduced pressure to obtain 5.08 g of target product, with a yield of 80%. mp: 89 to 92° C. m/z: 212.2 [M+H]+. 1HNMR (400Mz, DMSO): 13.21 (br, 1H, COOH), 6.75 (s, 2H, COCH═CHCO), 3.63 (t, 2H, J=7.2 Hz, NCH2CH2), 2.42(t, 2H, J=7.4 Hz, CH2COOH), 1.52-1.68 (m, 4H, NCH2CH2CH2CH2), 1.30-1.42 (m, 2H, NCH2CH2CH2CH2).
4.7 g (22 mmol) MC and 25 g (22 mmol) HOSu were added to 50 ml of acetonitrile under nitrogen gas. 4.5 g (22 mmol) of DCC was separately dissolved in 25 ml of acetonitrile while keeping the internal temperature at approximately 0° C., and the solution was slowly added dropwise to the above reaction solution. The reaction solution was allowed to react at 0° C. for two hours and then brought to room temperature before the reaction was allowed to continue overnight. Following filtration, the resulting filter cake was washed with acetonitrile at 10 ml×3, and the filtrate was concentrated under reduced pressure until dry. The oil thus obtained was dried under reduced pressure at room temperature for six hours to obtain 6.4 g of a light brown solid, with a yield of 95%. (It was then fed directly to the next reaction without further purification) m/z: 309.2 [M+H]+. 1HNMR (400Mz, CDCl3): 1-2 (m, 6H, CCH2CH2CH2C), 2.68 (t, 2H, CH2CO), 2.95 (s, 4H, COCH2CH2CO), 3.68 (t, 2H, CH2N), 6.81 (s, 2H), CH═CH).
10 g of Fmoc-Val and 3.4 g of HOSu were added to 100 ml THF. 6 g of DCC was separately dissolved in 50 ml of acetonitrile while keeping the internal temperature at approximately 0° C., and the solution was slowly added dropwise to the above reaction solution. The reaction solution was stirred at room temperature for 24 hours. After filtration, the filter cake was washed with THF, and the filtrate was concentrated under reduced pressure to obtain a transparent oil. The oily substance was fed directly into the next reaction without further purification. m/z: 437.4 [M+H]+.
4.0 g (1.05 eq) of Cit and 60 ml of aqueous sodium bicarbonate solution (NaHCO3, 2 g, 1.05 eq) were added to 20 ml of THF. 22.35 mmol of Fmoc-Val-OSu was separately dissolved in 60 ml DME, and the resulting solution was added to the reaction solution. The reaction solution was stirred at room temperature for 24 hours. After the reaction was completed, 110 ml of 15% citric acid aqueous solution was added to the system, and extraction was performed twice with EA and the organic layers were combined and concentrated under reduced pressure to obtain a white solid. 100 ml of methyl tert-butyl ether was added to the white solid and stirring was performed, followed by filtration; the filter cake was subject to drying under reduced pressure at 40° C. for 4 h to obtain 4.83 g of product, with a yield of 65%. m/z: 497.6 (M+H)+. 1HNMR (400Mz, DMSO): 0.92 (6H, m), 1.35-1.65 (4H, m), 2.10 (1H, m), 3.01 (2H, q), 3.99 (1H, t), 4.01-4.45 (2H, m), 4.45 (2H, t), 5.46 (2H, br), 6.03 (1H, t), 7.20-8.02 (8H, m), 8.25 (1H, d).
60 ml of DCM/MeOH=2/1 mixed solvent was added to a reaction flask, followed by addition of 2 g (4.2 mmol) Fmoc-vc and 1.04 g (2 eq) PABOH, after which the mixture was stirred to partial dissolution and 2.0 g (2 eq) EEDQ was added. The reaction system was allowed to continue reacting under stirring for 2.0 days in the dark at room temperature. After the reaction was completed, the reaction solution was concentrated under reduced pressure at 40° C. to obtain a white solid. The white solid was collected, 100 ml of methyl tert-butyl ether was added and stirring was performed, followed by filtration; the filter cake was washed with methyl tert-butyl ether, and the resulting white solid was dried under reduced pressure at 40° C., to obtain 2.2 g of product, with a yield of approximately 88%. m/z: 602.6 (M+H)+. 1HNMR (400Mz, DMSO): 0.95 (6H, m), 1.45-1.69 (4H, m), 2.10 (1H, m), 3.11 (2H, m), 3.99 (1H, m), 4.30 (2H, d), 4.05-4.66 (2H, m), 4.55 (2H, d), 5.21 (1H, t), 5.51 (2H, br), 6.11 (1H, t), 7.09-8.10 (12H, m), 8.21 (1H, d), 10.51 (1H, br).
490 mg (0.815 mmol) of Fmoc-vc-PABOH was added to 10 ml of NMP and the mixture was stirred to dissolution, after which 2 ml of diethylamine was added. The reaction was then allowed to proceed under stirring at room temperature for 24 hours. After the reaction was complete, the solution was concentrated under reduced pressure at 40° C., 20 ml of DCM was added to the oily substance thus obtained and stirring was performed to obtain crystals which were filtered; the filter cake was then washed with DCM, and the solid thus obtained was dried under reduced pressure to obtain 277 mg of product, with a yield of 90%. m/z: 380.2 (M+H)+. 1HNMR (400Mz, DMSO): 0.89 (6H, m), 1.31-1.61 (4H, m), 1.82 (1H, m), 2.86 (1H, m), 2.89 (2H, d), 4.38 (2H, d), 4.44 (1H, m), 5.01 (1H, br), 5.35 (2H, br), 5.84 (1H, br), 7.14 (2H, d), 7.42 (2H, d), 8.08 (1H, br), 9.88 (1H, br).
205 mg (0.54 mmol) of vc-PABOH and 184 mg (1.1 eq) of MC-OSu were added to 10 ml of NMP, and once addition was complete the reaction was allowed to proceed under stirring at room temperature for 24 hours. After the reaction was completed, the reaction solution was concentrated under reduced pressure at 40° C., 20 ml of methyl tert-butyl ether was added to the oily substance thus obtained and stirring was performed to obtain crystals. The crystals were then filtered and the filter cake was washed with methyl tert-butyl ether to obtain 310 mg of product, with a yield of 100%. m/z: 573.3 (M+H)+. 1HNMR (400Mz, DMSO): 0.89 (6H, m), 1.15-1.99 (10H, m), 2.11 (1H, m), 2.31 (2H, t), 3.21 (2H, m), 3.53 (2H, t), 4.32 (1H,t), 4.51 (1H, m), 4.59 (2H, br), 5.24 (1H, br), 5.56 (2H, br), 6.20 (1H, br), 7.12 (2H, s), 7.23 (2H, d), 7.58 (2H, d), 7.94 (1H, d), 8.17 (1H, d), 10.21 (1H, br).
168.6 mg (0.294 mmol) of mc-vc-PABOH was dissolved in 5 ml of anhydrous pyridine under nitrogen gas, and the reaction system was cooled to approximately 0° C. 179 mg (3 eq) of PNP was separately dissolved in 5 ml of DCM, and the resulting solution was slowly added into the reaction system. After maintaining the temperature at 0° C. for 10 min, the ice bath was removed, and the reaction solution was stirred at room temperature for three hours. After the reaction was completed, 70 ml of EA and 100 ml of 15% citric acid aqueous solution were added, and the organic layer was separated off. The organic layer was washed with citric acid, water, and saturated brine in succession then dried over anhydrous sodium sulfate and filtered, and the filtrate was concentrated under reduced pressure until dry to obtain a light-yellow oil, after which methyl tert-butyl ether was added to induce crystallization and 86 mg of an off-white solid, with a yield of 40%. m/z: 738 (M+H)+. 1HNMR (400Mz, CDCl3/CD3OD): 0.84 (6H, m), 1.11-1.84 (10H, m), 2.05 (1H, m), 2.15 (2H, t), 3.09 (2H, m), 3.32 (2H, t), 4.12(1H,m), 4.38 (1H, m), 5.15 (2H, s), 6.61 (2H, s), 6.84 (1H, d), 7.61 (1H, d), 7.21 (2H, d), 7.50 (2H, d), 7.61 (2H, d), 8.18 (2H, d), 9.59 (1H, br).
20 mg of mc-vc-PAB-PNP (1.5 eq) and 3 mg of HOBT were added to 2 ml of DMF. After briefly stirring the mixture at room temperature, 13 mg MMAE, 0.5 ml pyridine, and 25 ul DIEA were added. The reaction solution was stirred at room temperature for 2 days. After the reaction was complete, the reaction solution was directly purified using a preparative column, and the required components were collected, concentrated and lyophilized to obtain approximately 10 mg of product, with a yield of approximately 42%. m/z: 1317.1 (M+H)+.
Using the same procedure as Example 9, approximately 12.5 mg of mc-vc-PAB-MMAF was obtained, with a yield of 45.2%; m/z: 1345.7 (M+H)+
Using the same procedure as Example 9, approximately 9.5 mg of mc-vc-PAB-PBD was obtained, with a yield of 32.5%; m/z: 1325.4 (M+H)+
Using the same procedure as Example 9, approximately 11.2 mg of mc-vc-PAB-DOX was obtained, with a yield of 38.9%; m/z: 1143.2 (M+H)+
After dissolving 100 mg of commercially procured 10-0-Boc-SN-38 in 10 ml of dry dichloromethane, 25.6 mg (1 eq) DMAP was added, and a dichloromethane solution of triphosgene (62 mg triphosgene dissolved in 2 ml dichloromethane) was added dropwise at 0° C., after which the reaction was allowed to proceed at 0° C. for 12 h; the dichloromethane was then removed under reduced pressure and the resulting substance was dissolved with 10 ml dry DMF, after which 144 mg of mc-vc-PABOH was added and the resulting mixture was stirred for 24 hours at room temperature and liquid phase isolation was carried out to obtain 41 mg of mc-vc-PAB-SN-38, with a total two-step yield of 19.7%, m/z: 1063.2 (M+H)+
Freestyle™ 293-F (Invitrogen) suspension cells were used to express the 2A1-HC-Cys254ins antibody. One day prior to transfection, cells were seeded at a density of 6×105 cells/mL in a 1 L shaker flask containing 300 mL of F17 complete medium (Freestyle™ F17 expression medium, Gibco) and incubated overnight at 37° C. and 5% CO2 on a 120 rpm cell culture shaker. The following day, transfection of the antibody expression plasmid was carried out using PEI, where the ratio of plasmid to PEI was 2:1. One day after transfection, TN1 feed medium was added at 2.5% (v/v), the culture was run for a further four days and the supernatant was collected by centrifugation.
The resulting cell expression supernatant was collected and eluted with 0.1 M citric acid (pH 3.0) through a Protein A affinity chromatography column (Mabselect Sure LX, GE), and the captured antibodies were adjusted to pH 7.0 with 1 M Tris-HCl (pH 9.0) at 1/10 (v/v) and then passed through an SEC gel filtration chromatography column (Superdex 200, GE) to remove impurities such as polysomes and endotoxins, while the antibody buffer was replaced with PBS (pH 7.4) and UV280 nm target peak samples were collected and concentrated to 2 mg/ml using ultra-filtration centrifuge tubes (30KD, Pall).
2A1-HC-Cys254ins antibodies thus obtained showed a concentration of 2 mg/ml with a target antibody monomer ratio (POI%) greater than 90%, and were used in subsequent experiments.
Cell-expressed 2A1-HC-Cys357ins antibodies (SEQ ID N0:34) were purified using Mabselect Sure and after elution at low pH, a Tris solution was immediately added to achieve neutralization, and the solution was exchanged to a Tris-HCl buffer of pH 7.5. The compound mc-vc-PAB-MMAE was a white powder and was dissolved in DMA for later use. The antibody needed to be first reduced to remove the barrier present on the mutant cysteine residue. 1M DTT aqueous solution was added at a 40× molecular ratio to the 2A1-HC-Cys357ins antibody solution and the resulting mixture was mixed well and allowed to react at 20° C. for two hours. Thereafter, the pH of the sample was adjusted to 5.0, and the DTT and barrier in the sample was removed via SP Sepharose FF cation exchange chromatography. Next, DHAA solution was added to the sample at a molecular ratio of 20× and the reaction was allowed to proceed for four hours at 25° C. in the dark to reconnect the disulfide bonds between the antibody chains. Thereafter, mc-vc-PAB-MMAE solution was added to induce coupling between mc-vc-PAB-MMAE and the antibody mutant cysteine, after which thorough mixing was performed and the reaction was allowed to proceed at 25° C. for two hours. After the reaction was complete, SP Sepharose FF cation exchange chromatography was used to remove the mc-vc-PAB-MMAE that was not coupled to an antibody molecule, and 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC samples were obtained.
TDC samples were analyzed via high performance liquid chromatography hydrophobic chromatography, and DAR was calculated based on corresponding peak area. The specific method used was as follows:
Column: Proteomix® HICBu-NP5 (5 μm, 4.6×35 mm);
Mobile Phases: A: 2M ammonium sulfate, 0.025M, pH 7 phosphate buffer; B: 0.025M, pH 7 phosphate buffer; C: 100% isopropanol;
Buffer A was equilibrated, Buffer B and Buffer C were used to perform a gradient elution and detection was carried out at 25° C. and 214 nm.
Appended
The data in
Appended Table 1: 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC and 2A1-HC-Cys410ins-mc-vc-PAB-MMAE
Appended Table 1 shows that the coupling efficiency of TDC compounds subject to fixed-point coupling via cysteine insertion mutation modification is relatively high (theoretical maximum value is 2.0), and DAR was ≥1.6.
TDC antibody backbone samples were stored at 37° C., and aggregation was analyzed by SEC-HPLC on Days 0, 7, 14 and 21. The specific methodology was as follows:
Column: TSKgel SuperSW mAb HR (7.8 mm×30 cm)
Mobile Phase: 0.1M sodium sulfate, 0.1M pH 6.7 phosphate buffer.
Detection was performed at 25° C. and 280 nm.
Appended
Appended Table 2: SEC-HPLC detection of aggregation of TDC antibody backbones 2A1-HC-Cys357ins, 2A1-HC-Cys387ins, 2A1-HC-Cys378ins, and 2A1-HC-Cys410ins; the samples were stored at 37° C. for three weeks with fundamentally no change in monomeric POI content;
2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC and 2A1-HC-Cys410ins-mc-vc-PAB-MMAE
Appended Table 3 shows that the target monomer content of TDC compounds subject to cysteine fixed-point coupling was greater than 90%.
ELISA was used to compare the relative affinities of 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys410ins-mc-vc-PAB-MMAE TDC, and 2A1 for EGFRvIII. The specific process used was as follows:
Recombinant EGFRvIII-His*6 antigen was used to coat plates; fish skin gelatin was used as a seal; dilution of each insertion mutant antibody was performed separately, up to a maximum concentration 10 ug/ml and a 4-fold gradient dilution was performed for a total of 11 concentrations; HRP-labeled secondary antibodies were used for incubation; TMB was used for development and absorption detection was performed at 450 nm. Assay results were plotted as A450 paired concentrations, and as shown in
Appended
NO:34), 2A1-HC-Cys378ins (SEQ ID NO:36), 2A1-HC-Cys379ins (SEQ ID NO:38), 2A1-HC-Cys386ins (SEQ ID NO:40), 2A1-HC-Cys387ins (SEQ ID NO:42) and 2A1-HC-Cys410ins (SEQ ID NO:44) antibodies maintained 2A1 affinity for the antigen EGFRvIII.
TDC cytotoxic activity was determined via the following experimental procedure: TDC was added to EGFR-overexpressing or EGFRVIII-expressing human tumor cell culture medium, and cell viability was determined after 72 hours of cell culture. Cell-based in vitro experiments were used to determine cell viability, cytotoxicity and programmed cell death induced by TDC constituted by the present invention.
In vitro efficacy of antibody-toxin conjugates was determined via a cell proliferation assay. A CellTiter96® AqueousOne Solution Cell Proliferation Assay was purchased commercially from Promega Corp. (Madison, Wis.). CellTiter96® Aqueous One Solution Cell Proliferation Assay (a) is a colorimetric method used to detect the number of living cells in cell proliferation and cytotoxicity experiments. The above reagent contains the novel tetrazole compound [3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium, inner salt; MTS) as well as an electronic coupling agent (phenazine ethosulfate; PES). PES exhibits enhanced chemical stability, which allows it to be mixed with MTS to form a stable solution. This convenient “single solution” model is an improvement on the first generation of the CellTiter Aqueous Assay, in which the electronic coupling agent PMS was supplied separately from the MTS solution. MTS (Owen's reagent) is reduced by cellular organisms into a colored formazan product, which can be directly dissolved in culture medium (
Aqueous One Solution Reagent is added directly to the medium present in the wells of the culture plate, after which incubation is performed for 1 to 4 hours, followed by reading of the absorbance value at 490 nm using a microplate reader.
The amount of formazan product detected at 490 nm is proportional to the number of viable cells in culture. Because the formazan product of MTS is soluble in tissue culture medium, CellTiterAqueous One Solution Assay requires fewer steps than the MTT or INT methods. A431 (EGFR-overexpressing cells) and U87-EGFRVIII (an EGFRVIII mutant stable cell line) were used in the present invention as an investigative system for performing in vitro efficacy assays. In 96-well plates, cells were plated at 6000 cells/well and 24 hours later, antibody spiking was carried out. The dosing concentrations for A431 and U87-EGFRvIII ranged from 200 nM to 10 pM with a four-fold dilution performed, and the concentration of U87-EGFRVIII ranged from 500 nM to 30 pM. Cell viability was assayed via MTS 72 hours after treatment.
Appended
The results shown in Table 5 shown that 2A1-LC-Cys110ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys111ins-mc-vc-PAB-MMAE TDC, 2A1-LC-Cys142ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys254ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys255ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys258ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys259ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys354ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys355ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys378ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys379ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys386ins-mc-vc-PAB-MMAE TDC, 2A1-HC-Cys387ins-mc-vc-PAB-MMAE TDC and 2A1-HC-Cys410ins-mc-vc-PAB-MMAE exhibit significant cytotoxic activity against EGFRwt-overexpressing cell line A431 and the EFGRvIII-overexpressing cell line U87-EGFRvIII.
The present invention is not limited to the scope of the embodiments disclosed in the examples; said examples are used to exemplify several aspects of the invention, and any embodiments that are functionally equivalent shall fall within the scope of the present invention. Indeed, in addition to the examples shown and described herein, additional variants of the invention should also be apparent to a person skilled in the art and fall within the scope of the claims appended hereto.
A fixed amount of TDC sample was added to human plasma for which human IgG had already been removed, with each TDC tube prepared in triplicate; next, incubation in a 37° C. water bath was performed for 0 hours, 24 hours and 72 hours, after which the TDC sample was removed and 100 ul of Protein A (MabSelect SuRe™ LX Lot: #10221479GE, washed with PBS) was added to each tube; adsorption was then allowed to proceed under agitation on a vertical mixer for two hours, followed by washing and elution to obtain incubated TDC. HIC-HPLC and RP-HPLC testing was performed on TDC samples incubated for a fixed amount of time to determine the plasma stability of the samples.
Appended
As part of the present invention, we established a subcutaneous transplantation tumor model of the human pancreatic cancer cell line BxPC3 in nude mice to evaluate the in vivo efficacy of TDC conjugates such as 2A1-HC-Cys357ins-mc-vc-PAB-MMAE. 5×106 A431 cells were injected subcutaneously into the backs of 4 to 6-week-old BALB/c nude mice and when the average tumor size grew to approximately 150 to 200 mm3, the mice were randomly grouped into groups of six mice each. On Day 1, 2A1-HC-Cys357ins-mc-vc-PAB-MMAE (2A1-HC-Cys357ins TDC), 2A1-HC-Cys410ins-mc-vc-PAB-MMAE (2A1-HC-Cys410ins TDC), 2A1-HC-Cys387ins-mc-vc-PAB-MMAE (2A1-HC-Cys387ins TDC) and 2A1-HC-Cys378ins-mc-vc-PAB-MMAE (2A1-HC-Cys378ins TDC) were administered via a single tail vein injection at a dose of 5 mg/kg (
Appended
SRISITRDTSKNQFFLQLNSVTIEDTATYYCVTAGRGFPYWGQGTLVTVSA
| Number | Date | Country | Kind |
|---|---|---|---|
| 201710469761.5 | Jun 2017 | CN | national |
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/CN2018/091623 | 6/15/2018 | WO | 00 |
