The Sequence Listing XML file submitted via the USPTO patent electronic filing system named 156P656fromWIPOsoftware.xml, created on Nov. 8, 2022, and having a size of 10 kilobytes is hereby incorporated by reference.
The present invention relates to nano-encapsulation materials, and more specifically, to star-shaped amphiphilic fatty acid-modified elastin-like polypeptides constructs.
Nano-encapsulation of therapeutics and imaging agents can dramatically improve their efficacy and specificity, while reducing their undesirable side-effects. However, as the use of nanomaterials in medicine expands, new concerns regarding their off-target accumulation and toxicity have emerged. Nanobiomaterials, such as proteins, are promising platforms to address these concerns because in addition to degradability their sequence, structure, and function can be controlled with precision to modulate the carriers' characteristics such as targeting, stealth, and immunomodulation, among others. Consequently, precise engineering of the size and morphology of protein-based nanomaterials remains a key objective of the field as these characteristics regulate the pharmacokinetics and biodistribution of the encapsulated cargo. Specifically, rods are receiving increased attention because the higher aspect ratios of these anisotropic nanoparticles can increase cellular internalization and interaction with cell-surface receptors. Despite these promising attributes, the molecular design rules to create protein-based rods with both radius and length below 200 nm (also known as nanoworms) remain unclear.
The rational design of nanoworms requires delicate optimization of building blocks' “conformational asymmetry,” because these assemblies are thermodynamically favorable only in a narrow range of the phase diagram. The conformational asymmetry of macromolecules can be adjusted by altering their amphiphilic composition and/or topology. However, because proteins are only expressed as a linear sequence of amino acids, the design of protein-based nanorods has exclusively relied on constructs with extreme compositional asymmetry. For instance, some researchers have designed nanoworms (NWs) by fusing large, disordered elastin-like polypeptides (ELPs) to short dissimilar domains such as single-chain variable domain fragments or aromatic peptides. However, the complex and nonintuitive dependence of the NW's properties on protein sequence and features limits the widespread utility of this linear amphiphilic architecture. This is because small perturbations in composition or changes to solution parameters can result in polydisperse mixtures of cylindrical assemblies whose lengths range from nano- to micrometer. These difficulties in synthesis may hinder applications such as drug delivery or templated synthesis of nanomaterials, in which dispersity alters performance metrics such as biodistribution, endocytosis, and other desired functions of nanomaterials. Accordingly, there is a need in the art for a new class of protein-based nanostructures for biomedical applications using topological engineering of proteins to facilitate access to unique assemblies such as nanoworms by modulating their stability boundaries.
The present invention comprises the molecular design of star-shaped amphiphilic fatty acid-modified elastin-like (SAFE) polypeptide constructs. Examples demonstrate that their material properties (assembly and thermoresponse) are modulated by their lipidation pattern as characterized by scattering and microscopy experiments. Using molecular dynamics simulations and principal component analysis, we reveal that the lipidation pattern influences the shape, size, and hydration of SAFE chains at the molecular level and that the changes in these microscopic features parallel observed trends in macroscopic properties as a function of lipidation pattern.
Examples of the present invention focused on the simplest nonlinear topology: the miktoarm star in which two hydrophobic arms are compositionally identical while the third hydrophilic arm differs, i.e., A2B. To manipulate the protein's topology (e.g., branching), the isopeptide ligation between split-protein pairs, SpyCatcher and SpyTag, was used. This strategy has been used to synthesize proteins with complex nonlinear topologies with enhanced stability and proteolytic resistance or to click bio-active motifs to protein nanostructures. However, controlling nano-assembly of proteins by topological engineering alone remains limited because it may not provide the energetic driving force to compensate for the entropic penalty of self-organization. To overcome this barrier and induce nano-assembly, topological engineering was combined with lipidation PTM to generate hybrid protein amphiphiles with topological and compositional asymmetry.
In the present invention, the arms of the star (A or B) are based on a model thermoresponsive ELP with the canonical sequence of (GXGVP)n whose composition arm is distinguished by the identity of the guest residue (X) and arm (n) length. Together these features determine the arm's interaction with water or with each other. The N-termini of the hydrophobic arms were modified with a myristoyl group (C14:0) to generate star-shaped amphiphilic fatty acid-modified elastin-like polypeptides (SAFE). The amphiphilic architecture of SAFEs is defined by the hierarchical combination of the star topological asymmetry (compositional differences between the arms) and the pattern of lipidation (i.e., number and location). The inter- and intra-arm interactions and the hydration of the arms could be modulated by changing the pattern of lipidation and/or the solution temperature, thus providing a dial to regulate the nano-assembly of SAFEs into NWs.
In a first aspect, the present invention is a star miktoarm formed from a first hydrophobic arm comprised of a first repeating peptide unit having a first C-terminus and a first N-terminus, a first hydrophilic arm comprised of a second repeating peptide unit having a second C-terminus and a second N-terminus, wherein the first hydrophilic arm is bound to the first hydrophobic arm at a junction formed by the second N-terminus and the first C-terminus, and a second hydrophobic arm comprised of a third repeating peptide unit having a third C-terminus and a third N-terminus, wherein the second hydrophobic arm is bound by the third C-terminus to the junction of the first hydrophilic arm and the first hydrophilic arm. The first repeating peptide unit and the third repeating peptide unit may be the same. At least one of the first hydrophobic arm and the second hydrophobic arm may be myristoylated and, in some cases, both the first hydrophobic arm and the second hydrophobic arm may be myristoylated. The junction is formed by a first peptide fusion protein, such as SpyTag. The second hydrophobic arm is bound to a second peptide fusion protein, SpyCatcher, that will irreversibly conjugate with the first peptide fusion protein.
In another aspect, the present invention is a method of making a star miktoarm, comprising the steps of forming a first hydrophobic arm comprised of a first repeating peptide unit having a first C-terminus and a first N-terminus, forming a first hydrophilic arm comprised of a second repeating peptide unit having a second C-terminus and a second N-terminus, binding the first hydrophilic arm to the first hydrophobic arm at a junction formed by the second N-terminus and the first C-terminus, forming a second hydrophobic arm comprised of a third repeating peptide unit having a third C-terminus and a third N-terminus, and then binding the second hydrophobic arm by the third C-terminus to the junction of the first hydrophilic arm and the first hydrophilic arm.
The present invention will be more fully understood and appreciated by reading the following Detailed Description in conjunction with the accompanying drawings, in which:
Referring to the figures, wherein like numerals refer to like parts throughout, there is seen in
The present invention provides two main advantages. First, the present invention allows for the creation of lipidated proteins using a method that is much faster than traditional methods. Second, the present invention allows for the creation of thermally stable and mono-disperse nano worms. Although lipid modification of high molecular weight proteins has remained largely unexplored in materials science because most lipoproteins cannot be produced in E. coli as it lacks the enzymatic machinery, the present invention has overcome laborious, technically challenging, and low yield semi-synthetic approaches by genetically engineering E. coli to produce the desired protein and the minimum enzymatic machinery required for post-translational modification (PTM) with a specific lipid. Using this one-pot expression and modification system, the present invention can produce target lipoproteins at quantities sufficient for materials and biomedical applications. Using E. coli as a bio-factory according to the present invention also means that designer lipoproteins can be made from components not found in nature (such as the lipid described in this publication) because there is less interference from and to the metabolism of the host.
Recombinant Synthesis, Purification, and Molecular Characterization of SAFEs.
The genetic precision of SAFEs biosynthesis enables complete control over sequence and amphiphilic architecture with genetic precision. To do so, the necessary genetic elements were combined on two bicistronic plasmids (
[a]rs: The peptide substrate for the NMT enzyme, which is the site of lipidation.
[b]This plasmid is used for recombinant expression of MMC using a one-pot approach (FIG. 4).
Each construct was purified by leveraging the temperature-triggered phase behavior of ELP arms and characterized using high-performance liquid chromatography and mass spectrometry to confirm purity and the regio- and chemoselectivity of modification, as seen in
After purification, different biophysical and soft-matter characterization methods were used to test our hypothesis that the lipidation pattern modulates thermoresponse and nano-assembly of the SAFEs. Turbidimetry was first used to investigate the thermal response of SAFE constructs as a function of temperature and concentration, as seen in
Lipidation Pattern Modulates the Thermoresponse of SAFEs.
Results of turbidity experiments revealed two insights: 1) The thermal behavior of the symmetric constructs NNC and MMC were noticeably different from the asymmetrically lipidated constructs MNC and NMC. 2) Constructs that were identical except for lipid location (i.e., MNC vs. NMC) have divergent thermo-responses. It is hypothesized that these observed differences originate from the temperature-dependent assembly of SAFEs into different nano-/mesoscale structures.
Lipidation Patterns Modulate the Nano- and Mesoscale Assembly of SAFEs.
To test this hypothesis, dynamic light scattering (DLS) was performed to probe the assembly of SAFE in PBS as a function of temperature (15-65° C. at 5° C. increments).
At 20° C., the mono-modal decay time of NNC (t<102 ms) was consistent with the presence of unimeric or unassembled species, while all lipidated constructs formed nanoscale assemblies (102 ms<t<103 ms). Consistent with turbidimetry results, the ACFs for NNC and MMC shifted only slightly at higher temperatures (40 and 60° C.), but both constructs remained in the nanoscale range. The behavior of single-lipid constructs was noticeably different, as nanoscale assemblies at 20° C. formed much larger aggregates at 60° C., t>103 ms consistent with the size regime in the micron range. In addition, we observed subtle differences between the temperature-dependent nano-assembly of NMC and MNC. The NMC assemblies remained in the nanoscale range at 20 and 40° C. and formed larger micron-sized aggregates at 60° C. In contrast, the ACF of MNC deviated from one-phase exponential decay, which indicates the formation of a mixture of small and large particles.
Next, the ACFs were analyzed using the cumulant method to derive the size and dispersity (Zavg and polydispersity index, PDI) of SAFE assemblies at various temperatures.
As shown in
At low temperatures, MMC assembled into aggregates with an average size of 30 nm and a lower PDI compared to NMC and MNC. As T>Tcp, the aggregate size started to increase and reached ˜80 nm at 30° C. Increasing the temperature to 65° C. did not result in a significant increase in aggregate size. Notably, the PDI of single-lipid amphiphiles increased with temperature (approaching the maximum theoretical value of 1), while the PDI of MMC decreased with temperature. These results were interpreted as indicating the formation of a more homogenous assembly population for MIVIC, which drastically contrasts with the observed increase in the polydispersity of NMC and MNC at higher temperatures.
To complement insights provided by turbidity and DLS, microscopy was performed to visualize the assembly of different constructs at different temperatures (
Differential interference contrast (DIC) microscopy confirmed the effect of lipidation patterns on the mesoscale assembly of SAFE constructs. Both single-lipid amphiphiles underwent liquid-liquid phase separation and formed micron-size coacervates at 60° C. (
Results of turbidimetry, scattering, and microscopy experiments consistently demonstrate the following points: 1) Lipidation pattern changes the assembly and thermoresponse of SAFEs. 2) The changes in material properties as a function of temperature for the non- and double-lipidated constructs (NNC and MMC) differ considerably from the behavior of single-lipid SAFEs (MNC and NMC). 3) Intriguingly, differences in the lipidation site resulted in subtle differences in the assembly and thermoresponse of single-lipid amphiphiles, as seen in
These findings confirm the hypothesis that the material properties of SAFE can be modulated by changing their lipidation patterns and amphiphilic architecture. However, they also hint at a complex interplay between lipidation pattern, structure, and energetics of chemically and topologically modified SAFEs. These observations motivated our use of MD simulations to gain molecular-level insight into the interplay between the physicochemistry of lipids and the composition of the various constructs. To compute in silico properties, we focused on unimer dynamics that are precise yet have relatively low computational cost, while being mindful that thermoresponse and assembly are bulk properties (i.e., impacted by interactions between multiple chains). However, past studies have shown that single-chain properties such as hydration can reliably predict LCST behavior for linear ELPs. Similarly, we suggest that the physicochemical interplay between and among protein, lipid, and branching point modulate the key drivers of bulk properties at the single-chain level. The MD simulations were used to compute a series of structural and physicochemical properties corresponding to the size, shape, and hydration of constructs at 5, 37, and 67° C.
The trajectories obtained in the last 200 ns of MD simulations were used to derive 15 parameters related to different aspects of amphiphilic architecture (size, form(shape), and hydration) from the trajectories at 100 ps intervals (
The equilibrium structures of NNC, MNC, NMC, and MMC show how the single-tail and double-tail modifications alter the intramolecular structure of the constructs, as seen in
Because PCs include the varied influences of the original features, it is possible to trace differences between the clusters to back to changes in these features as a function of amphiphilic architecture or temperature. This information is captured in loading plots (
Extending this analysis to other features enables us to parse the contribution of lipidation patterns to the observed differences between the constructs and identify similar intuitive and subtle variations in size, shape, or hydration of each construct with high resolution. An analogy to the “packing parameter,” which predicts the assembly of amphiphiles based on geometric considerations such as size and shape of hydrophobic/hydrophilic moieties, is illustrative. The lipidation pattern influences the physicochemical characteristics of arms—size, hydrophobicity, and shape of various domains at the unimer level even when they are distant from the lipidation site. These variations can explain the observed differences in the nanoscale assembly of these amphiphiles as the function of molecular syntax or temperature.
Discussion
Controlling the length of 1D cylindrical assemblies—a prerequisite for formation of stable NWs—requires balancing the delicate interactions of building blocks along the main axis versus the endcap region. For most amphiphiles, the addition of a monomer to the cylinder length is a noncooperative process. That is, the free energy of micelle growth does not change as the aggregation number is increased. This property hinders the thermodynamic control over the growth process and promotes the formation of a polydisperse mixture with lengths ranging from nano-to-micrometer. These difficulties may explain why there are few systematic investigations on the preparation of protein NWs in the literature.
It was hypothesized that changing the linear topology of protein fusions may broadens the stability of nanoworms in the phase diagram. To test this hypothesis, two types of PTMs, lipidation and branching, were combined to synthesize high molecular weight, sequence-defined star amphiphiles with unique, and programmable amphiphilic architecture defined by the composition of proteins and the lipidation patterns. It was demonstrated that lipidation pattern modulates the phase behavior of star amphiphiles. Intriguingly, the addition of a single lipid reduced the LCST phase boundaries and promoted macroscopic phase separation <40° C. In contrast and counter-intuitively, double-lipidated constructs did not show macroscopic phase separation even when heated to 65° C. While LCST phase behavior is a useful feature for scalable purification of proteins, it also presents an upper operating condition for using these constructs as nanomaterials, since above the cloud point, mesoscale coacervates are formed, as seen in
Similarly, DLS and TEM confirmed that lipidation pattern significantly influences the nanoscale assembly of star amphiphiles as a function of temperature. Importantly, the present invention shows that a judicious choice of amphiphilic architecture can be used to prepare adaptive nanoworms that undergo a shape transformation in response to temperature stimuli. This morphological change, combined with the modulation of phase separation behavior discussed above, increases the NW stability even at extremely high temperatures. These characteristics are not found in the protein NW literature; nano-assembly either did not change with temperature or formed large aggregates at elevated temperatures.
To understand the origin of these divergent behaviors, MD simulations of a unimer were combined with PCA to parse the effect of lipidation patterns on the energetics and structure of these hybrid amphiphiles. MD simulations are increasingly being utilized to provide molecular-level insights that are experimentally unattainable and to explain dynamical behavior observed in self-assembled nanostructures. The power of MD simulations lies in their ability to account for the effects of complex sequence-encoded interactions.
Conclusions
This present invention provides several notable outcomes: First, it provides a straight-forward roadmap to synthesize adaptive, recombinant NW. Due to their amphiphilicity, these NWs can easily solubilize hydrophobic chemotherapeutics without resorting to complex, inefficient, and time-consuming conjugation/purification protocols. The recombinant nature of this system enables the fusion of genetically encoded bioactive or targeting peptides, which can be used to optimize the delivery and efficacy of these nanoplatforms.
Second, is the significant expansion of the hybrid protein-based-material design space by demonstrating the compatibility between two classes of PTMs, lipidation and protein branching. These methods should be generalizable to other classes of proteins and PTMs. Thus, this work will advance the study and design other hybrid systems, such as lipidated resilin with upper critical solubility phase behavior, or proteins modified with other classes of lipids (e.g., cholesterol) or charged PTMs such as phosphorylation.
Third, integration of experiment, simulation, and data analytics provides a road map to move synthesis of hybrid functional biomaterials beyond current ad hoc approaches into the realm of predictive design. Traditional brute-force material design, synthesis, and characterization strategies to elucidate the design principles of these hybrid materials are impractical given the large design space resulting from the orthogonality of protein, lipidation, and branching “building blocks.” The proposed alternative strategy is to use MD simulations and data analytics to survey quickly and less expensively the hybrid design space and then experimentally verify results. While commonly used in biophysical and biochemical studies, MD simulations is an emergent tool to design soft materials. However, realizing the full potential of this method, requires new approaches to reduce the computational cost of multiscale modeling required to predict the properties of desired materials. As shown here, the integration of machine learning can provide insights into design principles—a thermodynamically grounded understanding of the contribution of molecular syntax to programmable assembly of hybrid materials. Elucidating these principles will foster the development of next-generation biomaterials and therapeutics whose forms and functions rival the exquisite hierarchy and capabilities of biological systems.
Restriction enzymes, ligase, corresponding buffers, DNA extraction and purification kits, and chemically competent Eb5alpha and BL21(DE3) cells were purchased from New England Biolabs (Ipswich, Mass.). DNA oligonucleotides and gene fragments were synthesized by Integrated DNA Technologies (Coralville, Iowa). Apomyoglobin, adrenocorticotropic hormone (ACTH), sinapinic acid, alpha-cyano-4-hydroxycinnamic acid, ammonium bicarbonate, and trifluoroacetic acid (TFA) were purchased from Sigma-Aldrich (St. Louis, Mo.). High-performance liquid chromatography-(HPLC) grade acetonitrile, isopropyl β-D-1-thiogalactopyranoside (IPTG), SnakeSkin™ dialysis tubing with 7 K nominal molecular weight cut off (MWCO), mass spectroscopy grade Pierce™ trypsin protease, tryptone, yeast extract, agar, sodium chloride, ampicillin, phosphate buffer saline (PBS), myristic acid, urea, and ethanol were purchased from Thermo Fisher Scientific (Rockford, Ill.). Mini-PROTEAN® TGX Stain-Free™ Precast Gels, Precision Plus Protein™ All Blue Pre-stained Protein Standard, and Precision Plus Protein™ Unstained Protein Standards were purchased from Bio-Rad Laboratories, Inc. (Hercules, Calif.). The carbon-coated grid (CF300-Cu) was purchased from Electron Microscopy Sciences (Hatfield, Pa.). Deionized water was obtained from a Milli-Q® system (Millipore SAS, France). Simply Blue™ SafeStain was purchased from Novex (Carlsbad, Calif.). All chemicals were used as received without further purification.
The genes encoding SpyTag and SpyCatcher sequences were first cloned into modified pET24a(+) using restriction digest and NEBuilder® HiFi DNA Assembly. The modified pET24a(+) vector contains unique recognition sequences for type IIs restriction enzymes BseRI and Acul that flank the gene of interest. This feature enables the directional and modular assembly of repetitive protein polymers, i.e., (GVGVP)40 (SEQ ID NO: 1) and (GSGVP)60 (SEQ ID NO: 2) and the Spy pairs. In parallel, we first fused the (GVGVP)40 (SEQ ID NO: 1) gene to the N-termini of SpyTag and SpyCatcher genes. The (GVGVP)40-Tag (SEQ ID NO: 1) was subsequently fused to the N-terminus of (GSGVP)60 (SEQ ID NO: 2) in the second round of directional ligation to generate plasmids encoding for linear blocks. To generate myristoylated constructs, these genes were than subcloned into a modified pETDuet-1, a bicistronic vector containing all the necessary genetic elements for N-myristoylation. These elements include the NMT enzyme from S. cerevisiae and the site of N-myristoylation: a peptide substrate derived from ARF2 protein. The linear blocks were subcloned downstream of ARF2 recognition sequence (underlined). The schematic of this process is shown in
GLYASKLFSNLGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGV
GLYASKLFSNLGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGVPGVGV
All proteins were expressed in E. coli BL21(DE3) strains with IPTG-inducible lac promotors. The expression and purification of myristoylated proteins followed a previously established protocol modified by reducing induction time to 6 h. Cells were harvested by centrifugation (3745×g, 30 min, 4° C.), resuspended in PBS, 10 mL per 1 L of culture), and lysed by sonication. The lysate was clarified by centrifugation (22,830×g, 4° C., 15 min) before purification of proteins using inverse transition cycling (ITC). Proteins used for self-assembly studies were purified by reversed-phase HPLC (RP-HPLC) to ensure >95% purity. Organic solvents were removed by dialyzing the protein solution against water using SnakeSkin™ Dialysis Tubing (MWCO 7 kD) for ˜18 hours. The proteins were then lyophilized and stored at −20° C.
Methods
Cloning. Genes encoding linear building blocks V40-Tag-S60 and V40-Catcher were constructed using Gibson assembly and recursive directional ligation by plasmid reconstruction. The identity of each gene was confirmed using Sanger sequencing.
Protein Expression and Purification. Proteins were expressed in E. coli BL21(DE3) grown in 2× YT medium under the control of lac promotor. Myristoylated proteins were expressed in 2× YT the medium, supplemented with myristic acid (100 mM). All proteins were first purified by exploiting the lower critical solubility behavior of ELP followed by reversed phase HPLC to ensure >95% purity before self-assembly studies.
Synthesis of star amphiphiles. Miktoarm star amphiphiles were synthesized by mixing the corresponding linear building blocks (ELP block copolymer and ELP-Catcher fusions) in reaction buffer (PBS or PBS supplemented with 4M urea), and incubation at room temperature for 2 h. For instance, MMC was synthesized by reacting M-V40-Tag-S60 (30 μM) with M-V40-Catcher (20 μM). Reaction progress was monitored using SDS-PAGE and the appearance of the product band (˜75-100 kDa) and reduction in the intensity of starting material bands (˜50 kDa and ˜37 kDa), as seen in
RP-HPLC. Analytical and preparative RP-HPLC were performed on a Shimadzu instrument equipped with a photodiode array detector on C18 columns (Phenomenex Jupiter® 5 μm C18 300 Å, 250×4.6 mm and 250×10 mm). The mobile phase was a linear gradient of acetonitrile and water (0 to 90% acetonitrile over 40 min, each phase supplemented with 0.1% TFA).
MALDI-TOF-MS. Matrix-assisted laser desorption/ionization, time-of-flight mass mass spectrometry (MALDI-TOF-MS) was conducted on a Bruker Autoflex III. N-terminal peptide fragments were characterized after digestion with trypsin.
Turbidimetry Assay. The thermal behavior of proteins was characterized using a Cary 100 UV-Vis Spectro-photometer (Agilent, Santa Clara, Calif.) equipped with a Peltier temperature controller. The optical density of the solution at 350 nm was recorded at 15-65° C. while heating the solution at the rate of 1° C./min.
DLS. Dynamic light scattering analysis was performed on a Zetasizer Nano (Malvern Instruments, UK) with a 173° backscatter detector. Before analysis, protein solutions (20 μM in PBS) were subject to centrifugation (21,000×g, 5 min, 4° C.); supernatants were loaded into a DLS cuvette and analyzed at 15-65° C. (in 5° C. increments). Measurements were performed in triplicate at each temperature. Scattering autocorrelation functions (ACF) were analyzed with Zetasizer software using the cumulant and CONTIN methods to calculate the hydrodynamic radii (Zavg), polydispersity index, and intensity-size distributions. The Zavg with PdI and intensity distributions of linear controls and star amphiphiles are shown in
TEM. TEM imaging was performed using FEI Tecnai 12 BioTwin (ThermoFisher Scientific, Waltham, Mass.) operated at 120 kV, equipped with Gatan SC1000A CCD camera. Protein solution (10 μL) was deposited onto a carbon-coated grid. After blotting excess solution, the grid was stained with 1% uranyl acetate for 1 min and air dried at room temperature for 12 h before imaging.
Differential Interference Contrast Microscopy (DIC). DIC was conducted on a Zeiss AxioObserver Z1 widefield microscope (Carl Zeiss Inc., Berlin, Germany), with an ORCA-Flash4.0 LT+ Digital CMOS camera (Hamamatsu Photonics, Hamamatsu, Japan). Images were analyzed using MetaMorph imaging software (Molecular Devices, CA). Protein solution in PBS was heated to 60° C. and applied onto a glass slide (10 μL), shielded with a coverslip, and imaged immediately.
Molecular Dynamics Simulations. The atomistic structure of the SpyTag/SpyCatcher complex was obtained from the Protein Data Bank (PDB: 4MLI). The atomistic structures of disordered peptides (GVGVP)40 and (GSGVP)60 and the RS (GLYASKLFSNL) were obtained from I-TASSER (Iterative Threading ASSEmbly Refinement) server. YASARA was used to fuse the peptide arms to the SpyTag/SpyCatcher. The systems were subjected to energy minimization and equilibration steps with the input files generated from CHARMM-GUI solution builder, where the N-termini of NNC were modified by myristic acids to generate MMC, MNC, and NMC systems. The CHARMM36m force field parameters were used for disordered protein, salt (0.14 M NaCl and 0.01 M), and explicit TIP3P water. All atomistic molecular dynamics simulations were carried out using the GROMACS version 2019. Each system was energy minimized, followed by equilibration in isothermal-isochoric (NVT) and isothermal-isobaric (NPT) for 1 ns each, and production MD run under NPT conditions for 500 ns. The heavy atoms of the disordered protein were restrained during NVT and NPT equilibration. All restraints were removed during the production MD. The temperature of each system was maintained at 37° C. using the velocity-rescale thermostat with τt=1.0 ps. In the NPT equilibration step, isotropic pressure of 1 bar was maintained using Berendsen barostat with τp=5.0 ps and compressibility of 4.5×10−5 bar−1. In the production MD, we used the Parrinello-Rahman barostat with τp=5.0 ps and compressibility of 4.5×10−5 bar−1. Three-dimensional periodic boundary conditions were applied to each system. A 2 fs time step was used, and the nonbonded interaction neighbor list was updated every 20 steps. A 1.2 nm cutoff was used for the electrostatic and van der Waals interactions. The long-range electrostatic interactions were calculated using the Particle-Mesh Ewald method after a 1.2 nm cutoff. The bonds involving hydrogen atoms were constrained using the linear constraint solver (LINCS) algorithm. Besides 37° C., the MMC, NNC, MNC, and NMC systems were simulated for 200 ns at 5 and 67° C. The input structure for the additional simulations was obtained from the 37° C. production MD run. Except for temperature, other simulation parameters remained unchanged. Molecular visualization and images were rendered using PyMol, VMD, and YASARA software suites. Data analysis and plotting were performed using in-house Python scripts based on publicly hosted Python packages, such as matplotlib, scipy, and MDAnalysis.
Principal Component Analysis. The MD simulations trajectories were analyzed using in-house scripts to derive the 15 features describing aspects of form, size, and hydration of each construct in the last 200 ns of simulation. These variables include i) end-to-end distance between the three arms (F1-3); ii) the radius of gyration (Rg) of each arm and the branching point (S1-4); and iii) the average number of water molecules in the proximity of each domain and the average number of hydrogen bonds between each domain and surrounding water molecules (H1-8), as seen in Table 3 below.
aMost fibers extended beyond the imagining window. Maximum observable length measured is reported.
This information is used to generate a labelled dataset containing 1920 data points (15 features×4 constructs×2 temperatures×16 snapshots sampled within 170-200 ns with 2 ns intervals) as the input for PCA. First, all measurements were standardized using z-scoring (i.e., mean equal zero and standard deviation of 1) to ensure that differences in the scale and nature of these features does not bias the PCA results. The method of Horn's Parallel Analysis was used to select components with eigenvalues greater than PCs for a control dataset with identical dimension but generated “randomly” using 1000 Monte Carlo simulations) at 95 percentile (
Statistical Analysis. Statistical analysis including PCA was performed using GraphPad Prism 9.2. The output of PCA analysis (PC and loading scores) was imported into OriginPro 2012b (version 9.8.5.204) for visualization and for calculation of 95% confidence ellipsoids in
This application claims priority to U.S. Provisional Application No. 63/276,943 filed on Nov. 8, 2021.
This invention was made with government support under Grant No. 1R35GM142899-01 awarded by the National Institutes of Health (NIH) and Grant No. 2105193 awarded by the National Science Foundation. The government has certain rights in the invention.
Number | Date | Country | |
---|---|---|---|
63276943 | Nov 2021 | US |