Claims
- 1. An isolated and purified BID (BH3 Interacting domain Death agonist) polypeptide comprising an amino acid sequence which is at least 85 percent identical to the amino acid sequence set forth in SEQ ID NO:4.
- 2. The isolated and purified BID polypeptide of claim 1 wherein said polypeptide is at least 95 percent identical to the amino acid sequence set forth in SEQ ID NO:4.
- 3. An isolated and purified BID polypeptide which (a) lacks the carboxyl terminal signal-anchor sequence characteristic of the membrane bound members of the BCL-2 family, (b) lacks BH1 and BH2 domains, (c) has a BH3 domain, and (d) heterodimerizes with BAX, BCL-2 or BCL-X.sub.L.
- 4. The isolated and purified BID polypeptide of claim 3 comprising an immunogenic peptide selected from the group consisting of:
- (SEQ ID NO:29);
- (SEQ ID NO:30);
- (SEQ ID NO:31);
- (SEQ ID NO:32);
- (SEQ ID NO:33);
- (SEQ ID NO:34);
- (SEQ ID NO:35);
- (SEQ ID NO:36); and
- (SEQ ID NO:37).
- 5. The isolated and purified BID polypeptide of claim 3 comprising a sequence which is at least 65% identical to SEQ ID NO:4
- (-MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD-).
- 6. The isolated and purified BID polypeptide of claim 5 as set forth in SEQ ID NO:4
- (MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD).
- 7. The isolated and purified BID polypeptide of claim 3 comprising a sequence which is at least 65% identical to SEQ ID NO:5
- (-MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNVRTLEGMD-)
- or at least 65% identical to SEQ ID NO:6
- (-MDSEVSNGSGLGAKHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD-).
- 8. The isolated and purified BID polypeptide of claim 7 as set forth in SEQ ID NO:5
- (MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNVRTLEGMD)
- or SEQ ID NO:6
- (MDSEVSNGSGLGAKHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD).
- 9. An isolated and purified polypeptide comprising an immunogenic fragment of at least 10 contiguous amino acids of a BID polypeptide as set forth in SEQ ID NO:4
- (MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD),
- SEQ ID NO:5
- (MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNVRTLEGMD),
- or SEQ ID NO:6
- (MDSEVSNGSGLGAKHITDLLVFGFLQSSGCTRQELEVLGRELPVQAYWEADLEDELQTDGSQASRSFNQGRIEPDSESQEEIIHNIARHLAQIGDEMDHNIQPTLVRQLAAQFMNGSLSEEDKRNCLAKALDEVKTAFPRDMENDKAMLIMTMLLAKKVASHAPSLLRDVFHTTVNFINQNLFSYVRNLVRNEMD).
- 10. The isolated and purified fragment of claim 9 which contains a BH3 domain as set forth in SEQ ID NO:8 or SEQ ID NO:41.
- 11. The isolated and purified fragment of claim 11 which has the sequence as set forth in SEQ ID NO:51, SEQ ID NO:52 or SEQ ID NO:53.
- 12. An isolated and purified fusion protein comprising a BID polypeptide according to claim 5 covalently linked to a heterologous polypeptide sequence which enhances intracellular delivery of the BID polypeptide.
- 13. The isolated and purified fusion protein according to claim 14 wherein the BID polypeptide is as set forth in SEQ ID NO:55 (DSESQEEIIHNIARHLAQIGDEMDHNIQPTLV).
- 14. The isolated and purified fusion protein according to claim 14 wherein the heterologous polypeptide sequence is a Tat peptide as set forth in SEQ ID NO:54 (YGRKKRRQRRR).
- 15. The isolated and purified fusion protein of claim 16 comprising the sequence as set forth in SEQ ID NO:56 (YGRKKRRQRRRGDSESQEEIIHNIARHLAQIGDEMDHNIQPTLV).
Parent Case Info
This application is a divisional of application Ser. No. 08/706,741, now allowed.
REFERENCE TO GOVERNMENT GRANT
This invention was made with government support under Grant Number CA50239. The government has certain rights in this invention.
Foreign Referenced Citations (1)
Number |
Date |
Country |
WO 9404686 |
Mar 1994 |
WOX |
Divisions (1)
|
Number |
Date |
Country |
Parent |
706741 |
Sep 1996 |
|