Patent Application
20250129160
The present invention relates to the field of oncology, in particular, to bispecific T cell engager (TCE) molecules and treatment of cancer patients with said molecules.
The redirection of T cell activity against tumor cells by means of bispecific molecules independent of T cell receptor specificity is an evolving approach in immunooncology (Frankel S R, Baeuerle P A. Targeting T cells to tumor cells using bispecific antibodies. Curr Opin Chem Biol 2013; 17:385-92). Such new protein-based pharmaceuticals typically can simultaneously bind to two different types of antigen. They are known in several structural formats, and current applications have been explored for cancer immunotherapy and drug delivery (Fan, Gaowei; Wang, Zujian; Hao, Mingju; Li, Jinming (2015). “Bispecific antibodies and their applications”. Journal of Hematology & Oncology. 8:130).
Bispecific molecules useful in immunooncology can be antigen-binding polypeptides such as antibodies, e.g. IgG-like, i.e. full-length bispecific antibodies, or non-IgG-like bispecific antibodies, which are not full-length antibody constructs. Full length bispecific antibodies typically retain the traditional monoclonal antibody (mAb) structure of two Fab arms and one Fc region, except the two Fab sites bind different antigens. Non-full-length bispecific antibodies can lack an Fc region entirely. These include chemically linked Fabs, consisting of only the Fab regions, and various types of bivalent and trivalent single-chain variable fragments (scFvs). There are also fusion proteins mimicking the variable domains of two antibodies. An example of such a format is the bispecific T-cell engager (BiTER) (Yang, Fa; Wen, Weihong; Qin, Weijun (2016). “Bispecific Antibodies as a Development Platform for New Concepts and Treatment Strategies”. International Journal of Molecular Sciences. 18 (1): 48).
BiTE molecules are recombinant protein constructs made from two flexibly linked antibody derived binding domains. One binding domain of BiTE is specific for a selected tumor-associated surface antigen on target cells; the second binding domain is specific for CD3, a subunit of the T cell receptor complex on T cells. By their particular design, BiTE molecules are uniquely suited to transiently connect T cells with target cells and, at the same time, potently activate the inherent cytolytic potential of T cells against target cells.
There exists a need for bispecific molecules, specifically T cell engager (“TCE”) molecules, that bind a target antigen and CD3, and that demonstrate increased lysis of target cells and have desirable manufacturing properties such as increased aggregation temperatures and steeper HIC elution peak slopes. The present invention provides single-chain TCE molecules having an scFab that binds a target antigen (e.g. tumor antigen) and an scFv that binds CD3. Some TCE molecules further have an scFc, connected by a linker to the scFv, to extend the molecule half-life. The TCE molecules of the present invention demonstrate improved lysis of target cells and improved properties related to manufacturing.
The present invention also provides CCR8 TCE molecules that bind CCR8 and CD3. The C-C chemokine receptor type 8 (CCR8) is a member of the beta chemokine receptor family and is a seven transmembrane G-protein-coupled receptor with a 35 amino acid extracellular N-terminus. The ligand for CCR8 is CCL1, and CCL1-induced CCR8 signaling occurs via G-coupled proteins. CCR8 is expressed with much higher prevalence and at higher levels on the surface of cancer-resident Tregs compared to circulating or normal tissue Tregs and conventional T effector (Teff) cells. Treg cell infiltration in solid tumors is associated with poor clinical outcome, and Tregs suppress the anti-cancer immune response through inhibition of Teff cell cytotoxicity.
CCR8 TCE molecules of the present invention are thought to induce redirected T cell lysis of tumor-resident CCR8+ Tregs while sparing normal tissue Tregs that have little to no CCR8 expression. CCR8 TCE molecules of the present invention are thought to have an improved safety profile compared to other Treg-depleting therapeutic candidates targeting other markers that do not specifically deplete cancer-resident Tregs.
CCR8 TCE molecules of the present invention are single chain molecules and have either an (i) scFv that binds CCR8 and an scFv that binds CD3, wherein the two scFvs are connected by a linker; or (ii) an scFab that binds CCR8 and an scFv that binds CD3, wherein the scFab and scFv are connected by a linker. Some TCE molecules further have a scFc, connected by a linker to the scFv that binds CD3, to extend the half-life of the molecule. The CCR8 TCE molecules of the present invention demonstrate pM range cytotoxicity and bind both cynomolgus monkey and human CCR8. Interestingly, CCR8 TCE molecules were discovered that bind a unique epitope on CCR8 and do not block ligand binding to CCR8. Binding to this unique epitope is thought to contribute to high affinity and bioactivity of the TCE molecule. Binding to this unique epitope may also contribute to an acceptable pharmacokinetic profile.
The present invention provides a T cell engager (TCE) molecule, which may be referred to as an scFab-containing TCE molecule, comprising (i) an scFab that binds a tumor antigen, wherein the scFab comprises a first heavy chain variable region (scFab VH), a CHI domain, a first light chain variable region (scFab VL), and a Ck or CA domain, and (ii) an scFv that binds CD3, comprising a second VL and a second VH, wherein the TCE molecule is a single chain. In some embodiments, the scFab comprises a C-terminus portion that is connected by a linker to an N-terminal portion of the scFv. In some embodiment the TCE molecule further comprises an scFc. In some embodiments, the scFc comprises an N-terminus portion that is connected by a linker to the C-terminal portion of the scFv. In a particular embodiment, the scFv binds human CD3. In some embodiments, the tumor antigen is CCR8.
In some embodiments, the scFab of a TCE molecule of the present invention has an orientation in the following order, from N-terminus to C-terminus, VH, CH1, VL, and either Cκ or Cλ. In other embodiments, the scFab has an orientation in the following order, from N-terminus to C-terminus, VL, either Cκ or Cλ, VH, and CH1. In some embodiments, the scFab comprises a linker that connects the CH1 and VL, wherein the linker is (G4S)6, (G4S)7, (G4S)8, (G4Q)6, (G4Q)7, or (G4Q)8. In some embodiments, the scFab comprises a linker that connects Cκ or Cλ and VH, wherein the linker is (G4S)6, (G4S)7, (G4S)8, (G4Q)6, (G4Q)7, or (G4Q)8. In some embodiments, the scFab contains a natural cysteine clamp between the heavy and light chain constant domains. In some embodiments, the TCE molecule comprises an engineered cysteine clamp in the scFab between residue 44 in the VH domain and residue 100 in the VL domain (Kabat numbering). In some embodiments, the scFab contains a natural cysteine clamp between the heavy and light chain constant domains and an engineered cysteine clamp between residue 44 in the VH domain and residue 100 in the VL domain. In some embodiments, the TCE molecule CH1, Cκ and/or Cλ domains are IgG, IgM, IgA, IgD, or IgE. In a particular embodiment, the domains are IgG. In a more particular embodiment, the domains are IgG1. In some embodiments, the domains are human. In a particular embodiment, the domains are human IgG1.
The present invention provides a single-chain TCE molecule having the following orientation, from N-terminus to C-terminus: scFab (VH, CH1, linker, VL, either Cκ or Cλ), linker, scFv (VH, linker, VL). In an embodiment, the TCE molecule further comprises a scFc, and has the following orientation: scFab (VH, CHI, linker, VL, either Cκ or Cλ), linker, scFv (VH, linker, VL), linker, Fc1 (hinge, CH2, CH3), linker, Fc2 (hinge, CH2, CH3).
The present invention provides a single-chain TCE molecule having the following orientation, from N-terminus to C-terminus: scFab (VL, either Cκ or C2, linker, VH, CH1), linker, scFv (VH, linker, VL). In an embodiment, the TCE molecule further comprises a scFc, and has the following orientation: scFab (VL, either Cκ or Cλ, linker, VH, CH1), linker, scFv (VH, linker, VL), linker, Fc1 (hinge, CH2, CH3), linker, Fc2 (hinge, CH2, CH3).
The present invention provides a single-chain TCE molecule having the following orientation: scFv that binds CCR8 (VH, linker, VL), linker, scFv that binds CD3 (VH, linker, VL). In an embodiment, the TCE molecule further comprises a scFc, and has the following orientation: scFv that binds CCR8 (VH, linker, VL), linker, scFv that binds CD3 (VH, linker, VL)-Linker-Fc1 (hinge, CH2, CH3), linker, Fc2 (hinge, CH2, CH3).
The present invention also provides a TCE molecule having the following orientation from N-terminus to C-terminus: scFv that binds CCR8 (VH, linker, VL)-Linker-scFv that binds CD3 (VH, linker, VL)-Linker-Fc1 (CH2-CH3)-Linker-Fc2 (CH2-CH3). In an embodiment, the TCE molecule binds CCR8 and CD3. The present invention provides a TCE molecule having the following orientation from N-terminus to C-terminus: scFv that binds CCR8 (VL-Linker-VH)-Linker-scFv that binds CD3 (VH-Linker-VL)-Linker-Fc1 (CH2-CH3)-Linker-Fc2 (CH2-CH3). In an embodiment, the TCE molecule binds CCR8 and CD3.
The present invention provides a single-chain TCE molecule having a scFab-scFv-scFv-scFc format. In some embodiments, the TCE molecule comprises the following orientation: VH-CH1-Linker-VL-Cκ/Cλ-Linker-VH-Linker-VL-Linker-VH-Linker-VL-Linker-Fc1-Linker-Fc2. In some embodiments, the TCE molecule comprises the following orientation: VL-Cκ/Cλ-Linker-VH-CH1-Linker-VH-Linker-VL-Linker-VH-Linker-VL-Linker-Fc1-Linker-Fc2. In some embodiments, the TCE molecule comprises the following orientation: VL-Cκ/Cλ-Linker-VH-CH1-Linker-VL-Linker-VH-Linker-VH-Linker-VL-Linker-Fc1-Linker-Fc2. In some embodiments, the TCE molecule comprises the following orientation: VH-CH1-Linker-VL-Cκ/C2-Linker-VL-Linker-VH-Linker-VH-Linker-VL-Linker-Fc1-Linker-Fc2. In some embodiments, the TCE molecule comprises Cκ. In some embodiments, the TCE molecule comprises Cλ.
The present invention also provides a single-chain TCE molecule having an scFab-scFab-scFv-scFc format. In some embodiments, the TCE molecule comprises the following orientation: VH-CH1-Linker-VL-Cκ/Cλ-Linker-VH-CH1-Linker-VL-Cκ/Cλ-Linker-VH-Linker-VL-Linker-Fc1-Linker-Fc2. In some embodiments, the TCE molecule comprises the following orientation: VL-Cκ/C2-Linker-VH-CH1-Linker-VH-CH1-Linker-VL-Cκ/Cλ-Linker-VH-Linker-VL-Linker-Fc1-Linker-Fc2. In some embodiments, the TCE molecule comprises the following orientation: VH-CH1-Linker-VL-Cκ/Cλ-Linker-VL-Cκ/Cλ-Linker-VH-CH1-Linker-VH-Linker-VL-Linker-Fc1-Linker-Fc2. In some embodiments, the TCE molecule comprises the following orientation: VL-Cκ/Cλ-Linker-VH-CH1-Linker-VL-Cκ/Cλ-Linker-VH-CH1-Linker-VH-Linker-VL-Linker-Fc1-Linker-Fc2. In some embodiments, the TCE molecule comprises Cκ. In some embodiments, the TCE molecule comprises Cλ. In some embodiments, the TCE molecule comprises Cκ and Cλ.
In an embodiment, the scFab VH and CHI of an scFab-containing TCE molecule of the present invention comprise an amino acid sequence given by SEQ ID NO: 12, SEQ ID NO: 28, SEQ ID NO: 44, SEQ ID NO: 60, SEQ ID NO: 76, SEQ ID NO: 92, SEQ ID NO: 108, or SEQ ID NO: 124. In an embodiment, the TCE molecule of the present invention comprises a Cκ. In a particular embodiment, the scFab VL and Cκ of an scFab-containing TCE molecule of the present invention comprise an amino acid sequence given by SEQ ID NO: 13, SEQ ID NO: 29, SEQ ID NO: 45, SEQ ID NO: 61, SEQ ID NO: 77, SEQ ID NO: 93, SEQ ID NO: 109, or SEQ ID NO: 125. In another particular embodiment, the TCE molecule comprises an amino acid sequence given by SEQ ID NO: 14, SEQ ID NO: 30, SEQ ID NO: 46, SEQ ID NO: 62, SEQ ID NO: 78, SEQ ID NO: 94, SEQ ID NO: 110, or SEQ ID NO: 126. In another particular embodiment, the TCE molecule comprises an amino acid sequence given by SEQ ID NO: 15, SEQ ID NO: 31, SEQ ID NO: 47, SEQ ID NO: 63, SEQ ID NO: 79, SEQ ID NO: 95, SEQ ID NO: 111, or SEQ ID NO: 127. In another particular embodiment, the TCE molecule comprises an amino acid sequence given by SEQ ID NO: 16, SEQ ID NO: 32, SEQ ID NO: 48, SEQ ID NO: 64, SEQ ID NO: 80, SEQ ID NO: 96, SEQ ID NO: 112, or SEQ ID NO: 128.
In another embodiment, the scFab VH and CHI or scFab VL and Cκ comprise a sequence of amino acids that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of a scFab VH and CHI or scFab VL and Cκ sequence listed herein. In another embodiment, the TCE molecule comprises a sequence of amino acids that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the sequence of a TCE molecule sequence listed herein.
The present invention also provides a TCE molecule comprising (i) a first scFv that binds CCR8, wherein the first scFv comprises a first VH region (CCR8 scFv VH) and a first VL region (CCR8 scFv VL), and (ii) a second scFv that binds CD3, wherein the second scFv comprises a second VH region and a second VL region. A molecule having this structure and that binds CCR8 and CD3 may be referred to as a CCR8 TCE molecule. In a preferred embodiment, the CCR8 TCE molecule is a single chain.
In an embodiment, the CCR8 TCE molecule scFv VH comprises an amino acid sequence given by SEQ ID NO: 7, SEQ ID NO: 23, SEQ ID NO: 39, SEQ ID NO: 55, SEQ ID NO: 71, SEQ ID NO: 87, SEQ ID NO: 103, or SEQ ID NO: 119, and wherein the CCR8 scFv VL comprises an amino acid sequence given by SEQ ID NO: 8, SEQ ID NO: 24, SEQ ID NO: 40, SEQ ID NO: 56, SEQ ID NO: 72, SEQ ID NO:88, SEQ ID NO: 104, or SEQ ID NO: 120. In another embodiment, the first scFv comprises an amino acid sequence given by SEQ ID NO: 9, 25, 41, 57, 73, 89, 105, or 121. In another embodiment, the TCE molecule comprises an amino acid sequence given by SEQ ID NO: 10, SEQ ID NO: 26, SEQ ID NO: 42, SEQ ID NO: 58, SEQ ID NO: 74, SEQ ID NO: 90, SEQ ID NO: 106, or SEQ ID NO: 122. In another embodiment, the TCE molecule further comprises an scFc, wherein the TCE molecule comprises an amino acid sequence given by SEQ ID NO: 11, SEQ ID NO: 27, SEQ ID NO: 59, SEQ ID NO: 75, SEQ ID NO: 91, SEQ ID NO: 107, or SEQ ID NO: 123. In another embodiment, the CCR8 scFv VH comprises a sequence of amino acids that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to CCR8 scFv VH sequences listed herein. In another embodiment, the CCR8 scFv VL comprises a sequence of amino acids that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the CCR8 scFv VL sequences listed herein.
In another embodiment, the first scFv (that binds CCR8) comprises a sequence of amino acids that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to the first scFv sequences listed herein.
In another embodiment, a CCR8 TCE molecule of the present invention comprises a sequence of amino acids that is at least 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% identical to CCR8 TCE molecule sequences listed herein.
In some embodiments, the first VH (scFab VH and/or CCR8 scFv VH) of a TCE molecule of the present invention comprises HCDR1, HCDR2, HCDR3, and the first VL (scFab VL and/or CCR8 scFv VL) comprises LCDR1, LCDR2, and LCDR3, and wherein:
In a particular embodiment, HCDR1 comprises an amino acid sequence given by SEQ ID NO: 1, HCDR2 comprises an amino acid sequence given by SEQ ID NO: 2, HCDR3 comprises an amino acid sequence given by SEQ ID NO: 3, LCDR1 comprises an amino acid sequence given by SEQ ID NO: 4, LCDR2 comprises an amino acid sequence given by SEQ ID NO: 5, and LCDR3 comprises an amino acid sequence given by SEQ ID NO: 6.
In another particular embodiment, HCDR1 comprises an amino acid sequence given by SEQ ID NO: 17, HCDR2 comprises an amino acid sequence given by SEQ ID NO: 18, HCDR3 comprises an amino acid sequence given by SEQ ID NO: 19, LCDR1 comprises an amino acid sequence given by SEQ ID NO: 20, LCDR2 comprises an amino acid sequence given by SEQ ID NO: 21, and LCDR3 comprises an amino acid sequence given by SEQ ID NO: 22.
In another particular embodiment, HCDR1 comprises an amino acid sequence given by SEQ ID NO: 33, HCDR2 comprises an amino acid sequence given by SEQ ID NO: 34, HCDR3 comprises an amino acid sequence given by SEQ ID NO: 35, LCDR1 comprises an amino acid sequence given by SEQ ID NO: 36, LCDR2 comprises an amino acid sequence given by SEQ ID NO: 37, and LCDR3 comprises an amino acid sequence given by SEQ ID NO: 38.
In yet another particular embodiment, HCDR1 comprises an amino acid sequence given by SEQ ID NO: 49, HCDR2 comprises an amino acid sequence given by SEQ ID NO: 50, HCDR3 comprises an amino acid sequence given by SEQ ID NO: 51, LCDR1 comprises an amino acid sequence given by SEQ ID NO: 52, LCDR2 comprises an amino acid sequence given by SEQ ID NO: 53, and LCDR3 comprises an amino acid sequence given by SEQ ID NO: 54.
In another particular embodiment, HCDR1 comprises an amino acid sequence given by SEQ ID NO: 65, HCDR2 comprises an amino acid sequence given by SEQ ID NO: 66, HCDR3 comprises an amino acid sequence given by SEQ ID NO: 67, LCDR1 comprises an amino acid sequence given by SEQ ID NO: 68, LCDR2 comprises an amino acid sequence given by SEQ ID NO: 69, and LCDR3 comprises an amino acid sequence given by SEQ ID NO: 70.
In another particular embodiment, HCDR1 comprises an amino acid sequence given by SEQ ID NO: 81, HCDR2 comprises an amino acid sequence given by SEQ ID NO: 82, HCDR3 comprises an amino acid sequence given by SEQ ID NO: 83, LCDR1 comprises an amino acid sequence given by SEQ ID NO: 84, LCDR2 comprises an amino acid sequence given by SEQ ID NO: 85, and LCDR3 comprises an amino acid sequence given by SEQ ID NO: 86.
In yet another particular embodiment, HCDR1 comprises an amino acid sequence given by SEQ ID NO: 97, HCDR2 comprises an amino acid sequence given by SEQ ID NO: 98, HCDR3 comprises an amino acid sequence given by SEQ ID NO: 99, LCDR1 comprises an amino acid sequence given by SEQ ID NO: 100, LCDR2 comprises an amino acid sequence given by SEQ ID NO: 101, and LCDR3 comprises an amino acid sequence given by SEQ ID NO: 102.
In another particular embodiment, HCDR1 comprises an amino acid sequence given by SEQ ID NO: 113, HCDR2 comprises an amino acid sequence given by SEQ ID NO: 114, HCDR3 comprises an amino acid sequence given by SEQ ID NO: 115, LCDR1 comprises an amino acid sequence given by SEQ ID NO: 116 or SEQ ID NO: 336 (KSSQSVLYSSNNXINYLA, wherein X1 is K or R), LCDR2 comprises an amino acid sequence given by SEQ ID NO: 117, and LCDR3 comprises an amino acid sequence given by SEQ ID NO: 118.
The present invention provides a TCE molecule comprising an orientation, from N-terminus to C-terminus, of an scFv that binds CCR8 (VH, linker, VL), linker, scFv that binds CD3 (VH, linker, VL), wherein the scFv that binds CCR8 comprises CDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 comprising amino acid residues given by SEQ ID NO: 217, SEQ ID NO: 218, SEQ ID NO: 219, SEQ ID NO: 220, SEQ ID NO: 221, and SEQ ID NO: 222, respectively. In an embodiment, the scFv that binds CCR8 comprises a VH and VL given by SEQ ID NO: 223 and SEQ ID NO: 224, respectively. In a particular embodiment, the scFv that binds CCR8 comprises amino acid residues given by SEQ ID NO: 225. In an embodiment, the TCE molecule comprises G4S linkers. In an embodiment, the TCE molecule comprises G4Q linkers. In an embodiment, the CD3-binding scFv is I2E. In another embodiment, the CD3-binding scFv is I2C. In another embodiment, the TCE molecule comprises the amino sequence given by SEQ ID NO: 226. In a further embodiment, the TCE molecule comprises the amino acid sequence given by SEQ ID NO: 227. In some such embodiments, the TCE molecule is TCE 1.1. In a preferred embodiment, the TCE molecule is a single chain. In some embodiments, the TCE molecule may have an orientation such that the VL is N-terminal to the VH.
The present invention provides a TCE molecule comprising an orientation, from N-terminus to C-terminus, of an scFv that binds CCR8 (VH, linker, VL), linker, scFv that binds CD3 (VH, linker, VL)-Linker-Fc1 (hinge, CH2, CH3), linker, Fc2 (hinge, CH2, CH3), wherein the scFv that binds CCR8 comprises CDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 comprising amino acid residues given by SEQ ID NO: 228, SEQ ID NO: 229, SEQ ID NO: 230, SEQ ID NO: 231, SEQ ID NO: 232, and SEQ ID NO: 233, respectively. In an embodiment, the scFv that binds CCR8 comprises a VH and VL given by SEQ ID NO: 234 and SEQ ID NO: 235, respectively. In a particular embodiment, the an scFv that binds CCR8 comprises amino acid residues given by SEQ ID NO: 236. In an embodiment, the TCE molecule comprises G4S linkers. In an embodiment, the TCE molecule comprises G4Q linkers. In an embodiment, the CD3-binding scFv is I2E. In another embodiment, the CD3-binding scFv is I2C. In another embodiment, the TCE molecule comprises the amino sequence given by SEQ ID NO: 237. In a further embodiment, the TCE molecule comprises the amino acid sequence given by SEQ ID NO: 238. In some such embodiments, the TCE molecule is TCE 1.2. In a preferred embodiment, the TCE molecule is a single chain. In some embodiments, the TCE molecule may have an orientation such that the VL is N-terminal to the VH.
The present invention provides a TCE molecule comprising an orientation, from N-terminus to C-terminus, of a scFab that binds CCR8 (VH, CHI, linker, VL, either Cκ or Cλ), linker, an scFv that binds CD3 (VH, linker, VL), wherein the scFab that binds CCR8 comprises CDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 comprising amino acid residues given by SEQ ID NO: 239, SEQ ID NO: 240, SEQ ID NO: 241, SEQ ID NO: 242, SEQ ID NO: 243, and SEQ ID NO: 244, respectively. In an embodiment, the scFab comprises a VH and VL given by SEQ ID NO: 245 and SEQ ID NO: 246, respectively. In a particular embodiment, the scFab comprises amino acid residues given by SEQ ID NO: 247. In an embodiment, the TCE molecule comprises G4S linkers. In an embodiment, the TCE molecule comprises G4Q linkers. In an embodiment, the CD3-binding scFv is I2E. In another embodiment, the CD3-binding scFv is I2C. In another embodiment, the TCE molecule comprises the amino sequence given by SEQ ID NO: 248. In a further embodiment, the TCE molecule comprises the amino acid sequence given by SEQ ID NO: 249. In some such embodiments, the TCE molecule is TCE 1.3. In a preferred embodiment, the TCE molecule is a single chain. In some embodiments, the TCE molecule may have an orientation such that the VL is N-terminal to the VH.
The present invention provides a TCE molecule comprising an orientation, from N-terminus to C-terminus, of scFab that binds CCR8 (VH, CH1, linker, VL, either Cκ or Cλ), linker, scFv that binds CD3 (VH, linker, VL), linker, Fc1 (hinge, CH2, CH3), linker, Fc2 (hinge, CH2, CH3), wherein the scFab that binds CCR8 comprises CDR1, HCDR2, HCDR3, LCDR1, LCDR2, and LCDR3 comprising amino acid residues given by SEQ ID NO: 250, SEQ ID NO: 251, SEQ ID NO: 252, SEQ ID NO: 253, SEQ ID NO: 254, and SEQ ID NO: 255, respectively. In an embodiment, the scFab comprises a VH and VL given by SEQ ID NO: 256 and SEQ ID NO: 257, respectively. In a particular embodiment, the scFab comprises amino acid residues given by SEQ ID NO: 258. In an embodiment, the TCE molecule comprises G4S linkers. In an embodiment, the TCE molecule comprises G4Q linkers. In an embodiment, the CD3-binding scFv is I2E. In another embodiment, the CD3-binding scFv is I2C. In another embodiment, the TCE molecule comprises the amino sequence given by SEQ ID NO: 259. In a further embodiment, the TCE molecule comprises the amino acid sequence given by SEQ ID NO: 260. In some such embodiments, the TCE molecule is TCE 1.4. In a preferred embodiment, the TCE molecule is a single chain. In some embodiments, the TCE molecule may have an orientation such that the VL is N-terminal to the VH.
The present invention further provides a TCE molecule that binds to human CCR8, which comprises an HCDR1 amino acid sequence of SEQ ID NO: 787; an HCDR2 amino acid sequence of SEQ ID NO: 788; an HCDR3 amino acid sequence of SEQ ID NO: 789; an LCDR1 amino acid sequence of SEQ ID NO: 790; an LCDR2 amino acid sequence of SEQ ID NO: 791; and an LCDR3 amino acid sequence of SEQ ID NO: 792. In some embodiments, the TCE molecule comprises a VH amino acid sequence of SEQ ID NO: 965 and a VL amino acid sequence of SEQ ID NO: 966.
The present invention further provides a TCE molecule that binds to human CCR8, which comprises an HCDR1 amino acid sequence of SEQ ID NO: 787; an HCDR2 amino acid sequence of SEQ ID NO: 788; an HCDR3 amino acid sequence of SEQ ID NO: 789; an LCDR1 amino acid sequence of SEQ ID NO: 336, wherein X1 is K or R; an LCDR2 amino acid sequence of SEQ ID NO: 791; and an LCDR3 amino acid sequence of SEQ ID NO: 792. In some embodiments, the TCE molecule comprises a VH amino acid sequence of SEQ ID NO: 965 and a VL amino acid sequence of SEQ ID NO: 342, wherein X1 is K or R, X2 is H or Q, and/or X3 is S or P.
The present invention further provides a TCE molecule that binds to human CCR8, which comprises an HCDR1 amino acid sequence of SEQ ID NO: 805, an HCDR2 amino acid sequence of SEQ ID NO: 806, an HCDR3 amino acid sequence of SEQ ID NO: 807, an LCDR1 amino acid sequence of SEQ ID NO: 808, an LCDR2 amino acid sequence of SEQ ID NO: 809, and an LCDR3 amino acid sequence of SEQ ID NO: 810.
The present invention further provides a TCE molecule that binds to human CCR8, which comprises: (a) an HCDR1 amino acid sequence of X1X2GX4H, (SEQ ID NO: 1181), wherein (i) X1 is N, S, D, G, T, or R, (ii) X2 is C, N, Y, S, or F, and (iii) X4 is M or F; (b) an HCDR2 amino acid sequence of SEQ ID NOs: 596, 602, 608, 614, 620, 626, 632, 638, 644, 650, 656, 662, 668, 674, 680, 686, 692, 698, 704, 710, 716, 722, 728, 734, 740, 746, 752, 758, 764, 770, 776, 782, 788, 794, 800, 806, 815, 821, 827, 833, 839, 845, 851, 857, 863, 869, 875, 881, 887, or 893, or a variant thereof that comprises 1-4 amino acid substitutions or is at least 90% identical to any one of the foregoing HCDR2 amino acid sequences; (c) an HCDR3 amino acid sequence of SEQ ID NOs: 597, 603, 609, 615, 621, 627, 633, 639, 645, 651, 657, 663, 669, 675, 681, 687, 693, 699, 705, 711, 717, 723, 729, 735, 741, 747, 753, 759, 765, 771, 777, 783, 795, 801, 807, 816, 822, 828, 834, 840, 846, 852, 858, 864, 870, 876, 882, 888, or 894 or a variant thereof that comprises 1-4 amino acid substitutions or is at least 90% identical to any one of the foregoing HCDR3 amino acid sequences; (d) an LCDR1 amino acid sequence of SEQ ID NOs: 598, 604, 610, 616, 622, 628, 634, 640, 646, 652, 658, 664, 670, 676, 682, 688, 694, 700, 706, 712, 718, 724, 730, 736, 742, 748, 754, 760, 766, 772, 778, 784, 796, 802, 808, 811, 817, 823, 829, 835, 841, 847, 853, 859, 865, 871, 877, 883, or 889 or a variant thereof that comprises 1-4 amino acid substitutions or is at least 90% identical to any one of the foregoing LCDR1 amino acid sequences; (e) an LCDR2 amino acid sequence of RX2X3X4RPS (SEQ ID NO: 1182), wherein (i) X2 is A, N, D, S, or Q, (ii) X3 is S, T, N, I, F, or A, and (iii) X4 is N or V; and (f) an LCDR3 amino acid sequence of SEQ ID NOs: 600, 606, 612, 618, 624, 630, 636, 642, 648, 654, 660, 666, 672, 678, 684, 690, 696, 702, 708, 714, 720, 726, 732, 738, 744, 750, 756, 762, 768, 774, 780, 786, 798, 804, 810, 813, 819, 825, 831, 837, 843, 849, 855, 861, 867, 873, 879, 885, or 891 or a variant thereof that comprises 1-4 amino acid substitutions or is at least 90% identical to any one of the foregoing LCDR3 amino acid sequences. In some embodiments, the HCDR1 comprises an amino acid sequence of SEQ ID NOs: 595, 601, 607, 613, 619, 625, 631, 637, 643, 649, 655, 661, 667, 673, 679, 685, 691, 697, 703, 709, 715, 721, 727, 733, 739, 745, 751, 757, 763, 769, 775, 781, 793, 799, 805, 814, 820, 826, 832, 838, 844, 850, 856, 862, 868, 874, 880, 886, or 892. In some embodiments, the LCDR2 comprises an amino acid sequence of SEQ ID NOs: 599, 605, 611, 617, 623, 629, 635, 641, 647, 653, 659, 665, 671, 677, 683, 689, 695, 701, 707, 713, 719, 725, 731, 737, 743, 749, 755, 761, 767, 773, 779, 785, 797, 803, 809, 812, 818, 824, 830, 836, 842, 848, 854, 860, 866, 872, 878, 884, or 890. In some embodiments, the VH comprises an amino acid sequence of SEQ ID NOs: 901, 903, 905, 907, 909, 911, 913, 915, 917, 919, 921, 923, 925, 927, 929, 931, 933, 935, 937, 939, 941, 943, 945, 947, 949, 951, 953, 955, 957, 959, 961, 963, 967, 969, 971, 974, 976, 978, 980, 982, 984, 986, 988, 990, 992, 994, 996, 998, or 1000. In some embodiments, the VL comprises an amino acid sequence of SEQ ID NOs: 912, 914, 916, 918, 920, 922, 924, 926, 928, 930, 932, 934, 936, 938, 940, 942, 944, 946, 948, 950, 952, 954, 956, 958, 960, 962, 964, 968, 970, 972, 973, 975, 977, 979, 981, 983, 985, 987, 989, 991, 993, 995, 997, or 999.
In some embodiments, the TCE molecule comprises: (a) a VH comprising an amino acid sequence of SEQ ID NO: 967 and a VL comprising an amino acid sequence of SEQ ID NO: 968; (b) a VH comprising an amino acid sequence of SEQ ID NO: 969 and a VL comprising an amino acid sequence of SEQ ID NO: 970; (c) a VH comprising an amino acid sequence of SEQ ID NO: 971 and a VL comprising an amino acid sequence of SEQ ID NO: 972; (d) a VH comprising an amino acid sequence of SEQ ID NO: 974 and a VL comprising an amino acid sequence of SEQ ID NO: 973; (e) a VH comprising an amino acid sequence of SEQ ID NO: 976 and a VL comprising an amino acid sequence of SEQ ID NO: 975; (f) a VH comprising an amino acid sequence of SEQ ID NO: 978 and a VL comprising an amino acid sequence of SEQ ID NO: 977; (g) a VH comprising an amino acid sequence of SEQ ID NO: 980 and a VL comprising an amino acid sequence of SEQ ID NO: 979; (h) a VH comprising an amino acid sequence of SEQ ID NO: 982 and a VL comprising an amino acid sequence of SEQ ID NO: 981; (i) a VH comprising an amino acid sequence of SEQ ID NO: 984 and a VL comprising an amino acid sequence of SEQ ID NO: 983; (j) a VH comprising an amino acid sequence of SEQ ID NO: 986 and a VL comprising an amino acid sequence of SEQ ID NO: 985; (k) a VH comprising an amino acid sequence of SEQ ID NO: 988 and a VL comprising an amino acid sequence of SEQ ID NO: 987; (1) a VH comprising an amino acid sequence of SEQ ID NO: 990 and a VL comprising an amino acid sequence of SEQ ID NO: 989; (m) a VH comprising an amino acid sequence of SEQ ID NO: 992 and a VL comprising an amino acid sequence of SEQ ID NO: 991; (n) a VH comprising an amino acid sequence of SEQ ID NO: 994 and a VL comprising an amino acid sequence of SEQ ID NO: 993; (0) a VH comprising an amino acid sequence of SEQ ID NO: 996 and a VL comprising an amino acid sequence of SEQ ID NO: 995; (p) a VH comprising an amino acid sequence of SEQ ID NO: 998 and a VL comprising an amino acid sequence of SEQ ID NO: 997; or (q) a VH comprising an amino acid sequence of SEQ ID NO: 1000 and a VL comprising an amino acid sequence of SEQ ID NO: 999.
In some embodiments, the TCE molecule comprises a heavy chain variable region (VH) amino acid sequence of SEQ ID NO: 965, and a light chain variable region (VL) comprising the amino acid sequence: DIVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNXINYLAWYX2QKPGQX3PKLLISWA STRESGVPDRFSGSGSGTDFTLTINSLQAEDVAVYYCQQYYSIPITFGGGTKVEIKR (SEQ ID NO: 342), wherein X1 is K or R, X2 is H or Q, and/or X3 is S or P. In some embodiments, a TCE molecule of the present invention comprises a YTE motif in the Fc region, corresponding to M252Y/S254T/T256E in the constant heavy chain region of IgG1 or IgG4. The YTE extends the half-life of the molecule (see e.g. Booth et al., MAbs 2018 October; 10 (7): 1098-1110). In some embodiments, the TCE molecule of the present invention comprising YTE is a TCE molecule that binds CCR8 and CD3.
In some embodiments, a TCE molecule of the present invention comprises an I2E scFv. In some embodiments, a TCE molecule of the present invention comprises an I2C scFv. The amino acid sequences of I2E are given by SEQ ID NOs. 199 to 206. The amino acid sequences of I2C are given by SEQ ID NOs. 191 to 198.
The present invention provides additional TCE molecules described in Table 25. The amino acid sequences of these TCE molecules are given by SEQ ID NOs 261 to 589 in Table 25.
The present invention also provides a method of treating cancer in a patient comprising administering an effective amount of a TCE molecule of the present invention to the patient. In an embodiment, the cancer is a solid tumor. In a particular embodiment, the cancer is non-small cell lung cancer, gastric cancer, head and neck squamous cell carcinoma, hepatocellular carcinoma, triple-negative breast cancer, colorectal cancer, pancreatic cancer, or metastatic castrate-resistant prostate cancer. In some embodiments, the method further comprises administering to the patient a PD-1 antagonist antibody or a PD-L1 antagonist antibody. In some such embodiments, the PD-1 antagonist antibody or PD-L1 antagonist antibody is administered prior to, concurrently with, and/or after administration of the TCE molecule. In particular embodiments, the PD-1 antagonist antibody is pembrolizumab, nivolumab, cemiplimab, or antibody 20C1.009. In other particular embodiments, the PD-L1 antagonist antibody is atezolizumab, avelumab, or durvalumab. In some embodiments, the method further comprises administering to the patient a chemotherapeutic agent. In some such embodiments, the chemotherapeutic agent may be administered prior to, concurrently with, or after administration of the TCE molecule. In some embodiments, the method comprises administering to the patient a TCE molecule of the present invention and a chemotherapeutic agent. In some embodiments, the method comprises administering to the patient a TCE molecule of the present invention, a PD-1 or PD-L1 antagonist antibody, and a chemotherapeutic agent.
The present invention provides a TCE molecule of the present invention for use in therapy.
The present invention also provides a TCE molecule for use in treating cancer. In an embodiment, the cancer is a solid tumor. In a particular embodiment, the cancer is non-small cell lung cancer, gastric cancer, head and neck squamous cell carcinoma, hepatocellular carcinoma, triple-negative breast cancer, colorectal cancer, pancreatic cancer, or metastatic castrate-resistant prostate cancer. In a more particular embodiment, the cancer is non-small cell lung cancer, gastric cancer, head and neck squamous cell carcinoma, hepatocellular carcinoma, or triple-negative breast cancer. In some embodiments, the use further comprises administering to the patient a PD-1 antagonist antibody or PD-L1 antagonist antibody. In some such embodiments, the PD-1 antagonist antibody or PD-L1 antagonist antibody is administered prior to, concurrently with, and/or after administration of the TCE molecule. In particular embodiments, the PD-1 antagonist antibody is pembrolizumab, nivolumab, cemiplimab, or antibody 20C1.009. In other particular embodiments, the PD-L1 antagonist antibody is atezolizumab, avelumab, or durvalumab. In some embodiments, the use further comprises administering to the patient a chemotherapeutic agent. In some such embodiments, the chemotherapeutic agent may be administered prior to, concurrently with, or after administration of the TCE molecule. In some embodiments, the use comprises administering to the patient a TCE molecule of the present invention and a chemotherapeutic agent. In some embodiments, the use comprises administering to the patient a TCE molecule of the present invention, a PD-1 or PD-L1 antagonist antibody, and a chemotherapeutic agent.
The present invention provides the use of a TCE molecule of the present invention for the manufacture of a medicament for the treatment of cancer. In an embodiment, the cancer is a solid tumor. In a particular embodiment, the cancer is non-small cell lung cancer, gastric cancer, head and neck squamous cell carcinoma, hepatocellular carcinoma, triple-negative breast cancer, colorectal cancer, pancreatic cancer, or metastatic castrate-resistant prostate cancer. In a more particular embodiment, the cancer is non-small cell lung cancer, gastric cancer, head and neck squamous cell carcinoma, hepatocellular carcinoma, or triple-negative breast cancer.
The present invention also provides a pharmaceutical composition comprising a TCE molecule of the present invention and one or more pharmaceutically acceptable carriers, diluents, or excipients.
The present invention also provides a polynucleotide that encodes an amino acid sequence of a TCE molecule of the present invention. The term “encoding” or “encodes” refers to a polynucleotide sequence encoding one or more amino acids. The term does not require a start or stop codon. The present invention encompasses nucleic acid molecules encoding anti-CCR8 TCE polypeptide sequences.
In an embodiment, the TCE molecule of the present invention is encoded by a polynucleotide sequence given by SEQ ID NO: 590. In a particular embodiment, the TCE molecule encoded by the polynucleotide sequence given by SEQ ID NO: 590 comprises the amino acid sequence given by SEQ ID NO: 227.
In an embodiment, the TCE molecule of the present invention is encoded by a polynucleotide sequence given by SEQ ID NO: 592. In a particular embodiment, the TCE molecule encoded by the polynucleotide sequence given by SEQ ID NO: 592 comprises the amino acid sequence given by SEQ ID NO: 249.
In an embodiment, the TCE molecule of the present invention is encoded by a polynucleotide sequence given by SEQ ID NO: 593. In a particular embodiment, the TCE molecule encoded by the polynucleotide sequence given by SEQ ID NO: 593 comprises the amino acid sequence given by SEQ ID NO: 260.
In an embodiment, the TCE molecule of the present invention is encoded by a polynucleotide sequence given by SEQ ID NO: 591. In a particular embodiment, the TCE molecule encoded by the polynucleotide sequence given by SEQ ID NO: 591 comprises the amino acid sequence given by SEQ ID NO: 238.
The present invention also provides a DNA molecule comprising a polynucleotide that encodes an amino acid sequence of a TCE molecule of the present invention. In an embodiment, the TCE molecule of the present invention is encoded by a polynucleotide sequence given by SEQ ID NO: 590. In a particular embodiment, the TCE molecule encoded by the polynucleotide sequence given by SEQ ID NO: 590 comprises the amino acid sequence given by SEQ ID NO: 227. In another embodiment, the TCE molecule of the present invention is encoded by a polynucleotide sequence given by SEQ ID NO: 592. In a particular embodiment, the TCE molecule encoded by the polynucleotide sequence given by SEQ ID NO: 592 comprises the amino acid sequence given by SEQ ID NO: 249. In another embodiment, the TCE molecule of the present invention is encoded by a polynucleotide sequence given by SEQ ID NO: 593. In a particular embodiment, the TCE molecule encoded by the polynucleotide sequence given by SEQ ID NO: 593 comprises the amino acid sequence given by SEQ ID NO: 260. In another embodiment, the TCE molecule of the present invention is encoded by a polynucleotide sequence given by SEQ ID NO: 591. In a particular embodiment, the TCE molecule encoded by the polynucleotide sequence given by SEQ ID NO: 591 comprises the amino acid sequence given by SEQ ID NO: 238.
The present invention further provides a mammalian cell transformed with a DNA molecule of the present invention, wherein the transformed mammalian cell is capable of expressing a TCE molecule of the present invention.
The present invention also provides a process for producing a TCE molecule of the present invention, wherein the process comprises cultivating a mammalian cell under conditions such that the TCE molecule is expressed and recovering the expressed TCE molecule. The present invention also provides a mammalian cell transformed with a DNA molecule of the present invention, wherein the transformed mammalian cell is capable of expressing a TCE molecule of the present invention. The present invention also provides a TCE molecule obtainable by the process.
In another embodiment, the present invention provides a CCR8 TCE molecule that binds human CCR8 at an epitope wherein the epitope comprises at least one residue of SEQ ID NO: 134. In an embodiment, the epitope comprises at least two residues of SEQ ID NO: 134. In an embodiment, the epitope comprises at least three residues of SEQ ID NO: 134. In an embodiment, the epitope comprises at least four residues of SEQ ID NO: 134. In an embodiment, the epitope comprises at least five residues of SEQ ID NO: 134. In an embodiment, the epitope comprises six or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises seven or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises eight or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises nine or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises ten or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises eleven or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises twelve residues of SEQ ID NO: 134. In a particular embodiment, the epitope comprises the threonine residue at position 4 of SEQ ID NO: 134. The term “epitope” as used herein refers to sites of an antigen that are in contact with (e.g. binds) the molecule. The epitope may be determined by a method known to a person of ordinary skill, including flow cytometry of bound TCE molecule to peptides, hydrogen-deuterium exchange, alanine scanning, and/or x-ray crystallography. In an embodiment, the epitope is determined by epitope binning. In an embodiment, the epitope is determined by TCE molecule binding to CCR8 peptide-nanobody complexes. In an embodiment, the epitope is determined by screening TCE molecule binding to CCR8 by phage display. In an embodiment, the epitope is determined by determining binding to a CCR8 peptide expressed in human cells, wherein the peptide comprises an amino acid sequence given by SEQ ID NO: 134 or amino acid residues 1-12 of SEQ ID NO: 133. In some embodiments, the epitope is determined by anti-CCR8 TCE molecule binding to the T4R mutation in cynomolgus monkey CCR8. In an embodiment, binding to the T4R mutation is determined in a cell based affinity assay, wherein TCE molecule binding to cells expressing cynomolgus monkey cells CCR8 containing a T4R mutation is compared to TCE molecule binding to cells expressing wild-type cynomolgus monkey CCR8 (comprising a threonine at position four). In some embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows reduced binding to CCR8 comprising a T4R mutation. In particular embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows no detectable binding to CCR8 comprising a T4R mutation. In some embodiments, wild-type cynomolgus monkey CCR8 comprises an amino acid sequence given by SEQ ID NO: 129. In some embodiments, cynomolgus monkey CCR8 comprising a T4R mutation comprises an amino acid sequence given by SEQ ID NO: 130.
The present invention provides a method of treating cancer in a patient comprising administering to the patient an effective amount of a CCR8 TCE molecule that binds human CCR8 at an epitope wherein the epitope comprises at least one residue of SEQ ID NO: 134. In an embodiment, the epitope comprises at least two residues of SEQ ID NO: 134. In an embodiment, the epitope comprises at least three residues of SEQ ID NO: 134. In an embodiment, the epitope comprises at least four residues of SEQ ID NO: 134. In an embodiment, the epitope comprises at least five residues of SEQ ID NO: 134. In an embodiment, the epitope comprises six or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises seven or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises eight or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises nine or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises ten or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises eleven or more residues of SEQ ID NO: 134. In an embodiment, the epitope comprises twelve residues of SEQ ID NO: 134. In an embodiment, the epitope comprises a threonine residue at position 4 of SEQ ID NO: 134. In an embodiment, the epitope is determined by epitope binning. In an embodiment, the epitope is determined by TCE molecule binding to CCR8 peptide-nanobody complexes. In an embodiment, the epitope is determined by screening TCE molecule binding to CCR8 by phage display. In an embodiment, the epitope is determined by determining binding to a CCR8 peptide expressed in human cells, wherein the peptide comprises an amino acid sequence given by SEQ ID NO: 134 or amino acid residues 1-12 of SEQ ID NO: 133. In some embodiments, the epitope is determined by anti-CCR8 TCE molecule binding to the T4R mutation in cynomolgus monkey CCR8. In an embodiment, binding to the T4R mutation is determined in a cell based affinity assay, wherein TCE molecule binding to cells expressing cynomolgus monkey cells CCR8 containing a T4R mutation is compared to TCE molecule binding to cells expressing wild-type cynomolgus monkey CCR8 (comprising a threonine at position four). In some embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows reduced binding to CCR8 comprising a T4R mutation. In particular embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows no detectable binding to CCR8 comprising a T4R mutation. In some embodiments, wild-type cynomolgus monkey CCR8 comprises an amino acid sequence given by SEQ ID NO: 129. In some embodiments, cynomolgus monkey CCR8 comprising a T4R mutation comprises an amino acid sequence given by SEQ ID NO: 130.
In another embodiment, the present invention provides a CCR8 TCE molecule that binds human CCR8 at an epitope wherein the epitope consists of one residue of SEQ ID NO: 134. In an embodiment, the epitope consists of two residues of SEQ ID NO: 134. In an embodiment, the epitope consists of three residues of SEQ ID NO: 134. In an embodiment, the epitope consists of four residues of SEQ ID NO: 134. In an embodiment, the epitope consists of five residues of SEQ ID NO: 134. In an embodiment, the epitope consists of six residues of SEQ ID NO: 134. In an embodiment, the epitope consists of seven residues of SEQ ID NO: 134. In an embodiment, the epitope consists of eight residues of SEQ ID NO: 134. In an embodiment, the epitope consists of nine residues of SEQ ID NO: 134. In an embodiment, the epitope consists of ten residues of SEQ ID NO: 134. In an embodiment, the epitope consists of eleven residues of SEQ ID NO: 134. In an embodiment, the epitope consists of twelve residues of SEQ ID NO: 134. In an embodiment, the epitope consists of a threonine residue at position 4 of SEQ ID NO: 134.
The present invention provides a method of treating cancer in a patient comprising administering to the patient an effective amount of a CCR8 TCE molecule that binds human CCR8 at an epitope wherein the epitope consists of one residue of SEQ ID NO: 134. In an embodiment, the epitope consists of two residues of SEQ ID NO: 134. In an embodiment, the epitope consists of three residues of SEQ ID NO: 134. In an embodiment, the epitope consists of four residues of SEQ ID NO: 134. In an embodiment, the epitope consists of five residues of SEQ ID NO: 134. In an embodiment, the epitope consists of six residues of SEQ ID NO: 134. In an embodiment, the epitope consists of seven residues of SEQ ID NO: 134. In an embodiment, the epitope consists of eight residues of SEQ ID NO: 134. In an embodiment, the epitope consists of nine residues of SEQ ID NO: 134. In an embodiment, the epitope consists of ten residues of SEQ ID NO: 134. In an embodiment, the epitope consists of eleven residues of SEQ ID NO: 134. In an embodiment, the epitope consists of twelve residues of SEQ ID NO: 134. In an embodiment, the epitope consists of a threonine residue at position 4 of SEQ ID NO: 134.
In another embodiment, the present invention provides a CCR8 TCE molecule that binds human CCR8 at an epitope wherein the epitope comprises at least one residue of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises at least two residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises at least three residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises at least four residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises at least five residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises six or more residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises seven or more residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises eight or more residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises nine or more residues of amino acid residues 1-12 of SEQ ID NO: 133. In an embodiment, the epitope comprises ten or more residues amino acid residues 1-12 of SEQ ID NO: 133. In an embodiment, the epitope comprises eleven or more residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises twelve residues of amino acid residues 1-12 OF SEQ ID NO: 133. In a particular embodiment, the epitope comprises the threonine residue at position 4 of amino acid residues 1-12 OF SEQ ID NO: 133. The term “epitope” as used herein refers to sites of an antigen that are in contact with (e.g. binds) the molecule. The epitope may be determined by a method known to a person of ordinary skill, including flow cytometry of bound TCE molecule to peptides, hydrogen-deuterium exchange, alanine scanning, and/or x-ray crystallography. In an embodiment, the epitope is determined by epitope binning. In an embodiment, the epitope is determined by TCE molecule binding to CCR8 peptide-nanobody complexes. In an embodiment, the epitope is determined by screening TCE molecule binding to CCR8 by phage display. In an embodiment, the epitope is determined by determining binding to a CCR8 peptide expressed in human cells, wherein the peptide comprises an amino acid sequence given by SEQ ID NO: 134 or amino acid residues 1-12 of SEQ ID NO: 133. In some embodiments, the epitope is determined by anti-CCR8 TCE molecule binding to the T4R mutation in cynomolgus monkey CCR8. In an embodiment, binding to the T4R mutation is determined in a cell based affinity assay, wherein TCE molecule binding to cells expressing cynomolgus monkey cells CCR8 containing a T4R mutation is compared to TCE molecule binding to cells expressing wild-type cynomolgus monkey CCR8 (comprising a threonine at position four). In some embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows reduced binding to CCR8 comprising a T4R mutation. In particular embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows no detectable binding to CCR8 comprising a T4R mutation. In some embodiments, wild-type cynomolgus monkey CCR8 comprises an amino acid sequence given by SEQ ID NO: 129. In some embodiments, cynomolgus monkey CCR8 comprising a T4R mutation comprises an amino acid sequence given by SEQ ID NO: 130.
The present invention provides a method of treating cancer in a patient comprising administering to the patient an effective amount of a CCR8 TCE molecule that binds human CCR8 at an epitope wherein the epitope comprises at least one residue of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises at least two residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises at least three residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises at least four residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises at least five residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises six or more residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises seven or more residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises eight or more residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises nine or more residues of amino acid residues 1-12 of SEQ ID NO: 133. In an embodiment, the epitope comprises ten or more residues amino acid residues 1-12 of SEQ ID NO: 133. In an embodiment, the epitope comprises eleven or more residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises twelve residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope comprises a threonine residue at position 4 of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope is determined by epitope binning. In an embodiment, the epitope is determined by TCE molecule binding to CCR8 peptide-nanobody complexes. In an embodiment, the epitope is determined by screening TCE molecule binding to CCR8 by phage display. In an embodiment, the epitope is determined by determining binding to a CCR8 peptide expressed in human cells, wherein the peptide comprises an amino acid sequence given by SEQ ID NO: 134 or amino acid residues 1-12 of SEQ ID NO: 133. In some embodiments, the epitope is determined by anti-CCR8 TCE molecule binding to the T4R mutation in cynomolgus monkey CCR8. In an embodiment, binding to the T4R mutation is determined in a cell based affinity assay, wherein TCE molecule binding to cells expressing cynomolgus monkey cells CCR8 containing a T4R mutation is compared to TCE molecule binding to cells expressing wild-type cynomolgus monkey CCR8 (comprising a threonine at position four). In some embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows reduced binding to CCR8 comprising a T4R mutation. In particular embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows no detectable binding to CCR8 comprising a T4R mutation. In some embodiments, wild-type cynomolgus monkey CCR8 comprises an amino acid sequence given by SEQ ID NO: 129. In some embodiments, cynomolgus monkey CCR8 comprising a T4R mutation comprises an amino acid sequence given by SEQ ID NO: 130.
In another embodiment, the present invention provides a CCR8 TCE molecule that binds human CCR8 at an epitope wherein the epitope consists of at least one residue of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of two residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of three residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of four residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of five residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of six residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of seven residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of eight residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of nine residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of ten residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of eleven residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of twelve residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of a threonine residue at position 4 of amino acid residues 1-12 OF SEQ ID NO: 133.
The present invention provides a method of treating cancer in a patient comprising administering to the patient an effective amount of a CCR8 TCE molecule that binds human CCR8 at an epitope wherein the epitope consists of one residue of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of two residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of three residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of four residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of five residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of six residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of seven residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of eight residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of nine residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of ten residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of eleven residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of twelve residues of amino acid residues 1-12 OF SEQ ID NO: 133. In an embodiment, the epitope consists of a threonine residue at position 4 of amino acid residues 1-12 OF SEQ ID NO: 133.
In an embodiment, the epitope is determined by epitope binning. In an embodiment, the epitope is determined by TCE molecule binding to CCR8 peptide-nanobody complexes. In an embodiment, the epitope is determined by screening TCE molecule binding to CCR8 by phage display. In an embodiment, the epitope is determined by determining binding to a CCR8 peptide expressed in human cells, wherein the peptide comprises an amino acid sequence given by SEQ ID NO: 134 or amino acid residues 1-12 of SEQ ID NO: 133. In some embodiments, the epitope is determined by anti-CCR8 TCE molecule binding to the T4R mutation in cynomolgus monkey CCR8. In an embodiment, binding to the T4R mutation is determined in a cell based affinity assay, wherein TCE molecule binding to cells expressing cynomolgus monkey cells CCR8 containing a T4R mutation is compared to TCE molecule binding to cells expressing wild-type cynomolgus monkey CCR8 (comprising a threonine at position four). In some embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows reduced binding to CCR8 comprising a T4R mutation. In particular embodiments, an anti-CCR8 TCE molecule binds threonine at position four if it shows no detectable binding to CCR8 comprising a T4R mutation. In some embodiments, wild-type cynomolgus monkey CCR8 comprises an amino acid sequence given by SEQ ID NO: 129. In some embodiments, cynomolgus monkey CCR8 comprising a T4R mutation comprises an amino acid sequence given by SEQ ID NO: 130.
In some embodiments, the present invention provides a molecule that competes for binding CCR8 with a CCR8 TCE molecule of the present invention. Such molecule that competes for binding may be, for example, a TCE molecule, an antibody, antibody fragment, or polypeptide. In some embodiments, the present invention provides a molecule that binds the same epitope as a CCR8 TCE molecule of the present invention.
In some embodiments, a TCE molecule of the present invention can be administered concurrently with, before, or after a variety of drugs and treatments widely employed in cancer treatment such as, for example, chemotherapeutic agents, non-chemotherapeutic agents (e.g. anti-PD-1 or anti-PD-L1 inhibitors, such as antagonist antibodies), anti-neoplastic agents, and/or radiation. For example, administration can occur before, during, and/or after any of the treatments described herein. Examples of chemotherapeutic agents are discussed herein and include, but are not limited to, cisplatin, taxol, etoposide, mitoxantrone (Novantrone®), actinomycin D, cycloheximide, camptothecin (or water soluble derivatives thereof), methotrexate, mitomycin (e.g., mitomycin C), dacarbazine (DTIC), anti-neoplastic antibiotics such as adriamycin (doxorubicin) and daunomycin, and all the chemotherapeutic agents mentioned herein.
In some embodiments, a TCE molecule of the present invention may be administered concurrently with, before, or after a PD-1 antagonist antibody or a PD-L1 antagonist antibody. The term “PD-1 antagonist antibody” refers to an antibody that specifically binds to PD-1 and decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-1 and one or more of its ligands, such as PD-L1 and PD-L2. In some embodiments, a PD-1 antagonist antibody inhibits the binding of PD-1 to PD-L1 and/or PD-L2. The term “PD-L1 antagonist antibody” refers to an antibody that specifically binds to PD-L1 and decreases, blocks, inhibits, abrogates or interferes with signal transduction resulting from the interaction of PD-L1 with the PD-1 receptor. In some embodiments, a PD-L1 antagonist antibody inhibits the binding of PD-L1 to PD-1. In some embodiments, the PD-1 antagonist is any one of Antibody 20C1.006 (SEQ ID NOs: 179-188), Antibody 20C1.009 (SEQ ID NOS: 139-148, or 139-147 and 212), Antibody 20A2.3 (SEQ ID NOs: 149-158), Antibody 20D4.6 (SEQ ID NOs: 159-168), or Antibody 20D4.17 (SEQ ID NOs: 169-178). In one embodiment, the PD-1 antagonist antibody is pembrolizumab. In another embodiment, the PD-1 antagonist antibody is nivolumab. In yet another embodiment, the PD-1 antagonist antibody is cemiplimab. In a particular embodiment, the PD-1 antagonist antibody is antibody 20C1.009, for which the amino acid sequences of the CDRs, variable regions, and full light and heavy chains are provided in SEQ ID NOs: 139-148 and 212. 20C1.009 is also known as AMG 404 and is also known as zeluvalimab. In exemplary aspects, an anti-PD-1 antibody such as 20C1.009 comprises a HC comprising a C-terminal lysine, as in SEQ ID NO: 148. In alternative aspects, the antibody comprises a HC without the C-terminal lysine, as in SEQ ID NO: 212.
In some embodiments, the 1185-1200
The present disclosure provides single chain TCE molecules comprising an scFab that binds a target antigen and an scFv that binds CD3. The present disclosure also provides TCE molecules comprising an scFv that binds CCR8 and an scFv that binds CD3. Methods of treating cancer are also provided, as well as methods of making said TCE molecules.
A “single-chain variable fragment” (“scFv”) is a fusion protein in which a VL and a VH region are joined via a linker (e.g., a synthetic sequence of amino acid residues) to form a continuous protein chain wherein the linker is long enough to allow the protein chain to fold back on itself and form a monovalent antigen binding site (see, e.g., Bird et al., Science 242:423-26 (1988) and Huston et al., 1988, Proc. Natl. Acad. Sci. USA 85:5879-83 (1988)). When in the context of other additional moieties (e.g., an Fc region), the scFv can be arranged VH-linker-VL (anti-CD3 scFv), or VL-linker-VH, for example. An anti-target scFv is an scFv that binds an antigen, such as a tumor antigen. An anti-target scFv may bind CCR8. An anti-CD3 scFv binds CD3. Examples of anti-CD3 scFvs include I2E and I2C, given by amino acid sequences 199-206 and 191-198, respectively.
A “single-chain antigen-binding fragment” (“scFab”) is a fusion protein in which a VH and CHI are joined via a linker to a VL and Cκ or Cλ to form a continuous protein chain wherein the linker is long enough to allow the protein chain to fold back on itself and form a monovalent antigen binding site independent of the orientation. The linker may be, for example, a (G4S)6, (G4S)7, or (G4S)8 linker. A G4S linker is a linker made of amino acids GGGGS (SEQ ID NO: 189), from N-terminus to C-terminus, and may be repeated multiple times. A (G4S)4 linker, for example, means a linker comprising the following amino acids, from N-terminus to C-terminus: GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 190). Alternatively, the linker may be, for example, a (G4Q)6, (G4Q)7, or (G4Q)8 linker. A G4Q linker is a linker made of amino acids GGGGQ (SEQ ID NO: 207), from N-terminus to C-terminus, and may be repeated multiple times. A (G4Q)4 linker, for example, means a linker comprising the following amino acids, from N-terminus to C-terminus: GGGGQGGGGQGGGGQGGGGQ (SEQ ID NO: 208). The CCR8 TCEs of the present invention comprise G4Q linkers.
The scFab, scFv, and/or scFc may also have a cysteine clamp. A “cysteine clamp” involves the introduction of a cysteine into a polypeptide domain at a specific location, typically through replacing an existing amino acid at the specific location, so that when in proximity with another polypeptide domain, also having a cysteine introduced at a specific location, a disulfide bond (a “cysteine clamp”) may be formed between the two domains. In certain embodiments, an scFc comprises at least one cysteine clamp that results in a disulfide bond across both CH2 domains. In a further specific embodiment, an scFc comprises at least two cysteine clamps that results in a disulfide bond across both CH2 domains. In other embodiments, a binding construct's VH and VL domains may comprise the cysteine clamp(s) to result in disulfide bond formation between the VH and VL domains. These cysteine clamps will stabilize the VH and VL domains in an antigen-binding configuration.
A cysteine clamp may be naturally occurring, or it may be a result of a molecule engineered to contain cysteines. For example, a scFab may have a natural cysteine clamp between the heavy and light chain constant domains. An scFab may also have a natural cysteine clamp between the heavy and light chain constant domains and an engineered cysteine clamp between cysteines at residue 44 of the heavy chain variable region and residue 100 of the light chain variable region. In addition, an anti-target scFv may also contain a cysteine clamp between cysteines at residue 44 of the heavy chain variable region and residue 100 of the light chain variable region, whereas an anti-CD3 scFv does not contain an engineered cysteine clamp. An scFc may contain hinge cysteine clamps, natural CH2/CH3 cysteine clamps, and/or an engineered CH2 cysteine clamp (intrachain).
The VH and VL contain CDRs, which are interspersed with regions that are more conserved, termed framework regions (“FR”). Each variable region is composed of 3 CDRs and 4 FRs, arranged from amino-terminus to carboxy-terminus in the following order: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. The 3 CDRs of the VL are referred to as “LCDR1, LCDR2, and LCDR3,” and the 3 CDRs of the VH are referred to as “HCDR1, HCDR2, and HCDR3.” The CDRs contain most of the residues which form specific interactions with the antigen. That is, the CDRs contain most of the residues that are in contact with the antigen's residues. Assignment of amino acids to CDR domains within the VL and HL regions of the TCE molecules of the present invention is based on the well-known Kabat numbering convention (Kabat, et al., Ann. NY Acad. Sci. 190:382-93 (1971); Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, U.S. Department of Health and Human Services, NIH Publication No. 91-3242 (1991)). It is understand that other numbering conventions may also be used, such as Chothia (Chothia et al., “Canonical structures for the hypervariable regions of immunoglobulins”, Journal of Molecular Biology, 196, 901-917 (1987); Al-Lazikani et al., “Standard conformations for the canonical structures of immunoglobulins”, Journal of Molecular Biology, 273, 927-948 (1997)), and/or North (North et al., “A New Clustering of Antibody CDR Loop Conformations”, Journal of Molecular Biology, 406, 228-256 (2011)).
In the most general sense, a T cell engager (“TCE”) molecule as described herein comprises a single chain polypeptide that can bind to two different antigens. A “TCE molecule” may be used interchangeably with a “BiTE molecule”. A BiTE molecule can comprise an scFv or scFab, as long as it is bispecific, meaning that it binds two targets (target antigen and CD3) at the same time. A TCE molecule is an antigen-binding molecule. A TCE molecule of the present invention may comprise an scFab that binds a target (e.g. tumor or target antigen) and an scFv that binds CD3. Such molecule may have the orientation, from N-terminus to C-terminus: scFab (VH, CH1, linker, VL, either Cκ or Cλ), linker, scFv (VH, linker, VL). Such molecules may alternatively have the orientation, from N-terminus to C-terminus: scFab (VL, either Cκ or Cλ, linker, VH, CH1), linker, scFv (VH, linker, VL). In some embodiments, the scFab binds CCR8. In particular embodiments, the TCE molecule comprises a Cκ.
A TCE molecule of the present invention may also be comprised of an scFv that binds CCR8 and an scFv that binds CD3. Such TCE molecule may have the following orientation, from N-terminus to C-terminus: scFv that binds CCR8 (VH, linker, VL), linker, scFv that binds CD3 (VH, linker, VL).
A TCE molecule of the present invention may also have a half-life extending (HLE) moiety. An HLE moiety may extend the in vivo half-life of the TCE molecules of the present invention. Nonlimiting examples of half-life extending moieties include an Fc polypeptide, a single-chain Fc polypeptide (scFc), albumin, an albumin fragment, a moiety that binds to albumin or to the neonatal Fc receptor (FcRn), a derivative of fibronectin that has been engineered to bind albumin or a fragment thereof, a peptide, a single domain protein fragment, or other polypeptide that can increase serum half-life. In other embodiments, a half-life-extending moiety can be a non-polypeptide molecule such as, for example, polyethylene glycol (PEG). In some embodiments, the HLE is a single-chain Fc (“scFc”).
A scFc is a fusion protein in which a CH2 and CH3 (Fc1) are joined via a linker to another CH2 and CH3 (Fc2) to form a continuous protein chain wherein the linker is long enough to allow the protein chain to fold back on itself. In some embodiments, the scFc comprises cysteine clamps. An scFc may also comprise an Ig-Fc hinge region, or part of an Ig-Fc hinge region. The hinge is amino terminal to the CH2 domain, and the scFc may have the following orientation: (Fc1: hinge, CH2, CH3), linker, (Fc2: hinge, CH2, CH3). It is envisaged that the hinge region promotes dimerization. Such Fc polypeptide molecules can be obtained by papain digestion of an immunoglobulin region (resulting in a dimer of two Fc polypeptide), for example and not limitation. In an embodiment, the polypeptide sequence of an Fc monomer is substantially similar to an Fc polypeptide sequence of: an IgG1 Fc region, an IgG2 Fc region, an IgG3 Fc region, an IgG4 Fc region, an IgM Fc region, an IgA Fc region, an IgD Fc region and an IgE Fc region. (See, e.g., Padlan, Molecular Immunology, 31 (3), 169-217 (1993)).
A TCE molecule of the present invention having an HLE moiety (e.g. scFc) may have the following orientation: scFab (VH, CH1, linker, VL, Ck), linker, scFv (VH, linker, VL), linker, scFc (hinge, CH2, CH3, linker, hinge, CH2, CH3). A TCE molecule of the present invention having an HLE moiety may also be in the following orientation: scFab (VL, either Cκ or Cλ, linker, VH, CH1), linker, scFv (VH, linker, VL). A TCE molecule of the present invention having an HLE moiety may also be in the following orientation: scFv that binds CCR8 (VH, linker, VL), linker, scFv that binds CD3 (VH, linker, VL), scFc (hinge, CH2, CH3, linker, hinge, CH2, CH3). An scFc may also be referred to as Fc1 (hinge, CH2, CH3), linker, Fc2 (hinge, CH2, CH3, herein.
It will be appreciated that a TCE molecule of the present invention may have at least one amino acid substitution, providing that the TCE molecule retains the same or better desired binding specificity (e.g., binding to CCR8 and/or CD3). Therefore, modifications to the TCE molecule structures are encompassed within the scope of the invention. Such modifications may include amino acid substitutions, which may be conservative or non-conservative that do not destroy the desired binding capability of a binding construct. Conservative amino acid substitutions may encompass non-naturally occurring amino acid residues, which are typically incorporated by chemical peptide synthesis rather than by synthesis in biological systems. These include peptidomimetics and other reversed or inverted forms of amino acid moieties. A conservative amino acid substitution may also involve a substitution of a native amino acid residue with a normative residue such that there is little or no effect on the polarity or charge of the amino acid residue at that position.
A TCE molecule of the present invention may comprise a fragment of an amino acid sequence described herein.
A TCE molecule of the present invention can bind a target antigen (e.g. antigen expressed on a tumor cell) and CD3 expressed on T cells. A target antigen can be a human protein or a protein from another species, such as mouse, rat, rabbit, and/or cynomolgus monkey. A target antigen may be any protein expressed on tumor cells, in the case for treating cancer. Nonlimiting examples of target antigens include CCR8, claudin-6, and MAGE-B2.
In another embodiment, the present invention provides vectors comprising a nucleic acid encoding a polypeptide of the invention or a portion thereof. Examples of vectors include, but are not limited to, plasmids, viral vectors, non-episomal mammalian vectors and expression vectors, for example, recombinant expression vectors.
The recombinant expression vectors of the invention can comprise a nucleic acid of the invention in a form suitable for expression of the nucleic acid in a host cell. The recombinant expression vectors include one or more regulatory sequences, selected on the basis of the host cells to be used for expression, which is operably linked to the nucleic acid sequence to be expressed. Regulatory sequences include those that direct constitutive expression of a nucleotide sequence in many types of host cells (e.g., SV40 early gene enhancer, Rous sarcoma virus promoter and cytomegalovirus promoter), those that direct expression of the nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences, see Voss et al., 1986, Trends Biochem. Sci. 11:287, Maniatis et al., 1987, Science 236:1237, incorporated by reference herein in their entireties), and those that direct inducible expression of a nucleotide sequence in response to particular treatment or condition (e.g., the metallothionin promoter in mammalian cells and the tet-responsive and/or streptomycin responsive promoter in both prokaryotic and eukaryotic systems. It will be appreciated by those skilled in the art that the design of the expression vector can depend on such factors as the choice of the host cell to be transformed, the level of expression of protein desired, etc. The expression vectors of the invention can be introduced into host cells to thereby produce proteins or peptides, including fusion proteins or peptides, encoded by nucleic acids as described herein.
In another embodiment, the present invention provides host cells into which a recombinant expression vector of the invention has been introduced. A host cell can be any prokaryotic cell or eukaryotic cell. Prokaryotic host cells include gram negative or gram positive organisms, for example E. coli or bacilli. Higher eukaryotic cells include insect cells, yeast cells, and established cell lines of mammalian origin. Examples of suitable mammalian host cell lines include Chinese hamster ovary (CHO) cells or their derivatives such as Veggie CHO and related cell lines which grow in serum-free media (see Rasmussen et al., 1998, Cytotechnology 28:31) or CHO strain DXB-11, which is deficient in DHFR (see Urlaub et al., 1980, Proc. Natl. Acad. Sci. USA 77:4216-20). Additional CHO cell lines include CHO-K1 (ATCC #CCL-61), EM9 (ATCC #CRL-1861), and UV20 (ATCC #CRL-1862). Additional host cells include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (see Gluzman et al., 1981, Cell 23:175), L cells, C127 cells, 3T3 cells (ATCC CCL 163), AM-1/D cells (described in U.S. Pat. No. 6,210,924), HeLa cells, BHK (ATCC CRL 10) cell lines, the CV1/EBNA cell line derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) (see McMahan et al., 1991, EMBO J. 10:2821), human embryonic kidney cells such as 293, 293 EBNA or MSR 293, human epidermal A431 cells, human Colo205 cells, other transformed primate cell lines, normal diploid cells, cell strains derived from in vitro culture of primary tissue, primary explants, HL-60, U937, HaK or Jurkat cells. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described by Pouwels et al. (Cloning Vectors: A Laboratory Manual, Elsevier, New York, 1985).
Typically, expression vectors used in any of the host cells will contain sequences for plasmid maintenance and for cloning and expression of exogenous nucleotide sequences. Such sequences, collectively referred to as “flanking sequences” in certain embodiments will typically include one or more of the following nucleotide sequences: a promoter, one or more enhancer sequences, an origin of replication, a transcriptional termination sequence, a complete intron sequence containing a donor and acceptor splice site, a sequence encoding a leader sequence for polypeptide secretion, a ribosome binding site, a polyadenylation sequence, a polylinker region for inserting the nucleic acid encoding the polypeptide to be expressed, and a selectable marker element. The leader sequence may comprise an amino acid sequence given by SEQ ID NO: 213 (MDMRVPAQLL GLLLLWLRGA RC) which is encoded by SEQ ID NO: 214 (atggacatga gagtgcctgc acagctgctg ggcctgctgc tgctgtggct gagaggegcc agatgc). The leader sequence may comprise an amino acid sequence given by SEQ ID NO: 215 (MAWALLLLTL LTQGTGSWA) which is encoded by SEQ ID NO: 216 (atggcctggg ctctgctgct cctcaccctc ctcactcagg gcacagggtc ctgggcc). The leader polynucleotide sequence may comprise a polynucleotide sequence given by SEQ ID NO: 594 (ATGGACATGAGAGTGCCTGCACAGCTGCTGGGCCTGCTGCTGCTGTGGCTGAGA GGCGCCAGATG)
Vector DNA can be introduced into prokaryotic or eukaryotic cells via conventional transformation or transfection techniques. For stable transfection of mammalian cells, it is known that, depending upon the expression vector and transfection technique used, only a small fraction of cells may integrate the foreign DNA into their genome. In order to identify and select these integrants, a gene that encodes a selectable marker (e.g., for resistance to antibiotics) is generally introduced into the host cells along with the gene of interest. Additional selectable markers include those which confer resistance to drugs, such as G418, hygromycin and methotrexate. Cells stably transfected with the introduced nucleic acid can be identified by drug selection (e.g., cells that have incorporated the selectable marker gene will survive, while the other cells die), among other methods.
A polynucleotide encoding an amino acid sequence of a TCE molecule of the present invention can be any length as appropriate for the desired use or function, and can comprise one or more additional sequences, for example, regulatory sequences, and/or be part of a larger nucleic acid, for example, a vector. The skilled artisan will appreciate that, due to the degeneracy of the genetic code, each of the polypeptide sequences disclosed herein is encoded by a large number of other nucleic acid sequences. Mutations can also be introduced into a nucleic acid without significantly altering the biological activity of a polypeptide that it encodes. For example, one can make nucleotide substitutions leading to amino acid substitutions at non-essential amino acid residues.
Transformed cells can be cultured under conditions that promote expression of the polypeptide, and the polypeptide recovered by conventional protein purification procedures. Polypeptides contemplated for use herein include substantially homogeneous recombinant mammalian polypeptides substantially free of contaminating endogenous materials. Cells containing the nucleic acid encoding the TCE molecules of the present invention also include hybridomas.
In some embodiments, a vector comprising a nucleic acid molecule as described herein is provided. In some embodiments, the invention comprises a host cell comprising a nucleic acid molecule as described herein. In some embodiments, a nucleic acid molecule encoding a TCE molecule as described herein is provided. In some embodiments, a pharmaceutical composition comprising at least one TCE molecule described herein is provided.
Glutaminyl and asparaginyl residues are frequently deamidated to the corresponding glutamyl and aspartyl residues, respectively. Alternatively, these residues are deamidated under mildly acidic conditions. Either form of these residues falls within the scope of this invention.
Other modifications include hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl or threonyl residues, methylation of the α-amino groups of lysine, arginine, and histidine side chains (T. E. Creighton, Proteins: Structure and Molecular Properties, W. H. Freeman & Co., San Francisco, 1983, pp. 79-86), acetylation of the N-terminal amine, and amidation of any C-terminal carboxyl group.
Another type of covalent modification of the TCE molecules included within the scope of this invention comprises altering the glycosylation pattern of the protein. As is known in the art, glycosylation patterns can depend on both the sequence of the protein (e.g., the presence or absence of particular glycosylation amino acid residues, discussed below), or the host cell or organism in which the protein is produced. Particular expression systems are discussed below.
Glycosylation of polypeptides is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tri-peptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. Thus, the presence of either of these tri-peptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-acetylgalactosamine, galactose, or xylose, to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
The TCR-CD3 complex is a heteromultimer comprising a heterodimer comprising TCRα and TCRβ or TCRγ and TCRδ plus various CD3 chains from among the CD3 zeta (CD35) chain, CD3 epsilon (CD3ϵ) chain, CD3 gamma (CD3γ) chain, and CD3 delta (CD3δ) chain.
The CD3 receptor complex is a protein complex and is composed of four chains. In mammals, the complex contains a CD3γ (gamma) chain, a CD38 (delta) chain, and two CD3ε (epsilon) chains. These chains associate with the T cell receptor (TCR) and the so-called ((zeta) chain to form the T cell receptor CD3 complex and to generate an activation signal in T lymphocytes. The CD3γ (gamma), CD3δ (delta), and CD3ε (epsilon) chains are highly related cell-surface proteins of the immunoglobulin superfamily containing a single extracellular immunoglobulin domain. The intracellular tails of the CD3 molecules contain a single conserved motif known as an immunoreceptor tyrosine-based activation motif or ITAM for short, which is essential for the signaling capacity of the TCR. The CD3 epsilon molecule is a polypeptide which in humans is encoded by the CD3E gene which resides on chromosome 11. The most preferred epitope of CD3 epsilon is comprised within amino acid residues 1-27 of the human CD3 epsilon extracellular domain. It is envisaged that the TCE molecules according to the present invention typically and advantageously show less unspecific T cell activation, which is not desired in specific immunotherapy. This translates to a reduced risk of side effects.
In some embodiments the effector cell protein can be the human CD3 epsilon (CD3ϵ) chain, which can be part of a multimeric protein. Alternatively, the effector cell protein can be human and/or cynomolgus monkey TCRα, TCRβ, TCRδ, TCRγ, CD3 beta (CD3B) chain, CD3 gamma (CD3γ) chain, CD3 delta (CD38) chain, or CD3 zeta (CD35) chain.
Moreover, in some embodiments, a TCE molecule can also bind to a CD3ϵ chain from a non-human species, such as mouse, rat, rabbit, new world monkey, and/or old world monkey species. Such species include, without limitation, the following mammalian species: Mus musculus; Rattus; Rattus norvegicus; the cynomolgus monkey, Macaca fascicularis; the hamadryas baboon, Papio hamadryas; the Guinea baboon, Papio; the olive baboon, Papio anubis; the yellow baboon, Papio cynocephalus; the Chacma baboon, Papio ursinus; Callithrix jacchus; Saguinus oedipus; and Saimiri sciureus. Having a therapeutic molecule that has comparable activity in humans and species commonly used for preclinical testing, such as mice and monkeys, can simplify, accelerate, and ultimately provide improved outcomes in drug development. In the long and expensive process of bringing a drug to market, such advantages can be critical.
As used interchangeably herein, “treatment” and/or “treating” and/or “treat” are intended to refer to all processes wherein there may be a slowing, interrupting, arresting, controlling, stopping, or reversing of the progression of the disorders described herein, but does not necessarily indicate a total elimination of all disorder symptoms. Treatment includes administration of a TCE molecule of the present invention for treatment of a disease or condition in a human that would benefit from activity of a TCE molecule of the present invention and includes: (a) inhibiting further progression of the disease; and (b) relieving the disease, i.e., causing regression of the disease or disorder or alleviating symptoms or complications thereof.
Suitable PD-L1 antagonist antibodies for use in combination with a TCE molecule of the present invention include, but are not limited to, atezolizumab, avelumab, or durvalumab. Examples of PD-1 antagonist antibodies suitable for use in the methods of the invention include, but are not limited to pembrolizumab, nivolumab, cemiplimab, pidilizumab, spartalizumab, camrelizumab, sintilimab, tislelizumab, toripalimab, dostarlimab, Antibody 20C1.006 (SEQ ID NOs: 72-81), Antibody 20C1.009 (SEQ ID NOs: 32-41 or SEQ ID NOs: 32-40 and SEQ ID NO: 212), Antibody 20A2.003 (SEQ ID NOs: 42-51), Antibody 20D4.006 (SEQ ID NOs: 52-61), or Antibody 20D4.17 (SEQ ID NOs: 62-71), and any of the PD-1 antagonist antibodies described in WO 2019/140196.
Therapeutically effective doses of a TCE molecule can be administered. The amount of TCE molecule that constitutes a therapeutically dose may vary with the indication treated, the weight of the patient, the calculated skin surface area of the patient. Dosing of a TCE molecule can be adjusted to achieve the desired effects. In many cases, repeated dosing may be required. Dosages and the frequency of administration may vary according to such factors as the route of administration, the particular TCE molecule employed, the nature and severity of the disease to be treated, whether the condition is acute or chronic, and the size and general condition of the subject.
As used herein, an “effective amount” means the amount of a TCE molecule of the present invention or pharmaceutical composition comprising such TCE molecule that will elicit the biological or medical response of or desired therapeutic effect on a tissue, system, animal, mammal, or human that is being sought by the researcher, medical doctor, or other clinician. An effective amount of the TCE molecule may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the TCE molecule to elicit a desired response in the individual. An effective amount is also one in which any toxic or detrimental effect of the TCE molecule is outweighed by the therapeutically beneficial effects. Such benefit includes improving signs or symptoms of cancer. An effective amount can be readily determined by one skilled in the art, by the use of known techniques, and by observing results obtained under analogous circumstances. An effective amount of a TCE molecule of the present invention may be administered in a single dose or in multiple doses. In determining the effective amount for a patient, a number of factors are considered by the attending medical practitioner, including, but not limited to: the patient's size (e.g., weight or mass), body surface area, age, and general health; the specific disease or disorder involved; the degree of, or involvement, or the severity of the disease or disorder; the response of the individual patient; the particular compound administered; the mode of administration; the bioavailability characteristics of the preparation administered; the dose regimen selected; the use of concomitant medication; and other relevant circumstances known to medical practitioners.
A TCE molecule, or a pharmaceutical composition containing such a molecule, can be administered by any feasible method. Protein therapeutics will ordinarily be administered by a parenteral route, for example by injection, since oral administration, in the absence of some special formulation or circumstance, would lead to hydrolysis of the protein in the acid environment of the stomach. Subcutaneous, intramuscular, intravenous, intraarterial, intralesional, or peritoneal bolus injection are possible routes of administration. A TCE molecule can also be administered via infusion, for example intravenous or subcutaneous infusion.
TCE molecules can be administered in the form of a composition comprising one or more additional components such as a physiologically acceptable carrier, excipient or diluent. Optionally, the composition additionally comprises one or more physiologically active agents. In various particular embodiments, the composition comprises one, two, three, four, five, or six physiologically active agents in addition to one or more TCE molecules.
Claudin-6 T cell engager (“TCE”) molecules are examined for affinities to human Claudin-6. TCE molecules are represented below in Table 1 by unique identifiers. For example, the TCE molecule “CL6 3C1 HL CC×12C×scFc” refers to a TCE molecule having, from N-terminus to C-terminus, an scFv with an engineered cysteine clamp (“CC”; clamp between VH44 and VL 100 (Kabat numbering)) that binds Claudin-6 (“CL6”) and has the VH N-terminal to the VL, an I2C scFv that targets CD3 (VH N-terminal to the VL), and an scFc. The TCE molecule “CL6 3C1 HL scFab×I2C×scFc” refers to a TCE molecule having an scFab that binds Claudin-6 having the VH N-terminal to the VL, an I2C scFv that targets CD3 (VH N-terminal to the VL), and an scFc. An “x” represents a linker. The CDR sequences for both CL6 3C1 molecules are identical.
Cell-based affinity of TCE molecules is determined by nonlinear regression (one site-specific binding) analysis. CHO cells transfected with human Claudin-6 were incubated with decreasing concentrations of TCE molecules (up to 50 nM, step 1:1, 10 steps) for 16 h at 4° C. Bound TCE molecules are detected with Alexa Fluor 488-conjugated AffiniPure Fab Fragment Goat Anti-Human IgG (H+L). Fixed cells are detected with FACS flow and signals are detected by fluorescence cytometry. Respective equilibrium dissociation constant (Kd) values are calculated with the one site specific binding evaluation tool of the GraphPad Prism software. Mean Kd values and standard deviation are calculated with Microsoft Excel. Mean Kd values are calculated from three independent experiments.
According to procedures essentially as described above, the following affinities were obtained.
As shown in Table 1, these data demonstrate that TCE molecules having an scFab target binder show higher affinity for human Claudin-6 compared to TCE molecules having an scFv target binder.
Similarly, cell-based affinity of MAGE-B2 TCE molecules is determined by nonlinear regression (one site-specific binding) analysis. HLA-A*02:01 expressing T2 cells exogenously loaded with human MAGE-B2 peptide are incubated with decreasing concentrations of TCE molecules (up to 400 nM, 1:2 dilutions, 11 steps) for 16 hours at 4° C. Bound TCE molecules are detected with Alexa Fluor 488-conjugated AffiniPure Fab Fragment Goat Anti-Human IgG (H+L). Fixed cells are stained with DRAQ5, Far-Red Fluorescent Live-Cell Permeant DNA Dye, and signals are detected by fluorescence cytometry. Respective equilibrium dissociation constant (Kd) values are calculated with the one site specific binding evaluation tool of the GraphPad Prism software. Mean Kd values and standard deviations are calculated with Microsoft Excel. Mean Kd values are calculated from three independent experiments.
Following procedures essentially as described above, the following data were obtained.
As shown in Table 2, these data demonstrate that TCE molecules having an scFab target binder show higher affinity for human MAGE-B2 compared to TCE molecules having an scFv target binder.
Human peripheral blood mononuclear cells (PBMC) are prepared by Ficoll density gradient centrifugation from enriched lymphocyte preparations (buffy coats), a side product of blood banks collecting blood for transfusions. Buffy coats are supplied by a local blood bank and PBMC are prepared on the day after blood collection. After Ficoll density centrifugation and extensive washes with Dulbecco's PBS (Gibco), remaining erythrocytes are removed from PBMC via incubation with erythrocyte lysis buffer (155 mM NH4Cl, 10 mM KHCO3, 100 μM EDTA). Remaining lymphocytes mainly encompass B and T lymphocytes, NK cells, and monocytes. PBMC are kept in culture at 37° C./5% CO2 in RPMI medium (Gibco) with 10% FCS (Gibco).
Human T cells are isolated from PBMC using human Pan T cell isolation kit (Miltenyi Biotec, #130-096-535) according to the manufacturer's protocol. T cells are isolated using LS Columns (Milteny Biotec, #130-042-401). T cells are cultured in RPMI complete medium (RPMI1640; Biochrom AG, #FG1215) supplemented with 10% FBS (Bio West, #S1810), 1× non-essential amino acids (Biochrom AG, #K0293), 10 mM Hepes buffer (Biochrom AG, #L1613), 1 mM sodium pyruvate (Biochrom AG, #L0473) and 100 U/mL penicillin/streptomycin (Biochrom AG, #A2213) at 37° C.
For the analysis of cell lysis in flow cytometry assays, the fluorescent membrane dye DiOC18 (DiO) (Thermo Fisher, #V22886) is used to label target antigen positive cells (Claudin-6 stable transfected CHO cells or DAN-G stable transfected MAGE-B2 cells) as target cells and distinguish them from effector cells. Briefly, cells are harvested, washed once with PBS and adjusted to 10e6 cells/mL in PBS containing 2% (v/v) FBS and the membrane dye DiO (5 μL/10e6 cells). After incubation for 3 minutes at 37° C., cells are washed twice in complete RPMI medium and the cell number is adjusted to 1.25×10e5 cells/mL. The vitality of cells is determined using Nucleocounter NC-250 (Chemometec) and Solution18 Dye containing Acridine Orange and DAPI (Chemometec).
To quantify the lysis of target antigen positive cell lines in the presence of serial dilutions of TCE molecules, equal volumes of DiO-labeled target cells and effector cells (i.e., PBMC w/o CD14+ cells) are mixed, resulting in an E:T cell ratio of 10:1. 160 μl of this suspension is transferred to each well of a 96-well plate. Forty μL of serial dilutions of the corresponding TCE molecule, a negative control, or RPMI complete medium as an additional negative control are added. The TCE molecule-mediated cytotoxic reaction proceeds for 48 hours in a 7% CO2 humidified incubator. Cells are transferred to a new 96-well plate and loss of target cell membrane integrity is monitored by adding propidium iodide (PI) at a final concentration of 1 μg/mL. PI is a membrane impermeable dye that normally is excluded from viable cells, whereas dead cells take it up and become identifiable by fluorescent emission.
Samples are measured by flow cytometry on an iQue Plus (Intellicyt, now Sartorius) instrument and analyzed by Forecyt software (Intellicyt). Target cells are identified as DiO-positive cells. PI-negative target cells are classified as living target cells. Percentage of cytotoxicity is calculated as dead target cells/target cells×100. Using GraphPad Prism 7.04 software (Graph Pad Software, San Diego), the percentage of cytotoxicity is plotted against the corresponding TCE molecule concentrations. Dose response curves are analyzed with the four parametric logistic regression models for evaluation of sigmoid dose response curves with fixed hill slope and EC50 values are calculated.
Following procedures essentially as described above, the following data were obtained.
These data demonstrate that the Claudin-6 TCE molecules having an scFab target binder demonstrated improved potency of Claudin-6 transfected CHO cells compared to TCE molecules having an scFv target binder.
Data demonstrating MAGE-B2 TCE molecule cytotoxicity is shown in Table 4.
These data demonstrate that the MAGE-B2 TCE molecules having an scFab target binder demonstrated increased lysis of DAN-G cells compared to TCE molecules having an scFv target binder.
In a similar experiment, a scFab-containing TCE molecule having a disulfide-bridge (cysteine clamp (“CC”); cysteines at Kabat residues VH44/VL100; CL6 3C1-02scFabCC×I2C×scFc) is tested for cytotoxic activity. These data (shown in Table 5) demonstrate that the scFab-containing TCE molecule having a disulfide bridge showed similar activity compared to the scFab-containing TCE molecule without this disulfide bridge. Both scFab-containing TCE molecules demonstrated increased cytotoxicity compared to TCE molecules having an scFv target binder.
Data from TCE molecules binding a target antigen and CD3 is shown below in Table 6. The TCE molecules either contained a (G4S)8 linker in a scFab (VH-CHI-(G4S)8 linker-VL-Ck)-linker-aCd3scFv (VH-linker-VL)-linker-scFc (Fc-linker-Fc) orientation (top row), a (G4S)6 linker (second row), a disulfide-bridge stabilized (Kabat VH44/VL100) scFv target binding moiety (third row), or a (G4S)8 linker in a scFab (VH-CHI-linker-VL-Ck)-linker-aCd3scFv (VH-linker-VL)-linker-scFc (Fc-linker-Fc) orientation (bottom row).
These data demonstrate that the scFab-containing TCE molecule having an scFab (G4S)8 linker showed the highest cytotoxic activity compared to the other molecules tested. The scFab-containing TCE molecule with the VL-Ck-linker-VH-CH1-aCD3-scFc orientation demonstrated the least activity, which could be due to the orientation difference as compared to scFab-containing TCE molecule having the orientation VH-CH1-VL-Ck-aCD3-scFc.
Multitargeting TCE molecules are tested for cytotoxicity. As shown in the structures in
As shown in Table 7, TCE molecules having scFabs as both target binders (first row) have improved potency against single positive target cells (CD20 transfected CHO) and on double-positive Raji cells compared to TCE molecules having scFvs as both target binders (second row). In addition, TCE molecules having a CD20-binding scFab (third row) demonstrate improved potency for CD20 transfected CHO cells and double-positive Raji cells compared to TCE molecules having a CD20-binding scFv (fourth row).
To measure protein surface hydrophobicity, isolated and formulated TCE molecule monomer adjusted to a defined protein concentration is transferred into autosampler fitting sample vials and measured on a FPLC system. A Hydrophobic Interaction Chromatography (HIC) column is equilibrated with formulation buffer and a defined volume of protein solution applied at a constant formulation buffer flow. Detection is done by OD280 nm optical absorption.
Elution behavior is determined by peak shape respectively mathematically calculation of declining signal peak slope. Steeper slope/higher slope values indicate less hydrophobic interaction of the protein surface compared to constructs with more flat elution behavior and lower slope value.
Following procedures essentially as described above, the following data were obtained. “I2C” refers to an scFv that binds CD3. “CC” refers to an scFv containing an engineered cysteine clamp between a cysteine at position 44 (VH) and a cysteine at position 100 (VL) (Kabat).
These data demonstrate the degree of interaction of the applied construct with the hydrophobic column matrix surface. In most cases, peak slopes for the scFab comprising TCE molecules are steeper and have higher mathematically values compared to the other tested TCE molecules. Constructs having a higher surface hydrophobicity will have a stronger interaction with the matrix compared to constructs with less surface hydrophobicity and will therefore elute over a bigger elution volume with less curve steepness.
Rising temperatures may destabilize protein constructs, which will expose structures originally buried by protein folding. These structures can be sticky and can get in contact with other constructs resulting in aggregation and therefore a larger hydrodynamic radius. Molecules having higher aggregations temperature are more stable compared to molecules having lower aggregation temperatures.
To determine aggregation temperature of scFab-containing TCE molecules, isolated and formulated TCE molecule monomer adjusted to a defined protein concentration is pipetted in duplicates into a 96-well plate and covered with paraffin oil. The 96-well plate is transferred to a dynamic light scattering DLS reader capable of heating the plate at a defined rate in a defined temperature range. Measurement is performed from 40° C. to 70° C. at a defined rate of temperature increase. Detection is done by dynamic light scattering determining the hydrodynamic radius of the constructs over the temperature ramp. Temperature at the beginning of increase of hydrodynamic radius is defined as aggregation temperature. “I2C” refers to an scFv that binds CD3. “CC” refers to an scFv containing an engineered cysteine clamp (cysteine clamp between a cysteine at position 44 (VH) and a cysteine at position 100 (VL) (Kabat)) that binds a target (i.e. MAGE-B2 in Table 11).
These data demonstrate that scFab TCE molecules show higher mean aggregation temperatures compared to the other tested TCE molecules (having an scFv target binder) and are therefore more stable than TCE molecules with an scFv target binder.
Effects of biochemical competition with CCR8 ligand CCLI on CCR8-binding properties of CCR8-binding TCE molecules and scFab-containing CCR8-binding TCE molecules are assessed by flow cytometry, based on an engineered variant of the human T lymphocyte cell line HuT 78 expressing native CCR8 but not expressing human CD3 epsilon chain. The cell line bore a defined knockout in the CD3E gene.
Fifty thousand cells are incubated with 200 nM recombinant human CCL1 (Abcam, cat. no. ab9854) (diluted in PBS/2% FCS) or with PBS/2% FCS in 50 μl for 55 min at 4° C. Purified CCR8-binding TCE and scFab-containing CCR8-binding TCE molecules, diluted in PBS/2% FCS, are added to a final concentration of 100 nM in a total volume of 100 μl, followed by incubation at 4° C. for 45 minutes. For a negative control, PBS/2% FCS is added instead of purified CCR8-binding TCE or scFab-containing CCR8-binding TCE molecules. After three washes, bound molecules are detected for 45 minutes at 4° C. with R-Phycoerythrin-conjugated, anti-human IgG, Fc gamma fragment-specific antibody (Jackson, cat. no. 109-116-098), diluted 1:50 in PBS/2% FCS. After three washes, samples are measured on a FACSCanto II instrument (Becton Dickinson). All conditions are performed in three replicates.
Data are analyzed by FlowJo software (FlowJo/Becton Dickinson), generating median values for PE signals (median PE). From the three replicates per condition, average median PE values (with standard deviations) as well as ratios of average median PE in CCL1-treated setting over average median PE in CCL1-untreated setting were calculated using Excel software (Microsoft).
According to procedures essentially as described above, the following data were obtained.
Table 14 shows averages (with standard deviations) of median values of PE-signals, and ratios of average median PE of CCL1-treated condition over CCL1-untreated condition. Identifiers of CCR8-binding TCE molecules and scFab-containing CCR8-binding TCE molecules are indicated in the left column.
“I2E” represents an scFv that binds CD3. TCE1 TCE molecule (either scFab-12E-scFc or scFv CC×12E×scFc) amino acid sequences are given by SEQ ID NOs: 113-128. TCE8 TCE molecule (either scFab-12E-scFc or scFv CC×12E×scFc) amino acid sequences are given by SEQ ID NOs: 97-112. TCE2 TCE molecule (either scFab-12E-scFc or scFv CC×12E×scFc) amino acid sequences are given by SEQ ID NOs: 49-64.
These data demonstrate that the presence of CCLI did not affect binding of the CCR8-binding TCE molecule TCE1 or scFab-containing CCR8-binding TCE molecule TCE1. In contrast, CCL1 did block binding of TCE8 and TCE2 TCE molecules.
To determine surface hydrophobicity of scFab-containing CCR8 binding TCE molecules, isolated and formulated CCR8-binding TCE molecule and scFab-containing CCR8-binding TCE molecule monomer adjusted to a defined protein concentration are transferred into autosampler fitting sample vials and measured on a FPLC system. A Hydrophobic Interaction Chromatography (HIC) column is equilibrated with formulation buffer and a defined volume of protein solution applied at a constant formulation buffer flow. Detection is done by OD280 nm optical absorption. Elution behavior is determined by peak shape respectively mathematically calculation of declining signal peak slope. Steeper slope/higher slope values indicate less hydrophobic interaction of the protein surface compared to constructs with more flat elution behavior and lower slope value. Following procedures essentially as described above, the following data were obtained.
TCE4 TCE molecule (either scFab-12E-scFc or scFv CC×12E×scFc) amino acid sequences are given by SEQ ID NOs: 17-32. TCE1 TCE molecule (either scFab-12E-scFc or scFv CC×I2E×scFc) amino acid sequences are given by SEQ ID NOs: 113-128. TCE8 TCE molecule (either scFab-12E-scFc or scFv CC×12E×scFc) amino acid sequences are given by SEQ ID NOs: 97-112. TCE2 TCE molecule (either scFab-12E-scFc or scFv CC×12E×scFc) amino acid sequences are given by SEQ ID NOs: 49-64. TCE7 TCE molecule (either scFab-12E-scFc or scFv CC×12E×scFc) amino acid sequences are given by SEQ ID NOs: 81-96. TCE5 TCE molecule (either scFab-12E-scFc or scFv CC×12E×scFc) amino acid sequences are given by SEQ ID NOs: 33-48. TCE6 TCE molecule (either scFab-12E-scFc or scFv CC×12E×scFc) amino acid sequences are given by SEQ ID NOs: 65-80. “CC” denotes an engineered cysteine clamp between cysteines at residue 44 of the heavy chain variable region and residue 100 of the light chain variable region of the anti-target scFv.
These data demonstrate HIC elution peak slopes for the scFab-containing CCR8-binding TCE molecules are steeper and have higher mathematically values compared to the CCR8-binding TCE molecules having an scFv that binds CCR8.
Cell-based affinity of CCR8-binding TCE molecules and scFab-containing CCR8-binding TCE molecules is determined by nonlinear regression (one site-specific binding) analysis. CHO cells expressing human CCR8 (SEQ ID NO: 131), cynomolgus monkey CCR8 (SEQ ID NO: 129) or cynomolgus CCR8 (T4R; SEQ ID NO: 130) are incubated with decreasing concentrations of CCR8 bispecific constructs (50-3200 nM, step 1:2, 11 steps) for 16 hours at 4° C. Bound CCR8-binding TCE molecules and scFab-containing CCR8-binding TCE molecules are detected with Alexa Fluor 488-conjugated AffiniPure Fab Fragment Goat Anti-Human IgG (H+L). Fixed cells are stained with DRAQ5, Far-Red Fluorescent Live-Cell Permeant DNA Dye and signals are detected by fluorescence cytometry. Respective equilibrium dissociation constant (Kd) values are calculated with the one site specific binding evaluation tool of the GraphPad Prism software. Mean Kd values and affinity gaps are calculated with Microsoft Excel. Mean Kd values are calculated from two or three independent experiments. The affinity gaps are determined by dividing the cyno Kd by the human Kd. Following procedures essentially as described above, the following data were obtained.
These cell-based affinity measurements demonstrate that TCE molecules such as TCE1, with or without an scFab, have high affinity for both human CCR8 and cynomolgus monkey CCR8 without the T4R mutation. The affinity of the TCE1 TCE molecules was reduced against cynomolgus monkey cells having the T4R mutation.
In addition, the TCE molecule CCR8 TCE2 was not able to be produced in a sufficient amount. However, the TCE molecule having an scFab moiety (CCR8 TCE2 scFab) was able to be produced, demonstrating that the scFab moiety provides an advantage for molecule production.
To measure aggregation temperature, isolated and formulated CCR8-binding TCE molecule and scFab-containing CCR8-binding TCE molecule monomer adjusted to a defined protein concentration are pipetted in duplicates into a 96-well plate and overlaid with paraffin oil. The 96-well plate is transferred to a dynamic light scattering DLS reader capable of heating the plate at a defined rate in a given temperature range. Measurement is performed from 40° C. to 70° C. at a defined rate of temperature increase. Detection is done by dynamic light scattering determining the hydrodynamic radius of the constructs over the temperature ramp. The temperature at begin of increase of hydrodynamic radius is defined as aggregation temperature. Following procedures essentially as described above, the following data were obtained.
According to procedures essentially as described above, scFab-containing CCR8-binding TCE molecules demonstrated higher aggregation temperatures compared to the CCR8-binding TCE molecules having an scFv that binds CCR8. As described above, the TCE molecule CCR8 TCE2 was not able to be produced in a sufficient amount, whereas the TCE molecule having an scFab moiety (CCR8 TCE2 scFab) was able to be produced.
Human peripheral blood mononuclear cells (PBMC) are prepared by Ficoll density gradient centrifugation from enriched lymphocyte preparations (buffy coats), a side product of blood banks collecting blood for transfusions. Buffy coats are supplied by a local blood bank and PBMC are prepared on the same day of blood collection. After Ficoll density centrifugation and extensive washes with Dulbecco's PBS (Gibco), remaining erythrocytes are removed from PBMC via incubation with erythrocyte lysis buffer (155 mM NH4Cl, 10 mM KHCO3, 100 μM EDTA). Platelets are removed via the supernatant upon centrifugation of PBMC at 100×g. Remaining lymphocytes mainly encompass B and T lymphocytes, NK cells and monocytes. PBMC are kept in culture at 37° C./5% CO2 in RPMI medium (Gibco) with 10% FCS (Gibco).
For depletion of CD14+ cells, human CD14 MicroBeads (Milteny Biotec, MACS, #130-050-201) are used. For depletion of NK cells, human CD56 MicroBeads (MACS, #130-050-401) are used. PBMC are counted and centrifuged for 10 minutes at room temperature with 300×g. The supernatant is discarded, and the cell pellet resuspended in MACS isolation buffer [80 μL/107 cells; PBS (Invitrogen, #20012-043), 0.5% (v/v) FBS (Gibco, #10270-106), 2 mM EDTA (Sigma-Aldrich, #E-6511)]. CD14 MicroBeads and CD56 MicroBeads (20 μL/107 cells) are added and incubated for 15 minutes at 4 to 8° C. The cells are washed with MACS isolation buffer (1-2 mL/107 cells). After centrifugation (see above), supernatant is discarded, and cells are resuspended in MACS isolation buffer (500 μL/108 cells). CD14/CD56 negative cells are isolated using LS Columns (Miltenyi Biotec, #130-042-401). PBMC without CD14+/CD56+ cells are cultured in RPMI complete medium i.e. RPMI1640 (Biochrom AG, #FG1215) supplemented with 10% FBS (Biochrom AG, #S0115), 1× non-essential amino acids (Biochrom AG, #K0293), 10 mM Hepes buffer (Biochrom AG, #L1613), 1 mM sodium pyruvate (Biochrom AG, #L0473) and 100 U/mL penicillin/streptomycin (Biochrom AG, #A2213) at 37° C.
For the analysis of cell lysis in flow cytometry assays, the fluorescent membrane dye DiOC18 (DiO) (Molecular Probes, #V22886) is used to label human CCR8- or macaque CCR8-transfected CHO cells as target cells and distinguish them from effector cells. Briefly, cells are harvested, washed once with PBS and adjusted to 106 cell/mL in PBS containing 2% (v/v) FBS and the membrane dye DiO (5 μL/106 cells). After incubation for 3 minutes at 37° C., cells are washed twice in complete RPMI medium and the cell number adjusted to 1.25×105 cells/mL. The vitality of cells is determined using the NC-250 cell counter (Chemometec)
To quantify the lysis of cyno or human CCR8-transfected CHO cells in the presence of serial dilutions of CCR8-binding TCE molecule or scFab-containing CCR8-binding TCE molecule, equal volumes of DiO-labeled target cells and effector cells (i.e., PBMC w/o CD14+ cells) are mixed, resulting in an E:T cell ratio of 10:1. 80 μl of this suspension is transferred to each well of a 96-well plate. 20 μL of serial dilutions of the CCR8-binding TCE molecule or scFab-containing CCR8-binding TCE molecule and a negative control (a CD3-based TCE molecule recognizing an irrelevant target antigen) or RPMI complete medium as an additional negative control are added. The TCE molecule or scFab-containing TCE molecule-mediated cytotoxic reaction proceeded for 48 hours in a 7% CO2 humidified incubator. Cells are transferred to a new 96-well plate and loss of target cell membrane integrity is monitored by adding propidium iodide (PI) at a final concentration of 1 μg/mL. PI is a membrane impermeable dye that normally is excluded from viable cells, whereas dead cells take it up and become identifiable by fluorescent emission.
Samples are measured by flow cytometry on an iQue Plus instrument and analyzed by Forecyt software (both from Intellicyt). Target cells are identified as DiO-positive cells. PI-negative target cells are classified as living target cells. Percentage of cytotoxicity is calculated as number of dead targets cells/number of target cells×100. Using GraphPad Prism 5 software (Graph Pad Software, San Diego), the percentage of cytotoxicity is plotted against the corresponding TCE molecule or scFab-containing TCE molecule concentrations. Dose response curves are analyzed with the four parametric logistic regression models for evaluation of sigmoid dose response curves with fixed hill slope and EC50 values are calculated.
Following procedures essentially as described above, data from a 48-hour FACS-based cytotoxicity assay of scFab-containing CCR8-binding TCE molecule with human CCR8 transfected CHO cells (clone #A2) and human CCR8 isoform A27G (SEQ ID NO: 132) transfected CHO cells as target cells and unstimulated human PBMC (CD14−/CD56−) as effector cells (E:T ratio 10:1) is shown below in Table 18.
These data demonstrate that binder TCE1 and TCE8 show comparable bioactivity in a one-to two-digit pM range.
Data from a 48-hour FACS-based cytotoxicity assay of bispecific constructs with Chinese cynomolgus CCR8 (SEQ ID NO: 129) transfected CHO cells (clone #G4) and the mauritian cyno CCR8 isoform T4R (SEQ ID NO: 130) transfected CHO cells as target cells and unstimulated human PBMC (CD14−/CD56−) as effector cells (E:T ratio 10:1) is shown below in Table 19.
These data demonstrate that only the tested TCE1 TCE molecule (having a scFab targeting CCR8) shows pM bioactivity on the chinese cynomolgus monkey CCR8 transfected CHO cell line. The other tested molecules demonstrated no activity (as depicted by “X” in the table).
Data from a 48-hour FACS-based cytotoxicity assay of CCR8-binding TCE molecule and scFab-containing CCR8-binding TCE molecule with HUT-78 (CD3+) as target cells and unstimulated human PBMC (CD14−/CD56−) as effector cells (E:T ratio 10:1) is shown below in Table 20. EC50 values are determined by the four parametric logistic regression models for evaluation of sigmoid dose response curves with fixed hill slope.
These data demonstrate that binder TCE1 shows high bioactivity on the endogenous cell line HUT-78 (CD3+).
Isolation of effector cells and depletion of CD14+ and CD56+ cells are performed as described above. Target cells (described below) are harvested, spun down, and adjusted to 1.2×105 cells/mL in complete RPMI medium. The vitality of cells is determined using Nucleocounter NC-250 (Chemometec) and Solution18 Dye containing Acridine Orange and DAPI (Chemometec).
To quantify the lysis of target cells in the presence of serial dilutions of CCR8-binding TCE molecules or scFab-containing CCR8-binding TCE molecules, equal volumes of luciferase-positive target cells and effector cells (i.e., PBMC w/o CD14+; CD56+ cells) are mixed, resulting in an E:T cell ratio of 10:1. 42 μL of this suspension is transferred to each well of a 384-well plate. 8 μL of serial dilutions of the corresponding CCR8-binding TCE molecule or scFab-containing CCR8-binding TCE molecule and a negative control (a CD3-based TCE molecule recognizing an irrelevant target antigen) or RPMI complete medium as an additional negative control are added. The TCE molecule cytotoxic reaction proceeds for 48 hours in a 5% CO2 humidified incubator. Then, 25 μL substrate (Steady-Glo® Reagent, Promega) is transferred to the 384-well plate. Only living luciferase-positive cells react to the substrate and create a luminescence signal. Samples are measured with a SPARK microplate reader (TECAN) and analyzed by Spark Control Magellan software (TECAN). Percentage of cytotoxicity was calculated as (1-RLUSample/RLUNegative-Control)×100. RLU mean relative light unites. “Negative-Control” means cells without TCE molecule.
Using GraphPad Prism 7.04 software (Graph Pad Software, San Diego), the percentage of cytotoxicity is plotted against the corresponding multi-specific TCE molecule concentrations. Dose response curves are analyzed with the four parametric logistic regression models for evaluation of sigmoid dose response curves with fixed hill slope and EC50 values are calculated.
Following procedures essentially as described above, the following data were obtained. Data shown are of CCR8 scFab-containing CCR8-binding TCE molecules against the human CCR8 positive HUT-78 CD3ε-ko cell line (parental cells and clones shown below) or the human CCR8 negative (ko) HUT-78 (CD3ε+) cell line (monoplex clone 2E3; negative control) as target cells, and unstimulated human PBMC (CD14−/CD56−) as effector cells (E:T ratio 10:1).
These data demonstrate that the TCE1 scFab-containing TCE molecule shows a superior bioactivity on the human CCR8 positive HUT-78 (CD3ε−) cell lines compared to TCE8 and TCE2.
For confirmation of binding to human CCR8 and CD3 and to cyno CCR8 and CD3, TCE1 scFab-containing CCR8-binding TCE molecule, control TCE molecule (CD3-based TCE molecule recognizing an irrelevant target antigen), or anti-CCR8 antibodies clone L263G8 (BioLegend) and 433H (BD) are tested by flow cytometry using CHO cells transfected with human CCR8 and or macaque CCR8, the human CCR8 and CD3 positive human cell line HUT-78, the human CCR8 positive and CD3 negative HUT-78 cell line, CD3-expressing human T cell leukemia cell line HPB-all (DSMZ, Braunschweig, ACC483), and the cynomolgus CD3-expressing T cell line LnPx 4119.
Following procedures essentially as described above, the following data were obtained. A “-” indicates that no signal was detected. Data represent mean BL2 (channel in which the signal was detected) of the sample/mean BL2 of the secondary antibody control.
These data demonstrate that the scFab-containing TCE1 TCE molecule bound human CCR8 and cynomolgus monkey CCR8 in human or cyno expressing CHO cells but did not bind the cynomolgus monkey CCR8 having a T4R mutation. These data also demonstrate that TCE1 binds CCR8 expressed on a naturally-expressing CCR8 cell line (HUT-78 CCR8+/CD3e−).
The extracellular domain of human CCR8 comprises three loops and a N-terminal peptide of 35 amino acids. For epitope mapping, the N-terminal peptide of human CCR8 (designated P_1-35 (SEQ ID NO: 133)) is divided into three consecutive segments (designated P_1-12 (SEQ ID NO: 134), P_13-24 (SEQ ID NO: 135), P_25-35 (SEQ ID NO: 136)). To cover the adjacent N- or C-terminal regions of the consecutive segments two additional overlapping fragments (designated P_7-18 (SEQ ID NO: 137 and P_19-30 (SEQ ID NO: 138)) are made. At the C-terminal end of the full-length N-terminal peptide and all truncated N-terminal peptides of human CCR8 described above a V5 tag is fused via a G4S-linker. Following the V5 tag, chicken albumin is fused via a further G4S-linker followed by a FLAG tag, BAP (biotin acceptor protein) for in vivo biotinylation, and H3G, each fused via a SG-linker. All constructs described above are cloned into a pEFDHFR vector and transiently transfected into HEK 293 cells.
HEK 293 cells (1×10E8) are resuspended in 100 ml FreeStyle expression medium (Gibco 12338-018) and transfected with 4 ml OptiMEM (Gibco 31985-047), 100 μl 293fectin (Invitrogen 12347-019) and 50 μg DNA encoding either the full-length or truncated N-terminal CCR8 constructs according to the manufacturers protocol. Cells are grown in FreeStyle expression medium for 72 hours at 130 rpm in a humidified incubator with 8% CO2. Cells are centrifuged at 1,500 rpm for 10 minutes and the supernatant is harvested. 10 ml of the supernatant of each of the transfected cells or 9 ml of HEK 293 cells as negative control are 20× concentrated with Amicon Ultra-15 tubes (UFC901008) to 500 μL. For each of the full-length and truncated N-terminal CCR8 constructs as well as HEK 293 negative control, 18×1086 washed streptavidin-beads (Streptavidin Microspheres, 6 μm; Polysciences 24172-1) are resuspended in 500 μL of the concentrated supernatant and incubated slowly shaking for one hour. Beads coupled with the respective antigen or negative control are washed and stored at 4° C. overnight.
To verify expression and binding of the full-length and truncated N-terminal CCR8 constructs to streptavidin-beads, 2×10F5 beads per staining are incubated with 5 μg/mL of an anti-FLAG antibody (clone M2, Sigma F3165/F1804) and 5 μg/mL of an anti-V5 antibody (clone SV5-Pk1; AbD Serotec, MCA 1360) and a 1:100 dilution of PE-labeled anti mouse Fcy secondary antibody (Jackson 115-116-071). Antigen-bound beads are incubated with three different anti-human CCR8 antibodies. Binding of two of the anti-human CCR8 antibodies (clone L263G8; BioLegend, 360602 and clone 433H; BD 747578; 5 μg/ml each) is detected with a 1:100 dilution of a PE-labeled anti mouse Fcy secondary antibody (Jackson 115-116-071). Binding of anti-human CCR8 antibody (polyclonal; Abcam, ab140796) is detected with a 1:50 dilution of PE-labeled anti goat Fcy secondary antibody (Jackson 109-116-098).
To evaluate binding of CCR8-binding TCE molecules and scFab-containing CCR8-binding TCE molecules to the full-length and truncated N-terminal CCR8 constructs bound to streptavidin-beads, beads are incubated with 5 μg/mL of the respective TCE molecule. Binding of these CCR8-binding TCE molecules and scFab-containing CCR8-binding TCE molecules is detected using 2 μg/ml of an anti-Histidin-antibody (clone AD1.1.10; AbD Serotec MCA 1396) and a 1:100 dilution of a PE-labeled anti mouse Fcy secondary antibody (Jackson 115-116-071). All antibodies, CCR8-binding TCE molecules, and scFab-containing CCR8-binding TCE molecules are diluted in PBS with 2% FBS and all incubations are performed at 4° C. for 45 minutes (primary antibodies) or for 30 minutes (secondary antibodies). Washes are performed using PBS with 2% FBS and the final suspension buffer prior to FACS analysis is also PBS with 2% FBS. Antibody and TCE binding is detected using an Intellicyte IQue. Changes in mean fluorescence are analyzed with an Intellicyte IQue and FlowJo. Binding to the various full-length and truncated N-terminal CCR8 constructs is reflected as a positive signal detected by flow cytometry.
Following procedures essentially as described above, expression and binding of the full-length and the various truncated N-terminal CCR8 constructs to streptavidin-beads could be verified by flow cytometry.
These data demonstrate that anti-human CCR8 antibodies bound the full-length N-terminal peptide of human CCR8 P_1-35 indicating they recognized the N-terminal peptide of human CCR8. None of the antibodies showed binding to either streptavidin-beads alone or to the HEK 293 control. The anti-human CCR8 antibodies (clone L263G8 and clone 433H) showed the same binding pattern while the polyclonal anti-human CCR8 antibody showed additional binding to the overlapping fragment P_7-18.
As shown in Table 23, when binding to the truncated N-terminal peptides of CCR8 was evaluated, CCR8-binding TCE molecules and scFab-containing CCR8-binding TCE molecules showed two different binding patterns. For example, TCE4, TCE3 and TCE8 each bound to the truncated N-terminal peptide P_13-24. However, TCE1 bound to the truncated N-terminal peptide P_1-12.
These data demonstrate that CCR8-binding TCE molecules and scFab-containing CCR8-binding TCE molecules bound to the full-length N-terminal CCR8 peptide P_1-35. All molecules except TCE1 bound to the truncated N-terminal CCR8 peptide P_13-24. Interestingly, TCE1 binds to the truncated N-terminal CCR8 peptide P_1-12, suggesting TCE1 binds a unique epitope on CCR8, which is thought to contribute to the high affinity and bioactivity of TCE1.
Additional scFvs representing a new sequence family that binds in the 1-12 amino acid epitope cluster have been generated and screened by phage display.
This application claims the benefit of U.S. Provisional Application No. 63/197,265, filed Jun. 4, 2021, and U.S. Provisional Application No. 63/236,547, filed Aug. 24, 2021, each of which is incorporated by reference herein in its entirety.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/US2022/032006 | 6/2/2022 | WO |
| Number | Date | Country | |
|---|---|---|---|
| 63236547 | Aug 2021 | US | |
| 63197265 | Jun 2021 | US |
