Patent Application
20210145802
The present invention relates to novel therapies for the treatment and/or prevention of an ophthalmological condition using a thiazolidinedione or rhodanine compound which is not Pioglitazone, Rosiglitazone, Rivoglitazone, Balaglitazone or Mitoglitazone. In particular, the present invention is concerned with compounds of formula (I) as novel therapies for the treatment and/or prevention of glaucoma and/or dry age-related macular degeneration (AMD) and other ophthalmological conditions which may be associated with or caused by misfolding of the amyloid-β peptide.
Ophthalmological conditions cover a range of diseases, disorders and age-related changes which affect the eye and the surrounding area. Ophthalmological conditions can affect different areas of the eye, such as the retina and the lens, and have a range of causes. Studies have shown that protein misfolding and/or aggregation may be a feature of many ophthalmological conditions, including glaucoma, age-related macular degeneration (AMD), cataracts, retinitis pigmentosa, retinoschisis, and corneal dystrophies. When certain proteins and peptides such as the amyloid-β (Aβ) peptide undergo misfolding, this can disrupt normal cell or organ function. In some cases, symptoms are caused by the loss of function of the protein, while in others the abnormal protein is toxic or forms bodies which physically disrupt organ function. In some ophthalmological conditions, the misfolded protein aggregates into bodies such as fibrils and granules in the eye which physically cause light scattering and/or blocking, leading to loss of visual acuity.
Glaucoma is a group of eye diseases associated with optic nerve damage and permanent vision loss. The optic nerve transmits information to the brain from the retina and comprises retinal ganglion cells (RGCs) and glial cells. RCGs are present in both the retina and the optical nerve, and their irreversible death has been linked to vision loss in glaucoma patients.
Traditionally, glaucoma is believed to be predominantly caused by an increase in intraocular pressure. Current treatments largely focus on decreasing pressure in the eye, for example by medication, surgery or laser treatment. However, it is not known how intraocular pressure interacts with the direct mechanisms of vision loss such as the death of RGCs. Indeed, recent evidence has shown vision loss in glaucoma patients despite the successful application of pressure-lowering treatments. Furthermore, glaucoma can occur without an increase in intraocular pressure, known as Normal Tension Glaucoma. Alternative therapies which treat the loss of RCGs and/or optical nerve damage directly are therefore highly desirable.
Recent studies have implicated Aβ misfolding and deposition as a cause of glaucoma and shown that RGC death in experimental glaucoma models can be reduced by targeting Aβ formation and aggregation pathways. Targeting Aβ aggregation pathways therefore presents a promising therapeutic strategy for the treatment of glaucoma.
Age-related macular degeneration (AMD) is an ophthalmological condition characterised by progressive loss of central vision and affects nearly 50 million people worldwide. The effects are particularly significant in societies with an increasingly aging population. Dry AMD makes up around 90% of cases of AMD and there is currently no medical or surgical treatment for this condition. The macula is a region on the retina associated with central vision and fine detail perception. The underlying causes of this degenerative disease are not fully understood but risk factors include genetic, epigenetic and environmental factors. The disease is typified by the formation of deposits known as drusen, which consist of cellular debris and lipids, but this is also considered to be a normal part of the aging process and it is not known how drusen interact with the pathology of AMD.
The loss of vision in AMD is associated with atrophy of photoreceptors and the retinal pigment epithelium. This epithelium and RGCs have been shown to be significant sources of the Aβ peptide, which is secreted into the posterior eye, in dry AMD. Multiple studies now show that elevated Aβ levels are found in aging retinas and link the Aβ peptide with AMD progression. Aβ pathways are therefore also an attractive target for therapeutic strategies for the treatment of AMD, particularly dry AMD.
The Aβ peptide self-assembles into neurotoxic aggregates and forms amyloid deposits and plaques. Mainly, the 40-residue (Aβ40) and 42-residue (Aβ42) isoforms are found in these plaques. The Aβ42 peptide has been shown to induce the death of RGCs.
The Aβ peptide has typically been associated with degenerative diseases such as Alzheimer's disease and inclusion body myositis. To this end, several amyloid targeted strategies have been pursued in the past decades, including decreasing Aβ production, modulating Aβ transport, increasing Aβ clearance and decreasing Aβ aggregation. However, so far such strategies have not brought an effective drug to market. It is particularly desirable to develop inhibition strategies based on the use of drugs already validated for the treatment of other conditions or compounds known to be pharmaceutically acceptable.
The present inventors have used a high-throughput kinetics-based screening of libraries to identify inhibitors of Aβ aggregation, based on their ability to inhibit specific microscopic processes in the Aβ aggregation process which result in the reduction of the population(s) of toxic oligomeric aggregates. The libraries that have been screened consisted of drugs that have been approved by regulatory authorities (such as FDA, EMA, PMDA and others) in addition to experimental drugs that have entered clinical trials but have not been approved by any regulatory authority,
Surprisingly, a series of thiazolidinedione compounds, including Netoglitazone, were found to be excellent inhibitors of Aβ aggregate formation. The present invention therefore provides a thiazolidinedione or rhodanine compound which is not Pioglitazone, Rosiglitazone, Rivoglitazone, B alaglitazone or Mitoglitazone, or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, for use in the treatment and/or prevention of an ophthalmological condition.
The present invention also provides a thiazolidinedione or rhodanine compound comprising, at opposite ends of the molecule, a primary terminal group which is a thiazolidinedione or rhodanine group and a secondary terminal group which is not (i) a 5- to 10-membered partially unsaturated heterocyclyl group containing one or more nitrogen heteroatoms in the ring, or (ii) a 5- to 10-membered heteroaryl group containing one or more nitrogen heteroatoms in the ring, or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, for use in the treatment and/or prevention of an ophthalmological condition.
The present invention further provides a compound for use as described above, wherein the compound is a compound of formula (I), or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof,
wherein X represents O or S, W represents a benzene, naphthalene, benzodihydropyran or benzopyran ring, which is optionally further substituted, L represents a linker group which comprises an alkylene group optionally comprising (i) one or more heteroatoms and/or carbonyl groups; and/or (ii) a 5- to 10-membered saturated or unsaturated heterocyclic group which is optionally substituted and R3 represents an optionally substituted C6 to C10 aryl group, C5 to C9 carbocyclyl group, 5- to 9-membered saturated heterocyclyl group, 5- to 9-membered partially unsaturated heterocyclyl group which does not contain a nitrogen heteroatom in the ring, or a 5- to 10-membered heteroaryl group which does not contain a nitrogen heteroatom in the ring.
In another embodiment of the invention, the compound is a compound of formula (IA), or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof,
wherein X represents O or S, W represents a benzene or naphthalene ring, which is optionally further substituted, Y represents O or a carbonyl C(O) group, R1 and R2 are the same or different and each independently represent hydrogen or a substituted or unsubstituted C1 to C4 alkyl group or are linked to form a 5 to 7 membered aryl, carbocyclyl or heterocyclyl ring, which is optionally further substituted, n is an integer of from 0 to 2, Z represents a bond or a 5- to 10-membered saturated or unsaturated heterocyclic group which is optionally substituted, and R3 represents an optionally substituted C6 to C10 aryl group, optionally substituted C5 to C10 carbocyclyl group, or an optionally substituted heterocyclyl group selected from pyranyl, dihydropyranyl, dihydrofuranyl, dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, furanyl, and benzofuranyl.
Preferably, X represents O, W represents a benzene or naphthalene ring, Y represents O, R1 and R2 each independently represent hydrogen or are linked to form, together with W, a benzopyran or benzodihydropyran ring, and n is 0 or 1.
In another embodiment of the invention, the compound is a compound of formula (II) or (III), or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof,
wherein n is 1 or 2 and the other chemical groups are as defined above.
Preferably, Z represents a bond.
Preferably, X represents oxygen.
Preferably, R3 represents an optionally substituted C6 to C10 aryl group or an optionally substituted C5 to C10 carbocyclyl group.
In a further embodiment of the invention, the compound is Netoglitazone, Ciglitazone, Englitazone, Darglitazone or Troglitazone, or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof.
In a preferred embodiment, the compound is Netoglitazone or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof.
In one embodiment, the compound of the invention is for use in treating an ophthalmological condition which is associated with protein misfolding. Preferably, the ophthalmological condition is associated with misfolding of the amyloid-β peptide.
In one embodiment, the compound of the invention is for use in treating, preventing or inhibiting the formation, deposition, accumulation, or persistence of oligomers, fibrils, aggregates and/or plaques of proteins and/or peptides. Preferably, the compound of the invention is for use in treating, preventing or inhibiting the formation, deposition, accumulation, or persistence of amyloid β peptide oligomers, fibrils, aggregates and/or plaques.
In one embodiment, the compound of the invention is for use in treating an ophthalmological condition which is a retinal disease.
Preferably, the retinal disease is selected from macular degeneration, macular pucker, glaucoma, retinitis pigmentosa, choroidal neovascularization, retinal degeneration, oxygen-induced retinopathy, proliferative vitreoretinopathy, uveitis, retinopathy of prematurity, retrolental fibroplasia, retinoschisis, lattice degeneration, retinal detachment and/or retinal ganglion cell degeneration.
More preferably, the ophthalmological condition is glaucoma.
In another preferred embodiment, the ophthalmological condition is macular degeneration. More preferably, the macular degeneration is age-related macular degeneration (AMD). Even more preferably, the AMD is dry AMD. Most preferably, the dry AMD is early stage dry AMD.
In an embodiment of the invention, the compound of the invention is for use in the treatment of a patient which has been diagnosed with, or is at risk of developing, glaucoma and/or dry AMD.
In one embodiment, the patient has a family history of glaucoma and/or dry AMD. The present invention also provides a pharmaceutical composition comprising the compound of the invention as defined above or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, for use in the treatment and/or prevention of an ophthalmological condition.
Preferably, the pharmaceutical composition is for use in the treatment and/or prevention of an ophthalmological condition as defined above.
In one embodiment, the pharmaceutical composition further comprises one or more additional pharmaceutically active agents.
In another embodiment, the additional pharmaceutically active agent(s) are suitable for the treatment and/or prevention of an ophthalmological condition.
In a further embodiment, the compound of the invention and the additional pharmaceutically active agent(s) are formulated for separate, concurrent, simultaneous or successive administration.
The present invention also provides a kit comprising the compound of the invention as defined above or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, or a composition of the invention as described above, for use in the treatment and/or prevention of an ophthalmological condition. Optionally, the kit further comprises, in admixture or in separate containers, an additional pharmaceutically active agent(s) as defined above.
The present invention additionally provides a method of treating and/or preventing an ophthalmological condition in a patient which comprises administering to said patient an effective amount of the compound of the invention as defined above or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof. Preferably, the ophthalmological condition is as defined above. Most preferably, the ophthalmological condition is glaucoma and/or dry AMD.
The present invention further provides the use of the compound of the invention as defined above or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof in the manufacture of a medicament for the treatment and/or prevention of an ophthalmological condition. Preferably, the ophthalmological condition is as defined above. Most preferably, the ophthalmological condition is glaucoma and/or dry AMD.
As used herein, the term “patient” typically refers to a human patient. Patients may, however, be other vertebrate animals, such as mammals. The terms “subject” and “patient” are used interchangeably herein.
As used herein, the words “treatment” and “treating” are to be understood as embracing treatment and/or amelioration and/or prevention of or reduction in aggravation/worsening of symptoms of a disease or condition as well as treatment of the cause of the disease or condition, and may include reversing, reducing, or arresting the symptoms, clinical signs, and underlying pathology of a condition in a manner to improve or stabilise a subject's condition.
Reference to “prevention” and “preventing” a disease or condition embraces prophylaxis and/or inhibition of the disease or condition. The term “preventing” is art-recognized, and when used in relation to a condition, such as glaucoma and/or dry AMD or its associated symptoms, is well understood in the art, and includes administration of a drug and/or composition which reduces the frequency of, or delays the onset of, symptoms of a medical condition in a subject relative to a subject which does not receive the drug or composition.
As used herein, the term “pharmaceutically acceptable” refers to a material that does not interfere with the effectiveness of the compound of the invention and is compatible with a biological system such as a cell, cell culture, tissue, or organism. Preferably, the biological system is a living organism, such as a vertebrate.
As used herein, the phrase “therapeutically effective amount” refers to an amount of a compound, material or composition that is effective for producing some desired therapeutic effect, such as treating, preventing or ameliorating an ophthalmological condition or reducing the prevalence of misfolded protein, at a reasonable benefit/risk ratio applicable to any medical treatment. In one embodiment, the therapeutically effective amount is sufficient to reduce or eliminate at least one symptom. A therapeutically effective amount may partially improve a disease or symptom without fully eradicating the disease or symptom.
Compounds
The compound for use in the present invention is a thiazolidinedione or rhodanine compound which is not Pioglitazone, Rosiglitazone, Rivoglitazone, Balaglitazone or Mitoglitazone.
In particular, the compound of the invention may be a thiazolidinedione or rhodanine compound comprising, at opposite ends of the molecule, a primary terminal group which is a thiazolidinedione or rhodanine group and a secondary terminal group which is not (i) a 5- to 10-membered partially unsaturated heterocyclyl group containing one or more nitrogen heteroatoms in the ring, or (ii) a 5- to 10-membered heteroaryl group containing one or more nitrogen heteroatoms in the ring.
In one embodiment, the compound of the invention is a compound of formula (I).
In the compound of the invention, X represents 0 or S. Preferably X is O.
In the compound of the invention, W represents an optionally further substituted benzene, naphthalene, benzodihydropyran or benzopyran ring, preferably an optionally further substituted benzene or naphthalene ring, more preferably an unsubstituted benzene or naphthalene ring. In one embodiment, W represents an unsubstituted naphthalene ring.
In the compound of the invention, L represents a linker group which comprises an alkylene group optionally comprising (i) one or more heteroatoms and/or carbonyl groups; and/or (ii) a 5- to 10-membered saturated or unsaturated heterocyclic group which is optionally substituted. In particular, L may represent an alkylene group optionally comprising (i) one or more heteroatoms and/or carbonyl groups; and/or (ii) a 5- to 10-membered saturated or unsaturated heterocyclic group which is optionally substituted. Preferably the heteroatom is an oxy ether group or a secondary amino group which is optionally further substituted, for example by a C1 to C4 alkylene group. In one embodiment, L represents a C1 to C4 alkylene group comprising (i) an oxy, amino and/or carbonyl group and/or (ii) a 5- to 10-membered saturated or unsaturated heterocyclic group. Preferably the heterocyclic group is an optionally substituted oxazole, isoxazole, furan, pyrrole, pyridine, pyridazine, pyrimidine or pyrazine ring. In a preferred embodiment, L represents a C1 to C4 alkylene group comprising: an oxy group, carbonyl group and/or an optionally substituted a 5- to 10-membered saturated or unsaturated heterocyclic group selected from an oxazole, isoxazole, furan and pyrrole ring. The optional substituent(s) of the heterocyclic group may be, for example, a halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or a C1 to C4 alkyl group as described further below, preferably a hydroxyl, halogen and/or C1 to C4 alkyl group. Preferably L represents a C1 to C4 alkylene group comprising an oxy and/or carbonyl group.
In the compound of the invention, R3 represents an optionally substituted C6 to C10 aryl group, optionally substituted C5 to C10 carbocyclyl group, optionally substituted 5- to 10-membered saturated heterocyclyl group, optionally substituted 5- to 10-membered partially unsaturated heterocyclyl group which does not contain a nitrogen heteroatom in the ring, or optionally substituted 5- to 10-membered heteroaryl group which does not contain a nitrogen heteroatom in the ring. Preferably, R3 represents an optionally substituted C6 to C10 aryl group, optionally substituted C5 to C10 carbocyclyl group, or an optionally substituted heterocyclyl group selected from pyranyl, dihydropyranyl, dihydrofuranyl, dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, furanyl and benzofuranyl. The optional substituent(s) may be a halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or a C1 to C4 alkyl group as described further below. Preferably, R3 represents a C6 to C10 aryl group optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups, a C5 to C10 carbocyclyl group optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups, or a heterocyclyl group selected from pyranyl, dihydropyranyl, dihydrofuranyl, dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, furanyl and benzofuranyl, optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups. Preferably R3 represents a C6 to C10 aryl group or a C5 to C10 carbocyclyl group which is optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups, in particular a C6 to C10 aryl group optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups. More preferably, R3 represents a phenyl ring optionally substituted by one or more halogen groups, in particular phenyl or fluorophenyl.
In one preferred embodiment of the compound of Formula (I):
X represents O;
W represents a benzene or naphthalene ring, optionally substituted with a halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra or a C1 to C4 alkyl group as described further below;
L represents a C1 to C4 alkylene group comprising an oxy group, carbonyl group and/or an oxazole, isoxazole, furan or pyrrole ring which is optionally substituted with one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or a C1 to C4 alkyl group(s) as described further below, preferably a hydroxyl, halogen and/or C1 to C4 alkyl group; and
R3 represents a C6 to C10 aryl group optionally substituted with one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below, or a C5 to C10 carbocyclyl group optionally substituted with one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below.
Preferably, in the compound of Formula (I):
X represents O;
W represents an unsubstituted benzene or naphthalene ring;
L represents a C1 to C4 alkylene group comprising an oxy and/or carbonyl group; and R3 represents a C6 to C10 aryl group optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups.
In one preferred embodiment, the compound of the invention may be a compound of formula (IA), wherein X, W and R3 are as defined above.
In particular, in the compound of Formula (IA), W represents an optionally further substituted benzene or naphthalene ring, more preferably an unsubstituted benzene or naphthalene ring. In one embodiment, W represents an unsubstituted naphthalene ring.
In particular, in the compound of Formula (IA), R3 represents an optionally substituted C6 to C10 aryl group, optionally substituted C5 to C10 carbocyclyl group, or an optionally substituted heterocyclyl group selected from pyranyl, dihydropyranyl, dihydrofuranyl, dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, furanyl and benzofuranyl. The optional substituent(s) may be a halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or a C1 to C4 alkyl group as described further below. Preferably, R3 represents a C6 to C10 aryl group optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups, a C5 to C10 carbocyclyl group optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups, or a heterocyclyl group selected from pyranyl, dihydropyranyl, dihydrofuranyl, dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, furanyl, and benzofuranyl, optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups. Preferably R3 represents a C6 to C10 aryl group or a C5 to C10 carbocyclyl group which is optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups, in particular a C6 to C10 aryl group optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups. More preferably, R3 represents a phenyl ring optionally substituted by one or more halogen groups, in particular phenyl or fluorophenyl.
In the compound of Formula (IA), Y represents O or a carbonyl C(O) group. Preferably Y is O.
In the compound of Formula (IA), R1 and R2 are the same or different and each independently represent hydrogen or a substituted or unsubstituted C1 to C4 alkyl group, or R1 and R2 are linked to form a 5 to 7 membered aryl, carbocyclyl or heterocyclyl ring, which is optionally further substituted. Preferably, R1 and R2 each independently represent hydrogen, or R1 and R2 are linked to form, together with W, a benzopyran or benzodihydropyran ring. Preferably, R1 and R2 are both hydrogen.
In the compound of Formula (IA), n is an integer of from 0 to 2. Preferably, n is 0 or 1. More preferably, n is 0.
In the compound of Formula (IA), Z represents a bond or a 5- to 10-membered saturated or unsaturated heterocyclic group which is optionally substituted. Preferably, Z represents a bond or an optionally substituted oxazole, isoxazole, furan, pyrrole, pyridine, pyridazine, pyrimidine or pyrazine ring, wherein the optional substituent is preferably one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below, preferably a hydroxyl, halogen and/or C1 to C4 alkyl group.
In one preferred embodiment of the compound of Formula (IA):
X represents O;
W represents a benzene or naphthalene ring, optionally substituted with one ore more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below;
Y represents O;
R1 and R2 each independently represent hydrogen; or
R1 and R2 are linked to form, together with W, a benzopyran or benzodihydropyran ring; and
n is 0 or 1;
preferably wherein Z is a bond or an optionally substituted oxazole, isoxazole, furan or pyrrole ring, wherein the optional substituent is preferably one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below, preferably a hydroxyl, halogen and/or C1 to C4 alkyl group; and/or R3 represents a C6 to C10 aryl group optionally substituted with one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below, or a C5 to C10 carbocyclyl group optionally substituted with one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below, or a heterocyclyl group selected from pyranyl, dihydropyranyl, dihydrofuranyl, dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, furanyl and benzofuranyl, optionally substituted with one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below.
Preferably, in the compound of Formula (IA):
X represents O;
W represents an unsubstituted benzene or naphthalene ring;
Y represents O;
R1 and R2 each independently represent hydrogen; or
R1 and R2 are linked to form, together with W, a benzopyran or benzodihydropyran ring; and
n is 0 or 1;
preferably wherein Z is a bond and/or R3 represents a C6 to C10 aryl group optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups.
In a further embodiment, the compound of the invention may be a compound of formula (II) or (III), wherein X, Z and R3 are as defined above.
In the compound of Formula (II) or (III), n is an integer of 1 or 2, preferably 1.
Preferably in the compound of Formula (II) or (III), R3 represents a C6 to C10 aryl group optionally substituted with one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below, or a C5 to C10 carbocyclyl group optionally substituted with one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and/or C1 to C4 alkyl group(s) as described further below, or a heterocyclyl group selected from pyranyl, dihydropyranyl, dihydrofuranyl, dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, furanyl and benzofuranyl, optionally substituted with one or more halogen, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra or a C1 to C4 alkyl group(s) as described further below.
In one preferred embodiment of the compound of Formula (II) or (III):
X represents O;
n is an integer of 1 or 2;
Z is a bond; and
R3 represents a C6 to C10 aryl group optionally substituted by one or more hydroxyl, halogen and/or C1 to C4 alkyl groups.
In another embodiment, the compound of the invention is Netoglitazone, Ciglitazone, Englitazone, Darglitazone or Troglitazone. Preferably, the compound of the invention is Netoglitazone, Ciglitazone or Englitazone. In one embodiment, Netoglitazone is preferred in view of the fact that there is late-stage clinical data available for this compound.
As used herein, a C6 to C10 aryl group or moiety is an aryl group or moiety having from 6 to 10 carbon atoms, for example, phenyl or naphthyl, preferably phenyl. An aryl group or moiety can be substituted or unsubstituted. Suitable substituents include a halogen such as chlorine and/or fluorine, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and a C1 to C4 alkyl group such as methyl and/or ethyl, wherein a C1 to C4 alkyl substituent is itself either unsubstituted or substituted with 1 to 3 halogen atoms. Ra and Rb are as defined herein.
As used herein, a C5 to C10 carbocyclyl group or moiety can be a C5, C6, C7, C8, C9 or C10 cycloalkyl group and is preferably cyclopentyl or cyclohexyl. Typically a cycloalkyl group is substituted or unsubstituted with up to three substituents, e.g. one or two substituents. Suitable substituents include a halogen such as chlorine and/or fluorine, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and a C1 to C4 alkyl group such as methyl and/or ethyl, wherein a C1 to C4 alkyl substituent is itself either unsubstituted or substituted with 1 to 3 halogen atoms. Ra and Rb are as defined herein.
As used herein and unless otherwise stated, a 5- to 10-membered saturated heterocyclyl group or moiety is a saturated 5- to 10-membered ring system in which the ring contains at least one heteroatom. Typically, the ring contains up to three or four heteroatoms, e.g. one or two heteroatoms, selected from O, S and N. Thus, a 5- to 10-membered saturated heterocyclyl group or moiety is typically a 5- to 10-membered ring containing one, two or three heteroatoms selected from O, S and N. Suitable such heterocyclyl groups and moieties include, for example, monocyclic saturated 5- to 8-membered rings, more preferably 5- to 7-membered rings, such as tetrahydrofuranyl, piperidinyl, oxazolidinyl, morpholinyl, thiomorpholinyl, pyrrolidinyl, dioxolanyl, piperidonyl, azepanyl, oxepanyl, piperazinyl, tetrahydropyranyl and 1,4-diazepanyl, more preferably pyrrolidinyl, morpholinyl, piperazinyl, tetrahydropyranyl, piperidinyl, azepanyl and 1,4-diazepanyl.
As used herein and unless otherwise stated, a 5- to 10-membered unsaturated heterocyclic group or moiety is a 5- to 10-membered ring system in which the ring contains at least one unsaturated bond and at least one heteroatom. The ring may be partially unsaturated or fully unsaturated and aromatic. Typically, the ring contains up to three or four heteroatoms, e.g. one or two heteroatoms, selected from O, N and S. Thus, a 5- to 10-membered unsaturated heterocyclic group or moiety is typically a 5- to 10-membered ring containing one, two or three heteroatoms selected from O, N and S. Preferably, the heteroatoms are selected from O and N. Suitable such heterocyclyl groups and moieties include, for example:
monocyclic partially unsaturated 5- to 7-membered heterocyclyl rings such as dihydrofuranyl, pyranyl, dihydropyranyl, dioxinyl, dihydrooxepinyl, tetrahydrooxepinyl, pyrrolinyl, pyrazolinyl, imidazolinyl, dihydrooxazolyl, dihydroisoxazolyl, dihydrothiazolyl, dihydroisothiazolyl, dihydropyridinyl, tetrahydropyridinyl, dihydropyridazinyl, tetrahydropyridazinyl, dihydropyrimidinyl, tetrahydropyrimidinyl, dihydropyrazinyl, tetrahydropyrazinyl, oxazinyl, dihydrooxazinyl, thiazinyl, dihydrothiazinyl, dihydroazepinyl, tetrahydroazepinyl, dihydrothiophenyl, thiopyranyl, dihydrothiopyranyl, dihydrothiepinyl, and tetrahydrothiepinyl;
bicyclic partially unsaturated 8- to 10-membered heterocyclyl rings such as dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, benzodioxolyl, indolinyl, isoindolinyl, dihydroquinolinyl, tetrahydroquinolinyl, benzooxazinyl, dihydrobenzothiophenyl and benzodithiole; preferably dihydrobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, benzodioxolyl, indolinyl, isoindolinyl, dihydroquinolinyl and tetrahydroquinolinyl;
monocyclic 5- to 7-membered heteroaryl rings such as furanyl, oxepinyl, pyrrolyl, pyrazolyl, imidazolyl, triazolyl, tetrazolyl, oxazolyl, isoxazolyl, oxadiazolyl, thiazolyl, isothiazolyl, thiadiazolyl, pyridinyl, pyradazinyl, pyrimidinyl, pyrazinyl, triazinyl, azepinyl, thiophenyl, oxepinyl and thiepinyl; and
bicyclic 8- to 10-membered heteroaryl rings such as benzofuranyl, indolyl, isoindolyl, indolizinyl, indazolyl, benzimidazolyl, azaindolyl, azaindazolyl, purinyl, benzooxazolyl, benzoisooxazolyl, benzothiazolyl, benzoisothiazolyl, benzothiadiazolyl, quinolinyl, isoquinolinyl, quinolizinyl, quinoxalinyl, phthalazinyl, quinazolinyl, cinnolinyl, naphthyridinyl, pteridinyl and benzothiophenyl, preferably benzofuranyl, indolyl, isoindolyl, purinyl, quinolinyl and isoquinolinyl.
Preferably, the 5- to 10-membered unsaturated heterocyclic group is a monocyclic partially unsaturated 5- to 7-membered ring selected from dihydrofuranyl, pyranyl, pyrrolinyl and oxazinyl or a monocyclic 5- to 7-membered heteroaryl ring selected from furanyl, pyrrolyl, pyrazolyl, imidazolyl, triazolyl, oxazolyl, isoxazolyl, pyridinyl, pyradazinyl, pyrimidinyl and pyrazinyl.
As used herein and unless otherwise stated, a 5- to 10-membered partially unsaturated heterocyclyl group or moiety which does not contain a nitrogen heteroatom in the ring is a 5- to 10-membered ring system in which the ring contains at least one unsaturated bond and at least one heteroatom and does not contain a nitrogen heteroatom. Typically, the ring contains up to three or four heteroatoms, e.g. one or two heteroatoms, selected from O and S. Thus, a 5- to 10-membered partially unsaturated heterocyclyl group or moiety is typically a 5- to 10-membered ring containing one, two or three heteroatoms selected from O and S. Preferably, the heteroatoms are O. Suitable such heterocyclyl groups and moieties include, for example, monocyclic partially unsaturated 5- to 7-membered heterocyclyl rings such as pyranyl, thiopyranyl, dihydropyranyl, dihydrothiopyranyl, dioxinyl, dihydrofuranyl, dihydrothiophenyl, dihydrooxepinyl, dihydrothiepinyl, tetrahydrooxepinyl, tetrahydrothiepinyl, preferably pyranyl, thiopyranyl, dihydropyranyl and dihydrofuranyl; and bicyclic partially unsaturated 8- to 10-membered heterocyclyl rings such as dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl, dihydrobenzopyranyl, benzodioxolyl, dihydrobenzothiophenyl, and benzodithiole. Preferably, the 5- to 10-membered partially unsaturated heterocyclyl group selected from pyranyl, dihydropyranyl, dihydrofuranyl, dihydrobenzofuranyl, dihydroisobenzofuranyl, benzopyranyl and dihydrobenzopyranyl.
As used herein, and unless otherwise stated, a 5- to 10-membered heteroaryl group or moiety which does not contain a nitrogen heteroatom in the ring is a 5- to 10-membered ring system in which the ring is fully unsaturated and aromatic, contains at least one heteroatom and does not contain a nitrogen heteroatom. Typically, the ring contains up to three or four heteroatoms, e.g. one or two heteroatoms, selected from O and S. Thus, a 5- to 10-membered heteroaryl group or moiety is typically a 5- to 10-membered ring containing one, two or three heteroatoms selected from O and S. Preferably, the heteroatoms are O. Suitable such heteroaryl groups and moieties include, for example, monocyclic 5- to 7-membered heteroaryl rings, such as furanyl, thiophenyl, oxepinyl and thiepinyl; and bicyclic 8- to 10-membered heteroaryl rings such as benzofuranyl and benzothiophenyl. Preferably, the 5- to 10-membered hetereoaryl group is selected from furanyl and benzofuranyl.
A heterocyclyl and/or heteroaryl group or moiety may be substituted or unsubstituted. Each ring atom may be unsubstituted or may carry one or two substituents. If desired, a nitrogen atom may be disubstituted and a sulphur atom may be substituted, providing a charged heteroatom. Typically, a heterocyclyl or aryl group or moiety carries up to three substituents, e.g. one or two substituents. The heterocycle may be connected to the remainder of the molecule by a bond to any of its available ring positions.
As used herein, a group which is optionally substituted may be substituted with suitable substituents which include a halogen such as chlorine and/or fluorine, —ORa, —SRa, —NRaRb, —C(O)ORa, —C(O)NRaRb, —C(O)Ra and a C1 to C4 alkyl group such as methyl and/or ethyl, wherein a C1 to C4 alkyl substituent is itself either unsubstituted or substituted with 1 to 3 halogen atoms. Ra and Rb are as defined below. The optional substituent is preferably a hydroxyl, halogen such as chlorine or fluorine, or C1 to C4 alkyl group such as methyl or ethyl.
As used herein, a halogen is typically chlorine, fluorine, bromine or iodine, and is preferably chlorine, fluorine or bromine, more preferably chlorine or fluorine.
A C1 to C4 alkyl group or moiety can be linear, branched or cyclic but is preferably linear. Suitable such alkyl groups and moieties include methyl, ethyl, n-propyl, i-propyl, n-butyl, sec-butyl and tert-butyl. It is preferably a C1 to C3 alkyl group, more preferably ethyl or methyl. An alkyl group or moiety can be unsubstituted or substituted with 1, 2 or 3 halogen atoms.
As used herein, each Ra and each Rb independently represents hydrogen or an unsubstituted C1 to C4 alkyl group.
The compounds of the present invention may be produced using known methods. In particular, Netoglitazone is a known compound and can be produced, for example, according to the methods described in JP2009/234930 and WO2000/31055 or methods complying therewith.
The compound of the invention containing one or more chiral centre(s) may be used in enantiomerically or diastereomerically pure form or in the form of a mixture of isomers. The compounds of the invention may be used in any tautomeric form.
The compound can be used in the form of a pharmaceutically acceptable salt. As used herein, a pharmaceutically acceptable salt is a salt with a pharmaceutically acceptable acid or base. Pharmaceutically acceptable acids include both inorganic acids such as hydrochloric, sulphuric, phosphoric, diphosphoric, hydrobromic, hydroiodic or nitric acid and organic acids such as citric, fumaric, maleic, malic, ascorbic, succinic, tartaric, benzoic, acetic, methanesulphonic, ethanesulphonic, benzenesulphonic, p-toluenesulphonic acid, formic, acetic, propionic, glycolic, lactic, pyruvic, oxalic, salicylic, trichloroacetic, picric, trifluoroacetic, cinnamic, pamoic, malonic, mandelic, bismethylene salicylic, ethanedisulfonic, gluconic, citraconic, aspartic, stearic, palmitic, EDTA, p-aminobenzoic or glutamic acid, sulfates, nitrates, phosphates, perchlorates, borates, acetates, benzoates, hydroxynaphthoates, glycerophosphates or ketoglutarates. Further examples of pharmaceutically acceptable inorganic or organic acid addition salts include the pharmaceutically acceptable salts listed in Journal of Pharmaceutical Science, 66, 2 (1977) which are known to the skilled artisan. Pharmaceutically acceptable bases include alkali metal (e.g. sodium or potassium) and alkali earth metal (e.g. calcium or magnesium) hydroxides and organic bases such as alkyl amines, aralkyl amines and heterocyclic amines, lysine, guanidine, diethanolamine and choline.
The acid addition salts may be obtained as the direct products of compound synthesis. In the alternative, the free base may be dissolved in a suitable solvent containing the appropriate acid, and the salt isolated by evaporating the solvent or otherwise separating the salt and the solvent.
The compound of the invention may be used in the form of a solvate or hydrate. The compound may form solvates with standard low molecular weight solvents using methods known to the skilled artisan.
The present invention also provides prodrugs of the compounds of the invention. A prodrug is an analogue of a compound of the invention which will be converted in vivo to the desired active compound. Examples of suitable prodrugs include compounds which have been modified at a carboxylic acid group to form an ester, or at hydroxyl group to form an ester or carbamate. Further suitable prodrugs include those in which a nitrogen atom of the compound is quaternised by addition of an ester or alkyl ester group. For example, the nitrogen atom of an amine group or heterocyclyl ring may be quaternised by the addition of a —CH2—O—COR group, wherein R is typically methyl or tert-butyl. Other suitable methods will be known to those skilled in the art.
The present invention further provides precursors of the compounds of the invention. A precursor is a compound which the person skilled in the art could trivially convert into the desired active compound. Examples of suitable precursors include compounds which can be converted into compounds of the invention by the removal of a protecting group by a process known in the art.
The present invention also provides isotopically labelled derivatives of the compounds of the invention (or pharmaceutically acceptable salts, tautomers, solvates, hydrates, prodrugs, derivatives, stereoisomers or analogs thereof). An isotopically labelled derivative is a compound in which one or more of the constituent atoms are an atom having an atomic mass or mass number different from the atomic mass or mass number most commonly found in nature. Examples of isotopes suitable for inclusion in the compound of the invention include isotopes of: hydrogen, such as 2H and 3H; carbon, such as 11C, 13C and 14C; nitrogen, such as 13N, 15N and 16N; oxygen, such as 15O, 17O and 18O; fluorine, such as 18F; phosphorous, such as 32P; sulphur, such as 35S; chlorine, such as 36Cl; bromine, such as 77Br; and iodine, such as 123I and 125I. Preferred isotopes are 2H, 3H, 13C, 15N, 18O, 18F, 36Cl and 77Br.
Substitution with heavier isotopes such as deuterium, 2H, may afford certain therapeutic advantages resulting from greater metabolic stability, such as increased in vivo half-life or reduced dosage requirements. Such isotopically-labelled compounds of the invention may therefore be preferable in some circumstances.
Isotopically labelled compounds of the invention can be prepared by conventional techniques known to those skilled in the art, for example by carrying out isotopic substitution reactions or by using isotopically labelled reagents in place of non-labelled reagents.
Preferably, the compound for use according to the present invention is a compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, stereoisomer or isotopically labelled derivative thereof. More preferably, the compound for use is a compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, stereoisomer or isotopically labelled derivative thereof.
Treatment
In diseases which are associated with misfolded proteins, it is typical for the misfolded protein to display an increased tendency to bind to itself and thus form protein oligomers, aggregates and fibrils. This is often associated with an increase in the formation of a β-sheet secondary protein structure. These aggregates are resistant to the normal cellular clearance of proteins and therefore accumulate, potentially forming plaques consisting of large aggregates. These are widely known to be toxic species in a range of diseases associated with misfolded proteins. This can cause cell death and/or abnormal function of the affected tissue. The formation and growth of these aggregates involves the generation of new aggregates and the propagation of existing aggregates. Thus, diseases related to misfolded proteins are commonly caused, symptomised by or otherwise associated with the formation, accumulation, deposition and persistence of such oligomers, aggregates, fibrils and/or plaques of proteins and/or peptides. A treatment for ophthalomological conditions which are associated with the misfolding of proteins and/or peptides, such as that provided by the present invention, may therefore target such aggregated species.
Thus, in one embodiment the compound of the invention may be for use in treating, preventing or inhibiting the formation, deposition, accumulation or persistence of oligomers, fibrils, aggregates and/or plaques of proteins and/or peptides.
Amyloidogenic proteins are an example of proteins with a tendency to aggregate, and these proteins can misfold and aggregate leading to amyloidosis diseases. The amyloid precursor protein can undergo proteolysis to generate the Aβ peptide, which is associated with various ophthalmological conditions including glaucoma and AMD.
In a preferred embodiment, the compound of the invention is for use in treating, preventing or inhibiting the formation, deposition, accumulation or persistence of amyloid oligomers, fibrils, aggregates and/or plaques. More preferably, the amyloid oligomers, fibrils, aggregates and/or plaques are amyloid-β oligomers, fibrils, aggregates and/or plaques.
Protein aggregation is a very complex and multi-factorial process and it has proved very difficult to obtain accurate knowledge regarding the molecular mechanisms underlying the generation of toxic species and the process by which small molecules interfere with the aggregation pathway. Widespread evidence suggests that pre-fibrillar oligomeric species, rather than mature amyloid plaques, are the primary pathogenic agents. These oligomeric species are challenging to characterise due to their transient nature, which complicates drug discovery. This amongst many other evidences suggest that effective therapeutic strategies are unlikely to consist of a nonspecific suppression of the fibril formation process, but rather to involve the targeting of specific species in a controlled intervention at a precise microscopic step during the greatly complex and heterogeneous aggregation process.
Recent advances in establishing rate laws in chemical kinetics have allowed the details of Aβ macroscopic kinetic measurements to be finely described at the microscopic levels. The establishment of rate laws allowed at least three different classes of microscopic processes to be distinguished. The generation of aggregates can occur through either primary pathways, where new aggregates form from soluble monomers, or through secondary pathways. In the secondary pathways, new aggregates proliferate though either fragmentation, which is monomer-independent, or through surface catalysed secondary nucleation, which is monomer dependent.
As a consequence of this development, a key discovery has been made showing that the dominant mechanism responsible for the generation of toxic Aβ species is a specific step in the aggregation process, namely the surface-catalysed secondary nucleation. This finding is clearly important because unlike previous non-specific inhibition of aggregation measurements, it allows for the toxic process to be specifically targeted. This advance has also led to the conclusion that inhibiting Aβ aggregation per se, without an accurate knowledge of the underlying microscopic processes, could have unexpected consequences on the toxicity. Indeed, it could not only decrease it, but also leave it unaffected, or even increase it in the case the wrong microscopic step is targeted. Furthermore, the application of chemical kinetics does not require prior knowledge of the structure of the pathogenic species and it is not limited by the need for high protein-molecule binding affinities. Accordingly, the identification of efficient inhibitors that can perturb a specific microscopic step in Aβ42 aggregation could provide an efficient strategy for suppressing pathogenicity.
In one embodiment, the treating, preventing or inhibiting the formation, deposition, accumulation, or persistence of protein and/or peptide oligomers, fibrils, aggregates and/or plaques as discussed above may be achieved by inhibiting the primary nucleation and/or the surface-catalysed secondary nucleation of such oligomers, fibrils, aggregates and/or plaques. Preferably, this is achieved by inhibiting both the primary nucleation and secondary nucleation of oligomers, fibrils, aggregates and/or plaques. The oligomers, fibrils, aggregates and/or plaques are preferably Aβ oligomers, fibrils, aggregates and/or plaques, as discussed above.
The compounds of the invention may be used in a method of treating a subject suffering from or susceptible to an ophthalmological condition, which method comprises administering to said subject an effective amount of the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof. The compounds may be used in combination with additional therapeutic agent(s), as desired.
Multiple ophthalmological conditions can overlap. When the ophthalmological condition is associated with protein misfolding, multiple proteins can be involved. Given the general phenomenon of protein aggregation, drugs which are known to be effective in the treatment and/or prevention of the misfolding of one peptide may be modified to be effective in the treatment and/or prevention of the misfolding of other peptides.
In the present invention, the ophthalmological condition is preferably associated with protein misfolding. For example, the ophthlmological condition may be a retinal disease as discussed further below, cataracts or corneal dystrophy, such as lattice corneal dystrophy, Granular corneal dystrophy (Reis-Bücklers), Thiel-Behnke, Avellino dystrophy, Fuchs dystrophy. More preferably, the ophthalmological condition is associated with misfolding of the Aβ peptide. Thus, for example, the Aβ peptide may cause, symptomize and/or otherwise be associated with the ophthalmological condition (such as, for example, glaucoma or AMD).
In some embodiments, the ophthalmological condition is a retinal disease selected from: macular degeneration, macular pucker, glaucoma, retinitis pigmentosa, choroidal neovascularization, retinal degeneration, oxygen-induced retinopathy, proliferative vitreoretinopathy, uveitis, retinopathy of prematurity, retrolental fibroplasia, retinoschisis, lattice degeneration, retinal detachment and/or retinal ganglion cell degeneration.
In one embodiment, the ophthalmological condition is glaucoma. The glaucoma may be, for example, open-angle glaucoma, close-angle glaucoma, high-tension glaucoma, low-tension glaucoma, normal tension glaucoma, primary glaucoma, pigmentary glaucoma, primary juvenile glaucoma, developmental glaucoma, inflammatory glaucoma, traumatic glaucoma such as postsurgical glaucoma, drug-induced glaucoma and/or toxic glaucoma.
In one embodiment, the ophthalmological condition is macular degeneration. The macular degeneration may be, for example, age-related macular degeneration (AMD) or a genetic disorder such as Best's disease, Sorsby's fundus dystrophy or Stargardt's disease. Preferably, the macular degeneration is AMD. The AMD may be dry AMD or wet AMD. Preferably, the AMD is dry AMD. Furthermore, the AMD may be early, intermediate or late type AMD. Preferably, the AMD is early type AMD. More preferably, the AMD is early type dry AMD.
In a preferred embodiment, the compound is for use in the treatment of a patient which has been diagnosed with glaucoma and/or dry AMD. Thus, in one preferred embodiment, the compound is for use in the treatment of a patient which has been diagnosed with glaucoma. In another preferred embodiment, the compound is for use in the treatment of a patient which has been diagnosed with dry AMD.
In one embodiment of the present invention, the compound is for use in the treatment of a patient which is at risk of developing glaucoma and/or dry AMD. Furthermore, the patient preferably has a family history of glaucoma and/or dry AMD. When the patient is at risk of developing glaucoma and/or dry AMD, and/or has a family history of glaucoma and/or dry AMD, early stage intervention is possible and the formation of plaques can be avoided or reduced. This presents an opportunity for developing an effective strategy for preventing or delaying the onset of symptoms. In particular, the compound of the present invention is highly effective at preventing the nucleation of Aβ aggregates and may therefore be particularly effective when used as an early stage intervention.
The present invention additionally provides a method of treating and/or preventing an ophthalmological condition as described above in a patient which comprises administering to said patient an effective amount of a compound of the present invention as described above or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, analog or isotopically labelled derivative thereof. Preferred features of the compound for use as defined herein are also preferred features of the method of the invention.
The present invention further provides the use of a compound of the present invention as described above or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, analog or isotopically labelled derivative thereof in the manufacture of a medicament for the treatment and/or prevention of an ophthalmological condition as described above. Preferred features of the compound for use as defined herein are also preferred features of the use of the invention.
In one preferred embodiment, the present invention relates to a compound of Formula (I) as discussed above, or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, for use in the treatment and/or prevention of an ophthalmological condition selected from macular degeneration, macular pucker, glaucoma, retinitis pigmentosa, choroidal neovascularization, retinal degeneration, oxygen-induced retinopathy, proliferative vitreoretinopathy, uveitis, retinopathy of prematurity, retrolental fibroplasia, retinoschisis, lattice degeneration, retinal detachment and/or retinal ganglion cell degeneration. In a preferred embodiment, the compound is for use in the treatment and/or prevention of glaucoma. In a preferred embodiment, the compound is for use in the treatment and/or prevention of dry AMD.
In another preferred embodiment, the present invention relates to a compound of Formula (IA) as discussed above, or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, for use in the treatment and/or prevention of an ophthalmological condition selected from macular degeneration, macular pucker, glaucoma, retinitis pigmentosa, choroidal neovascularization, retinal degeneration, oxygen-induced retinopathy, proliferative vitreoretinopathy, uveitis, retinopathy of prematurity, retrolental fibroplasia, retinoschisis, lattice degeneration, retinal detachment and/or retinal ganglion cell degeneration. In a preferred embodiment, the compound is for use in the treatment and/or prevention of glaucoma. In a preferred embodiment, the compound is for use in the treatment and/or prevention of dry AMD.
In another preferred embodiment, the present invention relates to a compound of Formula (II) or (III) as discussed above, or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, for use in the treatment and/or prevention of an ophthalmological condition selected from macular degeneration, macular pucker, glaucoma, retinitis pigmentosa, choroidal neovascularization, retinal degeneration, oxygen-induced retinopathy, proliferative vitreoretinopathy, uveitis, retinopathy of prematurity, retrolental fibroplasia, retinoschisis, lattice degeneration, retinal detachment and/or retinal ganglion cell degeneration. In a preferred embodiment, the compound is for use in the treatment and/or prevention of glaucoma. In a preferred embodiment, the compound is for use in the treatment and/or prevention of dry AMD.
In another preferred embodiment, the present invention relates to Netoglitazone, Ciglitazone, Englitazone, Darglitazone or Troglitazone, preferably Netoglitazone, Ciglitazone, or Englitazone, more preferably Netoglitazone, or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, for use in the treatment and/or prevention of an ophthalmological condition selected from macular degeneration, macular pucker, glaucoma, retinitis pigmentosa, choroidal neovascularization, retinal degeneration, oxygen-induced retinopathy, proliferative vitreoretinopathy, uveitis, retinopathy of prematurity, retrolental fibroplasia, retinoschisis, lattice degeneration, retinal detachment and/or retinal ganglion cell degeneration. In a preferred embodiment, the compound is for use in the treatment and/or prevention of glaucoma. In a preferred embodiment, the compound is for use in the treatment and/or prevention of dry AMD.
Pharmaceutical Compositions and Administration
The present invention also provides a pharmaceutical composition comprising the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof for use in treating and/or preventing an ophthalmological condition. In one embodiment, this composition further comprises one or more pharmaceutically acceptable carriers diluents, excipients and/or additives. Preferred features of the compound for use as defined herein are also preferred features of the composition for use.
Preferably, the composition is a solution of the compound of the invention in a liquid carrier. Preferred pharmaceutical compositions are sterile.
The concentration of the compound of the invention in a pharmaceutical composition will vary depending on several factors, including the dosage of the compound to be administered.
In one embodiment, the compound of the invention is administered as a monotherapy. In another embodiment, the present invention provides a pharmaceutical combination of the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, with one or more additional therapeutic agent(s), wherein the additional therapeutic agent(s) are suitable for the treatment and/or prevention of an ophthalmological condition. Thus, the compound of the invention is present in the combinations, compositions and products of the invention with one or more additional therapeutic agent(s).
In one embodiment the present invention provides a pharmaceutical composition comprising (i) a compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, (ii) one or more additional therapeutic agent(s), which additional therapeutic agent(s) may be as defined herein and (iii) one or more pharmaceutically acceptable carriers and/or excipients.
Typically, the combination is a combination in which the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, and the additional therapeutic agent(s) are formulated for separate, simultaneous or successive administration. The combination may optionally also comprise a pharmaceutically acceptable carrier or diluent.
When, for example, the compound of the invention is part of a combination (such as a pharmaceutical combination) as defined herein, formulated for separate, simultaneous or successive administration, (a) the pharmaceutical compound of the invention, and (b) the additional therapeutic agent(s) may be administered by the same mode of administration or by different modes of administration.
For simultaneous administration, the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, and the additional therapeutic agent(s) may for example be provided in a single composition. Thus, the composition may, for example, comprise the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, and the additional therapeutic agent(s), and optionally a pharmaceutically acceptable carrier or diluent. For separate or successive administration, the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, and the additional therapeutic agent(s) may, for example, be provided as a kit.
The additional therapeutic agent(s) used in the invention can be any suitable therapeutic agent that the skilled person would judge to be useful in the circumstances. When the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof is for use in the treatment of glaucoma, particularly suitable classes of therapeutic agents include drugs suitable for lowering intraocular pressure (e.g. α-agonists, β-blockers, carbonic anhydrase inhibitors and prostaglandin analogues). When the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof is for use in the treatment of AMD, particularly suitable classes of therapeutic agents include nutritional supplements (e.g. Vitamins C and/or E, Beta carotene, Zinc and Lutein, preferably Lutein), which have been shown to slow progression of AMD. When the AMD is wet AMD, a particularly suitable class of therapeutic agents is inhibitors of vascular endothelial growth factor. In a preferable embodiment, the additional therapeutic agent(s) are suitable for the treatment and/or prevention of an ophthalmological condition.
In one embodiment, the composition of the invention is formulated to improve localisation to the visual system, such as the eye or the optic nerve. Thus, in one embodiment the composition of the invention may be formulated for intraocular administration, for example as a solution suitable for application into the eye. In one embodiment, the composition of the invention is suitable to be administered as an eye drop. In another embodiment, the composition of the invention is suitable to be administered by ophthalmic injection.
A further approach is intranasal administration, a non-invasive drug delivery technique that introduces the drug via the olfactory nerves, where the drug is directly delivered from the nasal mucosa to the visual system by transcellular absorption or endocytosis.
The compound, combinations, compositions and products of the invention may be administered in a variety of dosage forms. Thus, they can be administered orally, for example as tablets, troches, lozenges, aqueous or oily suspensions, dispersible powders or granules. The compound, combinations, compositions and products of the invention may also be administered parenterally, either subcutaneously, intravenously, intramuscularly, intrasternally, transdermally or by infusion techniques.
The compound, combinations, compositions and products of the invention may also be administered intraocularly, for example as an eye drop solution. The compound, combinations, compositions and products of the invention may also be administered intranasally, for example by spraying into the nasal cavity.
Depending on the vehicle and concentration used, the drugs can either be suspended or dissolved in the vehicle. Advantageously, adjuvants such as a local anaesthetic, preservative and buffering agent can be dissolved in the vehicle. The compound, combinations, compositions and products may also be administered as suppositories. The compounds, combinations, compositions and products may be administered by inhalation in the form of an aerosol via an inhaler or nebuliser. The pharmaceutical compound of the invention, pharmaceutical combinations and pharmaceutical compositions may be administered topically, for example, as a cream, foam, gel, lotion, or ointment.
A compound of the invention, and optionally additional therapeutic agent(s), is typically formulated for administration with a pharmaceutically acceptable carrier or diluent. For example, solid oral forms may contain, together with the active compound, solubilising agents, e.g. cyclodextrins or modified cyclodextrins; diluents, e.g. lactose, dextrose, saccharose, cellulose, corn starch or potato starch; lubricants, e.g. silica, talc, stearic acid, magnesium or calcium stearate, and/or polyethylene glycols; binding agents; e.g. starches, arabic gums, gelatin, methylcellulose, carboxymethylcellulose or polyvinyl pyrrolidone; disaggregating agents, e.g. starch, alginic acid, alginates or sodium starch glycolate; effervescing mixtures; dyestuffs; sweeteners; wetting agents, such as lecithin, polysorbates, laurylsulphates; and, in general, non-toxic and pharmacologically inactive substances used in pharmaceutical formulations. Such pharmaceutical preparations may be manufactured in known manner, for example, by means of mixing, granulating, tabletting, sugar-coating, or film coating processes.
Liquid dispersions for oral administration may be solutions, syrups, emulsions and suspensions. The solutions may contain solubilising agents e.g. cyclodextrins or modified cyclodextrins. The syrups may contain as carriers, for example, saccharose or saccharose with glycerine and/or mannitol and/or sorbitol.
Suspensions and emulsions may include pharmaceutically active compounds in which the average particle size has undergone particle size reduction by micronisation or nanonisation technologies. For instance, the average particle size of the compound of the invention may have undergone particle size reduction by micronisation or nanonisation technologies.
Suspensions and emulsions may contain as carrier, for example a natural gum, agar, sodium alginate, pectin, methylcellulose, carboxymethylcellulose, or polyvinyl alcohol. The suspensions or solutions for intramuscular injections may contain, together with the active compound, a pharmaceutically acceptable carrier, e.g. sterile water, olive oil, ethyl oleate, glycols, e.g. propylene glycol; solubilising agents, e.g. cyclodextrins or modified cyclodextrins, and if desired, a suitable amount of lidocaine hydrochloride.
Solutions for intravenous or infusions may contain as carrier, for example, sterile water and solubilising agents, e.g. cyclodextrins or modified cyclodextrins or preferably they may be in the form of sterile, aqueous, isotonic saline solutions.
For topical application to the skin, the compound may, for example, be made up into a cream, lotion or ointment. Cream or ointment formulations which may be used for the drug are conventional formulations well known in the art, for example as described in standard textbooks of pharmaceutics such as the British Pharmacopoeia.
For topical application by inhalation, the compound may be formulated for aerosol delivery for example, by pressure-driven jet atomizers or ultrasonic atomizers, or preferably by propellant-driven metered aerosols or propellant-free administration of micronized powders, for example, inhalation capsules or other “dry powder” delivery systems. Excipients, such as, for example, propellants (e.g. Frigen in the case of metered aerosols), surface-active substances, emulsifiers, stabilizers, preservatives, flavorings, and fillers (e.g. lactose in the case of powder inhalers) may be present in such inhaled formulations. For the purposes of inhalation, a large number of apparata are available with which aerosols of optimum particle size can be generated and administered, using an inhalation technique which is appropriate for the patient. In addition to the use of adaptors (spacers, expanders) and pear-shaped containers (e.g. Nebulator®, Volumatic®), and automatic devices emitting a puffer spray (Autohaler®), for metered aerosols, in particular in the case of powder inhalers, a number of technical solutions are available (e.g. Diskhaler®, Rotadisk®, Turbohaler® or the inhalers for example as described in European Patent Application EP 0 505 321).
A therapeutically effective amount of the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof is administered to a patient. A typical daily dose is, for example, from 0.1 to 25, from 0.2 to 20 or from 0.5 to 15 mg per kg of body weight, according to the activity of the compound or combination of specific therapeutic agents used, the age, weight and conditions of the subject to be treated, the type and severity of the disease and the frequency and route of administration. In one embodiment the daily dosage level is from 10 to 1500 mg, preferably from 15 to 1000 mg, and more preferably from 20 to 500 mg. Where a combination is administered, the compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof is typically administered in an amount of at least 1 mg, preferably at least 5 mg, 10 mg or at least 20 mg. A preferred upper limit on the amount of compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof administered is typically 200 mg, e.g. 100 mg, 50 mg or 25 mg. The compound of the invention or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof is typically administered in twice daily dosages of 5 to 50 mg, preferably 10 to 40 mg and more preferably 15 to 30 mg. Any additional therapeutic agent(s) are typically administered at or below the standard dose used for that drug. The compound, combination or composition of the invention is typically administered to the patient in a non-toxic amount.
In an embodiment of the present invention, the compound or composition of the invention is administered such that the compound of the invention is administered in a daily dose of from 0.1 mg/kg to 25 mg/kg. Preferably, the compound of the invention is administered in a daily dose of from 0.5 mg/kg to 15 mg/kg.
In another embodiment, the compound is administered in a daily dose of from 10 mg to 1500 mg. Preferably, the compound is administered in a daily dose of from 20 mg to 500 mg.
In a further embodiment, the compound may be administered in a twice daily dose of from 5 mg to 50 mg, preferably in a twice daily dose of from 15 mg to 25 mg.
In an embodiment of the invention, the compound or composition of the invention is delivered in vivo in a mammal. In another embodiment the mammal is a human. In a specific embodiment the human has been diagnosed with glaucoma, is known to have glaucoma, is suspected of having glaucoma, or is at risk for developing glaucoma. In an embodiment, the human is known to have glaucoma and is receiving an additional therapy for glaucoma. In a specific embodiment the human has been diagnosed with dry AMD, is known to have dry AMD, is suspected of having dry AMD, or is at risk for developing dry AMD. In an embodiment, the human is known to have dry AMD and is receiving an additional therapy for dry AMD.
The present invention also provides a kit comprising the compound of the invention, or a pharmaceutically acceptable salt, tautomer, solvate, hydrate, prodrug, derivative, stereoisomer, analog or isotopically labelled derivative thereof, or a composition of the invention, for use in the treatment and/or prevention of an ophthalmological condition. The kit optionally further comprises, in admixture or in separate containers, an additional pharmaceutically active agent(s) as defined above. Preferred features of the compound or composition for use as defined herein are also preferred features of the kit of the invention.
The recombinant Aβ(M1-42) peptide (MDAEFRHDSGYEVHHQKLVFFAEDVG-SNKGAIIGLMVGGVVIA [SEQ ID NO: 1]), here called Aβ42, was expressed in the E. coli BL21 Gold (DE3) strain (Stratagene, CA, U.S.A.) and purified as described previously with slight modifications. Briefly, the purification procedure involved sonication of E. coli cells, dissolution of inclusion bodies in 8 M urea, and ion exchange in batch mode on diethylaminoethyl cellulose resin and lyophylization. The lyophilized fractions were further purified using Superdex 75 HR 26/60 column (GE Healthcare, Buckinghamshire, U.K.) and eluates were analyzed using SDS-PAGE for the presence of the desired protein product. The fractions containing the recombinant protein were combined, frozen using liquid nitrogen, and lyophilized again.
Except for Netoglitazone, which was custom synthesised by GVK BIO, all small molecules were purchased with a purity greater than 99%. Small molecules were first solubilized in 100% DMSO to a concentration of 5 mM, and then diluted in the peptide solution to reach a final DMSO concentration of maximum 1-3%. We verified that the addition of DMSO in the reaction mixture has no effect on Aβ42 aggregation.
Solutions of monomeric peptides were prepared by dissolving the lyophilized Aβ42 peptide in 6 M GuHCl. Monomeric forms were purified from potential oligomeric species and salt using a Superdex 75 10/300 GL column (GE Healthcare) at a flowrate of 0.5 mL/min, and were eluted in 20 mM sodium phosphate buffer, pH 8 supplemented with 200 μM EDTA and 0.02% NaN3. The centre of the peak was collected, and the peptide concentration was determined from the absorbance of the integrated peak area using ε280=1490 L mol−1 cm−1. The obtained monomer was diluted with buffer to the desired concentration and supplemented with 20 μM Thioflavin T (ThT) from a 1 mM stock. All samples were prepared in low binding Eppendorf tubes on ice using careful pipetting to avoid introduction of air bubbles. Each sample was then pipetted into multiple wells of a 96-well half-area, low-binding, clear bottom and PEG coating plate (Corning 3881), 80 μL per well. Aβ42 kinetics have been performed in the absence or the presence of Netoglitazone, Mitoglitazone, Rosiglotazone, Rivoglitazone, Pioglitazone, Ciglitazone, Englitazone, Darglitazone, Troglitazone and B alaglitazone.
For the seeded experiments, preformed fibrils were prepared just prior to the experiment. Kinetic experiments were set up as described above for 5 μM Aβ42 samples in 20 mM sodium phosphate buffer, pH 8 with 200 μM EDTA, 0.02% NaN3 and 20 μM ThT. The ThT fluorescence was monitored for 3 hours to verify the formation of fibrils. Samples were then collected from the wells into low-binding tubes. Under the considered conditions (i.e. 5 μM Aβ42), the monomer concentration is negligible at equilibrium. The final concentration of fibrils, in monomer equivalents, was considered equal to the initial concentration of monomer. Fibrils were then added to freshly prepared monomer in order to reach either 2% or 50% final concentration of seeds in the absence or the presence of Netoglitazone.
For the experiments of Aβ42 aggregation kinetics in human CSF, monomeric solutions of 3 μM Aβ42 were prepared similar to above with the only exception that the buffer was 20 mM Hepes, pH 8 supplemented with 1 mM CaCl2 at 150 mM NaCl. The obtained monomer was diluted with the buffer in order to reach 66% final concentration of CSF, in which the effect of CSF is close to maximum. Aβ42 aggregation kinetics were performed in the absence and the presence of 1.25 and 5-fold excess of Netoglitazone.
For the experiments monitoring A1340 aggregation kinetics, the experiments were performed similarly to those described above for Aβ42 at a concentration of 10 μM of A1340 in the absence or presence of 1.25-fold excess of Netoglitazone.
Assays were initiated by placing the 96-well plate at 37° C. under quiescent conditions in a plate reader (Fluostar Omega, Fluostar Optima or Fluostar Galaxy, BMGLabtech, Offenburg, Germany). The ThT fluorescence was measured through the bottom of the plate with a 440 nm excitation filter and a 480 nm emission filter. The ThT fluorescence was followed for three repeats of each sample.
The time evolution of the total fibril mass concentration is described as a function only of the initial conditions and the rate constants of the system by the integrated rate law given by Eq. (54) in Cohen et al., J Chem Phys 135, 065106, 2011.
Interestingly, to capture the complete assembly process for Aβ42 (Cohen et al., Proc Natl Acad Sci USA, 110(24), 9758-63, 2013), only two particular combinations of the rate constants define much of the macroscopic behaviour. These are related to the rate of formation of new aggregates through primary pathways λ=√{square root over (2k+knm(0)n
Inhibitors can interfere with the aggregation process by inhibiting one or more of the individual microscopic steps. We can identify the microscopic events that are inhibited by the chemical compounds by fitting the integrated rate law (Eq. (54) in Cohen et al., J Chem Phys 135, 065106) to the macroscopic aggregation profiles and comparing the fitted set of microscopic rate constants (k+k2 and k+kn in the absence of pre-formed seeds; k+ and k2 in the presence of pre-formed seeds where primary nucleation is bypassed) required to describe the time evolution of the fibril formation in the absence and presence of Netoglitazone. The analysis is analogous to that carried out in Habchi et al., Proc Natl Acad Sci USA; 114(2):E200-E208, 2017 to study the effects of other small molecules on Aβ42 aggregation.
Using the rate constants (kn, k2 or k+) in the presence of the molecules, we can also estimate the reactive flux towards oligomers (r(t)) as:
r(t)=knm(t)n
The time at which the generation of oligomers reaches a peak, as well as the total number of oligomers generated over time (time integral of r(t)) can subsequently be predicted.
Blotting was performed using Aβ42 fibril-specific antibody (OC, Millipore). During the time course of the aggregation of a 2 μM Aβ42 in the absence and in the presence of 5-fold excess of Netoglitazone, 4 μL Aβ42 aliquots were removed from the mixture at different time points for blotting with OC. Aβ42 aliquots were spotted onto a nitrocellulose membrane (0.2 μm, Whatman) and then the membranes were dried and then blocked with Blocking One (Nacalai tesque) before immuno-detection. OC was used according to the manufacturer's instructions. Alexa Fluor® 488-conjugated secondary antibodies (Life technologies) were subsequently added and fluorescence detection was performed using Typhoon Trio Imager (GE Healthcare).
20 μl Aliquots were taken at the t50 (i.e. half-time) from aggregation reactions of 5 μM Aβ42 in the absence and in the presence of 5-fold excess of Netoglitazone. Samples were then immobilised on a 96-well Maxisorp ELISA plate (Nunc, Roskilde, Denmark) with no shaking for 1 h at room temperature. The plate was then washed three times with 20 mM Tris pH 7.4, 100 mM NaCl and incubated in 20 mM Tris pH 7.4, 100 mM NaCl, 5% BSA under constant shaking overnight at 4° C. The day after the plate was washed six times with 20 mM Tris pH 7.4, 100 mM NaCl and then incubated with 30 μl solutions of 5 μM oligomer-specific antibody under constant shaking either for 1 hour or overnight at room temperature. At the end of this incubation, the plate was washed six times with 20 mM Tris pH 7.4, 100 mM NaCl and incubated with 30 μl solutions of Rabbit polyclonal to 6× His Tag® HRP conjugated (Abcam, Cambridge, UK) at a dilution of 1:4000 in 20 mM Tris pH 7.4, 100 mM NaCl, 5% BSA under shaking for 1 hour at room temperature. The plate was washed 3 times with 20 mM Tris pH 7.4, 100 mM NaCl, then twice with 20 mM Tris pH 7.4, 100 mM NaCl, 0.02% Tween-20 and again three times with 20 mM Tris pH 7.4, 100 mM NaCl. Finally, the amount of bound oligomer-specific antibody was quantified by using 1-Step™ Ultra TMB-ELISA Substrate Solution (ThermoFisher Scientific, Waltham, Mass., United States), according to manufacturer instructions, and measuring the absorbance at 450 nm by means of a CLARIOstar plate reader (BMG Labtech, Aylesbury, UK).
Single vesicles tethered to PLL-PEG coated borosilicate glass coverslides (VWR International, 22×22 mm, product number 63 1-0122) were placed on an oil immersion objective mounted on an inverted Olympus IX-71 microscope. Each coverslide was affixed at Frame-Seal incubation chambers and was incubated with 50 μL of HEPES buffer of pH 6.5. Just before the imaging, the HEPES buffer was replaced with 50 μL Ca2+ containing buffer solution L-15. 16 (4×4) images of the coverslide were recorded under three different conditions (background, in the presence of Aβ42 and after addition of ionomycin (Cambridge Bioscience Ltd, Cambridge, UK), respectively). The distance between each field of view was set to 100 μm, and was automated (bean-shell script, Micromanager) to avoid any user bias. After each measurement the script allowed the stage (Prior H117, Rockland, Mass., USA) to move the field of view back to the start position such that identical fields of view could be acquired for the three different conditions. Images of the background were acquired in the presence of L15 buffer. For each field of view 50 images were taken with an exposure time of 50 ms. Thereafter, 50 μL of the aggregation reaction, diluted to a concentration of twice the targeted value, was added and incubated for 10 min. Next, 10 μL of a solution containing 1 mg/mL of ionomycin (Cambridge Bioscience Ltd, Cambridge, UK) was added and incubated for 5 min and subsequently images of Ca2+ saturated single vesicles in the same fields of view were acquired. The recorded images were analysed using ImageJ to determine the fluorescence intensity of each spot under the three different conditions in the presence of an aggregation mixture incubated with and without Netoglitazone.
Methods—In Vivo (C. elegans)
Standard conditions were used for the propagation of C. elegans (S. Brenner, The genetics of Caenorhabditis elegans. Genetics. 77, 71-94 (1974)). Briefly, the animals were synchronized by hypochlorite bleaching, hatched overnight in M9 buffer (3 g/l KH2PO4, 6 g/l Na2HPO4, 5 g/l NaCl, 1 μM MgSO4), and subsequently cultured at 20° C. on nematode growth medium (NGM) (CaCl2 1 mM, MgSO4 1 mM, cholesterol 5 μg/mL, PBS Buffer (250 μM KH2PO4, 67.5 μM KCl, 3.425 mM of NaCl, pH 6), Agar 17 g/L, NaCl 3 g/l, casein 7.5 g/l) plates seeded with the E. coli strain OP50. Saturated cultures of OP50 were grown by inoculating 50 ml of LB medium (tryptone 10 g/l, NaCl 10 g/l, yeast extract 5 g/l) with OP50 and incubating the culture for 16 h at 37° C. NGM plates were seeded with bacteria by adding 350 μl of saturated OP50 to each plate and leaving the plates at 20° C. for 2-3 days. On day 3 after synchronisation, the animals were placed on NGM plates containing 5-fluoro-2′deoxy-uridine (FUDR) (75 μM, unless stated otherwise) to inhibit the growth of offspring.
The following strains were used:
GMC101 dvIs100[unc-54p::A-beta-1-42::unc-54 3′UTR+mt1-2p::GFP]. mt1-2p::GFP produces constitutive expression of GFP in intestinal cells. unc-54p::A-beta-1-42 expresses full-length human Aβ42 peptide in body wall muscle cells that aggregates in vivo. Shifting L4 or young adult animals from 20° to 24° C. causes paralysis (G. McColl et al., Utility of an improved model of amyloid-beta (Aβ1-42) toxicity in Caenorhabditis elegans for drug screening for Alzheimer's disease. Mol Neurodegener. 7, 57 (2012));
NL5901 (pkIs2386 [α-synuclein::YFP unc-119(+)]) (“α-syn worms”), in which α-synuclein fused to YFP relocates to inclusions, which are visible as early as day 2 after hatching and increase in number and size during the aging of the animals, up to late adulthood (day 17) (T. J. Van Ham et al., C. elegans model identifies genetic modifiers of α-synuclein inclusion formation during aging. PLoS Genetics. 4 (2008));
CL2331; dvIs37 [myo-3p::GFP::A-Beta (3-42)+rol-6(su1006)] (Aβ3-42::GFPMuscular worms). Maintain at 16 C. Roller. Diffuse and aggregated GFP expression in body wall muscle. Low brood size. Sicker at higher temperatures. (C. D. Link et al., The β amyloid peptide can act as a modular aggregation domain. Neurobiol. Dis. 32, 420-425 (2008));
CL2355 [pCL45 (snb-1::Abeta 1-42::3′ UTR(long)+mt1-2::GFP] (Aβ1-42Neur worms). Maintain at 16 C. Pan-neuronal expression of human Abeta peptide. Constitutive intestinal expression of GFP from marker transgene. Strain shows deficits in chemotaxis, associative learning, and thrashing in liquid. Strain also has incomplete sterility due to germline proliferation defects and embryonic lethality (Y. Wu et al., Amyloid-beta-induced pathological behaviors are suppressed by Ginkgo biloba extract EGb 761 and ginkgolides in transgenic Caenorhabditis elegans. J. Neurosci. 26, 13102-13113 (2006)); and
N2 C. elegans var. Bristol used as controls (also labelled “healthy”). Generation time is about 3 days. Brood size is about 350, wild type phenotype, sub-cultured in 1973 (S. Brenner, The genetics of Caenorhabditis elegans. Genetics. 77, 71-94 (1974)).
Drugs were administered as previously shown (M. Perni et al., Massively parallel C. elegans tracking provides multi-dimensional fingerprints for phenotypic discovery. J. Neurosci. Methods. 306, 57-67 (2018); J. Habchi et al., An anticancer drug suppresses the primary nucleation reaction that initiates the production of the toxic Aβ42 aggregates linked with Alzheimers disease. Science Advances. 2, e1501244-e1501244 (2016); J. Habchi et al., Systematic development of small molecules to inhibit specific microscopic steps of Aβ42 aggregation in Alzheimer's disease. Proc Natl Acad Sci USA. 114, E200-E208 (2017); M. Perni et al., Multistep Inhibition of α-Synuclein Aggregation and Toxicity in Vitro and in Vivo by Trodusquemine. ACS Chem Biol, 17; 13(8):2308-2319 (2018)).
Briefly, Netoglitazone stocks (5 mM in 100% DMSO) were used at an appropriate concentration to seed 9-cm NGM plates. Plates were then placed in a laminar flow hood at room temperature (22° C.) for up to 4 hours to dry. C. elegans cultures were then transferred onto media seeded with compound as L4 stage or Day 3 for late treatments and incubated at 24° for the whole experiment. Experiments were carried out at different Netoglitazone concentrations ranging from 0.05 to 500 μM in 1% DMSO. As controls, plates seeded only with 1% DMSO were used.
All C. elegans populations were cultured at 20° C. and developmentally synchronized from a 4 h egg-lay. At 64-72 h post-egg-lay (time zero), individuals were transferred to FUDR plates, and body movements were assessed over the times indicated. At different ages, the animals were washed off the plates with M9 buffer and spread over an OP-50 unseeded 9 cm plate, after which their movements were recorded at 20 fps using a recently developed microscopic procedure (M. Perni et al., Massively parallel C. elegans tracking provides multi-dimensional fingerprints for phenotypic discovery. J. Neurosci. Methods. 306, 57-67 (2018)) for 1 min. Up to 600 animals were counted in each experiment in duplicate unless stated otherwise. One experiment that is representative of the three or more measured in each series of experiments is shown, and videos were analysed using a custom-made tracking code (M. Perni et al., Massively parallel C. elegans tracking provides multi-dimensional fingerprints for phenotypic discovery. J. Neurosci. Methods. 306, 57-67 (2018)).
Staining and Microscopy in Living C. elegans
Plaques staining was carried out as previously described (J. Habchi et al. (2016); M. Perni et al., A natural product inhibits the initiation of α-synuclein aggregation & suppresses its toxicity. Proc. Natl. Acad. Sci. U.S.A. 114, E1009-E1017 (2017)). Briefly, live transgenic animals were incubated with NIAD-4 over a range of concentrations and times, with 1 μM NIAD-4 (0.1% DMSO in M9 buffer) for 4 hours at room temperature. After staining, animals were allowed to recover on NGM plates for about 24 hours to allow destaining via normal metabolism. Stained animals were mounted on 2% agarose pads containing 40 mM NaN3 as anaesthetic on glass microscope slides for imaging. Images were captured with a Zeiss Axio Observer D1 fluorescence microscope (Carl Zeiss Microscopy GmbH) with a 20× objective and a 49004 ET-CY3/TRITC filter (Chroma Technology Corp). Fluorescence intensity was calculated using ImageJ software (National Institutes of Health) and then normalized as the corrected total cell fluorescence. Only the head region was considered because of the high background signal in the guts. All experiments were carried out in triplicate, and the data from one representative experiment are shown. Statistical significance was determined using t tests.
Chemotaxis measurements were carried out as previously described (O. Margie, C. Palmer, I. Chin-Sang, C. elegans Chemotaxis Assay. J Vis Exp, e50069 (2013)) and as illustrated in
(number of worms at the attractant locations−number of worms at the control locations)/total number of worms on the plate
Worms that were remaining in the central quadrant were excluded.
ROS-Glo™ H2O2 cell kit assay was used (Promega, Fitchburg, Wis., USA) and adapted for C. elegans studies. The ROS-Glo™ H2O2 Assay is a bioluminescent assay that measures the level of H2O2, a reactive oxygen species (ROS), directly in cell culture or tissue or in defined enzyme reactions. A derivatized luciferin substrate is incubated with sample and reacts directly with H2O2 to generate a luciferin precursor. Worms treated with 5 μM Netoglitazone in 1% DMSO or 1% DMSO only were washed using M9 buffer out the NGM plates. The buffer was then changed 3 times to remove the excess bacteria. Worm pellets were then divided in three wells and 80 μl of worm pellet (around 200 worms/well) was incubated for 6 h at RT with 20 μl of a ROS Substrate Solution (Promega, Fitchburg, Wis., USA); mild shaking at 300 rpm was used to avoid worm sedimentation; afterwards, worms were incubated for ca. 20 min with 100 μl of the detection solution; luminescence was then measured with a Clariostar (BMG Labtech, Aylesbury, UK).
The experimental anti-diabetic drug Netoglitazone is a peroxisome proliferator-activated receptor (PPAR) agonist belonging to the thiazolidinedione group. The present inventors have confirmed the effect of Netoglitazone and other glitazones using a range of biochemical, biophysical tools, including measurements in human Cerebrospinal fluid (CSF), and using an in vivo model of Aβ-mediated toxicity, Caenorhabditis elegans (C. elegans). Characterized by its simple anatomy, short lifespan, and well-established genetics, the nematode worm Caenorhabditis elegans has become a powerful model organism in biomedical research, in particular for genetic studies and drug screening. These worms are small (ca. 1 mm in length), transparent, easy to manipulate, with a short maturation period of 3 days from egg to adult at 25° C., and a life-span between 2 and 3 weeks, characteristics which facilitate the rapid study of multiple aspects of their biology. Nevertheless, they have a cellular complexity and tissue-specific protein expression profile comparable to that of higher organisms. As a result, C. elegans is commonly employed as a model organism for the characterization of the molecular mechanisms underlying neurodegeneration, in particular protein aggregation.
The health and fitness of C. elegans has conventionally been quantified in liquid media by counting the number of body bends per minute (BPM), or by measuring the speed of movement of the worms. Other key readouts in such studies are lifespan and paralysis which have, for example, recently led to major discoveries in the field of ageing, including the identification of specific genes and compounds modulating longevity, the link between oxidative stress and mitochondrial function, and the triggers for neurodegenerative diseases.
In order to screen for the effect of therapeutics in the most robust way, a wide field-of-view nematode-tracking platform (WF-NTP) was used, which enables the simultaneous investigation of multiple phenotypic readouts on large worm populations. The WF-NTP monitors up 5000 animals in parallel, and the phenotypical readout includes multiple parallel parameters.
It is shown that certain glitazones, including in particular Netoglitazone, are able restore the phenotype of healthy control worms in terms of their fitness and ROS production but not the cognate α-synuclein-mediated toxicity model, thus suggesting their specificity towards the aggregation of the Aβ peptide. Finally, it is shown that the improvement that was observed in the fitness of the Aβ-mediated toxicity model worms (“Aβ worms”) correlates extremely well with the decrease in the amount of aggregates that are formed in the worms during their life cycle.
The following non-limiting Examples illustrate the invention.
Aβ42 fibril formation was monitored in vitro using a 2 μM Aβ42 sample in the absence and the presence of Netoglitazone. For Aβ42 alone the half-time of aggregation was roughly 2 h under the buffer conditions used. A substantial delay in Aβ42 aggregation was observed in a concentration-dependent manner. This can be seen in
To investigate these effects further and to exclude possible interferences of the compounds with ThT binding to Aβ42 fibrils and the fluorescence measurements, the quantities of Aβ42 fibrils were probed at eight time points during the aggregation reaction in the absence and presence of 5-fold excess of Netoglitazone using a dot-blot assay with fibril-sensitive OC primary antibodies. These results can be seen in
A quantitative analysis was carried out on the effects of the molecules by matching the experimental aggregation profiles to kinetic curves calculated using the rate laws derived from a master equation that relates the time evolution of fibril formation to the rate constants of the different microscopic events. In this approach, the aggregation profiles in the presence of an inhibitor are described by introducing into the rate laws suitable perturbations to each of the microscopic rate constants evaluated in the absence of the inhibitor. The modifications of the rate constants required to describe the aggregation profiles in the presence of different concentrations of inhibitor are then indicative of the specific process affected by the presence of Netoglitazone.
In the presence of small molecules, the data are extremely well described when the rate constants of both primary (knk+) and secondary (k2k+) pathways are reduced, where kn is the rate constant of primary nucleation, k2 is the rate constant of surface-catalyzed secondary nucleation and k+ is the rate constant of elongation. All kinetic curves were compared to simulations where both primary and secondary pathways were decreased concomitantly and the rate constants of both pathways were plotted against the concentration of small molecules. These results can be seen in
To further explore the effects of Netoglitazone on distinct steps of the aggregation reaction, specifically the surface-catalyzed secondary nucleation and elongation steps, an additional series of kinetic measurements were carried out in the presence of Netoglitazone and either 2% or 50% of pre-formed fibril seeds. Normalised kinetics profiles in the absence of Netoglitazone under these conditions can be seen in
To obtain a more complete assessment on the effect of Netoglitazone on the secondary pathways of Aβ42 aggregation, the aggregation kinetics of a 2 μM Aβ42 sample in the presence of 2% fibril seeds was measured. These results can be seen in
Whether Netoglitazone retards Aβ42 aggregation under more physiologically relevant conditions was explored. Thus, the effect of Netoglitazone on the aggregation kinetics of Aβ42 in human cerebrospinal fluid (CSF) was monitored. CSF caused a concentration-dependent retardation of Aβ42 aggregation, suggesting that Aβ42 aggregation is slower in this fluid in line with previous results. We then investigated the effect of Netoglitazone under conditions where the effect of CSF is close to maximal, i.e. 66%. As can be seen in
To translate these findings into the possible effects on the generation of toxic forms of A1342 oligomers, a combination of simulation and experimental tools were used to assess the effect of Netoglitazone on the formation of Aβ42 oligomers. Indeed, from the aggregation kinetics curves of a 2 μM sample of Aβ42 in the absence or presence of 5-fold excess of Netoglitazone, shown in
Next, an ELISA was carried out using an oligomer-specific antibody, allowing a direct measurement of the concentration of Aβ42 oligomers formed by aggregation reactions in the absence and presence of Netoglitazone. The results, shown in
In order to further confirm the inhibition of Aβ aggregation that is observed in vitro, the effects of Netoglitazone were tested using a well-known model of Aβ-mediated toxicity (GMC101). In this model the 42-residue isoform of the human Aβ peptide is over expressed in the big muscle cells of C. elegans worms and this leads to age dependent protein aggregation and consequent muscular paralysis.
A treatment regime was at first defined by administering Netoglitazone at the last larval stage L4 (i. e. before the onset of the paralysis) as shown in
As a next step, the effect of Netoglitazone on the aggregation profile of the Aβ peptide in the worms was investigated. By using the amyloid specific dye NIAD-4, it was possible to stain for the plaques load in living Aβ worms. It was observed that the administration of 0.5 μM of Netoglitazone could significantly decrease the plaques load in Aβ worms, as shown in
The effect of Netoglitazone on the worm metabolic activities was investigated. Specifically, the levels of ROS production that are up-regulated in animals with Aβ-mediated toxicity were measured compared to healthy controls, and it was observed that Netoglitazone significantly decreased the levels of oxidative species, as shown in
The administration of Netoglitazone at L4 would in theory correspond to a preventative treatment since at the larval stages, no protein aggregates have been formed. This correlates extremely well with the in vitro studies where Netoglitazone was able to inhibit significantly the primary pathways. Given that Netoglitazone was also able to decrease the rate of surface-catalysed secondary nucleation and hence block the catalytic cycle of the aggregate proliferation, an assessment of this effect in vivo was sought.
Netoglitazone was administered at D3 of adulthood, a scenario where protein aggregates have already formed and a dysfunction of the phenotype in animals with Aβ-mediated toxicity can already be observed. Consequently, any possible effect of the drug would be ascribed to a therapeutic intervention by blocking the catalytic cycle of the aggregation inside the worms. Interestingly, in agreement with in vitro studies, it was found that this dosing regime also led to a significant decrease of the plaques load at D6 and an increase of the worm's mobility and survival rate, thus suggesting that Netoglitazone can affect secondary nucleation processes in vivo as well as in vitro. These results are shown in
Aβ42 fibril formation was monitored using fluorescence intensity in vitro using a 2 μM Aβ42 sample in the presence of Ciglitazone, Englitazone, Darglitazone, Troglitazone, Pioglitazone, Rosiglitazone, Rivoglitazone, Balaglitazone and Mitoglitazone, respectively, in the same manner as in Example 1.
Ciglitazone, Englitazone, Darglitazone and Troglitazone were observed to delay Aβ42 aggregation. In particular, Ciglitazone and Englitazone significantly delayed aggregation. This can be seen in
Further experiments with an additional C. elegans model were carried out, using Aβ1-42Neur worms, which exhibit pan-neuronal expression of Aβ peptides. Netoglitazone was administered at concentrations ranging from 0.05 to 500 μM in 1% DMSO. As controls, plates seeded only with 1% DMSO were used.
Automated motility assays were carried out and the movements of the animals recorded. As shown in
Chemotaxis assays were also carried out as shown in
Motility experiments were also carried out with Aβ3-42::GFPMuscular worms. As shown in
| Number | Date | Country | Kind |
|---|---|---|---|
| 1805554.1 | Apr 2018 | GB | national |
| 1805557.4 | Apr 2018 | GB | national |
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/GB2019/050983 | 4/4/2019 | WO | 00 |
