Patent Application
20200240982
For detection applications, many immunoassays rely on recognition elements based on monoclonal or polyclonal antibodies (IgG) derived from mice, rabbits, goats, or sheep. Functional IgG are comprised of four polypeptide chains, two identical heavy (H) chains and two identical light (L) chains, linked by disulfide bonds. Each antibody has two antigen binding domains formed by the interaction of adjacent variable (V) domains from the H and L chains. The antigen binding surface is composed of six complementarity-determining regions (CDRs), three residing in each of the VII and VL protein domains. The interaction of these six CDR loops of varying sizes and sequences allows the formation of diversified antigen binding surfaces with the topologies to recognize a wide range of antigenic targets. Although sensitive and specific, conventional antibodies can be time-consuming and expensive to develop and are not easily molecularly engineered.
It was discovered that certain animals, such as camelids (i.e. camels, llamas) and sharks, possess a class of immunoglobulins consisting of heavy-chain homodimers where antigen binding is mediated through a single V domain (
While the recombinant antibody fragments, sdAb and scFv, offer several attractive properties relative to conventional antibodies, one limitation is that being small their covalent attachment to a surface in a random fashion can impair their binding function to a greater extent. To overcome this limitation, various methods have been used to orient the sdAb or scFv onto the capture surface. There have been a number of non-covalent methods examined to immobilize these antibody fragments including the incorporation of a biotinylation tag. In this case a biotin binding molecule is immobilized to the surface and the sdAb biotin fusion is then captured. This can work well but has limitations for many systems that utilize avidin-biotin interactions to generate the signal as its use for both parts of the sandwich assay leads to unacceptable background signals that reduces sensitivity. An alternative is to make a fusion of the sdAb with a biotin binding molecule, such as rhizavidin or strepcore avidin, in that case one needs to prepare a biotin surface and then allow the fusion sdAb-rhizavidin to bind down. Again this is not a suitable approach when avidin-biotin binding is used in later assay steps. Another limitation of any non-covalent immobilization is that even when the affinities of that interaction are quite high, in multiplexed situations such as one has with MagPlex microspheres (color coded microspheres that can be used in as much as a 50-plex assay) over extended storage time of the mixed microspheres some of the antibody could switch places, possibly leading to either false positives or negatives.
A further consideration in conducting assays is that complex matrices, such as plasma and serum, can dramatically reduce assay sensitivity. Thus, to achieve highly sensitive detection in complex matrices a highly effective assay is essential.
A need exists for techniques to improve limits of detection in assays using sdAb and other recombinant antibody fragments.
The patent or application file contains at least one drawing executed in color. Copies of this patent or patent application publication with color drawing(s) will be provided by the Office upon request and payment of the necessary fee.
In one embodiment, an isolated single-domain antibody comprises a single domain antibody (sdAb) configured as a fusion protein comprising SpyTag (SEQ ID NO: 4) at a C-terminal of the sdAb.
In another embodiment, an isolated single-domain antibody comprises a genetically engineered fusion protein comprising (a) either SEQ ID NO: 3 or SEQ ID NO: 5; and (b) SpyTag (SEQ ID NO: 4) positioned at a C-terminal end of the fusion protein.
In a further embodiment, a method of detection, comprises providing a surface comprising SpyCatcher (SEQ ID NO: 6); providing a single domain antibody (sdAb) configured as a fusion protein comprising SpyTag (SEQ ID NO: 4) at a C-terminal of the sdAb; and contacting the surface with a sample suspected to contain an antigen recognized by the sdAb, wherein binding of the antigen to the sdAb results in detection of the antigen in the sample.
Before describing the present invention in detail, it is to be understood that the terminology used in the specification is for the purpose of describing particular embodiments, and is not necessarily intended to be limiting. Although many methods, structures and materials similar, modified, or equivalent to those described herein can be used in the practice of the present invention without undue experimentation, the preferred methods, structures and materials are described herein. In describing and claiming the present invention, the following terminology will be used in accordance with the definitions set out below.
As used herein, the singular forms “a”, “an,” and “the” do not preclude plural referents, unless the content clearly dictates otherwise.
As used herein, the term “and/or” includes any and all combinations of one or more of the associated listed items.
As used herein, the term “about” when used in conjunction with a stated numerical value or range denotes somewhat more or somewhat less than the stated value or range, to within a range of ±10% of that stated.
Overview
The present inventors sought a technique to orient single domain antibodies (sdAb) to magnetic microspheres to improve the limits of detection achievable in immunoassays. A binding method involving partners interacting to form a covalent bond was found effective to orient single domain antibodies (sdAb) on a magnetic microsphere and improve their capacity to bind target antigen and improve limits of detection.
The examples described below use SpyTag and SpyCatcher, which are peptide-protein partners that lock together covalently, in order to orient sdAb. SpyCatcher was produced as a recombinant his-tagged protein followed by production of engineered SdAb-SpyTag-his tag fusion proteins. To prepare magnetic microspheres, the SpyCatcher was covalently immobilized using conventional EDC/sNHS chemistry. Incubation of the SpyCatcher-coated microspheres with the SdAb-SpyTag genetic fusion protein results in self-assembly to produce coated microspheres with the sdAb covalently attached in the desired orientation.
Aspects of this work were described in Anderson et al., “Oriented Immobilization of Single-Domain Antibodies Using SpyTag/SpyCatcher Yields Improved Limits of Detection,” Anal. Chem. 2019, 91, 15, 9424-9429 and its associated Supporting Information, incorporated herein by reference for the purposes of disclosing techniques for orientation of immobilized antibodies and their uses.
To achieve the goal of preparing a MagPlex microsphere with oriented sdAb, a number of fusion proteins were prepared. First the surface of the microsphere was covalently coated with SpyCatcher, which is a small protein similar in size to the sdAb, which will spontaneously covalently bind with SpyTag. Different versions of the sdAb-SpyTag protein were also prepared. For the Staphylococcal enterotoxin B (SEB) assay, three fusion proteins were made using an anti-SEB sdAb, AcVe. There were a monomer (AcVe), dimer (AcVe-AcVe), and trimer (AcVe-AcVe-AcVe) all with the SpyTag genetically linked to the C-terminal. AcVe-SpyTag, AcVe-AcVe-SpyTag, and AcVe-AcVe-AcVe-SpyTag. Versions were also prepared that lacked the SpyTag. Then MagPlex microspheres were coated with these six proteins in the conventional covalent method using EDC and sNHS (1-ethyl-3-(3-dimethylaminopropyl)carbodiimide hydrochloride and N-hydroxysulfosuccinimide) chemistry, as well as the three SpyTag fusions were attached via the spontaneous reaction of SpyCatcher to SpyTag to microspheres that had first been coated with SpyCatcher using the EDC/sNHS chemistry. These 9 MagPlex bead sets were compared for their ability to detect SEB.
Using MagPlex microspheres first coated with SpyCatcher and then having the AcVe-SpyTag protein, monomer, dimer, or trimer, covalently bound provided a consistent effective surface, whereas the other assays produced either less signal or inconsistent signal levels. In order to confirm these results, a different assay was prepared using a sdAb-sdAb-SpyTag fusion protein immobilized onto the SpyCatcher coated MagPlex microsphere surface.
The result of the assay for the Dengue NS1 spiked into normal human serum (NHS) confirmed what was initially observed for the SEB assay, in that the use of a capture surface first coated with SpyCatcher in a random fashion, which is then used to capture the recombinant antibody (preferably a dimer i.e. sdAb-sdAb-SpyTag) provides a superior capture surface to alternative covalent methodologies. In the example shown in
This technique was also used with antibodies to dengue virus (DENY), which exists as four antigenically distinct virus serotypes DENV-1 through DENV-4. The starting sdAb are described in Shriver-Lake, L. C., Liu, J. L., Zabetakis, D., Sugiharto, V. A., Lee, C., Defang, G. N., Wu, S. L., Anderson, G. P., Goldman, E. R. 2018 “Selection and Characterization of Anti-Dengue NS1 Single Domain Antibodies” Scientific Reports 8:18086. doi: 10.1038/s41598-018-35923-1 and associated Supplementary Information, incorporated herein by reference for disclosing a number of sdAb against DENY and techniques for producing additional such antibodies. A llama was immunized with a mixture of recombinant nonstructural protein 1 (NS1) antigen from the four DENV serotypes and a phage display immune library of single domain antibodies was constructed and to select sdAb with specificity and affinity for DENV NS1.
The multiplex nature of the MAGPIX instrument (Luminex Corp., Austin, Tex.) enabled testing of both old and improved sdAb immobilization protocols in parallel.
Protein Sequences
The ACVE sdAb used in the examples has the sequence EFARSDVQLVESGGGLVQPGGSLRLTCAASGLIFGSYAMGWFRQAPGKA REFVAAISWSGGDTYADSVKGRFTISRDNAKNTVYLQMNSLEPEDTAVYS CAAVGSKYYISKDAKDYGYWGQGTQVTVSSAAAGGGGSGGGGSGSGLE HHHHHH (SEQ ID No: 1).
The Spy tag sequence is AHIVMVDAYKPTK (SEQ ID NO: 2).
The DD7 sdAb used here has the sequence EVQLVQSGGGSVQRGGSLRLSCRHSSITVPDYTIGMFRRRPGKGGEEVSLI SMHGGRSMYRGSVKGRFRISRDSVKNTVYLQMNNLKPEDTDIYYCGGT TFGLRRRPNEYDSMGQGSQVTVSS (SEQ ID NO: 3)
The construct XL-DD7-DD7, comprising a dimer of the DD7 sdAb and the orienting Spy tag sequence has the sequence: EVQLVQSGGGSVQAGGSLRLSCAHSSITVPDYTIGWFRRAPGKGGEEVSLI SMHGGRSWYAGSVKGRFAISRDSVKNTVYLQMNNLKPEDTDIYYCGGT TFGLAAAPNEYDSWGQGSQVTVSSGGGGSGGGGSGSEVQLVQSGGGSV QAGGSLRLSCAHSSITVPDYTIGWFRRAPGKGGEEVSLISMHGGRSWYA GSVKGRFAISRDSVKNTVYLQMNNLKPEDTDIYYCGGTTFGLAAAPNEY DSWGQGSQVTVSSGGGGSGGGGSGSAHIVMVDAYKPTKAAALEHHHH HH (SEQ ID NO: 4).
The construct DD7-gs3k had the sequence: EVQLVQSGGGSVQAGGSLRLSCAHSSITVPDYTIGWFRRAPGKGGEEVSLI SMHGGRSWYAGSVKGRFAISRDSVKNTVYLQMNNLKPEDTDIYYCGGT TFGLAAAPNEYDSWGQGSQVTVSSAAAGGGGSGGGGSKKKALEHHHH HH (SEQ ID NO: 5).
The SpyCatcher orienting protein which binds to SpyTag has the sequence: EFARSVDTLSGLSSEQGQSGDMTIEEDSATHIKFSKRDEDGKELAGATME LRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVN EQGQVTVNGKATKGDAHIGGGGSGGGGSGSGLEHHHHHH (SEQ ID NO: 6).
It is expected the these techniques can be successfully used with a wide variety of sdAb beyond those employed in the examples, particularly because single domain antibodies are relatively simple compared to other antibodies.
One of ordinary skill in the art might modify the exemplary embodiments by adding or removing spacers (such as between the sdAb and SpyTag or a feature serving the same function), tags for affinity purification, and the like, and/or by employing sdAb multimers.
In some embodiments, multiple types of labeled microspheres might be mixed together for a multiplexed assay. In additional embodiments, each type of microsphere has a distinctive signature, for example a different color of dye.
In some embodiments, the capture surface demonstrated here, MagPlex microspheres, could be replaced by another type of solid support such as another type of microspheres or a planar surface. For example, the technique could be used on the surface of a microtiter plate, a sensor chip, etc. In such cases, binding of an antigen to immobilized can be detected using techniques known in the art.
A number of suitable binding partners exist which could yield the desired covalent bond formation. The SpyCatcher/SpyTag used in the examples might be replaced with another pair known in the art, for example SnoopCatcher/SnoopTag, SdyCatcher/SdyTag, and intein domains.
This technique is generic to recombinant binding elements of which the sdAb has been demonstrated. It should also be generic to many capture surfaces where the capture element is covalently immobilized in addition to the magnetic microsphere shown here. Thus this technique has the ability to improve any number of immunoassays where one can benefit by orientation of the capture molecule. The new feature is that it is possible now to first prepare the capture surfaces with a generic element, the SpyCatcher protein or similar functioning protein, and then by simple addition of the fusion protein in the examples shown, the sdAb-sdAb-SpyTag, one can prepare a capture surface with the capture molecule covalently attached.
The herein-described technique avoids problems posed by alternative approaches. There are a number of non-covalent method to prepare the capture surface in an oriented manner that do enhance the sensitivity. However, they have limitation in that the same method used to attach the molecule can cause high backgrounds if it also used to generate the signal being measured, i.e. on cannot use avidin-biotin to immobilize and then use a biotinylated recognition antibody followed by a avidin conjugated phycoerthryin to generate the signal. Also non-covalent methods can also be difficult to multiplex. Other methods to achieve covalent bonding with a desired orientation can be much more difficult to adapt to protein and may require a click-chemistry approach which is difficult and expensive to implement.
All documents mentioned herein are hereby incorporated by reference for the purpose of disclosing and describing the particular materials and methodologies for which the document was cited.
Although the present invention has been described in connection with preferred embodiments thereof, it will be appreciated by those skilled in the art that additions, deletions, modifications, and substitutions not specifically described may be made without departing from the spirit and scope of the invention. Terminology used herein should not be construed as being “means-plus-function” language unless the term “means” is expressly used in association therewith.
This application claims the benefit of U.S. Provisional Application 62/797,472 filed on Jan. 28, 2019, the entirety of which is incorporated herein by reference.
| Number | Date | Country | |
|---|---|---|---|
| 62797472 | Jan 2019 | US |
