Patent Application
20230340546
The invention relates to the use of UV-activated enzymes to implement oxidation reactions of organic compounds. The present invention also relates to a process for oxidizing organic compounds using enzymes which are activated by UV light.
The development of environmentally friendly processes in the chemical industry is of ongoing concern. In this respect, the use of enzymes in the production of chemicals has been explored in the past. One such class of enzymes are Copper Radical oxidases (CROs), that can catalyze a wide variety of oxidation reactions. These enzymes comprise a Copper ion in their active site, hence their name Most CRO-enzymes belong to the CAZy family AA5 (Auxiliary Activity n°5 family), which encompasses CAZy subfamily 1 (AA5_1) and CAZy subfamily 2 (AA5_2).
These CRO enzymes however need to be activated prior, or during the intended use in catalysis. Such activation is typically achieved by adding a redox-activator such as Horseradish peroxidase (HRP) to the reaction mixture comprising the enzyme. Horseradish peroxidase is an expensive and relatively unstable material, that, in addition, must be removed from the reaction mixture during the purification of the reaction product.
Hence the need for activating these enzymes using different methods, in particular methods that do not imply adding an exogeneous redox-activator.
Thus, one aim of the present invention is the use of UV-activated enzymes in the oxidation of an organic compound.
Another aim of the present invention is the activation of specific enzymes using UV light.
Yet another aim of the present invention is to provide a process for the oxidation of chemical compounds, which can be controlled, without the use of exogeneous redox-activators.
Yet another aim of the present invention is to provide control over said process.
Yet another aim of the present invention is the use of UV-activated enzymes in the production of hydrogen peroxide.
Yet another aim of the present invention is the use of the hydrogen peroxide thus produced.
Thus, a first object of the present invention concerns the use of UV-activated Copper Radical Oxidase (CRO) enzymes for the implementation of a chemical oxidation process of an organic compound.
The inventors have surprisingly found that Copper Radical Oxidase enzymes can be activated by UV light. This feature has not been described in the literature to date and allows for the use of these enzymes in oxidation reaction, without the need to add external redox activators.
Without being bound to theory, the mechanism of the UV-activation of CRO enzymes implies the formation of a radical on a Tyrosine residue that is located close to the copper that is present in the active site of the enzyme.
This was corroborated by the inventors in an EPR (Electron Paramagnetic Resonance) experiment, the results of which are shown in
Irradiation of the enzyme with UV light shows the appearance of 2 signals (
CRO-enzymes can exist in a “mature” form, and in a “non-mature” form. Non-mature enzymes are inactive towards the catalytic oxidation reactions according to the present invention.
For the UV-activation to happen, the enzyme should first be “matured”, implying the copper mediated formation of a thioether bond between a cysteine residue and a Tyrosine residue in the enzymes active site (Ito et al., Novel Thioether Bond Revealed by a 1.7 A Crystal Structure of Galactose Oxidase, Nature 1991 Mar. 7; 350(6313):87-90, and Firbank et al., Crystal structure of the precursor of galactose oxidase: An unusual self-processing enzyme, Proc Natl Acad Sci USA. 2001 Nov. 6; 98(23): 12932-12937).
In most cases, this maturation step occurs naturally during the production of the enzyme, and the isolated CRO enzyme is already mature. However, in rare cases, it is possible to achieve maturation in vitro. For instance, when enzyme production is carried out under metal-free conditions. The result is a precursor of the CRO-enzyme that does not have copper in the active site. This isolated precursor enzyme can subsequently be treated with a copper source, allowing for in vitro maturation (Roger et al., J. Am. Chem. Soc. 2000, 122, 5, 990-991).
Scheme 1 shows the postulated catalytic cycle of the oxidation of a compound using a CRO enzyme.
A CRO enzyme in inactive form (semi-reduced), is exposed to UV light, thereby forming a CRO enzyme in active form (fully oxidized). This active species is able to oxidize a compound into an oxidized product, resulting in the concomitant formation of a fully reduced CRO enzyme. Said fully reduced enzyme subsequently reduces oxygen into hydrogen peroxide, thus regenerating the fully oxidized active form that can be involved in another reaction cycle. Turnover numbers of more than 10,000 can thus be achieved.
Thus, the expression “UV-activated” refers to control of the catalytic activity of an CRO enzyme by application of UV light as described herein. The enzyme is “activated” when UV light applied to the enzyme causes structural changes in the enzyme, in particular the formation of radical species, such as the formation of a radical on a Tyrosine residue that is located close to the copper that is present in the active site of the enzyme.
In other words, the CRO enzymes are capable of being controlled by UV light to be active, or more active, with respect to their catalytic activity towards oxidation reactions as disclosed herein.
The UV activated state of the enzyme can be shown by performing a use-test. Thus, for example, improved kinetics of the oxidation of benzyl alcohol into benzaldehyde is observed when the oxidation is catalyzed by a UV activated CRO enzyme, as compared to a non-UV activated CRO enzyme.
The UV activated state of the enzyme can also be determined by analysis of the presence of the Tyrosine radical, for instance by EPR ((Electron Paramagnetic Resonance).
According to another embodiment, the present invention concerns the use of UV-activated Copper Radical Oxidase (CRO) enzymes as described above, wherein the chemical oxidation of the organic compound is followed by the formation of hydrogen peroxide.
Thus, according to this embodiment, UV-activated Copper Radical Oxidase (CRO) enzymes are used for the implementation of a chemical oxidation process of an organic compound, and are used for the implementation of a reduction process of oxygen to hydrogen peroxide.
In a preferred embodiment of the present invention; the formation of hydrogen peroxide is concomitant.
The present invention also concerns the use of UV-activated Copper Radical Oxidase (CRO) enzymes for the implementation of a chemical oxidation process of an organic compound, in particular, wherein the chemical oxidation of the organic compound is followed by the formation of hydrogen peroxide.
A second object of the present invention concerns a process for the chemical oxidation of an organic compound,
According to the present invention, the expression “oxidizable function” relates to a functional group able to be oxidized, in particular a carbon-heteroatom single bond, that is oxidized into a carbon heteroatom double bond, wherein the heteroatom preferably chosen from O, N, or S, the oxidizable function is in particular a —C—OH group that is oxidized into a —C═O group. The oxidizable organic compounds according to the present invention comprise at least one oxidizable function as defined above.
According to the present invention, a step of contacting an organic compound with at least one CRO-enzyme, refers to bringing together said organic compound with said at least one CRO-enzyme. The organic compound thus is “in contact” with the at least one CRO-enzyme, and thus becomes available to the said at least one CRO-enzyme, allowing them to interact.
The organic compound and the at least one CRO-enzyme are typically brought in solution together, in the same reaction flask.
According to the present Invention, the expression “at least one CRO-enzyme” refers to one or more than one CRO-enzymes of different sequence, in particular from 1 to 3 CRO enzyme(s), more in particular 1, 2 or 3 CRO-enzyme(s).
For example, in a step of contacting an organic compound with 2 CRO-enzymes, a mixture of galactose oxidase and an alcohol oxidase, or a mixture of 2 galactose oxidases of different sequence, is used.
According to the present invention, “UV light” is a form of electromagnetic radiation having a wavelength ranging from 200 to 400 nm.
With “200 to 400 nm” is also meant the following ranges: 200 to 350 nm, 200 to 300 nm, 200 to 250 nm, 200 to 225 nm, 240 to 400 nm, 300 to 400 nm, 350 to 400 nm, 225 to 375 nm, 240 to 350 nm, 240 to 320 nm, and 270 to 290 nm.
Below 200 nm harmful species can be generated, resulting in side-reactions.
According to the present invention, the expression “exposing said at least one CRO enzyme to UV light” indicates that the CRO-enzyme is irradiated with UV light, whereby the UV light reaches the enzyme. In this respect, an experimental setup can be a UV-lamp that is immersed into the solution comprising the enzyme. Alternatively, the UV-source can be placed outside the reactor that contains the solution comprising the enzyme, said reactor being made of a material that does not block the UV light, such as Quartz. The UV-source can be artificial, such as a lamp, or natural, such as sun-light.
The exposure of the at least one CRO enzyme to UV light, during the step of exposing said at least on CRO enzyme with UV light, can occur at different stages of the process.
Thus, according to a preferred embodiment, the present invention relates to a process for chemical oxidation as previously described, wherein the step of exposing said at least one CRO enzyme to UV light is carried out during the step of contacting.
Thus, according to another preferred embodiment, the present invention concerns a process for chemical oxidation as previously described, wherein the step of exposing said at least one CRO enzyme to UV light is carried out before the step of contacting.
In this embodiment, the at least one CRO enzyme is exposed to UV light before the step of contacting with the organic compound to be oxidized. In other word, the enzyme is pre-exposed leading to a pre-activated enzyme.
Said pre-exposing the enzyme to UV light is preferably carried out by solubilizing the enzyme in a reaction solvent and providing UV light. Once activation is achieved, which can be analyzed using an EPR analysis, the enzyme is contacted with the organic compound.
Thus, according to another preferred embodiment, the present invention concerns a process for chemical oxidation as previously described, wherein the step of exposing said at least one CRO enzyme to UV light is carried out both before and during the step of contacting.
In this embodiment, the enzyme is pre-exposed to UV light, and is also exposed to UV light during the contacting step.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as previously described, wherein the step of exposing said at least one CRO enzyme to UV light is carried out
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
In some embodiments, the exposure to UV light is continuous, meaning uninterrupted exposure to UV light, whereby the exposure is maintained during the entire course of the reaction.
In other embodiments, the exposure to UV light is intermittent, whereby said exposure is interrupted by one or more periods of non-exposure. For example, by switching the light source on and off.
As shown in the postulated reaction mechanism of Scheme 1, the fully oxidized active form can be converted into a semi-reduced form, leading to an inactive enzyme that should be re-exposed to UV light in order to be activated.
Thus, by continuously exposing the enzyme to UV light during the oxidation reaction, the enzyme is continuously regenerated in situ.
On the contrary, by interrupting the exposure to UV light, the enzyme can become semi-reduced and inactive, and a decrease in catalytic activity is observed.
Subsequent renewed UV light exposure leads to reactivation of the enzyme.
This feature of the invention allows for control over the reaction kinetics, in a sense by switching the enzyme activity on and off. This feature also allows, if desired, to perform reactions in a sequential manner.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
The exposure periods may be of equal length, or may be of different length than the non-exposure periods.
In case of more than one 1 exposure period, the subsequent exposure periods may be of equal length or may be of different length.
In case of more than one 1 non-exposure period, the subsequent non-exposure periods may be of equal length or may be of different length.
By “one or more periods” should also be understood, 1 to 1000 periods, 1 to 500 periods; 1 to 250 periods, 1 to 100 periods, 1 to 10 periods, 10 to 1000 periods, 100 to 1000 periods, 250 to 1000 periods, 500 to 1000 periods, 10 to 500 periods, or 100 to 250 periods. These ranges include all individual integer values, so that for example “1 to 10 periods” has the meaning of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 periods.
By “1 second to 1 hour” should be understood all individual time-values comprised within this range, so that for example “1 second to 10 seconds” includes 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10 seconds.
By “1 second to 1 hour” should in particular be understood 1 second to 45 minutes, 1 second to 30 minutes, 1 second to 15 minutes, 1 second to 10 minutes, 1 second to 5 minutes, 1 second to 2 minutes, 1 to 60 seconds, 1 to 50 seconds, 1 to 40 seconds, 1 to 30 seconds, 1 to 20 seconds, 1 to 10 seconds, 1 to 5 seconds, 1 minute to 1 hour, 10 minutes to 1 hour, 30 minutes to 1 hour, 1 minute to 30 minutes, or 5 minutes.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
According to the present invention, it should be understood that the light intensity values correspond to the light intensity of the UV light to which the enzyme is exposed, before activation of said enzyme in other words, of the UV light that reaches the reaction medium. Said light intensity can be different from the light intensity of the UV light emitted from the UV-source.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
With “1 to 100 μmol photon·s−1·m−2” is also meant the following ranges: 1 to 75 μmol photon·s−1·m2, 1 to 50 μmol photon·s−1·m−2, 1 to 25 μmol photon·s−1·m−2, 1 to 15 μmol photon·s−1·m−2, 10 to 100 μmol photon·s−1·m−2, 25 to 100 μmol photon·s−1·m−2, 50 to 100 μmol photon·s−1·m−2, 75 to 100 μmol photon·s−1·m−2, 5 to 50 μmol photon·s−1·m−2, 10 to 50 μmol photon·s−1·m−2, in particular 10 to 30 μmol photon·s−1·m−2, and more in particular 14 to 15 μmol photon·s−1·m−2, or about 14.6 μmol photon·s−1·m−2.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
When oxygen is constantly provided, the provision of oxygen is uninterrupted, whereby oxygen provision is maintained during the entire course of the reaction.
Discontinuous provision of oxygen means that periods of oxygen provision are altered with periods of non-provision of oxygen. The oxygen provision is thus interrupted by one or more periods of non-provision. For example, by stopping the bubbling of oxygen into the reaction mixture.
As for the intermittent provision of UV light, this feature allows for control over the reaction kinetics, and allows, if desired, to perform reaction in a sequential manner.
The oxygen provision periods may be of equal length, or may be of different length than the non-provision periods.
In case of more than one 1 oxygen provision period, the subsequent oxygen provision periods may be of equal length or may be of different length.
In case of more than one 1 non-provision period, the subsequent non-provision periods may be of equal length or may be of different length.
The provision of molecular oxygen into the reaction mixture can be carried out by using open reaction vessels that are exposed to ambient air. The provision of oxygen is preferably carried out by bubbling oxygen or air into the reaction mixture, wherein the above mentioned non-provision of oxygen can be achieved for example by bubbling an inert gas into the reaction mixture in place of the oxygen or air.
Alternatively, and in another embodiment of the Invention, the molecular oxygen is provided by the presence of a catalase enzyme in the reaction mixture, said catalase enzyme being able to convert hydrogen peroxide into molecular oxygen and water.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
By “1 second to 10 minutes” should be understood all individual time-values comprised within this range, so that for example “1 second to 10 seconds” includes 1, 2, 3, 4, 5, 6, 7, 8, 9, and 10 seconds.
By “1 second to 10 minutes” should in particular be understood 1 second to 5 minutes, 1 second to 1 minute, 1 to 30 seconds, 1 to 10 seconds, 10 seconds to 10 minutes, 30 seconds to 10 minutes, 1 to 10 minutes, 5 to 10 minutes, 30 seconds to 5 minutes, 1 to 5 minutes, 2 to 5 minutes, or 2 to 3 minutes.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
With “a step of transfer” is meant the act of transferring the UV-activated enzyme into a solution comprising the organic substrate, or conversely transferring the organic substrate into the solution comprising the enzyme.
The transfer step is in particular carried out by transferring the UV-activated enzyme to the solution comprising the organic compound.
This transfer step should be performed quickly, preferably in less than 10 seconds, to prevent the UV-activated enzyme from deactivating in time.
In particular, the step of transfer should take place in a time sufficiently short to retain at least 80% of the initial activity of the UV-activated enzyme, preferably at least 90%, more preferably at least 95%.
In this respect the activity of the UV-activated enzyme is a parameter related to a batch of enzymes. The enzyme activity can be measured by methods known to the person skilled in the art.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
The aqueous buffer is in particular a sodium phosphate buffer, citrate-phosphate buffer, a tris-HCl buffer or HEPES, preferably a sodium phosphate buffer.
The buffered aqueous medium preferably has a pH ranging from 6 to 10, in particular from 7 to 9, more in particular 7 or 8.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
Families and subfamilies of the enzymes used in the present enzymes are classified according to the CAZy database, which describes the families of structurally-related catalytic and carbohydrate-binding modules (or functional domains) of enzymes that degrade, modify, or create glycosidic bonds.
Alternatively, enzymes can be identified by an enzyme commission number, or EC-number:
The at least one CRO enzyme in particular belongs to the AA5_1 or AA5_2 subfamilies.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
SEQ ID NO:1 corresponds to the following sequence, wherein the signal peptide is highlighted in underlined, and the catalytic domain is highlighted in bold:
MPTLRSALRNLPAALLALAAACEA
QNVGKWGPMVK
FPVVPVAVALVPETGNLLVWSSGWPNRWTTAGNGK
TYTSLYNVNTGNISDAIVQNTQHDMFCPGTSLDAD
GRIIVTGGSSAAKTSVLDFKKGESSPWTPLSNMQI
SRGYQSSCTTSEGKIFVIGGSFSGAGTRNGEVYDP
KANTWTKLAGCPVKPLVMQRGMFPDSHAWLWSWKN
GSVLQAGPSKKMNWYDTKGTGSNTPAGLRGTDEDS
MCGVSVMYDAVAGKIFTYGGGKGYTGYDSTSNAHI
LTLGEPGQAVQVQKLANGKYNRGFANAVVMPDGKI
WVVGGMQKMWLFSDTTPQLTPELFDPATGSFTPTT
PHTVPRNYHSTALLMADATIWSGGGGLCGANCKEN
HFDGQFWSPPYLFEADGVTPAKRPVIQSLSDTAVR
AGAPITITMQDAGAYTFSMIRVSATTHTVNTDQRR
IPLDGQDGGDGKSFTVNVPNDYGVAIPGYYMLFAM
NEAGVPCVAQFFKVTL
According to the present Invention, with the expression “at least 70% identity” should also be understood: at least 71%, at least 72%, at least 73%, at least 74%, at least 75%, at least 76%, at least 77%, at least 78%, at least 79%, at least 80%at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
SEQ ID NO:2 corresponds to the following sequence, wherein the signal peptide is highlighted in underlined, and the catalytic domain is highlighted in bold:
MKHLLTLALCFSSINAVAVTVPHKAVGTGIPEGSL
QFLSLRASAPIGSAISRNNWAVTCDSAQSGNECNK
VPAAAAIEPTSGRVLMWSSYRNDAFGGSPGGITLT
SSWDPSTGIVSDRTVTVTKHDMFCPGISMDGNGQI
VVTGGNDAKKTSLYDSSSDSWIPGPDMQVARGYQS
SATMSDGRVFTIGGSWSGGVFEKNGEVYSPSSKTW
TSLPNAKVNPMLTADKQGLYRSDNHAWLFGWKKGS
VFQAGPSTAMNWYYTSGSGDVKSAGKRQSNRGVAP
DAMCGNAVMYDAVKGKILTFGGSPDYQDSDATTNA
HIITLGEPGTSPNTVFASNGLYFARTFHTSVVLPD
GSTFITGGQRRGIPFEDSTPVFTPEIYVPEQDTFY
KQNPNSIVRVYHSISLLLPDGRVFNGGGGLCGDCT
TNHFDAQIFTPNYLYNSNGNLATRPKITRTSTQSV
KVGGRITISTDSSISKASLIRYGTATHTVNTDQRR
IPLTLTNNGGNSYSFQVPSDSGVALPGYWMLFVMN
SAGVPSVASTIRVTQ
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
SEQ ID NO:3 corresponds to the following sequence, wherein the signal peptide is highlighted in underlined, and the catalytic domain is highlighted in bold:
MVRSCAYKAIAAASLLSQLASAAITSCPNNETVWE
EPSRLLFFSSWSNDAFSGASGMTQFGDYDFATGAI
SQRTVTNTHHDMFCPGISQLEDGRILIQGGSDADT
VSIYDPATNEFTRGPNMTLARGYQTSCTLSNGKVF
TIGGAYSGERVGKNGEVYDPVANAWTYLPGADFRP
MLTNDHEGIWREDNHAWLFGWKNGSIFQAGPSKDQ
HWYGIQGNGTVAKAATRDDDDAMCGVWVMYDAVAG
KIFSAGGSPDYTDSPATQRAHITTIGEPNTPAEVE
RVADMGFPRGFANAVVLPDGQVLVTGGQRMSLVFT
NTDGILVAELFNPETREWKQMAPMAVPRNYHSVSI
LLPDATVFSGGGGMCWVQNVGDSTAGCDKTVDHSD
GEIFEPPYLFNEDGSRAARPVISAISADPIKAGAT
LTFTVEGVEGQGTAALIRLGSVTHSVNSDQRRVPL
NVTVSGNEYSATLPDDYGILLPGYYYLFVSTPQGT
PSIAKTVHVIL
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
SEQ ID NO:4 corresponds to the following sequence, wherein the signal peptide is highlighted in underlined, and the catalytic domain is highlighted in bold:
MFQTTLHLLFVLVVTGRGLA
APSTPTGWQFNLKAE
RSGIVALESIVVSPTLVVFFDRATNDPLQINNHSA
WGALWNLETSTVRALDVLTNSFCASGALLSNGTMA
SIGGDPNGFPGNPAIHPGTQAIRLFEPCDSPTGEG
CTLFEDPVTLHLLEKRWYPSSVRIFDGSLLIVGGM
HEETPFYNTDPALSFEFFPPKESTPRPSEFLNRSL
PANLFPRVFALPDGKVFMVANNQSIIYDIEANTER
ILPDIPNNVRVTNPIDGSAILLPLSPPDFVPEVLV
CGGTQTDTIDPSLLTSQTPASSQCSRIRLDEEGIA
RGWEVEHMLEGRMMPELVHLPNGQVLIANGARTGF
AAIASVSDPVGGSNADHAVLVPSLYTPDAPLGTRI
SNVGLPSSGIARVYHSSITLTPQGNFLIAGSNPNN
NSSVTAGVKFPSEFRVQTLDPPFMFVERPKILSMP
KKLAFGKSFTVPIAVPSTLAHPGAKVQVSLMDLGF
SSHAFHSSARLVFMNAKISQDGKSLTFTTPPNGRV
YPPGPATIFLTIDDVTSEGAWVMMGSGNPPPTLE
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
GlxA enzymes are bacterial homologues of fungal CAZy family AAS, in particular of galactose oxidases.
SEQ ID NO:5 corresponds to the following sequence, wherein the signal peptide is highlighted in underlined, and the catalytic domain is highlighted in bold:
MKDRAGRRRARRFAIGTAVVVALAGMNGPWLYRFS
TE
KYHQYKINQPEYKAANGKWEIIEFPEKYRQNTI
HAALLRTGKVLMVAGSGNNQDNSDDKQYDTRIWDP
VKGTIKKVPTPSDLFCTGHTQLANGNLLIAGGTKR
YEKLKGDVTKAGGLMVVHNENPDKPITLPAGTKFT
GKENGKTFVSKDPVLVPRAEKVFDPATGAFVRNDP
GLGRIYVEAQKSGSAYETGTEDNYRVQGLSGADAR
NTYGIAQKLALDKKDFQGIRDAFEFDPVAEKYIKV
DPMHEARWYPTLTTLGDGKLSVSGLDDIGQLVPGK
NEVYDPKTKAWTYTDKVRQFPTYPALFLMQNGKIF
YSGANAGYGPDDVGRTPGVWDVETNKFTKVPGMSD
ANMLETANTVLLPPAQDEKYMVIGGGGVGESKLSS
EKTRIADLKADDPKFVDGPSLEKGTRYPQASILPD
DSVLVSGGSQDYRGRGDSNILQARLYHPDTNEFER
VADPLVGRNYHSGSILLPDGRLMFFGSDSLYADKA
NTKPGKFEQRIEIYTPPYLYRDSRPDLSGGPQTIA
RGGSGTFTSRAASTVKKVRLIRPSASTHVTDVDQR
SIALDFKADGDKLTVTVPSGKNLVQSGWYMMFVTD
GEGTPSKAEWVRVP
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said organic compound is chosen from:
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said organic compound is chosen from:
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said organic compound is chosen from:
The alcohols according to the present invention can also comprise more than one hydroxyl groups. Examples of such polyols are 1,2-propanediol, 1,3-propanediol, 1,4-propanediol, glycerol, sorbitol, xylitol,
According to the present invention, primary alcohols are oxidized into aldehydes, secondary alcohols are oxidized into ketones, and gem-diols are oxidized into carboxylic acids.
The invention in particular concerns primary alcohols being oxidized into aldehydes and gem-diols being oxidized into carboxylic acids.
The term “saturated (C1 to C20) primary alcohols” means a primary alcohol comprising a saturated alkyl chain comprising 1 to 20 carbon atoms, linear or branched, in particular comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 carbon atoms, said saturated primary alcohols being for example chosen from methanol, ethanol, 1-propanol, 1-butanol, 1-pentanol, 1-hexanol, 1-heptanol, (±)-2-methyl-1-butanol and (S)-(−)-2-methyl-1-butanol,
The term “unsaturated (C1 to C20) primary alcohols” means a primary alcohol comprising an alkyl chain comprising 1 to 20 carbon atoms, linear or branched, in particular comprising 1, 2, 15 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 carbon atoms, said alkyl chain further comprising one or more double, or triple bonds,
The term “saturated (C1 to C20) secondary alcohols” means a secondary alcohol comprising a saturated alkyl chain comprising 1 to 20 carbon atoms, linear or branched, in particular comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 carbon atoms, said saturated secondary alcohols being for example chosen from 2-propanol, 2-butanol.
The term “unsaturated (C1 to C20) secondary alcohols” means a secondary alcohol comprising an alkyl chain comprising 1 to 20 carbon atoms, linear or branched, in particular comprising 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, or 20 carbon atoms, said alkyl chain further comprising one or more double, or triple bonds,
The term “(C3 to C10) cyclic alcohols” means a cyclic compound comprising from 3 to 10 carbon atoms, in particular comprising 3, 4, 5, 6, 7, 8, 9 or 10 carbon atoms,
The term “aryl alcohols” means a primary or secondary alcohol further comprising at least one aryl group, said at least one aryl group being linked to the hydroxyl group, in particular a primary hydroxyl group, by a (C1 to C20) linear or branched alkyl chain as previously defined, in particular by a C1 alkyl chain,
The term “heteroaryl alcohols” means an aryl alcohol as previously defined, wherein the aryl group further comprised a heteroatom chosen from O, N, or S,
The term “geminal diols” means a compound of structure R1HC(OH)2, being oxidized into R1CO2H· wherein R1 represents
In another embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said organic compound is of natural origin, or is derived from a compound of natural origin.
Examples of such compounds are waxes, cutins, hemicellulose such as xyloglucan,
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said organic compound is chosen from:
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said enzyme is an alcohol oxidase (AlcOx), and wherein said organic compound is an aryl alcohol comprising a primary hydroxyl group linked to the aryl group by a C1 alkyl group, in particular selected from benzyl alcohol, 4-nitrobenzyl alcohol, anisyl alcohol, veratryl alcohol and 4-hydroxybenzyl alcohol,
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said enzyme is an alcohol oxidase (AlcOx), and wherein said organic compound is a saturated, or unsaturated (C1 to C20) primary alcohol, linear or branched, in particular chosen from n-butanol, n-pentanol, n-hexanol or 2,4-hexadiene-1-ol.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said enzyme is an alcohol oxidase (AlcOx), and wherein said organic compound is a naturally-occurring polymer comprising long aliphatic chains bearing hydroxyl functions or a sugar, in particular polymers chosen from waxes, cutins and hemicellulose.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said enzyme is an alcohol oxidase (AlcOx), and wherein said organic compound is:
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above, wherein said enzyme is a glyoxal oxidase (GLOx), and wherein said organic compound is:
Said glyoxal, methyl glyoxal, glyoxylic acid and formaldehyde being in particular in the form of a hemi-acetal.
According to another preferred embodiment, the present invention concerns a process for chemical oxidation as described above,
A third object of the present invention is a process for the production of hydrogen peroxide, said process comprising the step of contacting one organic compound bearing an oxidizable function with at least one Copper-Radical Oxidase (CRO) enzyme in the presence of molecular oxygen, under exposure to UV light,
A fourth object of the present invention is the use of the hydrogen peroxide obtained by a process for the production of hydrogen peroxide as previously described, or by a process for chemical oxidation as described above,
According to another preferred embodiment, the present invention concerns the use of hydrogen peroxide as previously described, wherein the hydrogen peroxide-driven enzymatic reaction is chosen from decarboxylations, hydroxylations, halogenations, epoxidations, sulfoxidations, Baeyer-Villiger oxidations.
According to another preferred embodiment, the present invention concerns the use of hydrogen peroxide as previously described, wherein the hydrogen peroxide-driven enzymatic reaction consists in the enzymatic conversion of said hydrogen peroxide into oxygen and water, in particular using a catalase enzyme.
In this embodiment, the hydrogen peroxide that is formed from molecular oxygen during the CRO-catalyzed oxidation reaction is re-converted into molecular oxygen. Thus, regeneration of molecular oxygen occurs, allowing for the CRO-catalyzed oxidation reaction to continue to take place.
According to another preferred embodiment, the present invention concerns the use of hydrogen peroxide as previously described, wherein the hydrogen peroxide-driven enzymatic reactions consists in the degradation of a polysaccharide, said reaction comprising contacting said polysaccharide with one or more lytic polysaccharide monooxygenase (LPMO), in the presence of an external source of electrons,
Examples of reducing agents are organic compounds such as ascorbic acid or cysteine, photocatalysts such as Titanium dioxide, or enzymes such as cellobiose dehydrogenase.
According to another preferred embodiment, the present invention concerns the use of hydrogen peroxide as previously described,
The following figures and examples illustrate the practice of the present invention in some of its embodiments, the figures and examples should not be construed as limiting the scope of the invention.
▪ represents a reaction without activation of the enzyme (control reaction), ▴ represents a reaction wherein the enzyme is activated with horseradish peroxidase, ● represents a reaction according to the Invention, the enzyme being pre-activated with UV light, and ♦ represents a reaction wherein the buffer is exposed to UV light, in the absence of enzyme (negative control)
▪ represents a reaction in the dark, without UV light (control reaction), ▴ represents a reaction with intermittent UV exposure, but in the absence of a CRO enzyme (negative control), ● represents a reaction according to the Invention, wherein the enzyme was pre-activated by UV, and ♦ represents a reaction according to the Invention, wherein the enzyme intermittently activated by UV light, the grey vertical bars represent the periods of light exposure.
□ represents a reactions using UV light.
⋄ represents a reaction using broad spectrum UV-Vis light.
x represents continuous UV light.
□ represents discontinuous UV light.
⋄ represents discontinuous broad spectrum UV-Vis light.
● represents non light exposure (dark).
□ represents on/off cycles of 2/30 min
⋄ represents on/off cycles of 10/30 min.
The error bars show the standard deviation for 2 independent experiments.
The y-axes correspond to the aldehyde product concentrations, expressed in mM, and the x-axes correspond to the reaction time (min).
□ represents absence of activation (reaction in the dark).
⋄ represents activation by discontinuous UV light.
Δ represents the absence of catalase.
x represents the presence of catalase.
Δrepresents absence of activation (reaction in the dark).
⋄ represents activation by UV light.
Most chemicals were purchased from Sigma-Aldrich (Darmstadt, Germany) or VWR. HRP type II (MW 33.89 kDa) and catalase from bovine liver (monomer MW 62.5 kDa) were purchased from Sigma-Aldrich.
Molar concentrations of HRP was estimated by Bradford assay.
All alcohol substrates stock solutions were prepared in H2O whenever possible, aliquoted and stored at −20° C. The concentration of H2O2 stock solution was verified at 240 nm (ε240=43.6 M−1·cm−1).
The DNA cloning and strain production was performed according to methods described in the literature:
For preliminary tests, all proteins were first produced in 2 L flasks. To this end, single colonies of P. pastoris X33 expressing the gene of interest were individually streaked on a YPD agar plate containing Zeocin (100 μg·mL−1) and incubated 3 days at 30° C. A single colony was then used to inoculate 10 mL of YPD, in a 50 mL sterile Falcon tube, incubated during 5 h (30° C., 160 rpm). This pre-culture was used to inoculate at 0.2% (vol/vol), 500 mL of BMGY medium in a 2 L baffled flask, incubated during approximately 16 h (30° C., 200 rpm) until the OD600 nm reached 4-6. The produced cellular biomass was then harvested by centrifugation (5 min, 16° C., 3,000 g). The cell pellet was resuspended in 100 mL BMMY medium in a 500 mL flask supplemented with CuSO4 (500 μM) and methanol (1%, vol/vol) and incubated for 3 days (16° C., 200 rpm), with daily additions of methanol (1% added, vol/vol). Then, the extracellular medium was recovered by centrifugation (10 min, 4° C., 3,000 g) and the supernatant filtered on 0.45 μm membrane (Millipore, Massachusetts, USA) and stored at 4° C. prior to purification.
CgrAAO and PciGLOx-2 were produced according to known procedures: Y. Mathieu et al., “Discovery of a Fungal Copper Radical Oxidase with High Catalytic Efficiency toward 5-Hydroxymethylfurfural and Benzyl Alcohols for Bioprocessing,” ACS Catal., vol. 10, no. 5, pp. 3042-3058, 2020 and M. Daou et al., “Heterologous production and characterization of two glyoxal oxidases from Pycnoporus cinnabarinus,” Appl. Environ. Microbiol., vol. 82, no. 16, pp. 4867-4875, 2016, respectively.
CgrAlcOx and FgrGalOx were also produced at larger scale, in bioreactors. Bioreactor production was carried out in a 1.3-L New Brunswick BioFlo 115 fermentor (Eppendorf, Germany) Precultures were prepared as described above for flask production and were used to inoculate at 0.2% 100 mL of BMGY medium, in a 500 mL flask, incubated (30° C., 200 rpm) until the OD600 nm reached 2-6. Four hundred mL of basal salt medium containing 1.8 mL PTM1 trace salts (both made according to the P. pastoris fermentation process guidelines—Invitrogen—version B 053002) were inoculated with 10% (vol/vol) of the BMGY culture. Temperature was set to 30° C. One hundred μL of Pluronic E8100 (BASF, Germany) were added after 6 h of culture to prevent foam. After full consumption of glycerol (as indicated by a return of dissolve oxygen (DO) level at 100%), sorbitol-methanol transition phase was initiated by addition of 80 mL sorbitol (250 g·L−1 stock solution), 1.6 mL PTM1 traces salts and 2 mL methanol. After full consumption of carbon sources, the temperature was lowered to 20° C. and a methanol fed-batch was initiated with a feeding rate of 3.9 mL/h/L (mL per hour per liter of initial fermentation volume) of a methanol solution complemented with PTM1 trace salts (12 mL/L). New additions of 100 μL Pluronic E8100 were made after 30 h and 53 h of fermentation. Methanol feeding rate was increased to 7.8 mL/h/L after 53 h of fermentation. Throughout the fermentation, pH was maintained at 5 by automated adjustment with NH3 base. Air flow was maintained at 0.5 slpm (standard liter per minute). A cascade with a set point of 20% dissolved oxygen is maintained through agitation between 400 to 900 rpm and the percentage of pure oxygen addition between 0 to 50%. Fermentation was ceased after 118 hours. The harvested biomass was centrifuged (10 min, 5500 g, 4° C.). The supernatant was filtered through a 0.45-μm membrane (Millipore), flash-frozen in liquid nitrogen and stored at −80° C.
Flash-freezing did not cause any enzyme activity loss, for both CgrAlcOx and FgrGalOx.
The filtered culture broth was buffer exchanged by ultrafiltration through a 10 kDa cut-off polyethersulfone membrane (Vivacell 250, Sartorius Stedim Biotech GmbH, Germany) with Tris-HCl(50 mM pH 8.7) or Tris-HCl (50 mM pH 8.0) for CRO-AlcOx and CRO-GalOx, respectively. CRO-AlcOx was purified by anion exchange chromatography by loading the crude protein sample on a DEAE-20 mL HiPrep FF 16/10 column (GE Healthcare, Illinois, USA), equilibrated with buffer A1 (Tris-HCl, 50 mM, pH 8.7) and connected to an Äkta Express system (GE Healthcare). Elution was performed by applying a linear gradient from 0 to 50% of buffer B1 (Tris-HCl, 50 mM, pH 8.7+1 M NaCl) over 15 column volumes (CV) at a flow rate of 3 mL·min−1.
FgrGalOx was purified by ionic metal affinity chromatography by loading the crude protein sample on a His-Trap HP 5-mL column (GE Healthcare, Buc, France) and connected to an Äkta Xpress system (GE Healthcare). Prior to loading, the column was equilibrated with buffer A2 (50 mM Tris-HCl, pH 7.8, 150 mM NaCl). After loading, non-specific proteins were eluted by applying a first washing step of 5 CV at 2% of buffer B2 (50 mM Tris-HCl, pH 7.8, 150 mM NaCl, 500 mM imidazole) and the target protein was eluted during a second step of 5 CV at 30% of buffer B2. Loading and elution were carried out at a flow rate of 3 mL·min−1. In all cases, the collected fractions were analyzed by SDS-PAGE in 10% polyacrylamide precast gel (Bio-Rad) stained with Coomassie blue. Fractions containing the recombinant enzyme were pooled, concentrated and buffer exchanged in sodium phosphate (50 mM, pH 7.0) or sodium acetate (50 mM, pH 5.2), for CgrAlcOx and FgrGalOx, respectively. The protein concentration was determined by UV absorption at 280 nm using a Nanodrop ND-200 spectrophotometer (Thermo Fisher Scientific, Massachusetts, USA) for CgrAlcOx (ε=101215 M−1·cm−1), FgrGalOx (ε=124,135 M−1·cm−1) , PciGLOx-1 (ε=47,690 M−1·cm−1), CgrAAO (ε=107,760 M−1·cm−1).
Benzyl alcohol can be oxidized by several CROs, including CgrAlcOx, FgrGalOx and CgrAAO. The oxidation of benzyl alcohol into benzaldehyde was monitored by developing a simple absorbance assay consisting in measuring changes in absorbance at 254 nm upon oxidation of benzyl alcohol (1.5 mM) by the CRO (10 nM final concentration). Reactions were carried out in sodium-phosphate buffer (50 mM, pH 7.0), at 23° C., in UV-transparent cuvettes (1 mL reaction volume). In positive controls (carried out in the dark), horseradish peroxidase (HRP, 50 μg mL−1) was added to the mixture. The reactions were initiated by adding the CRO (100 μL of 100 nM stock solution), which was either stored in the dark or UV-exposed (vide infra). The reaction was mixed by vigorously pipetting up and down. In negative controls, the enzyme stock solution was replaced by sodium phosphate buffer (50 mM, pH 7.0), kept in the dark or UV-exposed. The absorbance (pathlength=1 cm) was measured using an Evolution 201 UV-Vis spectrophotometer (Thermo-Fisher). Given a 1:1 stoichiometry of the reaction, one can calculate the concentration of benzaldehyde according to Equation 1, where the molecular extinction coefficient of benzaldehyde at 254 nm is 57-fold higher (ε254benzaldehyde=8,497 M−1·cm−1) than its alcohol counterpart (ε254BnoH=149 M−1·cm−1).
[Benzaldehyde]t=(Abs254 nmt−Abs254 nmt0)/(ε254 benzaldehyde−ε254BnOH) (equation 1)
Pre-activation experiments consisted in exposing the enzyme stock solution (100 nM, 1 mL) to UV light during a given amount of time (usually 10 min) before transferring (ca. 30 sec step) a fraction (100 μL) to the reaction mixture. The reaction was then monitored as described above. In preliminary tests, a UV-lamp model EF-180/F (Spectroline, Spectronics Corporation, Westbury, USA) was used, delivering 254 nm UV light at a maximum power of 1350 μW/cm2, equivalent to 29 μmoles of photon·s−1·m−2), positioned side-wise (relatively to the reaction cuvette) at a 3 cm distance from the cuvette.
In intermittent illumination experiments, the full reaction mixture, i.e. containing buffer, CRO and benzyl alcohol, was submitted to cycles of UV exposure (2 min) followed by on-line spectrophotometric monitoring (2 min). In such experiments, the illumination set-up was the same as described in example 6.
CgrAlcOx (50 μM), prepared in sodium phosphate buffer (50 mM, pH 7.0), was flash-frozen in liquid nitrogen and continuous wave EPR spectrum was recorded. Then, the sample was thawed, exposed to UV light (280 nm +/−10 nm, sample positioned side wise and at 40 cm from lamp source, 400 mW received by the sample) during 10 min and flash-frozen again before recording a new EPR spectrum. Controls containing only buffer were also carried out. The illumination system was an Arc Lamp Housing equipped with a xenon-mercury bulb (Newport, USA, model 67005) and connected to an OPS-A150 Arc Lamp power supply (50-500 W) (Newport, USA). The power was set to 350 W. EPR spectra were recorded on a Bruker Elexsys E500 spectrometer operating at X-band at 110 K (BVT 3000 digital temperature controller) with the following acquisition parameters: number of scans, 3; modulation frequency, 100 kHz; modulation amplitude, 5 G; attenuation, 10 dB and microwave power, 20 mW.
Optimal illumination conditions are determined by exposing the full reaction mixture to different light intensities (by varying the distance between the light source and the reaction vessel and/or varying the power supply) and different light wavelengths (by using different bandpass filters). Continuous versus intermittent light exposure is also probed, where the duration of intermittent light and “dark” time are varied (from 0 sec to 10 min). An optimal reaction condition is defined as a reaction yielding a stable reaction kinetic and/or a high final product yield (e.g., >70%). The quantity of reaction products is measured off-line by sampling regularly the reaction mixture and stopping the reaction (by either adding EDTA (10 mM final) or acidifying the mixture with HCl (1N final)) prior to quantification. Different CRO/substrate couples are tested, including:
In standard reaction conditions, the CRO (10 nM-1 μM) is mixed with the substrate (3-30 mM) in buffered aqueous medium (sodium phosphate (50 mM, pH 8.0) for CRO-AlcOx and CRO-GalOx, sodium 2,2′-dimethylsuccinate (50 mM, pH 6.0) for CRO-GLOx, sodium phosphate (50 mM, pH 7.0) for CRO-AAO). The reaction is carried out at 23° C., under magnetic stirring, in Quartz cuvettes (Hellma, France). The effect of the supply of O2 is also tested by bubbling through a syringe either air or a mixture of N2/O2 (various ratio of O2 between 0 and 100% v/v), with a gas flow rate of 100 mL/min.
The illumination system is an Arc Lamp Housing equipped with a xenon-mercury bulb (Newport, USA, model 67005) and connected to an OPS-A150 Arc Lamp power supply (50-500 W) (Newport, USA). The power is set to 350 W. A bandpass filter (280±10 nm) with 50 mm optical diameter (Edmund Optics, Lyon) is mounted on the lamp. The light intensity received by the sample is measured outside of the reaction vessel, on the front side facing the light beam, with an optical power meter (Newport, USA).
Using optimized illumination conditions, we evaluate the effect of secondary enzymatic reactions on the primary photobiocatalytic CRO reaction. A first secondary reaction is the conversion of H2O2 produced in situ into H2O and O2 by a catalase. Various concentrations of catalase are tested (1 nM-1 μM). Another secondary reaction aims at using H2O2 produced in situ as co-substrate of a peroxygenase reaction. In this order, to the photobiocatalytic CRO reaction is added a mixture containing an LPMO (1 μM), cellulose (10 g·L−1Avicel or 0.1% w/v phosphoric acid swollen cellulose) and a reducing agent (100 μM ascorbic acid or cellobiose (3 mM)/cellobiose dehydrogenase (CDH, 0.1-1 μM)). The LPMO is the AA9E from Podospora anserina (PaLPM09E) and the CDH is the CDH from Podospora anserina (PaCDHB), produced and purified as previously described by C. Bennati Granier et al. “Substrate specificity and regioselectivity of fungal AA9 lytic polysaccharide monooxygenases secreted by Podospora anserina,” Biotechnol. Biofuels, vol. 8, no. 1, p. 90, December 2015.
After establishing the proof-of-concept in 1 mL reactions, the photobiocatalytic reactions is upscaled to 100 mL, using the same illumination system as described above but with a top-wise illumination, with the light source placed at optimal distance from the reaction mixture surface. The reaction is carried out in a 250 mL beaker without spout, under magnetic stirring, at 23° C. The top of the beaker is closed with a home-made Quartz window, equipped with a rubber ring, to allow UV light to reach the solution while minimizing losses by evaporation.
The CRO-AlcOx activity on benzyl alcohol is determined by quantifying benzaldehyde spectrophotometrically at 254 nm as described above.
The CRO-AlcOx activity on fatty alcohol is determined as follows: 500 μL of the reaction mixture is mixed with 500 μL of cyclohexane/ethyl acetate mixture (1:1), followed by shaking and centrifugation (5 min, 2300 rpm). The organic layer is transferred into a new vial by pipetting and injected in an Optima-σ-3 GC capillary column (30 m×0.25 mm×0.25 μm, Machery-Nagel GmbH&Co KG, Germany) mounted on a gas chromatography (GC)-2014 apparatus (Shimadzu, Japan) equipped with a flame ionization detector (FID). Nitrogen is used as carrier gas, under constant pressure (200 kPa). The inlet and detector temperature are set at 250° C. The temperature gradients of the GC method are described in Table 1. Heptan-1-al (1 mM) is added as internal standard.
The CRO-GalOx activity on galactose is determined in two ways:
The activities of CRO-GLOx on glyoxal/methylglyoxal/glyoxylic acid and CRO-AAO on HMF are analyzed as previously described by M. Daou et al., “Heterologous production and characterization of two glyoxal oxidases from Pycnoporus cinnabarinus,” Appl. Environ. Microbiol., vol. 82, no. 16, pp. 4867-4875, 2016. Briefly, the reaction products are separated on an Aminex HPX-87H column (300×7.8 mm; Bio-Rad) connected to a high pressure liquid chromatography (HPLC) apparatus (Agilent 1260) coupled to a diode-array detector (DAD, monitored wavelengths: 210, 280, 290, 330 and 350 nm). The column temperature is set to 45° C., sulfuric acid (2.5 mM) is used as isocratic eluant with a flow rate of 0.5 ml·min−1. All samples are filtered through 10-kDa-molecular-mass-cutoff Nanosep polyethersulfone membrane columns (Pall Corporation, Saint-Germainen-Laye, France) and 0.45-μm pore-size polyvinylidene difluoride syringe filters (Restek, Lisses, France) before injection in the column.
A solution containing BnOH (3 mM) and CgrAlcOx (10 nM) in aqueous sodium phosphate (50 mM, pH 7.0), at 23° C., was exposed to varying intensities of either UV light (λ=280±10 nm) or UV-Vis broad spectrum light (λ=200-800 nm), under magnetic stirring in air.
Benzyl alcohol was thus oxidized to benzaldehyde. The enzyme activity as a function of the light intensities was measured resulting in the data as shown in
Thus, 40% intensity, for example, corresponds to a light flux (at 4 cm distance) of 0.64 mW·cm−2, i.e. 14.6 μmol photon·s−1·m−2.
It can be seen from
A solution containing benzyl alcohol (3 mM) and CgrAlcOx (10 nM) in aqueous sodium phosphate (50 mM, pH 7.0), at 23° C., was exposed to varying illumination modes under magnetic stirring in air:
The discontinuous mode consisted in on/off illumination cycles of 1/30 min, repeated over 180 min.
A control of CgrAlcOx-catalyzed reaction (in the absence of any activator) gave the residual activity measured in the dark.
Experiments were carried out at 40% or 100% of Imax for UV light and UV-Vis light, respectively. Imax (at 4 cm, λ=280±10 nm)=1.6 mW·cm−2, i.e. 36.5 μmol photon·s−1·m−2.
Thus, 40% intensity, for example, corresponds to a light flux (at 4 cm distance) of 0.64 mW·cm−2, i.e. 14.6 μmol photon·s−1·m−2.
The time-course of benzaldehyde (PhCHO) production was observed as shown in
It can be seen from
A solution containing benzyl alcohol (3 mM) and CgrAlcOx (10 nM) in aqueous sodium phosphate (50 mM, pH 7.0), at 23° C. was left in the dark under magnetic stirring in air.
The enzyme had been pre-exposed beforehand to UV light (λ=280±10 nm; 40% of Imax) for varying amounts of time (0 to 1800 s). Imax (at 4 cm, λ=280±10 nm)=1.6 mW·cm−2, i.e. 36.5 μmol photon·s−1·m−2.
Thus, 40% intensity corresponds to a light flux (at 4 cm distance) of 0.64 mW·cm−2, i.e. 14.6 μmol photon·s−1·m−2.
The results obtained are as shown in
It can be seen from
A solution containing BnOH (3 mM) and CgrAlcOx (10 nM) in aqueous sodium phosphate (50 mM, pH 7.0), at 23° C., was subjected to benzyl alcohol oxidation to benzaldehyde, by exposure, under magnetic stirring, in air, to UV light (λ=280±10 nm; 40% of Imax) with two different discontinuous illumination modes: on/off cycles of either 2/30 min or 10/30 min, repeated over 180 min. Imax (at 4 cm, λ=280±10 nm)=1.6 mW·cm−2, i.e. 36.5 μmol photon·s−1·m−2.
Thus, 40% intensity corresponds to a light flux (at 4 cm distance) of 0.64 mW·cm−2, i.e. 14.6 μmol photon·s−1·m−2.
The results obtained are as shown in
It can be seen from
CgrAAO-catalyzed oxidation reactions were tested for:
CgrAAOx (50 nM) was activated by discontinuous UV light (λ=280±10 nm). A control in the dark was also carried out. The discontinuous mode consisted in on/off illumination cycles of 1/30 min, repeated over 180 min.
Experiments were carried out at 40% of Imax. Imax (at 4 cm, λ=280±10 nm)=1.6 mW·cm−2, i.e. 36.5 μmol photon·s−1·m−2. Thus, 40% intensity corresponds to a light flux (at 4 cm distance) of 0.64 mW·cm−2, i.e. 14.6 μmol photon·s−1·m−2.
All reactions were carried out in an aqueous sodium phosphate solution (50 mM, pH 7.0), at 23° C., under magnetic stirring, in air.
The results obtained for benzyl alcohol oxidation are as shown in
The results obtained for 5-hydroxymethylfurfural oxidation are as shown in
The results obtained for 5-hydroxymethyl-2-furan carboxylic acid oxidation are as shown in
Overall, the results displayed in
The time-course of benzaldehyde (PhCHO) production upon BnOH (3 mM) oxidation by CgrAlcOx (10 nM) was determined. Reaction mixture was exposed to discontinuous UV light (λ=280±10 nm), in the absence or presence of catalase (5 nM final). The discontinuous mode consisted in on/off illumination cycles of 2/30 min, repeated over 180 min.
Experiments were carried out at 40% of Imax (λ=280±10 nm). Imax (at 4 cm, λ=280±10 nm)=1.6 mW·cm−2, i.e. 36.5 μmol photon·s−1·m−2.
Thus, 40% intensity corresponds to a light flux (at 4 cm distance) of 0.64 mW·cm−2, i.e. 14.6 μmol photon·s−1·m−2.
All reactions were carried out in an aqueous sodium phosphate solution (50 mM, pH 7.0), at 23° C., under magnetic stirring, in air.
The results obtained are as shown in
Benzaldehyde (PhCHO, 1.2 mM) or BnOH (3 mM) were exposed, in the absence of enzyme, to discontinuous UV light (λ=280±10 nm). The discontinuous mode consisted in on/off illumination cycles of 2/30 min, repeated over 180 min.
Experiments were carried out at 40% of Imax (λ=280±10 nm). Imax (at 4 cm, λ=280±10 nm)=1.6 mW·cm−2, i.e. 36.5 μmol photon·s−1·m−2.
Thus, 40% intensity, corresponds to a light flux (at 4 cm distance) of 0.64 mW·cm−2, i.e. 14.6 μmol photon·s−1·m−2.
All reactions were carried out in an aqueous sodium phosphate solution (50 mM, pH 7.0), at 23° C., under magnetic stirring.
The results obtained are as shown in
The oxidation of benzyl alcohol (3 mM) to benzaldehyde (PhCHO), and the oxidation of lactose (3 mM) to lactonic acid (LacOx), catalyzed by FgrGalOx (50 nM) were studied.
The reaction mixtures were exposed to discontinuous UV light (λ=280±10 nm), consisting in on/off illumination cycles of 1/30 min.
Experiments were carried out at 40% of Imax (λ=280±10 nm). Imax (at 4 cm, λ=280±10 nm)=1.6 mW·cm−2, i.e. 36.5 μmol photon·s−1·m−2.
Thus, 40% intensity, corresponds to a light flux (at 4 cm distance) of 0.64 mW·cm−2, i.e. 14.6 μmol photon·s−1·m−2.
All reactions were carried out in an aqueous sodium phosphate solution (50 mM, pH 7.0), at 23° C., under magnetic stirring, in air.
The results obtained for the benzyl alcohol oxidation are as shown in
The results obtained for the lactose oxidation are as shown in
| Number | Date | Country | Kind |
|---|---|---|---|
| 20186971.6 | Jul 2020 | EP | regional |
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/EP2021/070365 | 7/21/2021 | WO |
