Claims
- 1. A method of producing a transformed plant, comprising incorporating into the nuclear genome of the plant an isolated DNA which comprises a structural gene coding for a Bowman-Birk trypsin inhibitor from Vigna unguiculata and expresses said Bowman-Birk trypsin inhibitor from Vigna unguiculata in leaves, stems or roots of said transformed plant in an insecticidally-effective amount.
- 2. The method of claim 1, wherein said incorporating comprises transforming plant tissue or cells with a plasmid which comprises, from 5' to 3', a cauliflower mosaic virus 35S RNA promoter, a polylinker cloning site into which said structural gene has been inserted, and Agrobacterium transcription termination and mRNA polyadenylation signals.
- 3. The method of claim 2, wherein said plasmid is pROK2.
- 4. The method of claim 1, wherein said plant is of the genus Nicotiana.
- 5. The method of claim 4, wherein said plant is Nicotiana Tabacum or Nicotiana plumbaginifolia.
- 6. The method of claim 2, wherein said structural gene encodes a protein having a sequence selected from the group consisting of:
- (a) (H.sub.2 N)-?SGDHHQDFTDEPSE??EACCDQCECTKSIPPQCRCSDVRLNSCHS ACKSCACTFSIPAQCFCGDINDFCYKPCKSDSHDD???-(COOH),
- (b) (H.sub.2 N)-SGDHHEATDEPSESSEACCDRCECTKSIPPQCRCSDVRLNSCHS ACKSCACTFSIPAQCFCGDINDSCYKPCKSSSHDDDDWDK-(COOH), and
- (c) (H.sub.2 N)-SNHHDDSSDEPSESSEPCCDSCICTKSIPPQCHCTDIRLNSCHS ACKSCMCTRSMPGKCRCLDIADFCYKPCKSRDEDDE-(COOH),
- where ? represents an amino acid residue at internal and C-terminal positions and a blocking group at an N-terminal position.
- 7. The method of claim 2, wherein said structural gene has the sequence: ##STR2##
- 8. The method of claim 2, wherein said structural gene has the sequence: ##STR3##
- 9. The method of claim 2, wherein said structural gene has the sequence: ##STR4##
- 10. The method of claim 2, wherein said structural gene has the sequence: ##STR5##
- 11. A transformed plant which contains and expresses a Bowman-Birk trypsin inhibitor from Vigna unguiculata in leaves, stems or roots in an insecticidally-effective amount, or an offspring of said transformed plant which contains and expresses a Bowman-Birk trypsin inhibitor from Vigna unguiculata in leaves, stems or roots in an insecticidally-effective amount.
- 12. The transformed plant of claim 11, prepared by incorporating into the nuclear genome of said plant an isolated DNA which comprises a structural gene coding for a Bowman-Birk trypsin inhibitor from Vigna unguiculata.
- 13. The transformed plant of claim 12, wherein said incorporating comprises transforming plant tissue or cells with a plasmid which comprises, from 5' to 3', a cauliflower mosaic virus 35S RNA promoter, a polylinker cloning site into which said structural gene has been inserted, and Agrobacterium transcription termination and mRNA polyadenylation signals.
- 14. The transformed plant of claim 13, wherein said plasmid is pROK2.
- 15. The transformed plant of claim 11, wherein said plant is of the genus Nicotiana.
- 16. The transformed plant of claim 15, wherein said plant is Nicotiana tabacum or Nicotiana plumbaginifolia.
- 17. The transformed plant of claim 11, wherein said Bowman-Birk trypsin inhibitor from Vigna unguiculata has a sequence selected from the group consisting of:
- (a) (H.sub.2 N)-?SGDHHQDFTDEPSE?'EACCDQCECTKSIPPQCRCSDVRLNSCHS ACKSCACTFSIPAQCFCGDINDFCYKPCKSDSHDD???-(COOH),
- (b) (H.sub.2 N)-SGDHHEATDEPSESSEACCDRCECTKSIPPQCRCSDVRLNSCHS ACKSCACTFSIPAQCFCGDINDSCYKPCKSSSHDDDDWDK-(COOH), and
- (c) (H.sub.2 N)-SNHHDDSSDEPSESSEPCCDSCICTKSIPPQCHCTDIRLNSCHS ACKSCMCTRSMPGKCRCLDIADFCYKPCKSRDEDDE-(COOH),
- where ? represents an amino acid residue at internal and C-terminal positions and a blocking group at an N-terminal position.
- 18. The transformed plant of claim 12, wherein said structural gene has the sequence: ##STR6##
- 19. The transformed plant of claim 12, wherein said structural gene has the sequence: ##STR7##
- 20. The transformed plant of claim 12, wherein said structural gene has the sequence: ##STR8##
- 21. The transformed plant of claim 12, wherein said structural gene has the sequence: ##STR9##
Priority Claims (2)
Number |
Date |
Country |
Kind |
8630448 |
Dec 1986 |
GBX |
|
8725610 |
Nov 1987 |
GBX |
|
Parent Case Info
This is a division of application Ser. No. 07/656,039, filed Feb. 19, 1991, now U.S. Pat. No. 5,218,104, which is a continuation of application Ser. No. 07/492,337, filed Mar. 12, 1990, abandoned, which is a continuation of application Ser. No. 07/134,842, filed Dec. 18, 1987, abandoned.
US Referenced Citations (1)
Number |
Name |
Date |
Kind |
4640836 |
Boulter et al. |
Feb 1987 |
|
Foreign Referenced Citations (1)
Number |
Date |
Country |
0135343 |
Mar 1985 |
EPX |
Divisions (1)
|
Number |
Date |
Country |
Parent |
656039 |
Feb 1991 |
|
Continuations (2)
|
Number |
Date |
Country |
Parent |
492337 |
Mar 1990 |
|
Parent |
134842 |
Dec 1987 |
|