The disclosure is directed to recombinant Cas9 fusion proteins capable of targeted DNA deletion and DNA integration in a cell without triggering the cell's endogenous DNA repair mechanism such as, homologous recombination. The Cas9 fusion proteins disclosed herein also minimize off target mutations, nucleotide insertions, and/or nucleotide deletions.
Clustered regularly interspaced short palindromic repeats (CRISPR) and CRISPR-associated (Cas) systems, such as Cas9 nuclease and Cas12a (Cpf1), have drastically improved the ease of targeted DNA modifications, largely due to its ability to target Cas9's function via design and co-expression of single guide RNAs (sgRNAs) or CRISPR RNA (crRNAs) for Cas12a. In the case of Cas9, sgRNA targeting is straightforward as it requires only simple DNA-RNA base pairing combined with the presence of a protospacer adjacent motif (PAM) on the target DNA. Systems employing Cas9 are highly robust and function in a broad range of organisms for a variety of editing strategies. Strategies for DNA integration and deletion are largely accomplished via formation of DSBs or paired single-stranded DNA breaks (SSBs) followed by processing via endogenous non-homologous end joining (NHEJ) or homologous recombination (HR). More recently, groups have described homology independent target integration (HITI), an effective technique for NHEJ mediated genome integration. This technique produces simultaneous CRISPR-Cas9-targeted double-stranded breaks (DSBs) on plasmid and genomic protospacer sequences and then utilize NHEJ to ligate plasmid DNA into the genomic protospacer. However, it has become apparent that CRISPR-based genome engineering strategies are limited with respect to their dependence on the generation of DSBs and endogenous DNA repair machinery. DSBs could generate unwanted mutations, translocations, complex rearrangements and destabilize karyotype. This is a fundamental limitation of CRISPR-Cas9's application in editing human cell lines for basic science and therapeutic purposes.
Technologies that avoid incurring double-stranded DNA damages during the editing process include “base-editor” (BE) Cas9 systems, which enable generation of single nucleotide changes without the need for double stranded DNA breaks. BE-Cas9's accomplished single nucleotide changes via fusion of a nicking Cas9 (Cas9D10A) with a cytidine deaminase and uracil glycosylase inhibitor domains. However, BEs are limited to single nucleotide changes. Accordingly, additional developments in the CRISPR-Cas9 technology is needed to prevent the development of unwanted mutations, translocations, complex rearrangements and destabilized karyotype.
The disclosure is directed to a recombinant Cas9. The recombinant Cas9 preferably comprises a catalytic domain of the resolvase of transposon Tn3 (“Tn3 resolvase”). In some aspects, the disclosure is directed to a Cas9 fusion protein where a catalytically inactive Cas9 is fused with the catalytic domain of a hyperactive mutant Tn3 resolvase. In certain nonlimiting embodiments, the catalytically inactive Cas9 is dCas9. A recombinant Cas9 comprising dCas9 and the catalytic domain of a hyperactive mutant Tn3 resolvase is referred to herein as iCas9.
In some aspects, the dimer of the recombinant Cas9 is described, wherein the dimer is bound to a DNA molecule. In certain embodiments of the dimer, the recombinant Cas9 further comprises a single guide RNA (sgRNA) bound to the catalytically inactive Cas9, and the DNA molecule on which the dimer is bound comprises two binding sites for the sgRNA. The distance between the binding sites for the sgRNA is at least 21 bp, for example, at least 22 bp, 22 bp, 30 bp, 31 bp, 40 bp, or 44 bp. In certain embodiments, the fusion protein of the dimer is bound to the same strand of the DNA molecule. In other embodiments, the fusion protein of the dimer is bound to opposite strands of the DNA molecule.
In some aspects, the tetramer of the recombinant Cas9 is described, wherein the tetramer is bound to a DNA molecule. In some embodiments of the tetramer, the recombinant Cas9 further comprises a sgRNA bound to the catalytically inactive Cas9, and the DNA molecule on which the tetramer is bound comprises two binding sites for the sgRNA. The distance between the binding sites for the sgRNA is at least 21 bp, for example, at least 22 bp, 22 bp, 30 bp, 31 bp, 40 bp, or 44 bp. In certain embodiments, each dimer of the tetramer is bound to the same strand of the DNA molecule. In other embodiments, each dimer of the tetramer is bound to opposite strands of the DNA molecule.
The disclosure is also directed to a method of producing the recombinant Cas9 and the use of the recombinant Cas9 for targeted DNA deletion or targeted DNA insertion in an eukaryotic genome. Kits for evaluating the ability of the recombination Cas9 for targeted DNA deletion or targeted DNA insertion in an eukaryotic genome are also disclosed herein.
Detailed aspects and applications of the disclosure are described below in the following drawings and detailed description of the technology. Unless specifically noted, it is intended that the words and phrases in the specification and the claims be given their plain, ordinary, and accustomed meaning to those of ordinary skill in the applicable arts.
In the following description, and for the purposes of explanation, numerous specific details are set forth in order to provide a thorough understanding of the various aspects of the disclosure. It will be understood, however, by those skilled in the relevant arts, that embodiments of the technology disclosed herein may be practiced without these specific details. It should be noted that there are many different and alternative configurations, devices and technologies to which the disclosed technologies may be applied. The full scope of the technology disclosed herein is not limited to the examples that are described below.
The singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “a step” includes reference to one or more of such steps.
As referenced herein, the spacing between sequences elements are measured as the bp distance between adjacent ends. For example, the spacing between accessories sgRNAs and the iCas9-site is the bp distance between the right guide of the iCas9-site (i.e. sg(H)) and the start of the accessory guide (e.g. sg(M) or (N)).
While clustered regularly interspaced short palindromic repeats (CRISPR) and CRISPR-associated (Cas) systems have made headlines as powerful tool for genome editing, site-specific recombinases are also powerful tools for genome engineering and synthetic biology. Site-specific recombinases are capable of facilitating DNA rearrangements with high predictability and specificity without incurring DSBs. These proteins possess the enzymatic machinery to facilitate transient DNA cleavage, strand-exchange and re-ligation without the need for high energy cofactors, DNA replication or DSB repair. Certain site-specific recombinases, such as ΦC31, are limited to specific ˜30 bp recognition sites and are often used for integration at specific ‘landing pad’ or pseudo-site loci. To circumvent this, directed evolution has been employed to retarget recombinase substrate specificity. For instance, Karpinski et al. reported directed evolution of Cre recombinase to target conserved sequences Human Immuno-deficiency Virus (HIV) long-terminal repeats (LTRs). This system led to efficient and highly specific excision of the HIV provirus; however, nearly 150 rounds of directed evolution were required. Alternatively, recombinases have been retargeted by fusing catalytic-domains to zinc finger or transcriptional activator-like (TAL) DNA-binding domains. These techniques however require complex addition of heterologous DNA-binding domains.
The disclosure relates to a new tool for genome editing that takes advantage of the programmability of the CRISPR-Cas system for targeted gene editing while using the functionality of a site-directed recombinase. The disclosure reports that a fusion protein comprising a catalytically inactive Cas9 fused with the catalytic domain of a recombinase overcomes the limitations of both the CRISPR-Cas system and site-directed recombinases. The recombinase is a TN3 resolvase. The examples demonstrate the function of iCas9 using the native TN3 core sequence. Likewise, zinc finger recombinase literature has focused largely on targeting canonical core sequences. There have been conflicting reports about the versatility of this family of serine recombinases. Some reports indicate Gin recombinase, a TN3 resolvase homolog, is highly versatile. However, other reports indicate directed evolution and rationally targeted mutagenesis are required to retarget substrate specificity. The versatility of iCas9's core sequence could be increased by fusion with highly versatile PAM-variant Cas9s, such as xCas9 or Cas9 orthologs in certain embodiment.
In some aspects, the fusion protein comprises a catalytically inactive Cas9 and a catalytic domain of a hyperactive Tn3 transposon resolvase. For example, the fusion protein comprises a catalytically inactive Cas9 and a catalytic domain of a hyperactive Tn3 transposon resolvase, where a first linker connects the C-terminus of the catalytic domain of the recombinase to the N-terminus of the catalytically inactive Cas9. The fusion protein also comprises a first nuclear localization signal, where a second linker connects the first nuclear localization signal to the C-terminus of the catalytically inactive Cas9 or the N-terminus of the catalytic domain of the recombinase. In some embodiments, the fusion protein further comprises a second nuclear localization signal wherein the first nuclear localization signal adjacent to the C-terminus of the catalytically inactive Cas9 and the second nuclear localization signal is adjacent to the N-terminus of the catalytic domain of the recombinase. Such embodiments of the fusion protein further comprise a third linker, wherein the second linker connects the first nuclear localization signal to the C-terminus of the catalytically inactive Cas9 and the third linker connects the second nuclear localization signals to the N-terminus of the catalytic domain of the recombinase. In some aspects, the linkers are flexible glycine serine linkers. For example, the amino acid sequence of the linker comprises repeats of GGS, SGSETPGTSESATPES (SEQ ID NO. 120), GGSGGSGSETPGTSESATPES (SEQ ID NO. 121), or combinations thereof. In certain embodiments, the nuclear localization signal is from SV40.
In a particular embodiments, the fusion protein is a hyperactive mutant TN3 resolvase fused to dCas9 with an amino acid sequence set forth in SEQ ID NO. 1, or having at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence similarity thereto, or the nucleic acid sequence set forth in SEQ ID NO. 2 having at least 80%, at least 85%, at least 90%, at least 92%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence similarity (also referred to herein as “iCas”). The disclosure also encompasses the method of producing iCas9.
As shown in the examples, iCas9 is capable of targeted DNA deletion and targeted DNA insertion of the genome of multiple eukaryotic hosts, ranging from yeast to human cells. However, unlike other recombinant Cas9, the optimal spacing between the guide sequences is greater than 20 bp, as shorter spacing resulted in little to no recombination (
The yeast experiments (see Example 3) identified optimal symmetric spacing's of 22 and 40 bp and asymmetric spacing's of 31 bp. Interestingly, this is consistent with the Watson-Crick DNA structure being 10.5 bp per helix turn combined with the requirement for co-localization of mTN3 catalytic domains to the same helical face of the DNA molecule (See
As shown in Example 4, iCas9 is capable of targeted DNA deletion and targeted DNA insertion in human cells, and the results confirmed the functionality of the 22 bp sgRNA spacing. The experiments in human cells also found 30 bp to be functional, which is consistent with previous reports using analogous recombinase-Cas9 designs. These altered spacing stringencies may be due to the use of supercoiled plasmids as substrates, which may have different spacing requirements than linear genomic DNA.
Accordingly, iCas9 may be a useful tool for targeted DNA integration. While previous reports have fused dCas9 to recombinase domains, these systems were incapable of genomic integration. For the first time, iCas9's ability to target intermolecular recombination has been validated, and it was through the use of an episomal assay described herein. The experimental design separated the assay from constraints of targeting the human genome, such as being long linear DNAs constrained in 3D space and compacted into different nuclear regions. Although the assay confirmed iCas9 is capable of targeting linear eukaryotic genomic DNA (
iCas9 targeting of endogenous loci can be accomplished through a mixture of multiplex sgRNA design and development of novel-iCas9 derivatives targeting new core sequences, for example “pseudo-core” sites. Because each sgRNA guides an individual iCas9 to the target locus, multiplex targeting is necessary to achieve dimerization and tetramerization. For example, two sgRNA guides would guide dimerization, while four sgRNA guides would guide tetramerization. Targeting with more pairs of sgRNAs, for example, with 6 sgRNA guides would result in hexamerization.
Also described herein are dimer and tetramer of the recombinant Cas9. The dimer of the recombinant Cas9 refers to the fusion protein in a dimerized state, where the dimer is bound to a DNA molecule and a single guide RNA (sgRNA) bound to the catalytically inactive Cas9 portion of the fusion protein. Accordingly, the dimer of the fusion protein comprises two fusion proteins, two sgRNAs, and the DNA molecule. The DNA molecule is a target DNA that comprises binding sites for two single guide RNAs (sgRNA), where the distance between the binding sites for the two sgRNAs is at least 21 bp or at least 22 bp apart, for example, 22 apart, 30 bp apart, 31 bp apart, 40 bp apart, or 44 bp apart. In some aspects, the fusion protein (monomeric units of the dimer) is bound to the same strand of the DNA molecule; in other aspects, they are bound to an opposite strand of the DNA molecule. The tetramer of the recombinant Cas9 refers to the fusion protein in a state where a first dimer of the fusion protein is bound to a second dimer of the fusion protein. Accordingly, the tetramer of the fusion protein comprises four fusion proteins, four sgRNAs, and the DNA molecule. The first dimer and the second dimer are bound to same strand of the DNA molecule in same aspects or are bound to an opposite strand of the DNA molecule in other aspects.
Since iCas9 does have its own fused recombinase functionality, iCas9 may be used for therapeutic purposes or generation of new cell lines, where double-stranded DNA lesions caused by wild type Cas9 can lead to large, multiple kilobase, deletions, insertions, and complex rearrangements. Since iCas9 does not directly rely on DSBs repair pathways such as NHEJ and HR, it reduces the likelihood of precipitating unwanted mutations. Furthermore, mTN3 catalytic domains of iCas9 require paired targeting by sgRNAs (
iCas9 may also be used in the field of synthetic biology for the construction and implementation of recombinase-based gene networks. Recombinase based gene networks are of increasing interest to synthetic biology. These systems can integrate multiple biological inputs and turn them into saved ‘DNA memory’. Recombinase based logic can be constructed in a way to imbue biological systems with Boolean logic functions or even 8-bit memory. These systems are capable of robust function but require coexpression of multiple recombinases and placement of sites corresponding to each recombinase to generate single circuits. iCas9 could enable the generation of RNA-programmed recombinase-based gene networks, wherein different sgRNAs could target different recombinase operations. Unlike previous iterations of recombinase-based gene circuitry, iCas9 systems would only require coexpression of multiple sgRNAs instead of separate recombinases. Numerous sgRNAs could be easily programmed and placed under control of inducible promoters to create circuits that predictably and combinatorically restructure in response to environmental or physiological cues.
In another aspect, the disclosure is directed to methods of using a Cas9 fusion protein (for example, iCas9) for targeted DNA deletion or targeted DNA insertion in a eukaryotic genome. Also disclosed are assay kits and methods for evaluating the ability of a Cas9 fusion protein for targeted DNA deletion and/or targeted DNA integration in eukaryotic cells. In certain embodiments, the assay kits and methods are for evaluating the ability of a Cas9 fusion protein for targeted DNA deletion and/or targeted DNA integration in eukaryotic cells, for example human cells, that is independent of the constraints of targeting the human genome.
In some aspects, the kit for evaluating a recombinant Cas9's ability for targeted DNA deletion in an eukaryotic genome comprises a first expression vector comprising an expression cassette for expressing the recombinant Cas9, a second expression vector encoding guide sequences, and a third expression vector that identifies a target sequence for deletion.
In some embodiments, the kit for evaluating a recombinant Cas9's ability for targeted DNA insertion in an eukaryotic genome comprises a first expression vector comprising an expression cassette for expressing the recombinant Cas9, a second expression vector encoding guide sequences, a third expression vector encoding a acceptor sequence, wherein the third expression vector is a vector that integrates the acceptor sequence into the eukaryotic genome (for example, a retroviral vector), and a fourth expression vector encoding the donor sequence. The first expression vector, the second expression vector, the third expression vector, and the fourth expression vector enable expression in an eukaryotic organism.
In one embodiment, the recombinant Cas9 expressed by the first expression vector is a catalytically inactive Cas9 fused to a catalytic domain of a recombinase. The second expression vector comprises a first single guide RNA (sgRNA) sequence and a second sgRNA sequence. The third expression vector comprises an oligonucleotide encoding a Cas9 site. The third expression vector in the kit for evaluating the ability for targeted DNA deletion comprises the target sequence for deletion and at least one oligonucleotide encoding a Cas9 site, wherein the target sequence for deletion is flanked by the at least one oligonucleotide encoding the Cas9 site. The third expression vector in the kit for evaluating the ability for targeted DNA insertion further comprises an acceptor sequence, wherein the acceptor sequence is upstream of the oligonucleotide encoding the Cas9 site, and a promoter sequence, wherein the promotor sequence drives expression of the acceptor sequence. For the kit for evaluating the ability for targeted DNA insertion, the fourth expression vector is promotorless and comprises a donor sequence and an oligonucleotide encoding the Cas9 site, wherein the donor sequence is downstream of the Cas9 site.
The Cas9 site comprises a core sequence that is recognized by the catalytic domain of the recombinase; a sequence complementary to the first sgRNA sequence that is upstream of and adjacent to the core sequence; a sequence complementary to the second sgRNA sequence that is downstream of and adjacent to the core sequence; and at least two protospacer adjacent motif sequences. Of the at least two protospacer adjacent motif sequences, at least one protospacer adjacent motif sequence is upstream of the sequence complementary to the first sgRNA sequence, and at least one protospacer adjacent motif sequence is downstream of the sequence complementary to the second sgRNA sequence. The distance between the sequence complementary to the first sgRNA sequence and the sequence complementary to the second sgRNA is at least 22 bp apart.
In some embodiments, the second expression vector comprises a third sgRNA sequence and the Cas9 site further comprises an accessory site sequence. The accessory sequence comprises a sequence complementary to the third sgRNA and a protospacer adjacent region distal to the third sgRNA. The distance between the accessory sequence and the sequence complementary to the second sgRNA sequence is at least 21 bp. In other embodiments, the Cas9 site further comprises an accessory site sequence. Thus, the kit further comprises a fifth expression vector that comprises a third sgRNA sequence. The accessory sequence comprises a sequence complementary to the third sgRNA and a protospacer adjacent region distal to the third sgRNA. The distance between the accessory sequence and the sequence complementary to the second sgRNA sequence is at least 21 bp.
In some implementations, the distance between the accessory sequence and the sequence complementary to the second sgRNA sequence is 21 bp.
In some implementations, the sequence complementary to the first sgRNA sequence and the sequence complementary to the second sgRNA sequence on the third expression vector is 22 bp apart. In one aspect, the sequence complementary to the first sgRNA sequence and the sequence complementary to the second sgRNA sequence on the third expression vector is 30 bp apart and the eukaryotic genome is a human genome. In another aspects, the sequence complementary to the first sgRNA sequence and the sequence complementary to the second sgRNA sequence on the third expression vector is 31 bp apart and the eukaryotic genome is a yeast genome. In certain implementations, the sequence complementary to the first sgRNA sequence and the sequence complementary to the second sgRNA sequence on the third expression vector is 40 bp apart.
In certain implementations where the eukaryotic genome is a yeast genome, the oligonucleotide encoding the Cas9 site comprises a nucleic acid sequence set forth in paragraph [0070]. In certain implementations where the eukaryotic genome is a human genome, the oligonucleotide encoding the Cas9 site comprises a nucleic acid sequence set forth in SEQ ID NO. 116, SEQ ID NO. 117, SEQ ID NO. 118 or SEQ ID NO. 119.
The disclosure is also directed to methods of deleting a target sequence from the genome in an eukaryotic cell. The methods comprise introducing into the cell a first nucleotide sequence encoding a recombinant Cas9; introducing a first oligonucleotide sequence encoding a first single guide RNA (sgRNA) sequence and a second oligonucleotide sequence encoding a second sgRNA sequence; coexpressing the nucleotide sequence, the first oligonucleotide sequence, and the second oligonucleotide sequence in the eukaryotic cell to generate a transformed eukaryotic cell; and culturing the transformed eukaryotic cell to remove the region of target sequence from the genome of the cultured eukaryotic cell.
The disclosure additionally is directed to methods of inserting an extraneous sequence into a target region of a genome in a cell. The method comprises introducing into the cell a first nucleotide sequence that encodes the recombinant Cas9 protein described; introducing a first oligonucleotide sequence encoding a first sgRNA sequence, a second oligonucleotide sequence encoding a second sgRNA sequence, and a third oligonucleotide encoding a third sgRNA sequence; introducing a second nucleotide sequence encoding the extraneous sequence and a recognition site sequence for a recombinant Cas9 protein described herein; coexpressing the first nucleotide sequence, the first oligonucleotide sequence, the second oligonucleotide sequence, the third oligonucleotide sequence, and the second nucleotide sequence in the eukaryotic cell to generate a transformed eukaryotic cell; and culturing the transformed eukaryotic cell to insert the extraneous sequence into the genome of the cultured eukaryotic cell at the site of the target region. The recognition site is proximal to the extraneous sequence, and the recognition sequence comprises a sequence complementary to the region of the genome comprising the target region and at least 21 bp from the 3′ end of the target region.
The first sgRNA sequence is complementary to the 5′ end of a target sequence. The second sgRNA is complementary to the 3′ end of the target sequence. The target sequence also has a protospacer adjacent motif that is adjacent to and proximal to its 5′ end and a protospacer adjacent motif that is adjacent and distal to its 3′ end. The distance between the 5′ end of the target sequence and the 3′ end of the target sequence is at least 22 bp. The region of the target sequence between the 5′ end of the target sequence and the 3′ end of the target sequence comprises a sequence recognized by the catalytic domain of the recombinase of the recombinant Cas9 protein described herein. For the methods of inserting an extraneous sequence into a target region of a genome in a cell, the third sgRNA sequence is complementary to a sequence in the genome of the cell that is at least 20 bp from the 3′ end of the target region. In some aspects, the third sgRNA sequence is complementary to a sequence in the genome of the cell that is 20 bp or 21 bp from the 3′ end of the target region. The sequence in the genome of the cell that is at least 20 bp from the 3′ end of the target region comprises a protospacer adjacent motif distal to the sgRNA sequence.
In one implementation of the methods, the distance between the 5′ end of the target sequence and the 3′ end of the target sequence is 22 bp. In another implementation, the distance between the 5′ end of the target sequence and the 3′ end of the target sequence is 30 bp. In still another implementation, the distance between the 5′ end of the target sequence and the 3′ end of the target sequence is 31 bp. In yet another implementation, the distance between the 5′ end of the target sequence and the 3′ end of the target sequence is 44 bp.
The methods described herein do not cause off target mutations, nucleotide insertions, and/or nucleotide deletions, which are problems encountered when attempting to alter the genome with wildtype Cas9. In some aspects, the portion of the genome is deleted independent of the cell's endogenous DNA repair mechanism. For example, the portion of the genome is deleted by triggering non-homologous end joining.
The disclosure is further illustrated by the following examples that should not be construed as limiting. The contents of all references, patents, and published patent applications cited throughout this application are incorporated herein by reference in their entirety for all purposes.
a. Bacterial Culture:
Molecular cloning was conducted using E. coli NEB-10-Beta (New England Biolabs, NEB). LB Miller Medium (Sigma Aldrich, Sigma) was supplemented with appropriate antibiotics for plasmid maintenance: Ampicillin (100 μg/ml), or Chloramphenicol (30 μg/ml). E. coli were cultured at 37° C.
b. Yeast Culture:
All yeast was cultured at 30° C. S. cerevisiae YPH500 were propagated on YPD agar plates and in liquid medium containing glucose. Liquid cultures were shaken at 250-300 RPM. Yeast minimal dropout media contained either 2% glucose or 2% galactose with 1% raffinose and necessary amino acid dropout solutions (Clonetech). Yeast were made competent using the Zymo competent yeast kit and transformed using manufacturer protocol. Genomic integrations and plasmid transformations were selected for on yeast minimal dropout plates with amino acid combinations necessary for selection. Yeast were cultured in liquid yeast dropout media necessary for plasmid selection.
c. Mammalian Cell Culture:
HEK293T cells (ATCC CRL-3216) were cultured on poly-L-ornithine (PLO) (Sigma) coated plates and maintained in Dulbecco's modified eagle medium supplemented with 10% (v/v) fetal bovine serum (FBS) and 1% (v/v) penicillin-streptomycin (all from ThermoFisher). Cells were maintained in a 37° C. incubator with 5% CO2 and passaged once ˜80% confluent.
d. Molecular Cloning:
iCas9 (TN3-GGSx6-dCas9) was constructed by fusion of a previously described hyperactive mutant recombinase (TN3 G79S, D102Y, E124Q). The resolvase catalytic domain (AA1-148) was linked to Cas9 D10A, H840A with a flexible glycine serine (GGSx6) linker. N- and C-terminal SV40 nuclear localization sequences with small glycine serine linkers (GGSx1) were added to facilitate nuclear entry. The coding region for the hyperactive TN3 mutant resolvase was synthesized as a human codon optimized gBlock by Integrated DNA technologies (IDT). The gBlock was sub-cloned into a dCas9 derivative of p415 Gall-Cas9 (Addgene #43804). The mTN3 catalytic domain along with D10A and H840A mutations to Cas9 were added using PCR primers containing SapI sites (Table 2). The amino acid sequence of iCas9 is set forth in SEQ ID NO. 1. The nucleic acid sequence of iCas9 is set forth in SEQ ID NO. 2.
Purified PCR products were digested with SapI and gel-extracted using the Sigma-Aldrich gel-extraction kit. iCas9 was assembled in XbaI-XhoI sites of p415 Gall-Cas9. The resulting p415 Gall-iCas9 vector also contains a Cen6 origin of replication and a leucine prototrophic marker. For expression in human cells iCas9 was PCRed with primers adding AgeI and MfeI upstream and downstream respectively. iCas9 was cloned into a modified pX330 with guide expression cassette removed. Digested and gel-extracted iCas9 PCR products were ligated with AgeI and EcoRI digested pX330. The resulting vector contains a CBH-promoter driving iCas9 expression.
sgRNA guides were synthesized as pairs of oligonucleotides. 5′ phosphates were added to oligonucleotides by incubating 1 ug total of top/bottom oligonucleotides in 50 μl reactions containing 1× T4 DNA Ligase Buffer and 10 units of T4 Polynucleotide Kinase (T4 PNK) at 37° C. overnight (Tables 1 and 2). Oligonucleotides were duplexed by heating the kinase reactions to 90° C. on an aluminum heating block for 5 minutes followed by slowly returning the reaction to room temperature (25° C.) over approximately 1 hour. Following duplexing, guides were ligated into respective vectors.
Yeast sgRNA expression cassettes, were constructed by cloning oligonucleotide duplexes into, pSB1C3 containing an SNR52 promoter with inverted SapI sites and an sgRNA hairpin recognized by S. pyogenes Cas9. Pairs of sgRNAs were then amplified with primers adding EcoRI and SapI, or SapI and SpeI sites. Purified PCR product were then digested with respective restriction enzymes, heat inactivated and ligated into EcoRI and SpeI digested pRS424. The resulting vector contains pairs of yeast sgRNA cassettes with a 2p origin of replication and tryptophan prototrophic marker.
Humanized sgRNAs were cloned into a modified pSB1C3 vector containing a human U6 promoter, inverted BbsI sites and a S. pyogenes recognized sgRNA hairpin (Sequence derived from pX330). Pairs of sgRNAs were then amplified with primers adding EcoRI and SapI, or SapI and XbaI sites. Purified PCR product were then digested with respective restriction enzymes, heat inactivated and ligated into EcoRI and XbaI digested pUC19. The resulting vector contains pairs of human sgRNA expression cassettes.
The Yeast Genomic Integration Vector (pMG) was generated using vectors previously described. Tef1 promoters drive constitutive expression of GFP and mCherry. To integrate into the yeast genome, one to two micrograms of pMG was digested with ApaI in 50 μl reactions for one hour or more at 37° C. Five microliters of the restriction product was transformed into competent YPH500 using protocol from Zymo Competent Yeast Kit (Zymo). Integrant were selected for by plating on histidine dropout plates.
To clone iCas9-target sequences into pMG, sites were synthesized as overlapping oligonucleotides. 5′ phosphates were added to oligonucleotides by incubating 1 ug of top/bottom oligonucleotides in 50 μl reactions containing 1×T4 DNA Ligase Buffer and 10 units of T4 Polynucleotide Kinase (T4 PNK) at 37° C. overnight. Oligonucleotides were duplexed by heating the kinase reactions to 90° C. on an aluminum heating block for 5 minutes followed by slowly returning the reaction to room temperature (25° C.) over approximately one hour. Following duplexing, sites were ligated into EcorI and MluI sites surrounding GFP.
e. Mammalian Cell Transfections
HEK293T cells were seeded at 1.8×105 cells/well in PLO coated 24-well plate and transfected 24 hours post-passage at ˜80% confluency. For plasmid-plasmid assays, 300 ng of iCas9, 100 ng of GFP-encoding donor vector (FeGFP-1C3), 100 ng of mCherry-expressing target vector (pUC:EAMP), and 100 ng sgRNA expression vectors were transfected per well using 1.5 μl Lipofectamine 3000 and 1 μl P3000. For genome integration experiments, 300 ng iCas9 expression vector, 100 ng GFP-encoding donor vector (FeGFP-1C3), 100 ng pIRFP670 and 100 ng sgRNA cassette(s) were transfected using 1.5 μl Lipofectamine 3000 and 1 μl P3000. pIRFP670 was co-transfected as a control with samples at >50% transfection efficiency.
f. Retrovirus and Stable Cell Line Generation
HEK293T cells were passaged to four PLO coated 100 mm culture plates in Opti-MEM reduced serum medium plus GlutaMAX and supplemented with 1 mM sodium pyruvate and 10% (v/v) FBS (all from ThermoFisher). To generate recombinant retroviruses, HEK 293T cells were transfected with the pKSBRV-1 transgene and packaging plasmids (pUMVC and pVSVG). 9 μg pKSBRV-1, 6 μg pUMVC, and 3 μg pVSVG expression plasmids were transfected per plate using 28 μl Lipofectamine 3000 and 36 μl P3000 (ThermoFisher). Media was changed 6 hours post-transfection and lentivirus containing supernatant was collected at 24 hours and 54 hours. Conditioned media was filtered using 0.45 μm filter and lentiviral particles were concentrated using Lenti-X (Takara Bio). HEK293T cells were then infected with the viruses followed by puromycin selection 48 hours later at a concentration of 0.75 μg/mL. Following selection for 2 weeks, cells were FACS sorted for the upper 50% of mCherry expressing cells to generate a pure population of cells stably expressing the transgene.
g. In Yeast GFP-Deletion Assay
To assay iCas9 function, YPH500 Ura3(MGaa) with p415 Gall-iCas9 and with various pRS424 (guide pairs) were cultured in 3 ml YP-Leu, -Trp with 2% Glucose. After 24 hours, 5 μl of the stationary phase culture was used to inoculate 3 ml of YP-Leu, -Trp with 2% Galactose, 1% Raffinose. Cell were diluted down (5 μl saturated culture in 3 ml media) at 48-hour intervals. Cells were analyzed by flow cytometry and fluorescent microscopy after 96 hours of galactose induction. Genomic DNA was also prepared after galactose induction.
h. Flow Cytometry
All flow cytometry was conducted on an Accuri C6 Flow Cytometer (BD Biosciences, CA). Samples were gated by consistent forward scatter (FSC) and side scatter (SSC) and 10,000 events within the FSC/SSC gate were collected. A 488 nm laser excitation and a 530±15 nm emission filter was used for GFP fluorescence determination. Flow cytometry files were analyzed using manufacture software and in MatLab (The MathWorks). Flow cytometry of HEK293T cells was conducted 72 hours post-transfection. Briefly, cells were dissociated using Accutase (ThermoFisher), washed with PBS, and analyzed using a BD Accuri C6 cytometer (BD Biosciences). GFP-positive cells were measured compared to transfections with a non-target sgRNA.
i. Fluorescent Microscopy
200 μl of stationary phase cultures of yeast were spun down at 4000*g for 2 minutes and washed once in 1×PBS solution. Following washing, cells were concentrating by resuspending in 10-20 μl of 1×PBS. 1-2 μl of cell solution was placed on glass microscope slides and visualized on a Nikon Ti-Eclipse inverted microscope with and LED-based Lumencor SOLA SE Light Engine with appropriate filter sets. GFP was visualized with an excitation at 472 nm and emission at 520/35 nm using a Semrock band pass filter. mCherry was visualized with excitation at 562 nm and emission at 641/75 nm. Constant exposure times, LUT and image gain adjustments were applied to microscopy data. HEK293T cells were imaged directly on TC plates 72 hours after transfection.
j. Genomic DNA Isolation and PCR Analysis of GFP Deletions
Yeast genomic DNA was prepared using the Zymo yeast genomic DNA preparation kit using the manufacturer's protocol with phenol-chloroform steps included. To assay genomic deletion, PCR was conducted using Phusion DNA polymerase (New England Biolabs). Annealing temperatures and extension times were calculated using the manufacturer's protocol. PCR products were visualized via 0.8% agarose gel electrophoresis. Human cell genomic DNA was prepared 72 hours post-transfection using the Qiagen DNEASY kit using the manufacturer protocol. PCR was conducted on 250 ng of genomic DNA with primers target the integration junction. Products were resolved on a 2% agarose.
k. Sequencing of Deletion and Integration Products
Following gel resolution of amplicons, deletion bands were gel-extracted using the Gen Elute gel extraction kit (Sigma-Aldrich) using the manufacturer's protocol. Following extraction, products with phosphorylated via incubation in 50 μl reactions with T4 PNK and 1× T4 DNA ligase buffer. Reactions were heat inactivated and ligated in equimolar ratio to SmaI cleaved and dephosphorylated pUC19. Ligations were transformed into chemically competent NEB10B E. coli and plated on Ampicillin Plates supplemented with 40 μl X-Gal solution (Promega). White colonies were picked and prepared using GeneElute Plasmid Preparation kit (Sigma-Aldrich). 300 ng of plasmid DNA was sequenced via DNASU's Sanger Sequencing Core facility.
2. Design of iCas9 and Guide Sequences for RNA-Guided Targeting of iCas9
The design of iCas9 followed several general principles. First, the fusion of catalytically inactive Cas9 (dCas9) with a hyperactive mutant TN3 resolvase (mTN3) was accomplished by addition of the N-terminal resolvase catalytic domain to the N-terminus of dCas9 (
To develop an iCas9 capable of targeting eukaryotic genomic DNA, a yeast-based fluorescent reporter system was used to detect recombination. A Saccharomyces cerevisiae dual-fluorescent recombination reporter system, which contains GFP and mCherry expression cassettes was constructed and enabled detection of recombination using flow cytometry and fluorescence microscopy. Both GFP and mCherry were constitutively expressed from translation elongation factor 1 (Tef1) promoters. GFP was flanked by TN3 Res1 core sequences and resulted in GFP deletion upon iCas9 targeting. (
To confirm loss-of-GFP was due to GFP-deletion and not the result of spurious cell death or non-specific recombination, fluorescence microscopy was used to detect GFP and mCherry expression. All cells with a non-target guide, sg(−), expressed both GFP and mCherry. However, cooperative targeting with sgRNA pairs resulted in GFP-negative cells with intact mCherry expression (
Aiming to improve iCas9 function, the effect of interdomain linker amino acid sequences was tested. These sequences included a range of flexible glycine serine and rigid linkers. Linker-3 was a common and effective linker used with Cas9 heterologous fusion proteins. Only subtle preference was observed for longer linker domains; however, these do not result in vivid improvement of iCas9 function (
To assess the function of iCas9 in human cells, a dual-fluorescence detection plasmid-based reporter was developed. The reporter plasmid contained mCherry flanked by core recognition sites with GFP downstream (
Next to determine iCas9's ability to target intermolecular recombination, a two-plasmid reporter system for plasmid-to-plasmid integration was developed. One plasmid contains an elongation factor 1α (EF1α) human T-cell leukemia virus (HTLV) hybrid promoter, and a core target site upstream of a mCherry coding region. A second promoterless GFP-donor plasmid contains a core target sequence upstream of a GFP reading frame (
To determine if iCas9 can mediate plasmid-to-genome integration, the plasmid-based assay was adapted to detect genome integration (
Given iCas9's ability to mediate plasmid-to-plasmid but not plasmid-to-genome recombination, cooperative targeting may be necessary to enable genomic integration. Bacterial TN3 resolvase uses cooperative binding at accessory sites to ensure efficient recombination of cointegrate products, where TN3 resolvase coordinates substrate DNA bending, supercoiling and 3D positioning. Multiplex sgRNAs targeting can recreate accessory site binding, which should allow for extra mTN3 domains to coordinate interaction between GFP-donor and the acceptor locus. To test this, a series of sgRNAs adjacent to the target core sites were designed. These sgRNAs were targeted to either the ‘+’ or ‘−’ strand at varying base pair distances from the core target site (
Table 1 lists the sgRNA guide sequences, and Table 2 lists the primers and oligonucleotides used.
The nucleic acid sequences for the exemplary guide sequences are listed below set forth in SEQ IN NOs. 116-119. The nucleic acid sequence and the amino acid sequence of an exemplary Cas9 fusion protein are listed below and set forth in SEQ ID NOs. 2 and 3.
iCas9-site (Yeast) (88 bp) (SEQ ID NO. 116): sg(G:H) underlined, PAMs bolded, TN3 Res1 sequence italicized
ATCAG
ACAGACCATACTCCAGATGG
GGGATGGCTAGGT
iCas9-site (Human) (88 bp) (SEQ ID NO. 117): sg(G:H) underlined, PAMs bolded, TN3 Res1 sequence italicized
ATCAG
ACAGACCTTACTCCAGAAGG
GGGAAGGCTAGGT
iCas9-site (Human) with Accessory Targets (123 bp) (SEQ ID NO. 118): sg(G:H) and sg(M) underlined, PAMs bolded, TN3 Res1 sequence italicized
ATCAG
ACAGACCTTACTCCAGAAGG
GGGAAGGCTAGGTGGCTACCGGTCG
CCA
CCATGGTGAGCAAGGGCGAG
iCas9-site (Human) with Accessory Targets (123 bp) (SEQ ID NO. 119): sg(G:H) and sg(N) underlined, PAMs bolded, TN3 Res1 sequence italicized
ATCAG
ACAGACCTTACTCCAGAAGG
GGGAAGGCTAGGTGGCTACCGGTCG
CCA
CCATGGTGAGCAAGGGCGAG
iCas9 Amino Acid Sequence (NLS-GGS-mTN3-GGS*6-dCas9-NLS) (1556 aa) (SEQ ID NO. 1): SV40 NLS underlined, mTN3 Catalytic Domain (TN3-TnpR G70S, D102Y, E124Q) bolded, GGS*6 Interdomain Linker italicized, dCas9 (Cas9 D10A, H840A) without modifications
MPKKKRKVGGS
MRIFGYARVSTSQQSLDIQIRALKDAGVKANRIFTDKAS
GSSTDREGLDLLRMKVEEGDVILVKKLDRLSRDTADMIQLIKEFDAQGVA
VRFIDDGISTDGYMGQMVVTILSAVAQAERRRILQRTNEGRQEAKLKGIK
FGRRRTVDR
GGSGGSGGSGGSGGSGGSMDKKYSIGLAIGTNSVGWAVITD
KKKRKV
This application claims the benefit of U.S. provisional patent application No. 62/834,880, filed Apr. 16, 2019 titled “CAS9 Fusion Proteins and Related Methods,” the entirety of the disclosure of which is hereby incorporated by reference thereto. Incorporated by reference in its entirety herein is a computer-readable nucleotide/amino acid sequence listing submitted concurrently herewith and identified as follows: One 42,484 byte ASCII (text) file named “20220426_SeqList” created on Apr. 26, 2022.
This invention was made with government support under GM106081 awarded by the National Institutes of Health. The government has certain rights in the invention.
Filing Document | Filing Date | Country | Kind |
---|---|---|---|
PCT/US2020/028149 | 4/14/2020 | WO |
Number | Date | Country | |
---|---|---|---|
62834880 | Apr 2019 | US |