Vaccine and methods to reduce campylobacter infection

Abstract

Vaccine vectors and methods for enhancing resistance to Campylobacter infection or for enhancing the immune response to Campylobacter are provided herein. The vaccine vectors include a first polynucleotide which encodes an antigenic polypeptide selected from SEQ ID NO: 7-9 or a fragment thereof. The vector may also include an immunostimulatory polypeptide. The methods include administering the vaccine vectors to a subject.

Description

SEQUENCE LISTING

A Sequence Listing accompanies this application and is incorporated herein by reference in its entirety. The Sequence Listing was filed with the application as a text file on Jun. 9, 2011.

BACKGROUND

The repertoire of safe and cost-effective vaccines for generation of mucosal immunity against a variety of agents is limited. The leading bacterial cause of human gastrointestinal disease worldwide is Campylobacter. Bacterial gastroenteritis continues to pose a significant threat to the general public in the United States and abroad for the foreseeable future. Infections with Campylobacter jejuni occur more frequently than the more publicized infections from Salmonella species or Escherichia coli O157:H7. The actual burden of illness of Campylobacter gastroenteritis nationwide is 500-850 infections/100,000 persons per year.

Not only is Campylobacter the leading cause of bacterial gastroenteritis, but C. jejuni has been associated with the neuropathological disease Guillain-Barré Syndrome (GBS). This life-threatening disease may be an immune response to ganglioside-like structures on certain C. jejuni strains leading to an autoimmune response against nerve cells. Although GBS is the most important chronic sequelae, Campylobacter infection is also associated with a reactive arthritis, which may progress to Reiter's syndrome.

Vaccination against Campylobacter has had limited success using killed whole-cell or protein based vaccines. In addition, there are concerns regarding the development of Guillain-Barré syndrome or other sequelae from killed whole-cell vaccination. A successful vaccine would need to be cost-effective, safe, orally effective, and be produced in large quantities in a very short time-period. At the present time there is no such vaccine.

SUMMARY

Vectors and methods for enhancing resistance to Campylobacter infection or enhancing the immune response to Campylobacter are provided herein.

In one aspect, vectors including a first polynucleotide sequence encoding an antigenic polypeptide not natively associated with the vector are provided. The antigenic polypeptide may be SEQ ID NO: 7 (cjaD; cj0113; GVSITVEGNCDEWGTDEYNQA), SEQ ID NO: 8(cjaA; cj0982; KDIVLDAEIGGVAKGKDGKEK) or SEQ ID NO: 9(ACE 393; cj0420; KVALGVAVPKDSNITSVEDLKDKTLLLNKGTTADA) or a fragment thereof. The vector may also include an immunostimulatory polypeptide not natively associated with the vector. The vaccine vector is capable of eliciting an immune response from a vaccinated subject that includes an IgA antibody response against Campylobacter. The response may be protective against challenge with Campylobacter.

In another aspect, vectors including a first polynucleotide sequence encoding an antigenic polypeptide not natively associated with the vector and a second polynucleotide sequence encoding an immunostimulatory polypeptide are provided. The antigenic polypeptides may be a fragment of SEQ ID NO: 1 (cjaD), SEQ ID NO: 2 (cjaA) or SEQ ID NO: 3 (ACE393). The vaccine vector is capable of eliciting an immune response from a vaccinated subject that includes an IgA antibody response against Campylobacter. The response may be protective against challenge with Campylobacter.

In still another aspect, pharmaceutical compositions comprising the vectors provided herein in a pharmaceutically acceptable carrier are disclosed.

In yet another aspect, methods of enhancing an immune response directed to Campylobacter in a subject are provided. The methods include administering an effective amount of the vectors provided herein to a subject. In one embodiment, the enhanced immune response includes an IgA antibody response and the response may be protective.

In still a further aspect, methods of enhancing resistance to Campylobacter infection are provided herein. The methods include administering an effective amount of the vectors disclosed herein to the subject such that the subject is resistant to infection after subsequent exposure to Campylobacter. In one embodiment the enhanced immune response includes an IgA antibody response and the response may be protective.

BRIEF DESCRIPTION OF THE FIGURES

FIG. 1 is a graph showing the standard curve for the quantitative PCR showing the number of cultivable Campylobacter jejuni on the x-axis as determined by conventional culturing and determination of colony forming units (CPU). The cycle number at which the fluorescence crossed the threshold in the quantitative PCR is shown on the y axis.

FIG. 2 is a graph showing the log cfu/g ileum content in chicks vaccinated with saline, or Salmonella vectors expressing Campylobacter peptides cj0420 (SEQ ID NO: 9), cj0113 (SEQ ID NO: 7) or cj0982 (SEQ ID NO: 8) (10⁸ cfu/chick), 11 days after challenge with C. jejuni (5×10⁷ cfu/ml). The quantitative PCR was performed on total DNA extracted by conventional methods from mucosal linings of the ileum. The results are presented as mean+/− SEM (n=10). Groups with different lower case letters are significantly different (p0.05).

FIG. 3 is a graph showing the log cfu/g ileum content in chicks vaccinated with saline, the Salmonella vector without an antigenic polypeptide insert or the Salmonella vector with the cj0113 insert (SEQ ID NO: 7) (10⁸ cfu/chick), 11 days after challenge with C. jejuni (1×10⁷ cfu/ml). The quantitative PCR was performed on total DNA extracted by conventional methods from mucosal linings of the ileum. The results are presented as mean+/− SEM (n=10) and the * indicates a significant difference (P<0.05).

FIG. 4 is a graph showing the relative levels of anti-Campylobacter IgG (S/P ratio) as measured by ELISA at days 21 and 32 after administration of the indicated vectors (10⁸ cfu/chick). Groups with different lower case letters are significantly different (P<0.05).

FIG. 5 is a graph showing the relative levels of anti-Campylobacter sIgA (S/P ratio) in the mucosa of the ileum on day 32 post-vaccination with the indicated vectors (10⁸ cfu/chick). Groups with different lower case letters are significantly different (P<0.05).

FIG. 6 is a graph showing the serum IgG levels (S/P ratio) at days 21 and 31 post vaccination and sIgA levels (S/P ratio) in the mucosa of the ileum at day 32 post vaccination with saline, the Salmonella vector without an insert or the vector with the antigenic polypeptide, cj0113 (SEQ ID NO: 7) (10⁸ cfu/chick). A * indicates a significant difference from controls (P<0.05).

FIG. 7 is a graph showing the C. jejuni specific serum IgG antibody levels 10 days post vaccination by oral gavage with either Bacillus subtitis backbone strain (BSBB) or cj0113 (SEQ ID NO: 7) Bacillus subtilis vectored vaccine candidate at 10⁸ cfu/chick. Data are presented as mean±SEM with the * indicating a significant difference (P<0.05) from both controls.

FIG. 8 is a graph showing the C. jejuni specific secretory IgA antibody levels 10 days post vaccination by oral gavage with either Bacillus subtilis backbone strain (BSBB) or cj0113 (SEQ ID NO: 7) Bacillus subtilis vectored vaccine candidate at 10⁸ cfu/chick. The mucosa was collected in the ileum region. Data are presented as mean±SEM with the * indicating a significant difference (P<0.05) from both controls.

FIG. 9 is a graph showing the log₁₀ CFU of C. jejuni per gram of ileum content as enumerated by quantitative PGR. Birds vaccinated with either Bacillus subtilis backbone strain (BSBB) or Bacillus subtilis vector expressing cj0113 (SEQ ID NO: 7), were challenged with C. jejuni at 1×10⁸ cfu/chick then enumerated 10 days after by PCR. qPCR was performed on total DNA extracted by conventional methods from mucosal linings of the ileum. The results are presented as mean log₁₀ cfu/gram of ileum content ±SEM (n=40) and the * indicates a significant difference (P<0.05) from control.

FIG. 10 is a graph showing the log₁₀ CFU of C. jejuni per gram of turkey ileum content as enumerated by quantitative PCR. Turkeys vaccinated with either backbone strain or cj0113 (SEQ ID NO: 7) Salmonella vectored vaccine, were challenged with C. coli at 1×10⁸ cfu/chick then enumerated 12 days after by PGR. qPCR was performed on total DNA extracted fay conventional methods from mucosal linings of the ileum. The results are presented as mean log₁₀ cfu/gram of ileum content ±SEM (n=10) and the * indicates a significant difference (P<0.05) from control.

DETAILED DESCRIPTION

Vaccine vectors that elicit mucosal, humoral, and cell-mediated immune responses against multiple serovars of Campylobacter offer a promising approach to limit Campylobacter gastroenteritis. This project utilizes a novel approach in the development of vaccines by inserting polynucleotide sequences encoding non-native linear epitopes (antigenic polypeptides). The antigenic polypeptides may be used in combination with an immunostimrnulatory polypeptide such as CD154 (CD40L) or HMGB1 (high mobility group box 1) in the vaccine vector. The antigenic polypeptide and the immunostimulatory polypeptide are suitably not polypeptide found natively associated with the vector. The epitope or antigenic polypeptide and the immunostimulatory polypeptide may be expressed on the surface of recombinant vectors. The vectors may be bacterial, viral or even liposome vectors. The vectors may be live, live and attenuated, or killed prior to administration. Substantial preliminary data, such as that shown in the Examples, demonstrates that Salmonella or Bacillus constructs expressing a foreign epitope are able to rapidly induce high titer epitope-specific antibodies in vivo. Furthermore, co-expression of surface CD154 or HMGB1 effectively enhanced the antibody response against the foreign epitope.

Recombinant DNA technologies enable relatively easy manipulation of many bacterial and viral species. Some bacteria and viruses are mildly or non-pathogenic, but are capable of generating a robust immune response. These bacteria and viruses make attractive vaccine vectors for eliciting an immune response to a heterologous, non-native, or foreign antigen. Bacterial or viral vaccine vectors may mimic the natural infection and produce robust and long lasting immunity. Vaccine vectors are often relatively inexpensive to produce and administer. In addition, such vectors can often carry more than one antigen and may provide protection against multiple infectious agents.

Polynucleotides encoding polypeptide antigens from any number of pathogenic organisms may be inserted into the vaccine vector and expressed to generate antigenic polypeptides. An antigenic polypeptide is a polypeptide that is capable of being specifically recognized by the adaptive immune system. An antigenic polypeptide includes any polypeptide that is immunogenic. The antigenic polypeptides include, but are not limited to, antigens that are pathogen-related, allergen-related, tumor-related or disease-related. Pathogens include viral, parasitic, fungal and bacterial pathogens as well as protein pathogens such as the prions.

The antigenic polypeptides may be full-length proteins or portions thereof. It is well established that immune system recognition of many proteins is based on a relatively small number of amino acids, often referred to as the epitope. Epitopes may be only 8-10 amino acids. Thus, the antigenic polypeptides described herein may be full-length proteins, 8 amino acid long epitopes or any portion between these extremes. In fact the antigenic polypeptide may include more than one epitope from a single pathogen or protein. Suitably the antigenic polypeptide is a polypeptide that is not natively associated with the vector. Not natively associated includes antigenic polypeptides that may also occur natively in the vector, but that are being expressed recombinantly as an epitope, are being expressed in combination with a different polypeptide as a fusion protein to allow for differential display and differential enhancement of the immune response as compared to the natively expressed polypeptide.

Multiple copies of the same epitope or multiple epitopes from different proteins may be included in the vaccine vector. It is envisioned that several epitopes or antigens from the same or different pathogens or diseases may be administered in combination in a single vaccine vector to generate an enhanced immune response against multiple antigens. Recombinant vaccine vectors may encode antigens from multiple pathogenic microorganisms, viruses or tumor associated antigens. Administration of vaccine vectors capable of expressing multiple antigens has the advantage of inducing immunity against two or more diseases at the same time.

The polynucleotides may be inserted into the chromosome of the vaccine vector or encoded on plasmids or other extrachromosomal DNA. Polynucleotides encoding epitopes may be expressed independently (i.e., operably linked to a promoter functional in the vector) or may be inserted into a vaccine vector polynucleotide (i.e., a native polynucleotide or a non-native polynucleotide) that is expressed in the vector. Suitably, the vaccine vector polynucleotide encodes a polypeptide expressed on the surface of the vaccine vector such as a transmembrane protein. The polynucleotide encoding the antigenic polypeptide may be inserted into the vaccine vector polynucleotide sequence in frame to allow expression of the antigenic polypeptide on the surface of the vector. For example, the polynucleotide encoding the antigenic polypeptide may be inserted in frame into a bacterial polynucleotide in a region encoding an external loop region of a transmembrane protein such that the vector polynucleotide sequence remains in frame. See the Examples below in which the antigenic polypeptides are inserted into an external loop of the lamB gene of the Salmonella enteritidis vector.

Alternatively, the polynucleotide encoding the antigenic polypeptide may be inserted into a secreted polypeptide. Those of skill in the art will appreciate that the polynucleotide encoding the antigenic polypeptide could be inserted in a wide variety of vaccine vector polynucleotides to provide expression and presentation of the antigenic polypeptide to the immune cells of a subject treated with the vaccine vector. In the Examples, several Campylobacter polynucleotides were inserted into the lamB coding sequence of Salmonella enteritidis. The resulting recombinant bacteria express the inserted antigenic polypeptides on the surface of the bacteria. The polynucleotides may be inserted in CotB of Bacillus subtilis such that the recombinant bacteria expressed the inserted antigenic polypeptides in spores or into sip for surface expression in vegetative bacteria.

The vectors may include a polynucleotide encoding full length Campylobacter proteins including cjaD (SEQ ID NO: 1), cjaA (SEQ ID NO: 2) and ACE393 (SEQ ID NO: 3) or an antigenic polypeptide of these proteins. In the Examples, antigenic polypeptides derived from the full-length proteins were used as follows: SEQ ID NO. 7 (a cjaD polypeptide called cj0113); SEQ ID NO: 8 (a cjaA polypeptide called cj0982); and SEQ ID NO: 9 (an ACE 393 polypeptide called cj0420). The polynucleotides used in the Examples are provided as SEQ ID NOs: 4-6, respectively. The polynucleotides used in the Examples had the antigenic polypeptides of SEQ ID NOs 7-9 separated by serine linkers and linked to CD154 amino acids 140-149 (three amino acids before, after and in between the antigenic polypeptide and the immunostimulatory polypeptide).

Suitably, the portion of the antigenic polypeptide inserted into the vaccine vector is immunogenic or antigenic. An immunogenic fragment is a peptide or polypeptide capable of eliciting a cellular or humoral immune response. Suitably, an antigenic polypeptide may be the full-length protein, or suitably may be 20 or more amino acids. 15 or more amino acids, 10 or more amino acids or 8 or more amino acids of the full-length sequence. Suitably the immune response generated against the target pathogen is a protective immune response. A protective immune response is a response capable of blocking or reducing morbidity or mortality caused by subsequent infection with the target pathogen, namely Campylobacter.

One of skill in the art will appreciate that any of these polynucleotide sequences may be used in combination with any other antigenic polypeptide including polypeptides from other heterologous pathogens or organisms and may also be used in conjunction with polynucleotides encoding immunostimulatory polypeptides such as a polypeptide of CD154 or HMGB1 such as is described in International Application Nos. PCT/US07/078785 and PCT/US2011/022062 both of which are incorporated herein by reference in their entireties.

Polynucleotides encoding immunostimulatory polypeptides that are homologous to proteins of the subject and capable of stimulating the immune system to respond to the foreign epitope may also be inserted into a vector. As described in more detail below, the vector may include a CD154 polypeptide that is capable of binding CD40 in the subject and stimulating the subject to respond to the vector and its associated foreign antigenic polypeptide. In addition, a vector may include a HMGB1 polypeptide or a functional fragment thereof. As described above with regard to antigenic polypeptides, polynucleotides encoding these polypeptides may be inserted into the chromosome of the vector or maintained extrachromosomally. One of skill in the art will appreciate that these polynucleotides can be inserted in a variety of vector polynucleotides for expression in different parts of the vector or for secretion of the polypeptides.

The polynucleotide encoding an immunostimulatory polypeptide capable of enhancing the immune response to a non-native antigenic polypeptide may also encode the antigenic polypeptide. The polynucleotide encoding an immunostimulatory polypeptide may be linked to the polynucleotide encoding the antigenic polypeptide, such that in the vaccine vector the immunostimulatory polypeptide and the foreign antigenic polypeptide are present on the same polynucleotide. For example, the antigenic polypeptide and the immunostimulatory polypeptide may be portions of a fusion protein. In the Examples, a polynucleotide encoding a polypeptide of CD154 that is capable of binding to CD40 also encodes an antigenic polypeptide from cjaD, cjaA or ACE 393 of Campylobacter. See SEQ ID NOS: 10-12 in the attached sequence listing for some examples of potential polypeptide sequences and SEQ ID NOs: 4-6 for polynucleotide sequences which encode for optional serine linkers between the antigenic polypeptide, the immunostimulatory polypeptide and the host polypeptide.

In the Examples, the polynucleotide encoding the Campylobacter antigenic polypeptides and the polynucleotide encoding the immunostimulatory polypeptide are both inserted in the outer loop of the transmembrane lamB gene. Those of skill in the art will appreciate that vector polynucleotides encoding other transmembrane proteins may also be used. In addition, the antigenic polynucleotides may be extrachromosomal or secreted by the vector. In the Examples, the polynucleotide encoding the Campylobacter cj0113 antigen (SEQ ID NO: 7) and the immunostimulatory peptide HMGB1 (SEQ ID NO:20) were expressed from a plasmid carried by a Bacillus vector and expressed on the cell surface.

Suitably, the CD154 polypeptide is fewer than 50 amino acids long, more suitably fewer than 40, fewer than 30 or fewer than 20 amino acids in length. The polypeptide may be between 10 and 15 amino acids, between 10 and 20 amino acids or between 10 and 25 amino acids in length. The CD154 sequence and CD40 binding region are not highly conserved among various species. The CD154 sequences of chicken and human are provided in SEQ ID NO: 13 and SEQ ID NO: 14, respectively.

The CD40 binding regions of CD154 have been determined for a number of species, including human, chicken, duck, mouse and cattle and are shown in SEQ ID NO: 15, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, and SEQ ID NO:19, respectively. Although there is variability in the sequences in the CD40 binding region between species, cross-species binding of CD154 to CD40 has been reported. For example, the human CD154 polypeptide was able to enhance the immune response in chickens. Therefore, one may practice the invention using species specific CD154 polypeptides or a heterologous CD154 polypeptide.

The HMGB1 (High Mobility Group Box-1) protein was first identified as a DNA-binding protein critical for DNA structure and stability. It is a ubiquitously expressed nuclear protein that binds DNA with no sequence specificity. The protein is highly conserved and found in plants to mammals. The zebrafish, chicken and human HMGB1 amino acid sequences are provided in SEQ ID NO: 28, SEQ ID NO: 20 and SEQ ID NO: 27, respectively. The sequence throughout mammals is highly conserved with 98% amino acid identity and the amino acid changes are conservative. Thus an HMGB1 protein from one species can likely substitute for that from another species functionally. The full-length HMGB1 protein or a portion thereof may be used as the HMGB1 polypeptide in the vaccine vectors described herein. HMGB1 has two DNA binding regions termed A box as shown in SEQ ID NO: 21 and 22 and B box as shown in SEQ ID NO: 23 and 24. See Andersson and Tracey, Annu. Rev. Immunol. 2011, 29:139-162, which is incorporated herein by reference in its entirety.

HMGB1 is a mediator of inflammation and serves as a signal of nuclear damage, such as from necrotic cells. HMGB1 can also be actively secreted by cells of the monocyte/macrophage lineage in a process requiring acetylation of the protein, translocation across the nucleus and secretion. Extracellular HMGB1 acts as a potent mediator of inflammation by signaling via the Receptor for Advanced Glycated End-products (RAGE) and via members of the Toll-like Receptor family (TLR), in particular TLR4. The RAGE binding activity has been identified and requires the polypeptide of SEQ ID NO: 25. TLR4 binding requires the cysteine at position 106 of SEQ ID NO: 20, which is found in the B box region of HMGB1.

The inflammatory activities of HMGB1 do not require the full-length protein and functional fragments have been identified. The B box has been shown to be sufficient to mediate the pro-inflammatory effects of HMGB1 and thus SEQ ID NO: 23 and 24 are HMGB1 polypeptides or functional fragments thereof within the context of the present invention. In addition, the RAGE binding site and the pro-inflammatory cytokine activity have been mapped to SEQ ID NO: 25 and SEQ ID NO: 26, respectively. Thus, these polypeptides are functional fragments of HMGB1 polypeptides in the context of the present invention.

Those of skill in the art are capable of identifying HMGB1 polypeptides and fragments thereof capable of stimulating pro-inflammatory cytokine activity, using methods such as those in International Publication No. WO02 092004, which is incorporated herein by reference in its entirety. Suitably, the HMGB1 polypeptide includes the RAGE binding domain at amino acids 150-183 of SEQ ID NO:20 (SEQ ID NO: 25 or a homolog thereof) and the pro-inflammatory cytokine activity domain between amino acids 89-109 of SEQ ID NO: 20 (SEQ ID NO: 26 or a homolog thereof). In particular, HMGB1 polypeptides and functional fragments or homologs thereof include polypeptides identical to, or at least 99% identical, at least 98% identical, at least 95% identical, at least 90% identical, at least 85% identical, or at least 80% identical to the HMGB1 polypeptides of SEQ ID NOs: 20-28.

One of skill in the art will appreciate that the HMGB1 polypeptide could be used to enhance the immune response to more than one antigenic polypeptide present in a vector. The polypeptide from HMGB1 stimulates an immune response at least in part by activating dendritic cells and macrophages and thus stimulating production of IL-1, IL-6, IFN-γ and TNF-α. Suitably, HMGB1 may be expressed on the surface of the vector.

At least a portion of the antigenic polypeptide and at least a portion of the HMGB1 polypeptide or another immunostimulatory polypeptide may be present on the surface of the vaccine vector. Present on the surface of the vaccine vector includes polypeptides that are comprised within a transmembrane protein, interacting with, covalently or chemically cross-linked to a transmembrane protein, a membrane lipid or membrane anchored carbohydrate. A polypeptide can be comprised within a transmembrane protein by having the amino acids comprising the polypeptide linked via a peptide bond to the N-terminus, C-terminus or anywhere within the transmembrane protein (i.e. inserted between two amino acids of the transmembrane protein or in place of one or more amino acids of the transmembrane protein (i.e. deletion-insertion). Suitably, the polypeptides may be inserted into an external loop of a transmembrane protein. Suitable transmembrane proteins are cotB and lamB, but those of skill in the art will appreciate many suitable transmembrane proteins are available.

Alternatively, the polypeptides may be covalently or chemically linked to proteins, lipids or carbohydrates in the membrane, or capsid if a viral vector is being used through methods available to persons of skill in the art. For example, di-sulfide bonds or biotin—avidin cross-linking could be used to present the antigenic and HMGB1 polypeptides on the surface of a vaccine vector. Suitably, the antigenic polypeptide and the HMGB1 polypeptide are part of a fusion protein. The two polypeptides may be directly linked via a peptide bond or may be separated by a linker or a section of a third protein into which they are inserted.

In the Examples, some of the vectors have the Campylobacter antigenic polypeptides (cj0113, cj0420 and cj0982) and the immunostimulatory polypeptide (CD154 amino acids 140-149 or HMGB1 or a functional fragment thereof) encoded on the same polynucleotide (lamB) such that the sequences are in frame with each other and with the Salmonella polynucleotide in which they were inserted. In some embodiments, linkers may be added between the polynucleotide sequences encoding the antigenic polypeptide and the immunostimulatory polypeptide such that in the expressed polypeptide several amino acids separate the two polypeptides. The linker may be 3 nucleotides encoding a single amino acid, or may be much longer, e.g. 30 nucleotides encoding 10 or more amino acids. In the Examples a 9 nucleotide linker was used and encoded for three serine residues. Those of skill in the art will readily envision many other types of linkers that could be used.

In addition, the polynucleotides may be present in a single copy or in multiple copies. For example, three copies of the antigenic polypeptide and three copies of the immunostimulatory polypeptide may be found in the same external loop of a transmembrane protein or expressed within several different vector proteins. In alternative embodiments, the immunostimulatory polypeptide and the antigenic polypeptide may be encoded by distinct polynucleotides.

Potential vaccine vectors for use in the methods include, but are not limited to, Bacillus, Salmonella (Salmonella enteritidis), Shigella, Escherichia (E. coli), Yersinia, Bordetella, Lactococcus, Lactobacillus, Streptococcus, Vibrio (Vibrio cholerae), Listeria, adenovirus, poxvirus, herpesvirus, alphavirus, and adeno-associated virus. Suitably, the vaccine vector is a GRAS organism. The vaccine vector may be inactivated or killed such that it is not capable of replicating. Methods of inactivating or killing bacterial or viral vaccine vectors are known to those of skill in the art and include, but are not limited to methods such as formalin inactivation, antibiotic-based inactivation, heat treatment and ethanol treatment. In some embodiments the vaccine vector may be a liposome based vector.

Compositions comprising the vector and a pharmaceutically acceptable carrier are also provided. A pharmaceutically acceptable carrier is any carrier suitable for in vivo administration. The pharmaceutically acceptable carrier may include water, buffered solutions, glucose solutions or bacterial culture fluids. Additional components of the compositions may suitably include excipients such as stabilizers, preservatives, diluents, emulsifiers and lubricants. Examples of pharmaceutically acceptable carriers or diluents include stabilizers such as carbohydrates (e.g., sorbitol, mannitol, starch, sucrose, glucose, dextran), proteins such as albumin or casein, protein-containing agents such as bovine serum or skimmed milk, and buffers (e.g., phosphate buffer). Especially when such stabilizers are added to the compositions, the composition is suitable for freeze-drying or spray-drying.

Methods of enhancing immune responses to Campylobacter in a subject by administering the vectors described herein are also provided. The vector may contain a HMGB1 polypeptide or a CD154 polypeptide capable of stimulating the immune response to the vector and the antigenic polypeptides described above. The vector is administered to a subject in an amount effective to enhance the immune response of the subject to the non-native antigenic polypeptides. Suitably the immune response to challenge with Campylobacter is enhanced.

Enhancing an immune response includes, but is not limited to enhancing antibody responses. Suitably the IgA response is enhanced, more suitably the secretory IgA response is enhanced after administration of the vector as compared to a control. The control may be the same subject prior to administration of the vector, a comparable subject administered a vector alone or a vector expressing an irrelevant or a non-Campylobacter antigenic polypeptide. The antibody response, suitably the IgA response, may be increased as much as two fold, three fold, four fold, five fold or more as compared to the response of a control subject. The enhanced immune response may also result in a reduction of the ability of Campylobacter to grow or replicate and colonize the subject after administration of the vectors described herein. Such a reduction may be tested by challenging a subject administered the vector with a Campylobacter infection and monitoring the ability of the bacteria to colonize and replicate, i.e. infect, the subject as compared to a control subject. The growth of Campylobacter in the subject may be reduced by 1 log, 2 logs, 3 logs, 4 logs, 5 logs or even more. The growth of Campylobacter in a subject administered the vector may be below the level of detection.

In addition, methods of enhancing resistance to Campylobacter infection are disclosed. Briefly, the methods comprise administering to a subject the vectors described above comprising Campylobacter antigenic polypeptides in an amount effective to elicit an immune response. Enhancing resistance to Campylobacter infection includes but is not limited to reducing the incidence of Campylobacter infections, limiting the spread of Campylobacter infections from one host to another, reducing Campylobacter replication in the subject, invasion or spread within a single host, reduced morbidity associated with Campylobacter infections, and reduced duration of a Campylobacter infection.

Administration of the vector may prevent the subject from contracting Campylobacter or from, exhibiting any outward signs of disease, such as gastroenteritis or GBS. Increased resistance to Campylobacter may also include increased antibody production, suitably IgA production. The antibody response, suitably the IgA response, may be increased as much, as two fold, three fold, four fold, five fold or more as compared to the response of a control subject. The enhanced immune response may also result in a reduction of the ability of Campylobacter to grow or replicate and colonize the subject after administration of the vectors described herein. Such a reduction may be tested by challenging a subject administered the vector with a Campylobacter infection and monitoring the ability of the bacteria to colonize and replicate, i.e. infect, the subject as compared to a control subject. The growth of Campylobacter in the subject may be reduced by 1 log, 2 logs, 3 logs, 4 logs, 5 logs or even more. The growth of Campylobacter in a subject administered the vector may be below the level of detection.

The antigenic polypeptides for use in all the methods described herein may be from cjaD, cjaA or ACE 393 as discussed above. The insertion of the antigenic polypeptides into the vector may be accomplished in a variety of ways known to those of skill in the art, including but not limited to the scarless site-directed mutation system described in International Patent Publication No. WO2008/036675, which is incorporated herein by reference in its entirety. The vector may be a bacterium engineered to express Campylobacter antigenic polypeptides in conjunction with polynucleotides capable of enhancing the immune response as discussed above. In particular, a polypeptide of CD154 or HMGB1 may be expressed by the vector to enhance the immune response of the subject to the antigenic polypeptides. The vectors used in these methods may be attenuated or killed prior to administration or use in the methods.

The useful dosage to be administered will vary depending on the age, weight and species of the subject, the mode and route of administration and the type of pathogen against which an immune response is sought. The composition may be administered in any dose of vector sufficient to evoke an immune response. For bacterial vectors, it is envisioned that doses ranging from 10³ to 10¹⁰ bacteria, from 10⁴ to 10⁹ bacteria, or from 10⁵ to 10⁷ bacteria are suitable. The composition may be administered only once or may be administered two or more times to increase the immune response. For example, the composition may be administered two or more times separated by one week, two weeks, or by three or more weeks. The bacteria vectors are suitably viable prior to administration, but in some embodiments the bacteria vectors may be killed prior to administration. In some embodiments, the bacteria vectors may be able to replicate in the subject, while in other embodiments the bacteria vectors may be attenuated and/or may not be capable of replicating in the subject.

For administration to animals or humans, the compositions may be administered by a variety of means including, but not limited to, intranasally, mucosally, by spraying, intradermally, parenterally, subcutaneously, orally, by aerosol or intramuscularly. Eye-drop administration or addition to drinking water or food are additionally suitable means of administration. For chickens, the compositions may be administered in ovo.

With regard to the methods, a subject includes, but is not limited to, a vertebrate, suitably a mammal, suitably a human, or birds, suitably poultry such as chickens or turkeys. Other animal models of infection may also be used. Enhancing an immune response includes, but is not limited to, inducing a therapeutic or prophylactic effect that is mediated by the immune system of the subject. For example, an immune response is enhanced if the subject is protected from subsequent infection with Campylobacter. Specifically, enhancing an immune response may include enhanced production of antibodies, such as demonstrated in FIGS. 4-8, enhanced class switching of antibody heavy chains, maturation of antigen presenting cells, stimulation of helper T cells, stimulation of cytolytic T cells or induction of T and B cell memory. In the Examples, an increase in the amount of secretory IgA was seen after administration of the vector and was correlated with protection from subsequent Campylobacter infection.

It is envisioned that several epitopes or antigens from the same or different pathogens may be administered in combination in a single vector to generate an enhanced immune response against multiple antigens and their associated pathogens. Recombinant vaccine vectors may encode antigens from multiple pathogenic microorganisms, viruses or tumor associated antigens. Administration of vaccine vectors capable of expressing multiple antigens has the advantage of inducing immunity against two or more diseases at the same time.

Heterologous polynucleotides encoding antigens can be inserted in the vaccine vector genome at any non-essential site or alternatively may be carried on a plasmid using methods well known in the art. One suitable site for insertion of polynucleotides is within external portions of transmembrane proteins or coupled to sequences which target the heterologous polynucleotide for secretory pathways. One example of a suitable transmembrane protein for insertion of polynucleotides is the lamB gene of Salmonella. Heterologous polynucleotides include, but are not limited to, polynucleotides encoding antigens selected from pathogenic microorganisms or viruses other than the vaccine vector, i.e., non-native polynucleotides encoding non-native polypeptides.

The following examples are meant only to be illustrative and are not meant as limitations on the scope of the invention or of the appended claims. All references cited herein are hereby incorporated by reference in their entirety.

EXAMPLES

Attenuation of Salmonella Vaccine Candidate Strains

Salmonella enteritidis phage type 13A (S. enteritidis) was attenuated by introducing defined, irreversible deletion mutations in the aroA and/or htrA gene of the S. enteritidis genome as previously described (available as ATCC Deposit Nos: PTA-7871, PTA-7872 and PTA-7873). Briefly, the target gene sequence in the bacterial genome of S. enteritidis was replaced with the kanamycm-reslstant (Km^R) gene sequence. This was performed using 3S-PCR and electroporation of the 3S-PCR products into electrocompetent Salmonella cells containing the pKD46 plasmid. The resulting cell mixture was plated on LB agar plates supplemented with Km to select for positive clones containing a Km^R gene. The Km^R gene was inserted into the genomic region containing the genes of interest (aroA or htrA) by flanking the Km^R gene with sequences homologous to the genes of interest. Once Km⁸ mutants were obtained, the deletion mutations were confirmed by PCR and DNA sequencing. All Km^R genes were removed before epitope insertion was started.

Construction of Recombinant Vaccine Candidates

Three potential candidate antigenic polypeptides were selected: Omp18/cjaD (cj0113), cjaA (cj0982) and ACE393 (cj0420). The polypeptides selected were as follows: cj0113 (GVSITVEGNCDEWGTDEYNQAWMTTSYAPTS; SEQ ID NO: 10), cj0982c (KDIVLDAEIGGVAKGKDGKEKWMTTSYAPTS; SEQ ID NO: 11), and cj0420 (KVALGVAVPKDSNITSVEDLKDKTLLLNKGTTADAWMTTSYAPTS; SEQ ID NO: 12), all inserts additionally contain a sequence for amino acids 140-149 of CD154.

Recombinant S. enteritidis strains containing stable integrated copies of cj0113-CD154 (cj0113), cj0420-CD154 (cj0420) or cj0982c-CD154 (cj0982) were constructed using the method of Cox et al. Scarless and site-directed mutagenesis in Salmonella enteritidis chromosome. BMC Biotechnol 2007; 7:59. Briefly, an I-SceI enzyme site along with a Km^R gene was introduced into Loop 9 of the lamB gene by design of a PCR product which had the I-SceI enzyme site and Km^R gene flanked by approximately 200-300 base pairs of DNA on each side, homologous to the up and downstream regions of Loop 9. Primers used are shown in Table 1 below. The PCR product was electroporated into electrocompetent attenuated Salmonella cells containing the pKD46 plasmid and the resulting cell mixture plated on LB agar plates supplemented with Km to select for positive clones now containing a Km^R gene. After the Sce-I/Km mutation was made in Loop 9, this region was replaced by a codon-optimized foreign epitope DNA sequence (Burns D M, Beacham I R. Rare codons in E. coli and S. typhimurium signal sequences, FEBS Lett 1985; 189(2):318-24). This second 3S-PCR reaction produced the foreign epitope insert flanked by Loop 9 up and downstream regions, and the resulting PCR product was electroporated into electrocompetent SE13A containing the Sce-I/Km mutation described above. Plasmid pBC-I-SceI was also electroporated into the cells along with the insert as the plasmid produces the I-SceI enzyme which recognizes and cleaves a sequence creating a gap at the I-SceI enzyme site in the Loop 9 region of the LamB gene where the foreign epitope sequences inserted into the SE13A genome. The plasmid also carries with it a chloramphenicol (Cm) resistant gene (Cm^R) as the inserts that will replace the Km^R gene the mutations must have a new selection marker to counter-select against the previous I-SceI/Km mutation. After electroporation, cells were plated on LB agar plates containing 25 μg/mL Cm for the selection of positive mutants.

TABLE I
PCR Primers
	Amplified
Primer	Region	Primer Sequence (SEQ ID NO)
lam-up-f	Loop 9 up	5′TGTACAAGTGGACGCCAATC 3′ (SEQ ID NO: 29)
lam-up-r	Loop 9 up	5′GTTATCGCCGTCTTTGATATAGCC3′ (SEQ ID NO: 30)
lam-dn-f	Loop 9 dn	5′ATTTCCCGTTATGCCGCAGC3′ (SEQ ID NO: 31)
lam-dn-r	Loop 9 dn	5′ GTTAAACAGAGGGCGACGAG 3′ (SEQ ID NO: 32)
Km-f	I-Scel/Kmr	5′GCTATATCAAAGACGGCGATAAC TAACTATAACGGTCCTAAGGTAGCGA
	gene	ATTTCCGGGGATCCGTCGA 3′ (SEQ ID NO: 33)
Km-r	I-Scel/Kmr	5′ GCTGCGGCATAACGGGAAA TGTAGGCTGGAGCTGCTTCG 3′ (SEQ ID NO: 34)
Kan4f	Inside Kmr	5′CAAAAGCGCTCTGAAGTTCC 3′ (SEQ ID NO: 35)
	gene
Kan4r	Inside Kmr	5′GCGTGAGGGGATCTTGAAGT 3′ (SEQ ID NO: 36)
	gene
lam 3f	Outer regions	5′GCCATCTCGCTTGGTGATAA 3′ (SEQ ID NO: 37)
	of loop 9
lam 3r	Outer regions	5′CGCTGGTATTTTGCGGTACA 3′ (SEQ ID NO: 38)
	of loop 9
Cj0113f	Insert with	5′TTCATCGGTACCCCATTCATCACAGTTACCCTTCAACGGTGATGCTAACACCGGAGGAGGAGT
	loop 9 up	TATCGCCGTCTTTGATATAGCC3′ (SEQ ID NO: 39)
Cj0113r	Insert with	5′ATGAATGGGGTACCGATGAATATAACCAGGCGTCCTCCTCCTGGATGACCACCTCCTATGCG
	loop 9 down	CCGACCTCCTCCTCCTCCATTTCCCGTTATGCCGCAGC3′ (SEQ ID NO: 40)
Cj0420f	Insert with	5′ATCTTTACCTTTCGCAACACCACCGATTTCCGCATCCAGAACGATATCTTTGGAGGAGGAGT
	loop 9 up	TATCGCCGTCTTTGATATAGCC3′ (SEQ ID NO: 41)
Cj0420r	Insert with	5′GTGTTGCGAAAGGTAAAGATGGTAAAGAAAAATCCTCCTCCTGGATGACCACCTCCTATGC
	loop 9 down	GCCGACCTCCTCCTCCTCCATTTCCCGTTATGCCGCAGC3′ (SEQ ID NO: 42)
Cj0982	Insert with	5′GGTTTTATCTTTCAGATCTTCAACGCTGGTGATGTTGCTATCTTTCGGAACCGCAACACCCA
c-f	loop 9 up	GCGCAACTTTGGAGGAGGAGTTATCGCCGTCTTTGATATAGCC3′ (SEQ ID NO: 43)
Cj0982	Insert with	5′AAGATCTGAAAGATAAAACCCTGCTGCTGAACAAAGGTACCACCGCGGATGCGTCCTCCTC
c-r	loop 9 down	CTGGATGACCACCTCCTATGCGCCGACCTCCTCCTCCTCCATTTCCCGTTATGCCGCAGC3′
		(SEQ ID NO: 44)

Once positive mutation/inserts were suspected, PCR and DNA sequencing were performed to confirm that the insertion, sequences are present and correct.

Challenge with Campylobacter jejuni

Three wild-type isolates of C. jejuni from broiler chickens were individually grown to log-phase growth, combined, serially diluted and spread plated for conventional culture enumeration as previously described (Cole et al. Effect of aeration and storage temperature on Campylobacter concentrations in poultry semen. Poult Sci 2004; 83:1734-8). These were diluted to approximately 10⁷ to 10⁸ cfu/ml tor challenge by oral gavage using spectrophotometric density and comparison to a previously-generated standard curve. Empirically determined cfu administered are reported for each of experiment involving challenge (see below).

Vaccination Study 1

In the first immunization study, 210 day-of-hatch broiler chicks were obtained from a local commercial hatchery and randomly assigned to one of four treatment groups: saline only (Negative control), or one of three vaccine candidate groups: cj0113, cj0420 or cj0982; n=50/pen. Each treatment group was housed in an individual floor pen on fresh pine Litter and provided water and feed ad libitum. On day-of-hatch, all chicks in each treatment group were inoculated, via oral gavage, with 0.25 mL of a solution containing approximately 10⁸ cfu/mL of the appropriate treatment. On day 21 post-hatch, all birds in each treatment group were challenged with C. jejuni, via oral gavage, with 0.25 mL of a solution containing 1×10⁷ cfu/ml. On days 3, 11, 21 (prior to booster inoculation) and 32 post-hatch, 10-15 birds from each treatment group were humanely killed and their liver, spleen and cecal tonsils aseptically removed for the determination of organ invasion, colonization and clearance of the Salmonella vaccine vector strains. Also, on days 21 and 32 post-hatch, ileum sections were removed and processed for use in qRT-PCR and on day 32 a separate ileum sample was removed and diluted 1:5 in saline and was used to test for secretory immunoglobulin A (sIgA). In addition, blood samples were collected from 10 birds per treatment group and the serum was used for determining antibody response on days 21 and 32 post-vaccination.

Vaccination Study 2

In experiment 2, 110 day-of-hatch broiler chicks were obtained from a local commercial hatchery and randomly assigned to one of two treatment groups: saline only (vehicle control) or Salmonella vaccine candidate, cj0113, (n=55/pen). Each treatment group was housed in an individual floor pen on fresh pine litter and provided water and feed ad libitum. On day-of-hatch, all chicks in each treatment group were inoculated via oral gavage with 0.25 mL of a solution containing approximately 10⁸ cfu/mL of the appropriate treatment. On day 21 post-hatch, all birds in each treatment group were challenged with C. jejuni, via oral gavage, with 0.25 mL of a solution containing 1×10⁷ cfu/ml. On days 3, 11, 21 (prior to booster inoculation) and 32 post-hatch, 10-15 birds from each treatment group were humanely killed and their liver, spleen and cecal tonsils aseptically removed for the determination of organ invasion, colonization and clearance of the Salmonella vaccine vector strains. Also, on days 21 and 32 post-hatch ileum sections were removed and processed for use in qRT-PCR. In addition, blood samples were collected from 10 birds per treatment group and the serum was used for determining antibody response on days 21 and 32 post-hatch.

Vaccination Study 3

A third experiment was similar to vaccination experiment 2 (described above) except with the addition of a third group of S. enteriditis 13A aroA/htrA without the Campylobacter epitope (SE13A) as a control for the oral vaccination of the vector itself. All sample collections were the same as vaccination study 2 except on day 32 post-hatch an additional section of ileum was used to harvest the mucosal layer for sIgA as in experiment 1.

Measurement of Campylobacter Antibody Response

Serum collected from birds in both immunization studies was used in an ELISA to determine relative antibody responses. Briefly, individual wells of a 96-well plate were coated with C. jejuni. Antigen adhesion was allowed to proceed overnight at 4° C., the plates were then washed and blocked with Superblock™ (Pierce) for 1 hour at room temperature. Plates were then incubated for 2 hours with a 1:50 dilution of the previously collected sera. The plates were rinsed again followed by incubation with a Peroxidase-labeled anti-chicken IgG secondary antibody (Jackson Immunolaboratories) for an additional hour. After subsequent rinsing, the plates were developed using a peroxidase substrate kit (BD OpEIA™, Fisher Scientific) and absorbances were read on a spectrophotometer at 450 nm. Each plate contained a positive control and negative control where a pooled sample from vaccinated chicks and pre-immune chicken serum, respectively, replaced the serum from the treatment groups. The absorbance obtained for the positive control, negative control and experimental samples were used to calculate Sample to Positive control ratios (S/P ratios) using the following calculation: (sample mean−negative control mean)/(positive control mean−negative control mean) (Brown et al. Detection of antibodies to Mycoplasma gallisepticum in egg yolk versus serum samples. J Clin Microbiol 1991; 29(12):2901-3 and Davies et al. Evaluation of the use of pooled serum, pooled muscle tissue fluid (meat juice) and pooled faeces for monitoring pig herds for Salmonella. J Appl Microbiol 2003; 95(5):1016-25). The ELISA method used for detection of sIgA was similar to the above described assay for serum immunoglobulin except we used goat anti-chicken IgA conjugated with horseradish peroxidase (GenTex) in place of the anti-chicken IgG antibody conjugate.

DNA Isolation and Quantitative PCR for C. jejuni

Total DNA extraction from ileal samples was achieved using the QIAmp® DNA Stool Mini Kit (Qiagen). The manufacturer's included protocol was modified slightly in the following ways: ileal contents were removed to include the mucosal layer and diluted 1:5 (w/v) with ice cold PBS+0.05% Tween 20; one ml of the slurry was added to ml of the included ASL Buffer in a 2.0 ml microcentrifuge tube, vortexed and heated to 70° C. for 5 minutes. Subsequently, the manufactures recommendations were followed to the last step when the DNA was eluted into a final volume of 50 ul.

Quantitative determination of C. jejuni was accomplished using a previously published method with slight modifications (Skanseng et al. Comparison of chicken gut colonisation by the pathogens Campylobacter jejuni and Clostridium perfringens by real-time quantitative PCR. Mol Cell Probes 2006; 20(5):269-7)9. The assay was optimized for use on the MX3005P® (Agilent Technology) and Brilliant® II QPCR master mix (Agilent Technologies) all other mixture components, primers, probe and cycling conditions remained as published.

A standard curve (FIG. 1) was prepared using a pure culture of C. jejuni serially diluted 10-fold and added to a constant background of ileal content; total DNA isolation was done as previously described.

Statistical Analysis

Data were analyzed using Student's two-tailed t-test assuming unequal variances to compare the difference between groups and controls using JMP™ statistic software. A value of P<0.05 was considered significant.

Results

An excellent correlation of quantification of C. jejuni using conventional microbiological enumeration techniques verses the qPCR was found (FIG. 1) with a greater than 99% correlation between the two methods. In experiment 1, we observed significant levels of colonization by the three candidate vectored vaccines within the cecal tonsils by day 3 post-vaccination; as well as significant invasion of the internal organs by the cj0113 expressing vector at the same time point (Table II). However, by day 11 post-vaccination, there was a decline in the amount of colonization of all three vectors and by day 21 post-vaccination, the vectors had been completely cleared from the cecal tonsils as well as the internal organs (Table II). We observed the same trend in our follow up vaccination study (experiment 2), using vector-expressed cj0113 as our vaccine candidate, as shown by the data presented in Table II.

TABLE II
Percentage of colonization, invasion and clearance of liver, spleen
or cecal tonsils by Salmonella following vaccination with one of three
Salmonella vectored vaccine candidates or saline gavage.
	Liver/Spleen	Cecal Tonsils
	Day	Day	Day	Day	Day	Day	Day	Day
	3	11	21	32	3	11	21	32
Experi-
ment 1
Saline	0	0	0	0	0	0	0	0
cj0420	0	0	0	0	60	0	0	0
cj0113	50	0	0	0	100	40	0	0
cj0982	0	0	0	0	70	20	0	0
Experi-
ment 2
Saline	0	0	0	0	0	0	0	0
cj0113	0	20	0	0	50	40	0	0
In experiments 1 and 2 incidence of the attenuated recombinant Salmonella vaccine vector is represented as the percentage of positive liver, spleen, or cecal tonsils out of 10 birds. Chicks were orally gavaged with approximately 108 cfu of the appropriate treatment on day-of-hatch and. On days 3, 11, 21 and 32 post-hatch, 10 birds from each treatment group were euthanatized, and the livers, spleens, and ceca tonsils were collected for the determination (+/−) of the attenuated recombinant Salmonella vaccine vectors. The liver and spleen of each bird was pooled and assayed as one sample.

Chickens were challenged with C. jejuni on day 21 post vaccination. Ileal mucosal samples were obtained on days 21 and 32 post vaccination (days 0 and 11 post challenge) and used for DNA sample preparation to enumerate C. jejuni within the gut as described above. Vaccination with vector candidates cj0420 and cj0982 caused an approximate 1 log and 2 log reduction (P<0.05), respectively, in the level of C. jejuni present in the ileal samples. Using the cj0113 vaccine candidate, there was a marked 4.8 log reduction (P<0.05) of C. jejuni in the ileum compared to the control birds (FIG. 2).

In experiment 2, a repeat of the primary immunization study was done with only the vaccine candidate expressing cj0113. In this study, qPCR data revealed an approximate 5 log reduction of C. jejuni in cj0113 SE-vectored vaccine administered to birds when compared to the birds receiving saline only (Table III). Additionally, in experiment 3 vaccination, with the cj0113 vector caused an approximate 4 log reduction, to below detectable levels, of C. jejuni as compared with the saline or Salmonella parent strain which contained no epitope insert (FIG. 3).

TABLE III
Enumeration of Campylobacter jejuni by quantitative
PCR in chicks 11 days following Campylobacter
challenge in Experiment 2 (n = 10).
	Mean C. jejuni
	Log10 cfu/gm
	ileum	SDa	SEb
	Saline	5.00	0.98	0.44
	cj0113	0.00	0.00	0.00
	In experiment 2 Campylobacter jejuni quantification was determined in chicks receiving saline or the Salmonella vectored vaccine candidate, cj0113 at 108 cfu/chick by quantitative PCR 11 days after receiving a C. jejuni challenge dose of approximately 107 cfu/ml. qPCR was performed on total DNA extracted by conventional methods from mucosal linings of the ileum. The results are presented as mean log10 cfu/gram of ileum content with standard deviationa and standard errorb (n = 10).

Serum samples collected in each experiment on Days 21 and 32 post-vaccination were used to determine C. jejuni-specific IgG antibodies. In the first experiment all three vaccine candidates (cj0420, cj0113, cj0982) caused significantly higher antibody levels at both time points when compared to the group which received only saline (FIG. 4). Also in the first experiment, the group vaccinated with cj0113 showed significantly higher antibody titers when compared to cj0420 and cj0982 (FIG. 4). An ELISA was also used to determine mucosal sIgA antibody levels specific for Campylobacter. These data indicate that the vaccine vector cj0113 caused a significant increase in the levels of sIgA when compared, to the saline group and the two groups receiving either cj0420 or cj0982 (FIG. 5). The results from the second and third study in which only cj0113 was used as a vaccine candidate showed results similar to experiment 1 with vaccinated birds having significantly higher levels of antigen-specific IgG and sIgA antibodies to C. jejuni when compared to the birds receiving only saline (Data for Experiment 3 are shown in FIG. 6). Also, in the third experiment the antibody levels for the backbone strain (SE13) were similar to saline controls (FIG. 6).

Bacillus Vectored Vaccination Study

Production of Heterologous Proteins for Vegetative Cell Expression

Plasmid pHT10 purchased from MoBioTec/Boca. Scientific, Boca Raton, Fla. (Nguyen et al., 2007) was transformed at the multiple cloning site by addition of a Bacillus subtilis codon optimized insertion sequence for cj0113 and HMGB1 (SEQ ID NO: 4 and 20, respectively). DNA sequencing was done to confirm correct sequence insertion. The newly modified plasmid was then transformed into Bacillus. Briefly, Bacillus cultures were grown overnight at 37° C. in HS media (Spizizen's medium supplemented with 0.5% glucose, 50 μg/ml DL-tryptophan, 50 μg/ml uracil, 0.02% casein hydrolysate, 0.1% yeast extract, 8 μg/ml arginine, 0.4 μg/ml histidine, 1 mM MgSO4). Inoculate 20 ml LS medium (Spizizen's medium supplemented with 0.5% glucose, 5 μg/ml DL-tryptophan, 5 μg/ml uracil, 0.01% casein hydrolysate, 0.1% yeast extract, 1 mM MgSO₄ 2.5 mM MgCl₂, 0.5 mM CaCl₂) with 1 ml overnight culture and incubate with shaking for 3-4 hours at 30° C. Withdraw 1 ml of LS culture and add 10 μl of 0.1M EGTA and incubate at room temperature for 5 minutes. Add 1-2 μg plasmid DNA, shake for 2 hours at 37° C., and plate on LB plates with selective antibiotics. These transformed Bacillus spp. now produce heterologous epitope sequences from Campylobacter (cj0113) and HMGB1 when induced with 1 mM IPTG.

Vaccination Study

In the vaccination challenge, 100 day-of-hatch broiler chicks were obtained from a local commercial hatchery and randomly assigned to one of four treatment groups: saline only. Bacillus vector alone (BSBB) or 10⁶ or 10⁸ Bacillus vaccine candidate, cj0113, (n=25/pen). Each treatment group was housed in an individual floor pen on fresh pine litter and provided water and feed ad libitum. On day-of-hatch, all chicks in each treatment group were inoculated via oral gavage with 0.25 mL of a solution containing approximately 1.06 cfu/mL of the backbone vector strain or the Cj0113 Bacillus vector. On day 10 birds received a booster vaccination of the same treatment they received on day of hatch. On day 21 post-hatch, all birds in each treatment group were challenged with C. jejuni, via oral gavage, with 0.25 mL of a solution containing 1×10⁷ cfu/ml prepared as described above. On days 3, 11, 21 (prior to booster inoculation) and 32 post-hatch, 10-15 birds from each treatment group were humanely killed and their liver, spleen and cecal tonsils aseptically removed for the determination of organ invasion, colonization and clearance of the vaccine vector strains. Also, on days 21 and 36 post-hatch ileum sections were removed and processed for use in qRT-PCR. In addition, blood samples were collected from 15 birds per treatment group and the serum was used for determining antibody response on days 21 and 36 post-hatch.

Results

Serum samples collected on Day 36 post-vaccination were used to determine C. jejuni-specific IgG antibodies. Vaccination with the bacillus vector expressing the cj0113 polypeptide caused significantly higher antibody levels when compared to the group which received only saline or empty vector (FIG. 7). An ELISA was also used to determine mucosal sIgA antibody levels specific for Campylobacter at day 36 post vaccination. These data indicate that the vaccine vector expressing cj0113 caused a significant increase in the levels of sIgA when compared to the empty vector (FIG. 8).

Chickens were challenged with C. jejuni on day 24 post vaccination. Ileal mucosal samples were obtained on days 24 and 36 post vaccination (days 0 and 11 post challenge) and used for DNA sample preparation to enumerate C. jejuni within the gut as described above. Vaccination with the Bacillus cj0113 vector caused an approximate 3 log reduction (P<0.05) in the level of C. jejuni present in the ileal samples (FIG. 9).

Vaccination Study in Turkey Poults

Since the Salmonella-vectored Cj0113 vaccine has been effective in reducing Campylobacter recovery after challenge in chickens we hypothesized that the vaccine may also work in poults. Therefore, to further evaluate the use of this epitope delivery system, an experiment was designed to test the effectiveness of the vaccine against C. coli challenge in turkey poults.

The ΔSE-cj0113 vaccine was constructed as described above. Salmonella enteritidis phage type 13A (SE13A) was used as the backbone strain for this vaccine candidate. This isolate was double attenuated by irreversible gene deletions in the aroA and htrA genes as previously described. Recombinant strains containing these deletions were then modified further to incorporate the cj0113 insert and an immunostimulatory molecule, CD-154 (ΔSE-cj0113). These sequences were integrated as previously described.

In this experiment, 70 poults were obtained from a local hatchery. They were randomly assigned to one of two treatment groups and tagged. Thirty poults were orally gavaged with 10⁸ cfu/poult ΔSE-cj0113 and the remaining poults were sham treated with saline. On day 21, poults were challenged with 1.5×10⁸ s cfu/poult of C. coli by oral gavage. Liver, spleen and cecal tonsils were aseptically removed on day 3 (N=10), day 21 (N=10) and day 35 (N=10) for detection of vector recovery by enrichment in tetrathionate broth and plating on Brilliant Green agar. On days 21 and 35, ingesta (N=10) and tissue (N=5) samples were collected for further analysis. Ingesta from the Ileum of cultured poults were analyzed using qPCR for enumeration of C. coli. Tissue samples from the same region were collected and total RNA was extracted. Interferon-gamma and TNF-alpha like vaccine responses were evaluated.

Results

As previously shown in chickens, the poults developed a significant immune response following vaccination with Salmonella-vectored Cj0113 vaccine. After challenge, there was a about a five-log reduction in Campylobacter coli in the ileum as compared to vector only controls (FIG. 10). Vaccination with the Salmonella-vectored Cj0113 vaccine does appear to work in turkeys similar to the chickens.

Claims

1. A vaccine vector comprising a first polynucleotide sequence encoding an antigenic polypeptide not natively associated with the vector and a second polynucleotide sequence encoding an HMGB1 polypeptide having at least 98% sequence identity to at least one of SEQ ID NOs: 20, 27 or 28, wherein the antigenic polypeptide consists of SEQ ID NO: 7, or a fragment of SEQ ID NO: 1 comprising SEQ ID NO: 7, wherein the vaccine vector elicits an immune response to Campylobacter jejuni.

2. The vaccine vector of claim 1, wherein the vaccine vector is a bacterium.

3. The vaccine vector of claim 2, wherein the bacterium is from a genus selected from Salmonella, Escherichia, Bacillus or Lactobacillus.

4. The vaccine vector of claim 2, wherein the first polynucleotide sequence and the second polynucleotide sequence are integrated into the genome of the bacterium.

5. The vaccine vector of claim 1, wherein the vaccine vector comprises more than one copy of the first polynucleotide sequence, more than one copy of the second polynucleotide sequence or more than one copy of the first and second polynucleotide sequence.

6. The vaccine vector of claim 1, wherein the first polynucleotide sequence is linked in frame to the second polynucleotide sequence.

7. The vaccine vector of claim 1, wherein the antigenic polypeptide and the HMGB1 polypeptide are expressed on the surface of the vaccine vector.

8. The vaccine vector of claim 7, wherein the first polynucleotide sequence and the second polynucleotide sequence are inserted within a third polynucleotide sequence encoding an external portion of a transmembrane protein.

9. The vector of claim 1, further comprising a second immunostimulatory polypeptide comprising a CD154 polypeptide.

10. The vaccine vector of claim 1, wherein the antigenic polypeptide consists of SEQ ID NO: 7.

11. A method of inducing an immune response in a subject comprising administering the vector of claim 1 to the subject in an amount effective to induce the immune response of the subject to Campylobacter jejuni.

12. The method of claim 11, wherein the immune response includes an antibody response to Campylobacter jejuni.

13. The method of claim 12, wherein the soluble IgA antibody response to Campylobacter jejuni is induced.

14. The method of claim 11, wherein the vector is attenuated or killed prior to administration.