ANTIMICROBIAL PEPTIDES, COMPOSITIONS COMPRISING THE SAME AND USES THEREOF

Abstract

Antimicrobial peptides such as, for example, the peptides shown in SEQ ID No 1, SEQ ID No 2, SEQ ID No 3, SEQ ID No 4 or SEQ ID No 5. The peptides have activity against Gram positive bacteria and against Gram negative bacteria. A bactericidal composition is also provided, which may comprise an amount between 0.5 μg/mL and 1024 μg/mL of the peptides; and excipients.

Description

The present invention relates to antimicrobial peptides such as for example, the peptides shown in SEQ ID No 1, SEQ ID No 2, SEQ ID No 3, SEQ ID No 4 or SEQ ID No 5. These peptides show activity against Gram positive bacteria and against Gram negative bacteria. It is also provided a bactericidal composition comprising an amount between 0.5 μg/mL and 1024 μg/mL of the peptides; and excipients.

BACKGROUND OF THE INVENTION

The treatment of chronic wounds and ulcers is complex and difficult and represents a challenge for the health system as a whole, having a strong impact on economy in general. In particular, the problem of recurrent infections with bacterial strains resistant to antimicrobial treatments.

Even though nowadays effective treatments are available for the majority of the infections, antibiotics abuse, carried out over many decades, has led to the generation of strains resistant to common-use antimicrobials by means of horizontal transfer of genes between pathogenic microorganisms.

This progressive decrease in the efficacy of first-choice antibiotics and the limited therapeutic approaches available for the wound treatment and healing, emphasize the need for new classes of drugs and their means of application.

Presently, some bactericidal peptides exist. Each peptide has different characteristics in terms of the minimum inhibitory concentrations that are to be used for achieving the desired bactericidal activity, in addition, they show differences in solubility, cytotoxicity, specificity and target against different pathogens.

Patent document U.S. Pat. No. 6,696,238 discloses polypeptides and defensins used as antimicrobials in the preparation of culture media.

BRIEF DESCRIPTION OF THE INVENTION

Antimicrobial peptides are provided, in a preferred embodiment the peptides may be those shown in SEQ ID No 1, SEQ ID No 2, SEQ ID No 3, SEQ ID No 4 or SEQ ID No 5. The peptides have activity against Gram positive bacteria and against Gram negative bacteria.

A bactericidal composition is provided, comprising an amount between 0.5 μg/mL and 1024 μg/mL of the peptides mentioned in the paragraph above; and excipients.

The use of the peptides 1 is provided for preparing a medicament for bacterial infections.

DESCRIPTION OF THE DRAWINGS

FIG. 1 shows circular dichroism (CD) spectra of the peptides of the invention in an aqueous solution; wherein it is shown that the peptides are not structured in aqueous buffer, and with a characteristic minimum at approximately 200 nm. Omi: Omiganan peptide, p1: peptide 1; p2: peptide 2, p3: peptide 3, p4: peptide 4, p5: peptide 5.

FIG. 2 shows circular dichroism (CD) spectra of the peptides of the invention in a solution with SDS, wherein conformational changes are observed in the peptides 1, 2 and 5, which are consistent with the formation of alpha-helix structures. Omi: Omiganan peptide, p1: peptide 1; p2: peptide 2, p3: peptide 3, p4: peptide 4, p5: peptide 5.

DETAILED DESCRIPTION OF THE INVENTION

The fundamental characteristic of the peptides of the invention is their sequence and the amino acids assembly within the peptide chain which has been designed with the aim of enhancing selectivity of action over the bacterial strains, decreasing its potential cytotoxic action, which is very common in these types of peptides.

The peptides disclosed herein are active against Gram positive and Gram negative bacteria, including several types of Staphilococcus and Pseudomonas. The MIC values (minimum inhibitory concentration) are especially interesting in some strains. New synthetic peptides are disclosed in the present invention which are amidated or not amidated at the C-terminal end, and which have bactericidal activity in strains relevant for clinical issues and are resistant to traditional antibiotics. These peptides may be incorporated in a suitable vehicle for application, for instance, topically, which would provide a correct solution to the problem of superficial wounds with a high risk of infection. Additionally, they are easy to apply products and have a wide bactericidal spectrum, which solves the increasing problem of multiresistant bacterial strains.

Five peptides were synthesized having antibacterial activity, in a preferred embodiment the peptides were the following:

peptide 1:
(SEQ ID No 1)
WPKWWKWKRRWGRKKAKKRRG
peptide 2:
(SEQ ID No 2)
GLLKKWLKKWKEFKRIVGY
peptide 3:
(SEQ ID No 3)
FGKEKKAWWRRRKWLK
peptide 4:
(SEQ ID No 4)
TTCDLLSGVGLPNVPQPLHCVFRGNRKIKW
peptide 5:
(SEQ ID No 5)
RIVQRIKKWLLKWKKLGY
known peptide (Omiganan):
(SEQ ID No 6)
ILRWPWWPWRRK

The 5 designed and synthesized peptides of the invention, plus omiganan (peptide of the state of the art) were evaluated for their antimicrobial capacity in microdilution assays for determining the minimum inhibitory concentration (MIC). A first panel of 8 representative strains was analyzed in these assays, encompassing Gram positive and Gram negative bacteria. The results of the obtained MIC are outlined in Table 1, expressed as μg/ml of each peptide. The lowest MIC values indicate a higher antimicrobial potency.

TABLE 1
		pep-	pep-	pep-	pep-	pep-
		tide	tide	tide	tide	tide
Organism	OMI	1	2	3	4	5
Staphylococcus warneri	4	4	8	8	>256	4
M6823
Staphylococcus cohnii	8	8	8	4	>256	4
M6767
Staphylococcus aureus	16	16	64	128	>256	16
ATCC29213
Escherichia coli	32	32	16	64	>256	4
ATCC25922
Staphylococcus aureus	16	8	32	128	>256	4
M6794
Pseudomonas aeruginosa	32	16	16	128	>256	8
ATCC27853
Pseudomonas aeruginosa	64	16	32	128	>256	8
M13513
Klebsiella pneumoniae	64	>128	16	128	>256	8
M13540

Subsequently, the capacity of the peptides of the invention for lysing human erythrocytes was evaluated, as a measure of their cytotoxicity (Table 2). The assays were carried out according to the Examples and are expressed as a percentage of total lysis obtained with either water or the surfactant Tween 20. In this assays, the lower hemolysis percentage, the lower expected cytotoxic activity.

TABLE 2
			Hemolysis %	Hemolysis %
Sample	Concentration	OD 540 nm	(1% Tween20)	(water)
peptide 1	128 ug/ml	0.067	4	3.4
peptide 2	128 ug/ml	0.641	46.3	39.8
peptide 3	128 ug/ml	0.036	1.7	1.5
peptide 4	128 ug/ml	0.04	2	1.72
peptide 5	128 ug/ml	0.163	11.1	9.5
Omiganan	128 ug/ml	0.171	11.6	10
Tween20	1%	1.37	100	86
PBS	—	0.013	0	0
water	—	1.59	116.2	100

As can be seen, peptides 1, 2 and 5 have higher antimicrobial potency values. The hemolysis values are lower or similar to those of the Omiganan peptide. Even though peptide 2 has high hemolysis values, it was decided to go on with its analysis since in an eventual topical use these values would not be an impediment. In a preferred embodiment, peptides 1 and 5 are selected, which have the highest therapeutic index values, understood as the value indicating the antimicrobial potency over the cytotoxicity percentage.

Subsequently, an analysis of a panel of clinical isolates including strains with different resistance mechanisms against conventional antibiotics was carried out, all of which are of clinical relevance. In Tables 3 and 4 the results obtained when analyzing MIC of the selected peptides 1, 2 and 5, are shown, plus the control peptide Omiganan. In Table 3 the results for a panel of Gram negative bacteria are shown, and in Table 4 for a panel of Gram negative bacteria. In these tables the detected gene/s responsible for the resistance against antibiotics for each strain, are included.

In this studies, it may be seen that peptide 5 is up to eight times more active than the known peptide Omiganan in Pseudomona aeuruginosa. A similar thing is observed with Klebsiella pneumoniae, where great improvements in potency of the peptides 2 and 5 are observed, while peptide 1 has a lower activity than the Omiganan peptide for that strain.

	TABLES 3 and 4
	MIC (ug/ml)
Strain	ID No.	Resistance Gene	Omiganan	peptide 1	peptide 2	peptide 5
Pseudomonas aeruginosa (n = 12)
P. aeruginosa	M13513	kpc	256	32	64	64
P. aeruginosa	M11005	kpc	512	64	64	128
P. aeruginosa	M7723	kpc	256	64	64	32
P. aeruginosa	M7728	imp	512	128	64	64
P. aeruginosa	M5109	vim	256	128	64	64
P. aeruginosa	M5200	vim + ges	512	64	64	64
P. aeruginosa	M7525	spm	512	64	64	64
P. aeruginosa	M7712	spm	512	64	64	64
P. aeruginosa	M5470	ND1	512	128	64	64
P. aeruginosa	M7907	per	128	128	64	64
P. aeruginosa	COS 12p	ND.	512	64	64	64
P. aeruginosa	ATCC 27853	WT	256		64	64
Acinetobacter sp. (n = 10)
A. baumanii	M13523	oxa-51	64	64	32	4
A. baumanii	FAV-1	per + oxa-51 + oxa-58	64	64	16	16
A. baumanii	M5179	oxa-51	64	64	32	32
A. baumanii	M7978	imp	64	64	16	8
A. junii	M9013	oxa-51 + imp	64	32	32	8
A. baumanii	M5277	per	32	64	32	8
A. baumanii	M5949	oxa-23 + oxa-GVI	128	256	32	16
A. baumanii	M7489	oxa-51 + tem	32	64	8	16
A. baumanii	M9665	oxa-51	64	128	4	32
A. baumanii	M5282	oxa-51	16	64	8	8
Klebsiella pneumoniae (n = 12)
K. pneumoniae	M5825	ges-3 + ctx-m-2	64	>1024	8	32
K. pneumoniae	M7647	vim-like + ctx-m-2 +	1024	>1024	32	32
		tem-1 + shv-1
K. pneumoniae	M13540	kpc	256	>1024	16	64
K. Pneumoniae	M9885	kpc	256	>1024	64	32
K. Pneumoniae	M11245	kpc + per-2	32	1024	16	8
K. pneumoniae	M1803	ctx-m-2 + per-2 +	1024	>1024	32	64
		tem-1 + shv + oxa-9
K. pneumoniae	M9140	cit	64	1024	32	32
K. pneumoniae	M9310	ctx-m-2 + shv-1 +	64	>1024	16	32
		tem-1
K. pneumoniae	M9375	ctx-m-2 + shv-1 +	32	1024	64	16
		tem-1
K. pneumoniae	M9170	oxa-GIII	128	>1024	32	64
K. pneumoniae	M9491	mox	128	1024	64	64
K. pneumoniae	FAV3	WT	128	1024	128	128
Escherichia coli (n = 9)
E. coli	Cos15	per + tem	64	128	64	64
E. coli	M9884	WT	64	128	32	32
E. coli	M9209	kpc	64	128	64	128
E. coli	M7859	cit	64	128	32	16
E. coli	NEU23	oxa-GIII + tem	32	128	32	32
E. coli	ABC11	ctx-m-2	64	128	32	32
E. coli	LCA1	ctx-m-2 + tem-1	64	128	64	64
E. coli	M5306	ctx-m-2 + tem-1 +	64	128	4	64
		per-2
E. coli	ATCC 25922	WT	64	256	32	32
	MIC (ug/ml)
Strain	ID No.	Resistance gene	Omiganan	peptide 1	peptide 2	peptide 5
Staphylococcus aureus (n = 11)
S. aureus	ATCC29213	WT	32	32	64	32
S. aureus	M6794	mecA	64	32	64	64
S. aureus	204	ermA	64	64	64	32
S. aureus	28	ermA	32	32	64	64
S. aureus	33	msrA	32	32	128	64
S. aureus	239	ermC	32	32	64	64
S. aureus	M6276	ermA + lnuA	32	16	128	64
S. aureus	M2832	mecA	64	32	128	64
S. aureus	M4046	mecA	32	32	128	32
S. aureus	M6820	mecA	128	64	128	64
S. aureus	M6784	mecA	32	32	32	32
Coagulase Negative Staphylococcus (CNS) (n = 12)
S. epidermidis	M2919	mecA	8	16	16	8
S. epidermidis	M2921	mecA	8	8	8	8
S. saprophyticus	M4070	mecA	8	16	32	8
S. saprophyticus	M2981	mecA	8	16	8	8
S. epidermidis	M2923	WT	8	16	16	16
S. epidermidis	M2931	WT	16	16	16	8
S. haemolyticus	M2976	mecA	4	16	8	8
S. haemolyticus	M3014	WT	4	16	8	8
S. hominis	M2973	mecA	4	4	4	4
S. hominis	M2967	mecA	4	8	8	8
S. warnerii	M6823	mecA	8	8	8	8
S. cohnii	M6767	mecA	4	16	16	8
Enterococcus spp. (n = 17)
E. faecium	M2304	vanA	4	16	16	8
E. faecium	M2664	vanA	8	16	8	8
E. faecium	M2619	vanB	16	32	16	16
E. faecium	M2481	vanB	16	32	16	16
E. faecium	ZAP95	WT	16	32	16	16
E. faecium	M6261	N.D	16	32	16	16
E. faecalis	M4899	vanB	256	256	128	256
E. faecalis	M6534	vanB	256	128	256	256
E. faecalis	M4992	vanA	128	128	128	128
E. faecalis	M6383	vanA	128	128	128	128
E. faecalis	M4449	vanA	128	128	128	128
E. faecalis	ATCC 51299	vanB	256	256	256	256
E. faecalis	ATCC 29212	WT	128	64	128	128
E. faecalis	M6983	vanA	128	64	128	128
E. gallinarum	M2723	vanC1 + vanA	16	32	32	16
E. gallinarum	M2685	vanC1 + vanA	16	16	16	16
E. raffinosus	M6187	vanA	4	ND	8	8

In order to evaluate the structure that the peptides acquire in aqueous solution and in the presence of a surfactant such as SDS, a circular dichroism (CD) assay was performed. This way, the differences between the structured acquired by the peptides and their biological activity could be correlated.

The CD spectra of the peptides in aqueous solution show that said peptides are not structured in aqueous buffer, with a characteristic minimum at approximately 200 nm. With the addition of SDS micelles, conformational changes are generated in peptides 2 and 5, which are consistent with the formation of alpha-helix structures, with two characteristic minimums, close to 208 and 222 nm. Peptide 1 is also subjected to a similar transition, however the structure level acquired is much lower than that observed in peptides 2 and 5. The CD spectrum of peptide 3 is almost invariable with the addition of SDS micelles, indicating the persistence of a disorganized conformation. In the case of Omiganan, the spectrum is significantly modified in the presence of SDS, with the band at 200 nm diminishing and a new band appearing near 230 nm, which may be a result of the interaction between side chains in tryptophan (FIGS. 1 and 2). These experimental results match the theoretical parameters obtained by computational analysis.

Physical-chemical parameters of the peptides theoretically analyzed for each sequence are summarized in Table 5.

	TABLE 5
	pep-	pep-	pep-	pep-	pep-
	tide 1	tide 2	tide 3	tide 4	tide 5
Isoelectric point	13.10	10.89	12.25	9.85	11.75
Net charge	+12	+6	+7	+3	+7
Hydrophobicity *	+29.04	+20.51	+23.38	+19.05	+16.10
Alpha-helix content **	1.03	5.35	1.54	0.11	7.07
* Wimley-White Scale Kcal mol−1
** According to AGADIR algorithm

When the non-amidated peptides of the invention were assessed the results shown in Table 6 were obtained.

TABLE 6
NON-AMIDATED PEPTIDES, MIC (μg/ml) IN AGAR DILUTION
Species	ID No.	Resistance Gene	Omiganan	peptide 1	peptide 2	peptide 3	peptide 4	peptide 5
S. warnerii	M6823	Oxa-R	16	16	8	32	>128	8
S. cohnii	M6767	mecA	16	16	16	32	>128	8
S. aureus	M6794	MRSA	>128	>128	>128	>128	>128	>128
E. coli	ATCC 25922	WT	>128	>128	128	>128	>128	64
S. aureus	ATCC29213	MSSA	>128	>128	>128	>128	>128	>128
P. aeruginosa	ATCC 27853	WT	>128	>128	>128	>128	>128	>128
P. aeruginosa	M13513	KPC	>128	>128	>128	>128	>128	>128
K. pneumoniae	M13540	KPC	>128	>128	64	>128	>128	>128

For the concentrations studied: peptide 1 has activity against S. warnerii and S. cohnii; peptide 2 has activity against S. warnerii, S. cohnii, E. coli and K. pneumoniae, peptide 3 has activity against S. warnerii and S. cohnii, peptide 4 does not have activity against any of the tested strains and peptide 5 has activity against S. warnerii, S. cohnii and E. coli.

The present invention is better illustrated with the following examples, which are not to be construed as a limitation to the scope thereof. On the contrary, it must be clearly understood that other embodiments, modifications and equivalents thereof may be apparent for a person skilled in the art, after reading the present description without departing from the spirit of the present invention and/or scope of the annexed claims.

Examples

The design of the peptides was aimed at generating amphipathic, cationic sequences, of the alpha-helix type. To this end, multiple alignment informatics tools, simulators of physical-chemical properties such as hydrophobicity or alpha-helix content, were used. All of said informatics software (BLAST, CLUSTAL, AGADIR, ExPASY) are freeware and available through the Internet.

In this analysis, the sequences and amino acids were set forth in specific consensus positions, when available, or semi-conserved motifs in some known peptides. Taking into consideration these diverse parameters, five in silico peptides were designed, having between 18 and 30 amino acids (SEQ ID No 1, 2, 3, 4 and 5)

Synthesis and Purification

The peptide synthesis was carried out by means of automated SPPS (solid phase peptide synthesis) synthesis and subsequently analyzed by mass spectrometry and purified by reverse phase HPLC.

Also, each peptide was amidated in the C-terminal end.

Circular Dichroism Analysis

Far-UV Circular Dichroism

Secondary structure content was studied by far-UV Circular dichroism spectroscopy, using a JASCO J 810 equipment (Jasco Corp., Tokio, Japan) calibrated with (+)10-camphorsulfonic acid. Measurements were carried out under a 8 1/h-nitrogen gas flux, at a temperature of 20° C., controlled by a Peltier-type system (JASCO).

Spectra between 185 and 320 nm were recorded, using a 0.1 cm-optical path cell. Concentration of the peptides were 40 μM, dissolved in 10 mM sodium phosphate buffer pH 7.0, or in the same buffer with 10 mM sodium dodecyl sulfate (SDS). Sensitivity was 100 millidegrees. Scan speed was 50 nm/min, a response time of 1 s and a bandwidth of 1 nm. An average of five spectra was performed for each sample. The average was corrected by buffer absorption and then baselined to zero using the average of readings at 290 and 320 nm. Finally, the data were smoothed using a Golay polynomial Savizky fourth grade, with a window of ten points. The spectra were converted to mean molar ellipticity per residue by using the equation:

[θ]=θ/(10×c×n×d)

wherein [θ] is the molar ellipticity (in degrees×cm²×dmol⁻¹), θ is the ellipticity in millidegrees, n is the number of residues in the peptide and c its molar concentration, d the length of the cell in centimeters.

In vitro sensitivity assay of aerobically growing bacteria, using the disc diffusion method was performed according to the standards in the M2 document of the CLSI (Clinical and Laboratory Standards Institute: Performance Standards for Antimicrobial Disk Susceptibility Tests.) using the non-amidated peptides

In brief, intermediate solutions (10×) of the antimicrobial non-amidated peptides were prepared by serial dilutions 1:2, 1:4 and 1:8 by two-fold dilutions. Then, one part of the solution of the antimicrobial peptide 10× was added to nine parts of melted bacteriological agar. The antibiotic solution was added for each dilution, in the melted agar and cooled to 45-50° C. in a water bath. Then, the agar-antibiotic mixture was placed in a Petri dish until a 3-4 mm depth was reached. The inoculum is prepared with a turbidity of 0.5 in the McFarland scale (approximately 1-2 10⁸ CFU/ml). The final inoculum required for the agar dilution test is 10⁴ colony forming units (CFU) per “spot” having 5-8 mm in diameter. The inoculated plates must be incubated upside down at 35° C. for a period of 16-20 hs. MIC was recorded as the value of the lower dilution completely inhibiting bacterial development, without considering the development of a single colony or a slight film caused by the inoculum deposit. The final point in these cases will correspond to the concentration at which there is more than 80% reduction in growth as compared with the control.

Analysis of Antimicrobial Activity

Antimicrobial activity was analyzed by means of the determination of the MIC (minimum inhibitory concentration) by the microdilution technique. The technique was carried out in the standard fashion according to (CLSI M07-A9 Vol. 32 No 2. January 2012). The peptide concentration range used was from 0.5 μg/mL to 512 μg/mL in two-fold serial dilutions. The used medium was MH Difco broth supplemented with cations, at a final concentration of Ca⁺⁺20-25 mg/L and Mg⁺⁺10-12.5 mg/L. The working inoculum used corresponds to a 1/100 dilution of a bacterial suspension equivalent to 0.5 in the Mc Farland scale.

Analysis of Hemolytic Activity

Evaluation of cytotoxic activity was performed by means of an erythrocyte hemolysis assay (according to Pure Appl. Chem., Vol. 79, No. 4, pp. 717-728, 2007). In brief, from a volume of heparinized human whole blood, 3 times that volume of PBS is added and centrifuged 10 minutes at 1500 rpm, repeating the washing two more times. 10% blood solutions in PBS were prepared with that pellet. Subsequently, each group was added the corresponding peptide at the indicated concentration and incubated at 37° C. for 30 minutes. After incubation time, each tube was centrifuged at 10000 rpm for 5 minutes and the supernatant was read in a spectrophotometer at 600 nm.

Bacterial Strains

78 isolates were studied, previously characterized in the Reference National Laboratory INEI-ANLIS of the Instituto Carlos Malbrán, with different antibiotic resistance mechanisms.

40 Gram positive strains, 37 INEI-ANLIS isolates were analyzed plus three ATCC reference strains:

• • Staphylococcus aureus (11 isolates)
  • Staphylococcus Coagulase Negative (12 isolates: 4 S. epidermidis, 2 S. saprophyticus, 2 S. haemolyticus, 2 S. hominis, 1 S. warnerii, 1 S. cohnii)
  • Enterococcus spp. (17 isolates: 6 E. faecium, 8 E. faecalis, 2 E. gallinarum, 1 E. raffinosus)The resistance mechanisms for this group, as may be seen in Table 4, were as follows: WT, vanA, vanB, vanC, mecA, ermA, ermC, msrA, InuA.43 Gram negative strains, 41 INEI-ANLIS isolates, plus three reference ATCC strains were analyzed:
  • Pseudomonas aeruginosa (12 isolates)
  • Acinetobacter sp. (10 isolates: 9 A. baumanii, 1 A. junii)
  • Klebsiella pneumoniae (12 isolates)
  • Escherichia coli (9 isolates)

The resistance mechanisms for this group, as may be seen in Table 4, were as follows: (tem-1, cmy, cit, shv-1, ctx-m-2, per-2, ges-1/3, veb-1, oxa-9, oxa-23, oxa-58, vim-11, imp-1/13/16, spm-1, kpc-2).

Claims

1. An antimicrobial peptide, characterized by the fact that it comprises a sequence selected from the group consisting of SEQ ID No 1, SEQ ID No 2, SEQ ID N° 3, SEQ ID No 4 and SEQ ID No 5.

2. The peptide according to claim 1, characterized by the fact that it has activity against Gram positive bacteria.

3. The peptide according to claim 1, characterized by the fact that it has activity against Gram negative bacteria.

4. The peptide according to claim 2, characterized by the fact that the bacteria are selected from the group consisting of Staphylococcus aureus, Staphylococcus epidermidis, Staphylococcus saprophyticus, Staphylococcus haemolyticus, Staphylococcus hominis, Staphylococcus warnerii, Staphylococcus cohnii, Enterococcus faecium, Enterococcus faecalis, Enterococcus gallinarum and Enterococcus raffinosus.

5. The peptide according to claim 3, characterized by the fact that the bacteria are selected from the group consisting of Pseudomonas aeruginosa, Acinetobacter baumanii, Acinetobacter junii, Klebsiella pneumoniae and Escherichia coli.

6. The peptide according to claim 1, characterized by the fact that it is amidated in its C-terminal end.

7. A bactericidal composition, characterized by the fact that it comprises an effective amount of at least one peptide according to claim 1; and excipients.

8. The bactericidal composition according to claim 7, characterized by the fact that it comprises an amount between 0.5 μg/mL and 1024 μg/mL of the peptides.

9. The composition according to claim 7, characterized by the fact that the peptide is amidated in its C-terminal end.

10. Use of the peptide as defined in claim 1 for preparing a medicament against bacterial infections.