Conjugates of galactose-binding lectins and clostridial neurotoxins as analgesics

Information

  • Patent Application
  • 20060121056
  • Publication Number
    20060121056
  • Date Filed
    October 25, 2005
    19 years ago
  • Date Published
    June 08, 2006
    18 years ago
Abstract
A class of novel agents that are able to modify nociceptive afferent function is provided. The agents may inhibit the release of neurotransmitters from discrete populations of neurones and thereby reduce or preferably prevent the transmission of afferent pain signals from peripheral to central pain fibres. They comprise a galactose-binding lectin linked to a derivative of a clostridial neurotoxin. The derivative of the clostridial neurotoxin comprises the L-chain, or a fragment thereof, which includes the active proteolytic enzyme domain of the light (L) chain, linked to a molecule or domain with membrane translocating activity. The agents may be used in or as pharmaceuticals for the treatment of pain, particular chronic pain.
Description
TECHNICAL FIELD

This invention relates to a class of novel agents that are able to modify nociceptive afferent function. The agents may inhibit the release of neurotransmitters from discrete populations of neurones and thereby reduce or preferably prevent the transmission of afferent pain signals from peripheral to central pain fibres. The agent may be used in or as a pharmaceutical for the treatment of pain, particularly chronic pain.


BACKGROUND

The sensation of pain due to injury or disease is carried from the periphery to the brain by a multi-neuronal pathway. The first part of this system comprises the primary nociceptive afferents that form synapses with secondary neurones in the dorsal horn of the spinal cord, or the nuclei of the cranial nerves. These synapses pass on the incoming information by the release of neurotransmitters and neuromodulators such as glutamate and substance P. These synapses are, therefore, possible sites for intervention to alleviate pain, indeed one of the modes of action of the opiate analgesics is to down-modulate neurotransmitter release at these synapses.


Unfortunately, the opiates have a number of limitations as drugs. Firstly, there are a number of chronic pain conditions for which the opiates are not effective. Secondly, the opiates have a number of side effects that are mediated both peripherally (constipation) and centrally (respiratory depression and euphoria) which present problems for long term use.


There is, therefore, a need for the development of new pharmaceuticals for the treatment of pain, particularly chronic pain.


One approach to this problem is the use of new agents containing fragments of clostridial neurotoxins (WO96/33273).


The clostridial neurotoxins are proteins with molecular masses of the order of 150 kDa. They are produced by various species of bacterium of the genus Clostridium, most importantly C. tetani and several strains of C. botulinum. There are at present eight different classes of the neurotoxins known: tetanus toxin, and botulinum neurotoxin in its serotypes A, B, C1, D, E, F and G, and they all share similar structures and modes of action. The clostridial neurotoxins are synthesised by the host bacterium as single polypeptides that are modified post-translationally to form two polypeptide chains joined together by a disulphide bond. The two chains are termed the heavy chain (H), which has a molecular mass of approximately 100 kDa, and the light chain (L), which has a molecular mass of approximately 50 kDa. Two distinct functions can be identified within the H-chain; binding and translocation. The carboxy-terminal half (HC) is involved in the high affinity, neurospecific binding of the toxin to cell surface acceptors, whilst the amino-terminal half (HN) is central to the translocation of the toxin into the neuronal cell. For botulinum neurotoxin type A these domains are considered to reside within amino acid residues 872-1296 for the HC, amino acid residues 449-871 for the HN and residues 1-448 for the LC. The minimal domains necessary for the activity of the light chain of clostridial toxins are described in J. Biol. Chem. Vol. 267, No. 21, July 1992, pages 14721-14729. The eight distinct neurotoxin light chains (L) are highly specific zinc-dependent endopeptidases which each hydrolyse different but specific peptide bonds in one of three substrate proteins, synaptobrevin, syntaxin or SNAP-25. These substrates are important components of the neurosecretory machinery. The hydrolytic activity of the clostridial toxins results in a prolonged muscular paralysis. The functions of all three identified domains are necessary for the toxic activity of the clostridial endopeptidases.


Some of the clostridial endopeptidases, most notably botulinum neurotoxin type A, have been used as pharmaceutical agents for the treatment of a range of muscle dystonias. The flaccid paralysing action of the native botulinum toxins makes them appropriate for this use.


The use of fragments of clostridial neurotoxins for the desired purpose of analgesia is dependent on the invention of conjugates, or derivatives of these molecules, with a specific binding activity that will deliver the L-chain endopeptidase to the nociceptive afferent neurons in preference to other neurones in the relevant anatomical locus. Delivery of these conjugates includes binding to the cell surface, internalisation via an endosomal compartment and translocation of the clostridial endopeptidase activity into the cytosol.


Targeting of extracellular species to specific intracellular locations following endocytosis involves an appreciation of a number of possible targeting strategies. It is understood that early endosomes are part of the key sorting mechanisms of the cell, routing species to late endosome (and onto lysosomes for degradation), recycling to the cell surface or to the Trans-Golgi Network. Intracellular routing determinants have been suggested that determine the pathway and final destination of particular species (Mellman, 1996, Annu. Rev. Cell Biol., 12, 575-625).


Current data suggests that translocation of native clostridial neurotoxins occurs from an acidic intracellular compartment, though the exact location and nature of the compartment is unknown (Montecucco & Schiavo, 1994, Mol. Micro. 13, 1-8). In patent WO96/33273 it is proposed that for an agent to be effective, the agent must target to an appropriate compartment for translocation of the toxin. As an example of specific intracellular targeting, internalisation of the NGF-receptor is by specific endocytosis and retrograde routing (initiated by receptor-ligand complex), via acidic endosomes to the cell body, and an agent incorporating NGF is given in support of WO96/33273.


STATEMENT OF INVENTION

The present invention relates to an agent that can reduce and preferably prevent the transmission of pain signals from the periphery to the central nervous system, thereby alleviating the sensation of pain. Specifically, the invention can provide an agent that can reduce and preferably prevent the transmission of pain signals from nociceptive afferents to projection neurones. More specifically, the invention can provide an agent that can inhibit the exocytosis of at least one neurotransmitter or neuromodulator substance from at least one category of nociceptive afferents.


In one aspect of the invention, an agent is provided which can be administered to the spinal cord, and which can inhibit the release of at least one neurotransmitter or neuromodulator from the synaptic terminals of nociceptive afferents terminating in that region of the spinal cord.


In a second aspect of the invention, there is provided an agent which can specifically target defined populations of afferent neurones, so that the effect of the agent is limited to that cell type.


In a third aspect of the invention, there is provided a method of treatment of pain that comprises administering an effective dose of the agent according to the invention.


In a fourth aspect of the invention, the agent can be expressed recombinantly as a fusion protein that includes the required components of the agent.


Definitions


Without wishing to be limited by the definitions set down, it is intended in this description that the following terms have the following meanings:


Light chain means the smaller of the two polypeptide components of any of the clostridial neurotoxins. It is commonly referred to as the L-chain or simply L. An L-chain has a molecular mass of approximately 50 kDa, and it is a metalloprotease exhibiting high substrate specificity for vesicle and/or plasma membrane associated proteins involved in the exocytotic process.


Heavy chain means the larger of the two polypeptide components of any of the clostridial neurotoxins. It is commonly referred to as H-chain or simply H and has a molecular mass of approximately 100 kDa.


HC fragment means a peptide derived from the H-chain of a clostridial neurotoxin which is responsible for binding of the native holotoxin to cell surface acceptor(s) involved in the intoxicating action of clostridial toxin prior to internalisation of the toxin into the cell. It may be approximately equivalent to the carboxy-terminal half of the H-chain, or the domain corresponding to that fragment in the intact H-chain.


HN fragment means a fragment derived from the H-chain of a clostridial neurotoxin approximately equivalent to the amino-terminal half of the H-chain, or the domain corresponding to that fragment in the intact H-chain. It is characterised as:

  • A portion of the H-chain which enables translocation of that portion of the neurotoxin molecule such that a functional expression of light chain activity occurs within a target cell.
  • The domain responsible for translocation of the endopeptidase activity, following binding of neurotoxin to its specific cell surface receptor via the binding domain, into the target cell.
  • The domain responsible for formation of ion-permeable pores in lipid membranes under conditions of low pH.
  • The domain responsible for increasing the solubility of the entire polypeptide compared to the solubility of light chain alone.


LHN means a fragment derived from a clostridial neurotoxin that contains the L-chain, or a functional fragment thereof, coupled to a HN fragment.


BoNT/A means botulinum neurotoxin serotype A, and is a neurotoxin produced by Clostridium botulinum; it has a molecular mass of approximately 150 kDa.


LHN/A is LHN that is derived from Clostridium botulinum neurotoxin type A.


Targeting Moiety (TM) means any chemical structure of an agent which functionally interacts with a binding site causing a physical association between the agent and the surface of a primary sensory afferent.


Primary sensory afferent is a nerve cell that can carry sensory information from the periphery towards the central nervous system.


Primary nociceptive afferent is a nerve cell that can carry sensory information from the periphery towards the central nervous system, where that information can result in a sensation of pain.


Lectin is any protein that binds to oligosaccharide structures.


Galactose-binding lectin is a lectin that binds to oligosaccharide structures in which the terminal residue is derived from galactose or N-acetylgalactosamine.


DETAILED DESCRIPTION OF THE INVENTION

It can be seen from this disclosure that an agent for reducing or preventing the transmission of pain signals from peripheral, nociceptive afferent neurones to projection neurones has many potential applications in the reduction of the sensation of pain, particularly of severe chronic pain.


Lectins are a class of proteins, often glycoproteins, that bind to carbohydrate structures. Lectins are found across the whole range of life forms from viruses to mammals. The most commonly exploited sources are the abundant lectins found in the seeds of plants. Lectins have previously been labelled and used as cell surface markers.


According to the invention, there is provided an agent that can inhibit the release of at least one neurotransmitter or neuromodulator or both from the synaptic terminals of nociceptive afferents.


It is known that such an agent can be produced based on the use of fragments of clostridial neurotoxin conjugated to a targeting ligand (WO96/33273). Given the known complexity of intracellular transport and the constraints on construct requirements, it is surprising that conjugates between toxin fragments and a specific sub-class of lectins that bind only to galactosyl residues form agents to produce analgesics that are particularly potent and selective. Inventions incorporating such lectins are the subject of this disclosure and several examples are provided.


One example of a class of plant-derived, galactose-binding lectins are those that can be purified from the seeds of the genus Erythrina. These lectins have been characterised to exist predominantly as non-covalent dimeric proteins with total molecular weights of approximately 60 kDa. Lectins have been isolated from several Erythrina species including: E. corallodendron (Gilboa-Garber and Mizrahi, 1981, Can. J. Biochem. 59, 315-320), E. cristagalli (Iglesias et al., 1982, Eur. J. Biochem. 123, 247-252), E. indica (Horejsi et al., 1980, Biochim. Biophys. Acta 623, 439-448), E. arborescens, E. suberosa, E. lithosperma (Bhattacharyya et al., 1981, Archiv. Biochem. Biophys. 211, 459-470) E. caffra, E. flabelliformis, E. latissima, E. lysistemon, E. humeana, E. perrieri, E. stricta, and E. zeyheri (Lis et al., 1985, Phytochem. 24, 2803-2809).


These lectins have been analysed for their selectivity for saccharide binding (see e.g. Kaladas et al., 1982, Archiv. Biochem. Biophys. 217, 624-637). They have been found to bind preferentially to oligosaccharides with a terminal β-D-galactosyl residue.


A second example of a plant-derived, galactose-binding lectin with the desired binding specificity can be obtained from Glycine max (soy) beans. This lectin (soya bean agglutinin, SBA) is a tetrameric protein with a total molecular weight of approximately 110 kDa. It binds to oligosaccharides containing galactose or N-acetylgalactosamine residues.


An example of a galactose-binding lectin from bacteria is PA-I, obtained from Pseudomonas aeruginosa. PA-I is a D-galactosephilic lectin with a molecular weight of about 13 kDa and it binds to galactose-containing oligosaccharides (Gilboa-Garber and Mizrahi, 1981, Can. J. Biochem. 59, 315-320).


These and other lectins of the sub-class of galactose-binding lectins can be used as targeting moieties (TM) for conjugates of the type described in WO96/33273. The requirements for TMs in these agents are that they show specificity for the primary sensory afferents over other spinal nerves and that they lead to the internalisation of the agents into an appropriate intracellular compartment. The lectins of this invention fulfil these criteria. Surprisingly, in comparison to other lectins of WO96/33273, they can fulfil these criteria more efficiently and can provide agents with enhanced selectivity for nociceptive afferent neurosecretion.


Thus, in one embodiment of the invention a galactose-binding lectin is conjugated, using linkages that may include one or more spacer regions, to a derivative of the clostridial neurotoxins.


In another embodiment of the invention the agent is expressed in a recombinant form as a fusion protein. The fusion protein may be derived from nucleic acid encoding an appropriate fragment of a galactose-binding lectin, in addition to any desired spacer domains, with nucleic acid encoding all or part of a polypeptide of one serotype of neurotoxin. Such a nucleic acid may be a chimera derived from the nucleic acid encoding polypeptides from more than one serotype.


In this embodiment, a genetic construct is employed which encodes the non-cytotoxic protease (or fragment thereof), the translocating domain, and the TM.


The coding sequences of the TM, translocating domain and protease/protease fragment are preferably arranged in a single genetic construct. These coding sequences are preferably arranged in-frame so that subsequent transcription/translation is continuous through both coding sequences and results in a fusion protein.


Alternatively, the coding sequences of the TM, translocation domain and protease/protease fragment may be arranged on separate genetic constructs and, following translation, the corresponding proteins associate with each other to form the agent. Association of the TM, translocation domain and protease/protease fragment translation products may be encouraged by ensuring that each translation product has one or more mutually compatible amino acids at an exposed surface. An example of such an amino acid is cysteine, or other sulphur-containing amino acids. The presence of a sulphur group on these amino acids allows the formation of disulphide bridges between the TM, translocation domain and protease/protease translation products.


The fusion protein aspect of the present invention may employ any variation of any TM—translocation domain—protease sequence identified in the present specification. For example:

    • N and C-terminal protein fusions (ie. either 5′ or 3′ genetic construct fusions) may be employed. Different combinations of TM-protease-translocation domain, protease-translcoation domain-TM and protease-TM-translocation domain may be more suitable than others;
    • should a protease-TM-translocation domain fusion be employed then it may be preferable to insert a specific cleavage sequence between the protease/protease fragment and the TM, to enable the TM to have freedom to bind to the target receptor. According to this embodiment it may be preferable to engineer into the genetic construct means (eg. a disulphide bridge) to keep the fusion complex together;


The genetic construct preferably incorporates a nucleic acid sequence encoding a spacer peptide at the fusion junction between the TM and the protease/translocation domain. However, a spacer is not essential. Examples of spacer peptides include:

    • PPPIEGR [Kim, J. S., Raines, R. T. (1993). Ribonuclease S-peptide as a carrier in fusion proteins. Protein Sci 2(3):348-56];
    • collagen-like spacer [Rock, F., Everett, M., Klein, M. (1992). Over-expression and structure-function analysis of a bioengineered IL-2/IL-6 chimeric lymphokine. Protein Eng 5(6):583-91]; and
    • trypsin sensitive diphtheria toxin peptide [O'Hare, M., Brown, A. N., Hussain, K., Gebhardt, A., Watson, G., Roberts, L. M., Vitetta, E. S., Thorpe, P. E., Lord, J. M. (1990). Cytotoxicity of a recombinant ricin-A-chain fusion protein containing a proteolytically-cleavable spacer sequence. FEBS Lett Oct 29;273(1-2):200-4].


Turning to the protease (pr protease fragment) component of the agent, all protease variants described in the present application and in the present Applicant's co-pending application U.S. Ser. No. 09/255,829 may be employed. The content of U.S. Ser. No. 09/255,829 is herein incorporated by reference thereto.


All constructs have a 5′ ATG codon to encode an N-terminal methionine and a C-terminal translational stop codon if these codons are not already present. Expression of a number of fusion proteins is well-known in the art and was so at the priority date of the present application (ie. 8 Oct. 1997). Methods for the construction and expression of the constructs of the present invention may employ information from the following references and others:

  • Lorberboum-Galski, H., FitzGerald, D., Chaudhary, V., Adhya, S., Pastan, I. (1988). Cytotoxic activity of an interleukin 2-Pseudomonas exotoxin chimeric protein produced in Escherichia coli. Proc Natl Acad Sci USA 85(6):1922-6;
  • Murphy, J. R. (1988) Diphtheria-related peptide hormone gene fusions: a molecular genetic approach to chimeric toxin development. Cancer Treat Res; 37:123-40;
  • Williams, D. P., Parker, K., Bacha, P., Bishai, W., Borowski, M., Genbauffe, F., Strom, T. B., Murphy, J. R. (1987). Diphtheria toxin receptor binding domain substitution with interleukin-2: genetic construction and properties of a diphtheria toxin-related interleukin-2 fusion protein. Protein Eng; 1(6):493-8;
  • Arora, N., Williamson, L. C., Leppla, S. H., Halpern, J. L. (1994). Cytotoxic effects of a chimeric protein consisting of tetanus toxin light chain and anthrax toxin lethal factor in non-neuronal cells J Biol Chem; 269(42):26165-71;
  • Brinkmann, U., Reiter, Y., Jung, S. H., Lee, B., Pastan, I. (1993). A recombinant immunotoxin containing a disulphide-stabilized Fv fragment. Proc Natl Acad Sci USA; 90(16):7538-42; and
  • O'Hare, M., Brown, A. N., Hussain, K., Gebhardt, A., Watson, G., Roberts, L. M., Vitetta, E. S., Thorpe, P. E., Lord, J. M. (1990). Cytotoxicity of a recombinant ricin-A-chain fusion protein containing a proteolytically-cleavable spacer sequence. FEBS Lett Oct 29;273(1-2):200-4.


The method of preparing a fusion protein according to the present invention requires nucleic acid sequence data relating to the selected TM and the protease/protease fragment. These sequence data were readily available at the priority date of the present application as evidenced by the data/publications of several preferred TMs which have been listed in the present specification. Alternatively, any necessary sequence data may be obtained by techniques well-known to the skilled person.


In one embodiment, DNA encoding the TM sequences may be cloned from a source organism by screening a cDNA library for the correct coding region (for example by using specific oligonucleotides based on the known sequence information to probe the library), isolating the TM DNA, sequencing this DNA for confirmation purposes, and then placing the isolated DNA in an appropriate expression vector for expression in the chosen host.


As an alternative to isolation of the sequence from a library, the available sequence information may be employed to prepare specific primers for use in PCR, whereby the coding sequence is then amplified directly from the source material and, by suitable use of primers, may be cloned directly into an expression vector.


Another alternative method for isolation of the coding sequence is to use the existing sequence information and synthesise a copy, possibly incorporating alterations, using DNA synthesis technology.


Another alternative method is to use existing protein sequence information and synthesise a version of the coding sequence that can give rise to that protein sequence. Using DNA synthesis technology to do this (and the alternative described above) enables the codon bias of the coding sequence to be modified to be optimal for the chosen expression host. This may give rise to superior expression levels of the fusion protein.


All of the above methods may be employed to obtain sequence information on the selected protease component of the agent.


Ideally, optimisation of the codon bias for the expression host would be applied to the TM, the spacer (if there is one), the translocation domain and the protease. Optimisation of the codon bias is possible by application of the protein sequence into freely available DNA/protein database software, eg. programs available from Genetics Computer Group, Inc.


By way of example, the following TM protein sequences were readily available by the priority date of the present application (ie. 8 Oct. 1997:

pseudomonas aeruginosa PA-I lectin (ACCESSIONX65933)MAWKGEVLANNEAGQVTSIIYNPGDVITIVAAGWASYGPTQKWGPQGDREHPDQGLICHDAFCGALVMKIGNSGTIPVNTGLFRWVAPNNVQGAITLIYNDVPGTYGNNSGSFSVNIGKDQSSoybean agglutiflin (SBA) [ACCESSION P05046](modified to remove the signal sequence)aetvsfswnkfvpkqpnmilqgdaivtssgklqlnkvdengtpksslgralystpihiwdketgsvasfaasfnftfyapdtkrladglafflapidtkpqthagylglfnenesgdqvvavefdtfrnswdppnphiginvnsirsittswdlannkvakvlitydastsllvaslvypsqrtsnilsdvvdlktslpewvrigfsaatgldipgshdvlswsfasnlphassnidpldltsfvlheaiErythrifla corallodefldron lectin (ECorL)[ACCESSION CAA36986] (modified to remove thesignal sequence)vetisfsfsefepgndnltlqgaalitqsgvlqlkinqngmpawdstgrtlyakpvhiwdmttgtvasfetrfsfsieqpytrplpadglvffmgptkskpaqgygylgifnnskqdnsyqtlgvefdtfsnqwdppqvphigidvnsirsiktqpfqldngqvanvvikydasskilhavlvypssgaiytiaeivdvkqvlpewvdvglsgatgaqrdaaethdvyswsfqaslpetnd


In another embodiment of the invention the required LHN, which may be a hybrid of an L and HN from different clostridial toxin serotypes, is expressed as a recombinant fusion protein with the galactose-binding lectin, and may also include one or more spacer regions.


In a further embodiment of the invention the required TM, L or LHN and translocation domain components may be separately expressed in a recombinant form and subsequently linked, covalently or non-covalently, to provide the desired agent.


In a further embodiment of the invention the required translocation domain may be of a non-clostridial origin, comprising instead a peptide or other entity capable of similar or enhanced function.


Examples would include, but not be restricted to, the translocation domain of diphtheria toxin (O'Keefe et al., Proc. Natl. Acad. Sci. USA (1992) 89, 6202-6206; Silverman et al., J. Biol. Chem. (1993) 269, 22524-22532), the translocation domain of Pseudomonas exotoxin type A (Prior et al., Biochemistry (1992) 31, 3555-3559), the translocation domains of anthrax toxin (Blanke et al., Proc. Natl. Acad. Sci. USA (1996) 93, 8437-8442) and a variety of fusogenic or hydrophobic peptides of translocating function (Plank et al., J. Biol. Chem (1994) 269, 12918-12924).


The translocating domain may be obtained from a microbial protein source, in particular from a bacterial or viral protein source. It is well documented that certain domains of bacterial toxin molecules are capable of forming such pores. It is also known that certain translocation domains of virally expressed membrane fusion proteins are capable of forming such pores. Such domains may be employed in the present invention.


Hence, in one embodiment, the translocating domain is a translocating domain of an enzyme, such as a bacterial or viral toxin. One such molecule is the heavy chain of a clostridial neurotoxin, for example botulinum neurotoxin type A. Other sources of bacterial toxin translocating domains include diphtheria toxin and domain II of pseudomonas exotoxin.


Other sources of translocating domains include certain translocating domains of virally expressed membrane fusion proteins. For example, Wagner et al. (1992) and Murata et al. (1992) describe the translocation (ie. membrane fusion and vesiculation) function of a number of fusogenic and amphiphilic peptides derived from the N-terminal region of influenza virus haemagglutinin. Other virally expressed membrane fusion proteins known to have the desired translocating activity are a translocating domain of a fusogenic peptide of Semliki Forest Virus (SFV), a translocating domain of vesicular stomatitis virus (VSV) glycoprotein G, a translocating domain of SER virus F protein and a translocating domain of Foamy virus envelope glycoprotein. Virally encoded “spike proteins” have particular application in the context of the present invention, for example, the E1 protein of SFV and the G protein of the G protein of VSV.


Preferably it has been found to use only those portions of the protein molecule capable of pore-formation within the endosomal membrane.


Methodology to enable assessment of membrane fusion and thus identification of translocation domains suitable for use in the present invention are provided by Methods in Enzymology Vol 220 and 221, Membrane Fusion Techniques, Parts A and B, Academic Press 1993.


Examples of preferred translocating domains for use in the present invention are listed in the table below. The below-listed citations are all herein incorporated by reference.

TranslocationAmino aciddomain sourceresiduesReferencesDiphtheria toxin194-380Silverman et al., 1994, J. Biol. Chem. 269, 22524-22532London E., 1992, Biochem. Biophys. Acta., 1113, 25-51Domain II of405-613Prior et al., 1992, Biochemistry 31, 3555-3559pseudomonas exotoxinKihara & Pastan, 1994, Bioconj Chem. 5, 532-538Influenza virusGLFGAIAGFIENGWEGMIDGWYG,Plank et al., 1994, J. Biol. Chem. 269, 12918-12924haemagglutininand variants thereofWagner et al., 1992, PNAS, 89, 7934-7938Murata et al., 1992, Biochemistry 31, 1986-1992Semliki Forest virusTranslocation domainKielian et al., 1996, J Cell Biol. 134(4), 863-872fusogenic proteinVesicular Stomatitis118-139Yao et al., 2003, Virology 310(2), 319-332virus glycoprotein GSER virus F proteinTranslocation domainSeth et al., 2003, J Virol 77(11) 6520-6527Foamy virus envelopeTranslocation domainPicard-Maureau et al., 2003, J Virol. 77(8), 4722-4730glyoprotein


Use of the translocating domains listed in the above table includes use of sequence variants thereof. A variant may comprise one or more conservative nucleic acid substitutions and/or nucleic acid deletions or insertions, with the proviso that the variant possesses the requisite translocating function. A variant may also comprise one or more amino acid substitutions and/or amino acid deletions or insertions, so long as the variant possesses the requisite translocating function.


The only functional requirement of the translocating domain is that it is capable of forming appropriate pores in the endosomal membrane. A number of routine methods are available for confirming that a particular translocating domain has the requisite translocating activity, and thus to determine the presence of a translocating domain. Shone et al. (1987), and Blaustein et al. (1987) provide details of two very simple assays to confirm that any particular bacterial translocating domain has the requisite translocating activity. Shone (1987) describes a simple in vitro assay employing liposomes, which are challenged with a test molecule. The presence of a molecule having the requisite translocating function is confirmed by release from the liposomes of K+ and/or labelled NAD. Blaustein (1987) describes a simple in vitro assay employing planar phospholipid bilayer membranes, which are challenged with a test molecule. The presence of a molecule having the requisite translocation function is confirmed by an increase in conductance across the phospholipid membrane.


Exploitation in Industry


The agent described in this invention can be used in vivo, either directly or as a pharmaceutically acceptable salt, for treatment of pain.


For example, an agent according to the invention can be administered by spinal injection (epidural or intrathecal) at the level of the spinal segment involved in the innervation of an affected organ for the treatment of pain. This is, for example, applicable in the treatment of deep tissue pain, such as chronic malignant pain.




The present invention will now be described by reference to the following examples together with the Figures that show the following:



FIG. 1. SDS-PAGE analysis of fractions from ExL-LHN/A purification scheme



FIG. 2. Cleavage of SNAP-25 by ExL-LHN/A



FIG. 3. SDS-PAGE analysis of fractions from EcL-LHN/A purification scheme



FIG. 4 SDS-PAGE analysis of fractions from SBA-LHN/A purification scheme



FIG. 5 Native gel analysis of ExL- and SBA-LHN/A



FIG. 6 Activity of ExL-LHN/A on release of neurotransmitter from eDRG and eSC neurons



FIG. 7 Activity of SBA-LHN/A on release of neurotransmitter from eDRG and eSC neurons



FIG. 8 Activity of WGA-LHN/A on release of neurotransmitter from eDRG and eSC neurons



FIG. 9 Activity of ExL-LHN/A in an in vivo electrophysiology model of analgesia



FIG. 10 Activity of ExL-LHN/A in an in vivo behavioural model of analgesia




EXAMPLE 1
The Production of a Conjugate Between a Lectin from Erythrina cristagalli and LHN/A

Materials


Lectin from E. cristagalli (ExL) was obtained from Sigma Ltd.


LHN/A was prepared essentially by the method of Shone C. C., Hambleton, P., and Melling, J. 1987, Eur. J. Biochem. 167, 175-180.


SPDP was from Pierce Chemical Co.


PD-10 desalting columns were from Pharmacia.


Dimethylsulphoxide (DMSO) was kept anhydrous by storage over a molecular sieve.


Denaturing sodium dodecylsulphate polyacrylamide gel electrophoresis (SDS-PAGE) was performed using gels and reagents from Novex


Immobilised lactose-agarose was obtained from Sigma Ltd.


Additional reagents were obtained from Sigma Ltd.


Methods


The lyophilised lectin was rehydrated in phosphate buffered saline (PBS) to a final concentration of 10 mg/ml. Aliquots of this solution were stored at −20° C. until use.


The ExL was reacted with an equal concentration of SPDP by the addition of a 10 mM stock solution of SPDP in DMSO with mixing. After one hour at room temperature the reaction was terminated by desalting into PBS over a PD-10 column.


The thiopyridone leaving group was removed from the product by reduction with dithiothreitol (DTT, 5 mM, 30 min). The product of this reaction was analysed spectrophotometrically at 280 nm and 343 nm to determine the degree of derivatisation achieved. The degree of derivatisation achieved was 0.8±0.06 mol/mol. The thiopyridone and DTT were removed by once again desalting into PBS over a PD-10 column.


The LHN/A was desalted into PBSE (PBS containing 1 mM EDTA). The resulting solution (0.5-1.0 mg/ml) was reacted with a four- or five-fold molar excess of SPDP by addition of a 10 mM stock solution of SPDP in DMSO. After 3 h at room temperature the reaction was terminated by desalting over a PD-10 column into PBS.


A portion of the derivatised LHN/A was removed from the solution and reduced with DTT (5 mM, 30 min). This sample was analysed spectrophotometrically at 280 mm and 343 nm to determine the degree of derivatisation. The degree of derivatisation achieved was 2.26±0.10 mol/mol.


The bulk of the derivatised LHN/A and the derivatised ExL were mixed in proportions such that the ExL was in greater than three-fold molar excess. The conjugation reaction was allowed to proceed for >16 h at 4° C.


The product mixture was centrifuged to clear any precipitate that had developed. The supernatant was concentrated by centrifugation through concentrators (with 10000-50000 molecular weight exclusion limit) prior to a two step purification strategy. As the first step, the concentrated material was applied to a Superose 12 column on an FPLC chromatography system (Pharmacia). The column was eluted with PBS and the elution profile followed at 280 nm.


Fractions were analysed by SDS-PAGE on 4-20% polyacrylamide gradient gels, followed by staining with Coomassie Blue. The major band of conjugate has an apparent molecular mass of between 130-160 kDa; this is separated from the bulk of the remaining unconjugated LHN/A and more completely from the unconjugated ExL. Fractions containing conjugate were pooled prior to the second chromatography step; immobilised lactose-agarose. Selected post-Superose-12 fractions were applied to PBS-washed lactose-agarose and incubated for 2 hours at 4° C. to facilitate binding. Lectin-containing proteins (i.e. ExL-LHN/A conjugate) remained bound to the agarose during subsequent washing with PBS to remove contaminants (predominantly unconjugated LHN/A). ExL-LHN/A conjugate was eluted from the column by the addition of 0.3M lactose (in PBS) and the elution profile followed at 280 nm. The fractions containing conjugate were pooled, dialysed against PBS, and stored at 4° C. until use.


In FIG. 1 is illustrated the SDS-PAGE profile during different stages in the conjugate purification scheme. Lanes 2 and 3 indicate ExL lectin and LHN/A respectively prior to conjugation. Lanes 4, 5 & 6 represent conjugation mixture, post-Superose-12 and post-lactose affinity chromatography samples respectively. Lane 6 is therefore indicative of the profile of the final conjugate material. Molecular weight markers are represented in lanes 1 & 7 with sizes indicated on the figure.


On the SDS-PAGE gel there are bands due to lectin alone in fractions containing the conjugate, this material is probably due to the non-covalent homo-dimeric nature of the ExL; where only one monomer of ExL is covalently attached to the LHN/A the other is dissociated from the complex by the SDS in the electrophoretic procedure giving rise to these bands. The absence of free lectin monomers was confirmed by native PAGE analysis and is illustrated in FIG. 5. ExL-LHN/A (lane 5) was analysed by non-denaturing PAGE. Samples were separated using 4-20% polyacrylamide gel for 6.75 hours, 125V, 4° C. The electrophoresis profile was compared to those of LHN/A (lane 3) and ExL lectin only (lane 4). A range of marker proteins were analysed alongside; apoferritin (lane 6), β-amylase (lane 8), alcohol dehydrogenase (lane 7) and albumin (lane 9). Approximate molecular sizes are indicated.


EXAMPLE 2
The Production of a Conjugate Between a Lectin from Erythrina corallodendron and LHN/A

The procedure for production of a conjugate between a lectin from Erythrina corallodendron and LHN/A is essentially as described in Example 1 but with the following differences:


Materials


Lectin from E. corallodendron (EcL) was obtained from Sigma Ltd.



FIG. 3 illustrates the purification scheme for the EcL-LHN/A conjugate. Samples were applied to 4-20% polyacrylamide gradient gels and subjected to electrophoresis prior to staining with Coomassie blue. Lane 1=molecular weight markers. Lane 2 represents the post-lactose affinity purified sample of EcL-LHN/A. Lane 3 is a sample of pre-lactose affinity purified (size-exclusion chromatography only) EcL-LHN/A. Lane 4 is a sample of pre-lactose affinity purified ExL-LHN/A.


EXAMPLE 3
The Production of a Conjugate between a Lectin from Glycine max and LHN/A

The procedure for production of a conjugate between a lectin from Glycine max_and LHN/A is essentially as described in Example 1 but with the following differences:


Materials


Lectin from G. max (SBA) was obtained from Sigma Ltd.


Method


For the affinity chromatography step an immobilised N-acetylgalactosamine (GalNAc) column was used and specific SBA-LHN/A was eluted by the addition of 0.3M lactose.



FIG. 4 illustrates SDS-PAGE profile changes during the purification scheme for SBA-LHN/A. SBA-LHN/A was purified from crude conjugate mixture by Superose-12 size-exclusion chromatography and immobilised N-acetylgalactosamine affinity chromatography. Samples were subjected to SDS-PAGE on 4-20% polyacrylamide gels. Lanes 6-8 were run in the presence of 0.1M DTT. Lanes 1 (& 7) and 2 (&8) indicate SBA and SPDP-derivatised LHN/A respectively, prior to conjugation. Lanes 3, 4 & 5 (& 6) represent conjugation mixture, post-Superose-12 and post-affinity chromatography samples respectively. Lane 5 is therefore indicative of the profile of the final conjugate material. Molecular weight markers are represented in lanes Mr with sizes indicated on the figure.


The absence of free lectin monomers was confirmed by native non-denaturing PAGE analysis as illustrated in FIG. 5. Samples were separated using 4-20% polyacrylamide gel for 6.75 hours, 125V, 4° C. The electrophoresis profile of SBA-LHN/A (lane 1) was compared to those of SBA lectin only (lane 2) and LHN/A (lane 3). A range of marker proteins were analysed alongside; apoferritin (lane 6), β-amylase (lane 8), alcohol dehydrogenase (lane 7) and albumin (lane 9). Approximate molecular sizes are indicated.


EXAMPLE 4
Activity of ExL-LHN/A in Primary Neuronal Cultures

The dorsal root ganglia contain the cell bodies of primary nociceptive afferent neurons. It is well established that in primary in vitro cultures of this tissue the neurons retain many of the characteristics of the nociceptive afferent. These characteristics include the ability to release neuropeptides such as substance P in response to chemical stimuli known to cause pain in vivo (e.g. capsaicin). Neurons anatomically adjacent to those of the DRG include those of the spinal cord. Cultures of SC neurons prepared from embryonic rats can be established in vitro and the release of neurotransmitter (3H-glycine) under potassium stimulation can be assessed. As such, the eSC neurons represent a model cell for testing the selectivity of the agents described.


The selectivity of the EXL-LHN/A agent for eDRG over eSC neurons is clearly illustrated in FIG. 6. The dose curves document the effectiveness of ExL-LHN/A in an in vitro cell culture model by comparing inhibition of neurotransmission in eDRG with eSC neurons.


Materials


Substance P enzyme linked immunosorbent assay kits were from Cayman Chemical Company.


Western blot reagents were obtained from Novex Monoclonal antibody SMI-81 was from Sternberger Monoclonals Inc.


Methods


Primary cultures of dorsal root ganglion and embryonic spinal cord neurons were established following dissociation of the ganglia dissected from rat embryos (embryological age 12-15 days). For the preparation of eDRG neurons, the cells were plated into 12 well plates at an initial density of 3×105 cells/well in a medium containing NGF (100 ng/ml). After one day in culture, fresh medium containing cytosine arabinoside (10×10−6 M) was added to kill non-neuronal cells. After 2-4 days the cytosine arabinoside was removed. After several more days in culture the medium was replaced with fresh medium containing conjugate or LHN.


For the preparation of eSC neurons, Cells were plated onto poly-D-lysine coated 12 well plates (Costar) at a density of 2×106 cells per well (1 ml/well). ‘Plating’ medium was MEM with Earles Salts (Sigma), containing 5% foetal bovine serum (FBS), 5% heat inactivated horse serum (HS), 0.6% dextrose, 1.5 g/l NaHCO3 and 2 mM L-glutamine. Cultures are incubated at 37° C. with 10% CO2. The medium was changed to ‘feeding’ medium (plating medium minus the FBS with N1 (Sigma) 1/50 supplement) after one day. When glial cells became almost confluent anti-mitotic agents (15 microgrammes/ml 5-fluoro-2′-deoxyuridine (FdU) and 35 microgrammes/ml uridine (U)) were added for a further 2-3 days. Cells were cultured for at least 3 weeks prior to use.


The cells were incubated with these agents for varying times and then tested for their ability to release the neurotransmitters glutamate and substance P (eDRG) or glycine (eSC). After the release assays were performed the cells were lysed and the hydrophobic proteins were extracted by phase partitioning with Triton-X-114 following the method outlined in Boyd, Duggan, Shone and Foster (J. Biol. Chem. 270, 18216-18218, 1995).


Substance P Release Assay


The release of endogenous substance P was effected by collecting cell supernatants after treating the cells for 5 min with either a physiological balanced salt solution or a balanced salt solution in which the potassium ion concentration had been raised to 100 mM with consequent reduction in the sodium ion concentration to maintain isotonicity. Total substance P was measured after extraction in 2 M acetic acid, 0.1% trifluoroacetic acid and subsequent dehydration. Substance P immunoreactivity was measured using an enzyme immunoassay kit (Cayman Chemical Company).


[3H] Glutamate Release Assay


The release of glutamate was measured after loading the cells with [3H]glutamine as a radiotracer. The [3H]glutamine is converted to [3H]glutamate in the cell, and it is this [3H]glutamate that is taken up by synaptic vesicles and released upon depolarisation of the neuron. The cells are loaded with the [3H]glutamine (5×10−6 Ci/ml in HEPES-buffered MEM) for 2 h, then washed twice with HEPES-buffered MEM and thrice with balanced salt solution (BSS). Basal release was assessed with a 3 min incubation with BSS. Stimulated release was determined by a 3 min incubation with BSS in which the potassium concentration had been elevated to 80-100 mM with a consequent reduction in the sodium concentration to maintain isotonicity. All manipulations were performed at 37° C. The cells were lysed by the addition of Triton-X-100 (0.1%, v/v). For the basal and stimulated release superfusates the glutamate was separated from the glutamine by ion-exchange chromatography over Dowex-1 resin. The relevant fractions were analysed for 3H content by liquid scintillation counting.


[3H] Glycine Release Assay


The release of glycine was measured after loading the cells with [3H]glycine as a radiotracer. The [3H]glycine is taken up by synaptic vesicles and released upon depolarisation of the neuron. The cells are loaded with the [3H]glycine (2×10−6 Ci/ml in HEPES-buffered MEM) for 2 h, then washed once with HEPES-buffered MEM and thrice with balanced salt solution (BSS). Basal release was assessed with a 5 min incubation with BSS. Stimulated release was determined by a 5 min incubation with BSS in which the potassium concentration had been elevated to 56 mM with a consequent reduction in the sodium concentration to maintain isotonicity. All manipulations were performed at 37° C. The cells were lysed by the addition of 2 M acetic acid, 0.1% trifluoroacetic acid. Fractions were analysed for their 3H content by liquid scintillation counting and inhibition of release determined.



FIG. 6 illustrates the activity of ExL-LHN/A on release of neurotransmitter from eDRG and eSC neurons. Both eDRG and eSC cultures were exposed to a range of ExL-LHN/A concentrations (1 ml volumes) for three days. The percentage inhibition of eDRG substance P (n) and eSC [3H]-glycine (?) release is in comparison to untreated controls. The data shown is representative of =3 determinations. IC50 for eDRG was determined to be 3.66±0.92 μg/ml. An inhibition of 50% was not obtained for eSC using the concentration range employed.


Western Blotting


ExL-LHN/A was applied to eDRG for 16 hours. After the determination of neurotransmitter release the cells were lysed by the addition of 2 M acetic acid, 0.1% trifluoroacetic acid and subsequently dehydrated. To extract the membrane proteins from these mixtures Triton-X-114 (10%, v/v) was added and incubated at 4° C. for 60 min, the insoluble material was removed by centrifugation and the supernatants were then warmed to 37° C. for 30 min. The resulting two phases were separated by centrifugation and the upper phase discarded. The proteins in the lower phase were precipitated with chloroform/methanol for analysis by Western blotting.


The extracted protein samples were applied to 4-20% polyacrylamide gradient gels and subjected to electrophoresis prior to transfer to nitrocellulose. Proteolysis of SNAP-25, a crucial component of the neurosecretory process and the substrate for the zinc-dependent endopeptidase activity of BoNT/A, was then detected by probing with an antibody (SMI-81) that recognises both the intact and cleaved forms of SNAP-25 (FIG. 2). Proteins blotted onto nitrocellulose were probed with antibody SMI-81. Lanes 1-3, 4-6, 7-9 and 10-12 represent cells treated with medium, 40 microgrammes/ml ExL, 20 microgrammes/ml ExL and 40 microgrammes/ml LHN/A respectively. Densitometric analysis of these data determined the % SNAP-25 cleavage to be 52.7% and 37.0% for 40 and 20 microgrammes/ml respectively.


EXAMPLE 5
Activity of SBA-LHN/A in Primary Neuronal Cultures

Using methodology described in Example 4, the activity of SBA-LHN/A in primary neuronal cultures was assessed. The selectivity of the SBA-LHN/A conjugate for eDRG over eSC neurons is illustrated in FIG. 7. Both eDRG and eSC cultures were exposed to a range of SBA-LHN/A concentrations (1 ml volumes) for three days. The percentage inhibition of eDRG substance P (n) and eSC (3H)-glycine (O) release is in comparison to untreated controls. The data is the mean of three determinations±SE. The curves shown are representative of two experiments. IC50 values for eDRG neurons were determined to be 1.84 and 7.6 microgrammes/ml. It is observed that SBA-LHN/A exhibits a clear selectivity of the inhibition of neurotransmitter release from eDRG relative to eSC neurons. These data therefore confirm observations described for ExL-LHN/A above and highlight the properties of galactose-specific lectins.


EXAMPLE 7
Activity of WGA-LHN/A in Primary Neuronal Cultures

Using methodology described in Example 4, the activity of WGA-LHN/A in primary neuronal cultures was assessed. WGA represents an example of a non-galactosyl targeted lectin and therefore serves as an indicator of the properties of conjugate that do not recognise galactosyl moieties. The lack of selectivity of the WGA-LHN/A conjugate for eDRG over eSC neurons is illustrated in FIG. 8. eDRG and eSC neurons were exposed to a range of concentrations of WGA-LHN/A for 3 days prior to assay of stimulated release of neurotransmitter (substance P and glycine respectively). Each conjugate concentration was assessed in triplicate and results are expressed as percentage inhibition compared to untreated controls. Panels A and B represent dose response curves from one experiment representative of ≧3 for eDRG and eSC neurons respectively. Each point shown is the mean of three determinations±SE of the mean. IC50 data for the effects of WGA-LHN/A was calculated to be 0.34±0.06 microgrammes/ml (eDRG) and 0.06±0.09 microgrammes/ml (eSC), indicating the lack of C-fibre selectivity.


EXAMPLE 8
Activity of ExL-LHN/A in an Electrophysiological Model of Pain

A dose of 45 microgrammes of ExL-LHN/A in a 10 microlitres volume of vehicle was given by intrathecal injection to rats between lumbar sections L4-L5, 24 hours prior to electrophysiological analysis of neuronal activity. Animals were allowed to recover and movement was not restricted prior to sacrifice and analysis. The results from a group of 3 animals with 10 neurons recorded per animal, show that there was a 73% reduction in the C-fibre responses of the neurones (FIG. 9A) although the stimulus threshold is only slightly elevated (FIG. 9B). Inhibition of C-fibre responses would lead to a decrease in the transmission of pain signals and these data are indicative of the analgesic effect of conjugate ExL-LHN/A. There was also a significant decrease in the Aδ response (FIG. 9C). These fibres are also implicated in the transmission of noxious stimuli and this result emphasises the analgesic effect of ExL-LHN/A. Aβ neurons, a cell type that is not involved in transmission of noxious stimuli, were essentially unaltered in their responses to this stimulus (FIG. 9D). The lack of affect on the Aβ-fibre neurons is indicative of the selectivity of ExL-LHN/A for the neurons central to the transmission of pain signals.


EXAMPLE 9
Activity of ExL-LHN/A in Behavioural Models of Pain

In an accepted in vivo model of pain, the mouse hotplate test, ExL-LHN/A has been demonstrated to exhibit analgesic properties. FIG. 10 illustrates the data obtained for ExL-LHN/A where it is compared to a supramaximal dose of morphine. ExL-LHN/A was applied intrathecally (30 microgrammes in a 5 microlitre vehicle volume) to each of a group of 10 mice and analgesic response in the hot plate test determined. Data is presented as hot plate latency (seconds) plotted against assay time (P=pre-treatment, 0-5=hours post application). Onset of ExL-LHN/A action had apparently reached a plateau at 1 hour that remained constant for at least 5 hours. The level of analgesia is similar to a supramaximal dose (50 microgrammes, 20× mouse EC50) of morphine in this test, but is of much longer duration. This level of morphine achieves a maximal effect at 1 hour and then returns to control levels over a period of 5 hours. These data represent a clear indication of the analgesic potential of agents such as ExL-LHN/A.


Materials


Adult outbred mice (MFl) of either sex, weight range 20 to 30 g.


Methods


Test material is injected into the intrathecal space of anaesthetised mice using a 30 gauge disposable needle attached to a 50 microlitre Hamilton syringe. The site of injection was normally chosen to be between lumbar vertebrae 5 and 6. The needle is inserted into the tissue to one side of the vertebrae so that it slips into the groove between the spinous and transverse processes. The needle is then moved carefully forward to the intervertebral space. 5 microlitres of test material is then injected into the intrathecal space and the needle withdrawn. The skin incision is then closed with a single wound clip and the animal placed in a box to allow recovery.


EXAMPLE 10
Isolation of the Gene for Erythrina cristagalli Lectin (ECL)

The gene encoding Erythrina cristagalli lectin (ECL) was isolated as described in Stancombe et al 2003, Protein Expression & Purification, 30, 283-292. Briefly, E. cristagalli seeds (supplied by Sandeman Seeds) were germinated to obtain leaf material from the saplings, from which genomic DNA was prepared. Total genomic DNA was isolated and purified from leaf material using a plant DNeasy miniprep kit (Promega Corp.). PCR was performed using High Fidelity Taq polymerase (Roche Diagnostics Corp) according to the manufacturer's instructions. The full ECL sequence was amplified using 100 ng of genomic DNA as the template and the primers 5′-GTGGAAACCATATCGTTTAG-3′ and 5′-GTAGGAATAACAGCATCGTTTG-3′ in a Techne Genius thermal cycler. The PCR products were cloned into the pCR2.1 vector (Invitrogen Corp) and transformed into E. coli TOP10 cells to create clone pCR ECL. The complete DNA sequence of the ECL coding region was submitted to GenBank (AY158072) and is described in SEQ ID 1.


EXAMPLE 11
Creation of an Erythrina cristagalli Lectin-LHN/A (ECL-LHN/A) Expression Clone

The LHN/A amino acid sequence, obtained from freely available database sources such as GenBank (accession number P10845) or Swissprot (accession locus BXA1_CLOBO), was altered so the LC-HN/A linker (in this case defined as the inter-domain polypeptide region that exists between the cysteines of the disulphide bridge between LC and HN) included the recognition sequence for Factor Xa for specific protease activation. Using Backtranslation tool v2.0 (Entelechon), the DNA sequence encoding the modified LHN/A was determined. A BamHI recognition sequence was incorporated at the 5′ end and XbaI plus HindIII recognition sequences were incorporated at the 3′ end of the LHN/A. Two stop codons inserted between the XbaI and HindIII sites for efficient translation termination. Two further restriction sites, SalI and PstI, were inserted to flank the linker region. The DNA sequence was screened using MapDraw, (DNASTAR Inc.) for restriction enzyme cleavage sequences incorporated during the back translation. Any cleavage sequences that are found to be common to those required for cloning were removed manually from the proposed coding sequence ensuring common E. coli codon usage is maintained. E. coli codon usage was assessed Graphical Codon Usage Analyser (Geneart), and the % GC content and codon usage ratio assessed by reference to published codon usage tables. This optimised DNA sequence (SEQ ID 2) containing the LHN/A open reading frame (ORF) was then commercially synthesized.


The DNA encoding mature ECL was amplified from the cloned pCR ECL (SEQ ID 1) using oligonucleotides incorporating XbaI and HindIII recognition sequences at the 5′ and 3′ ends respectively. The 5′ oligonucleotide also encodes a glycine/serine flexible spacer region between the XbaI site and the ECL gene and the 3′ oligonucleotide also contains two stop codons just before the HindIII site for efficient translation termination. The resulting PCR product is depicted in SEQ ID 3.


The LHN/A was inserted into the pMAL (NEB) expression vector using the BamHI and HindIII restriction enzymes. The spacer-ECL was then inserted into the pMAL-LHN/A DNA using the XbaI and HindIII restriction enzymes. The resultant construct is the final ECL-LHN/A fusion product in the pMAL expression vector (SEQ ID 4 and SEQ ID 5)


EXAMPLE 12
Expression & Purification of ECL-LHN/A

The pMAL expression vector expressing ECL-LHN/A was transformed into E. coli HMS174 or AD494(DE3) (Novagen). Cultures were grown in Terrific broth complex medium supplemented with ZnCl2 (1 μM), ampicillin (100 μg/ml), 0.2% (w/v) glucose. Parameters for expression of the constructs were initially determined in shake flask cultures. Pre-induction bacterial growth was maintained at 37° C. to an OD600 nm of 0.5, at which stage expression of ECL-LHN/A was induced by addition of IPTG to 0.5 mM and a reduction in temperature to 30° C. After 4 h at 30° C. the bacteria were harvested by centrifugation and the resulting paste was stored at −70° C.


Typically, 16 g of cell paste was suspended in 160 ml PBS and lysed by sonication (MSE Soniprep 150). The resulting lysate was clarified by centrifugation prior loading onto a 25 ml amylose column and eluted with 10 mM maltose in PBS. The eluant contained approximately 50% pure fusion protein and was treated with Factor Xa (1 U Factor Xa/100 μg fusion protein; 20 h; 26° C.) to remove the maltose binding protein fusion partner and cleave the LC-HN junction to activate the protein. After incubation, the sample was filtered (0.45 μm) and diluted twofold with water to give a 0.5×PBS buffer composition. The cleaved, filtered, and diluted ECL-LHN/A was processed through a Q-Sepharose FF column (10 ml) and eluted within a 0-500 mM NaCl gradient.


See FIG. 12 for an illustration of the purified soluble LHN/A-ECL and its activation by treatment with protease.


EXAMPLE 13
Creation of an Erythrina cristagalli Lectin-LHN/C (ECL-LHN/C) Expression Clone

The LHN/C amino acid sequence obtained from freely available database sources such as GenBank (accession number X62389) was synthesised maintaining the native Factor Xa activation site within the linker region (SEQ ID 6) using the methods described in example 2. The spacer-ECL was also created using the method described in example 2 but with an alternative helical spacer region incorporated during PCR amplification (SEQ ID 7). The two genes were then sub-cloned into the PMAL expression vector using BamHI, XbaI and HindIII restriction enzymes to create ECL-LHN/C (SEQ ID 8 and SEQ ID 9).


EXAMPLE 14
Expression, Purification and Characterisation of ECL-LHN/C

The pMAL expression vector expressing ECL-LHN/C was transformed into E. coli HMS174 or AD494(DE3) (Novagen). Cultures were grown in Terrific broth complex medium supplemented with ZnCl2 (1 μM), ampicillin (100 μg/ml), 0.2% (w/v) glucose. Parameters for expression of the constructs were initially determined in shake flask cultures. Pre-induction bacterial growth was maintained at 37° C. to an OD600 nm of 0.5, at which stage expression of ECL-LHN/C was induced by addition of IPTG to 0.5 mM and a reduction in temperature to 30° C. After 4 h at 30° C. the bacteria were harvested by centrifugation and the resulting paste was stored at −70° C.


Typically, 16 g of cell paste was suspended in 160 ml PBS and lysed by sonication (MSE Soniprep 150). The resulting lysate was clarified by centrifugation prior loading onto a 25 ml amylose column and eluted with 10 mM maltose in PBS. Taking advantage of the native Factor Xa protease recognition sequence in the LHN/C activation loop, the eluant was treated with Factor Xa (1 U Factor Xa/100 μg fusion protein; 20 h; 26° C.) to remove the maltose binding protein fusion partner and cleave the LC-HN junction to activate the protein. After incubation, the sample was filtered (0.45 μm) and diluted twofold with water to give a 0.5×PBS buffer composition. The cleaved, filtered, and diluted ECL-LHN/C was processed through a Q-Sepharose FF column (10 ml) and eluted within a 0-500 mM NaCl gradient.


See FIG. 11 for an illustration of the purified soluble LHN/C-ECL and its activation by treatment with protease.


EXAMPLE 15
Creation of an Erythrina corallodendron Lectin-LHN/A (ECorL-LHN/A) Expression Clone

The ECorL amino acid sequence, obtained from freely available database sources such as GenBank (accession number CAA36986), was modified for E. coli expression by removal of amino acids at the N and C terminus of the ECorL precursor before back translation using Backtranslation tool v2.0 (Entelechon). The DNA sequence was further modified to incorporate XbaI and HindIII recognition sequences at the 5′ and 3′ ends respectively. Between the XbaI site and the ECorL gene, a glycine/serine flexible spacer region was added and after the ECorL gene, but before the HindIII site, two stop codons were also included. The DNA sequence was screened using MapDraw, (DNASTAR Inc.) for restriction enzyme cleavage sequences incorporated during the back translation. Any cleavage sequences that were found to be common to those required for cloning were removed manually from the proposed coding sequence ensuring common E. coli codon usage was maintained. E. coli codon usage was assessed Graphical Codon Usage Analyser (Geneart), and the % GC content and codon usage ratio assessed by reference to published codon usage tables. This optimised DNA sequence (SEQ ID 10) containing the ECorL ORF was then commercially synthesized.


The ECorL (SEQ ID10) and the LHN/A (SEQ ID2) synthetic genes were sub-cloned into the pMAL expression vector using BamHI, XbaI and HindIII restriction enzymes to create ECorL-LHN/C (SEQ ID 11 and SEQ ID 12).


EXAMPLE 16
Creation of a Soybean Agglutinin-LHN/C (SBA-LHN/C) Expression Clone

The SBA amino acid sequence, obtained from freely available database sources such as GenBank (accession number P05046), was modified for E. coli expression by removal of N terminal signal sequence before back translation using Backtranslation tool v2.0 (Entelechon). The DNA sequence was modified to incorporate XbaI and HindIII recognition sequences at the 5′ and 3′ ends respectively. Between the XbaI site and the SBA gene a glycine/serine flexible spacer region was added and after the SBA gene, but before the HindIII, site two stop codons were also included. The DNA sequence was screened using MapDraw, (DNASTAR Inc.) for restriction enzyme cleavage sequences incorporated during the back translation. Any cleavage sequences that are found to be common to those required for cloning were removed manually from the proposed coding sequence ensuring common E. coli codon usage is maintained. E. coli codon usage was assessed Graphical Codon Usage Analyser (Geneart), and the % GC content and codon usage ratio assessed by reference to published codon usage tables. This optimised DNA sequence (SEQ ID 13) containing the SBA ORF was then commercially synthesized.


The SBA (SEQ ID 13) and the LHN/C (SEQ ID 6) synthetic genes were sub-cloned into the pMAL expression vector using BamHI, XbaI and HindIII restriction enzymes to create SBA-LHN/C (SEQ ID 14 and SEQ ID 15).


EXAMPLE 17
Creation of a Pseudomonas aeruginosa-LHN/A (PA-1-LHN/A) Expression Clone

The PA-I amino acid sequence, obtained from freely available database sources such as GenBank (accession number X65933), was back translated using Backtranslation tool v2.0 (Entelechon). The DNA sequence was modified to incorporating XbaI and HindIII recognition sequences at the 5′ and 3′ ends respectively. Between the XbaI site and the PA-I gene a glycine/serine flexible spacer region was added and after the PA-I gene but before the HindIII, site two stop codons were also included. The DNA sequence was screened using MapDraw, (DNASTAR Inc.) for restriction enzyme cleavage sequences incorporated during the back translation. Any cleavage sequences that are found to be common to those required for cloning were removed manually from the proposed coding sequence ensuring common E. coli codon usage is maintained. E. coli codon usage was assessed Graphical Codon Usage Analyser (Geneart), and the % GC content and codon usage ratio assessed by reference to published codon usage tables. This optimised DNA sequence (SEQ ID 16) containing the PA-I ORF was then commercially synthesized.


The PA-I (SEQ ID 16) and the LHN/A (SEQ ID 2) synthetic genes were sub-cloned into the pMAL expression vector using BamHI, XbaI and HindIII restriction enzymes to create PA-I-LHN/A (SEQ ID 17 and SEQ ID 18).


EXAMPLE 18
Creation of an Erythrina cristagalli Lectin-LC/A-DT (ECL-LC/A-DT) Expression Clone

The LHN/A and DT amino acid sequence, obtained from freely available database sources such as GenBank (accession numbers P10845 and 1×DTT respectively). The diphtheria toxin (DT) translocation domain (domain T) is known in the art to effect translocation of cargo proteins from an acidified endosomal compartment to the cytosol. To create a clostridial endopeptidase—DT-T—lectin hybrid, amino acids 202-378 of diphtheria toxin (INLDW . . . SYNRP) were identified as the suitable fragment for insertion to the C-terminus of the LC/A. To maintain the proximity of the cysteines within the DT protease sensitive loop (essential for disulphide bonding), the DT loop sequence was also utilised between the LC and the DT-T. This effectively led to a truncation of the LC/A sequence after the C-terminal cysteine. In order that cleavage of the loop was specifically achieved, the sequence of the DT protease loop was modified to incorporate a Factor Xa recognition sequence. The resultant junction (italicised) took the form of LC/A-CAGNIEGRSVGSSLSC-DT-T. This hybrid amino acid sequence was back translated using the Backtranslation tool v2.0 (Entelechon). A BamHI recognition sequence was incorporated at the 5′ end and XbaI plus HindIII recognition sequences were incorporated at the 3′ end of the gene. Two stop codons inserted between the XbaI and HindIII sites for efficient translation termination. The DNA sequence was screened using MapDraw, (DNASTAR Inc.) for restriction enzyme cleavage sequences incorporated during the back translation. Any cleavage sequences that are found to be common to those required for cloning were removed manually from the proposed coding sequence ensuring common E. coli codon usage is maintained. E. coli codon usage was assessed Graphical Codon Usage Analyser (Geneart), and the % GC content and codon usage ratio assessed by reference to published codon usage tables. This optimised DNA sequence (SEQ ID 19) containing the LC/A-DT-T open reading frame (ORF) was then commercially synthesized.


The LC/A-DT (SEQ ID 19) was inserted into the pMAL expression vector using the BamHI and HindIII restriction enzymes. The spacer-ECL (SEQ ID 3) was then inserted into the pMAL-LC/A-DT DNA using the XbaI and HindIII restriction enzymes. The resultant construct is the final ECL-LC/A-DT fusion product in the pMAL expression vector (SEQ ID 20 and SEQ ID 21)


EXAMPLE 19
Creation of an Erythrina cristagalli Lectin-LC/A-HN/C (ECL-LC/A-HN/C) Expression Clone

By taking the ECL-LHN/A (SEQ ID 4) and the synthesised LHN/C (SEQ ID 6) and digesting both with PstI and XbaI the HN regions have been switched to create the hybrid ECL-LC/A-HN/C in the pMAL expression vector (SEQ ID 22 and SEQ ID 23).


EXAMPLE 20
Creation of an Erythrina cristagalli Lectin-IgA Protease-HN/A (ECL-IgA-HN) Expression Clone

The IgA protease and LHN/A amino acid sequences were obtained from freely available database sources such as GenBank (accession number P09790 and P10845 respectively). Information regarding the structure of the N. Gonorrhoeae IgA protease gene is available in the literature (Pohlner et al., Gene structure and extracellular secretion of Neisseria gonorrhoeae IgA protease, Nature. 1987, 325(6103), 458-62). A hybrid amino acid sequence was created by fusing the IgA protease to the HN/A translocation domain. The proximity of the cysteines within the original LHN/A endopeptidase was maintained by engineering the IgA onto the N-terminus of the clostridial activation loop in place of the LC domain. Within the activation loop the recognition sequence for Factor Xa was incorporated to allow specific protease activation. Using Backtranslation tool v2.0 (Entelechon), the DNA sequence ncoding the IgA-HN/A fusion modified for E. coli expression as determined. A BamHI recognition sequence was incorporated at the 5′ end and XbaI plus HindIII recognition sequences were incorporated at the 3′ end of the IgA-HN/A. Two stop codons were inserted between the XbaI and HindIII sites for efficient translation termination. Two further restriction sites, SalI and PstI, were inserted to flank the linker region between the cysteines. The DNA sequence was screened using MapDraw, (DNASTAR Inc.) for restriction enzyme cleavage sequences incorporated during the back translation. Any cleavage sequences that are found to be common to those required for cloning were removed manually from the proposed coding sequence ensuring common E. coli codon usage is maintained. E. coli codon usage was assessed Graphical Codon Usage Analyser (Geneart), and the % GC content and codon usage ratio assessed by reference to published codon usage tables. This optimised DNA sequence (SEQ ID 24) containing the IgA-HN/A open reading frame (ORF) was then commercially synthesized.


The IgA-HN/A (SEQ ID24) was inserted into the pMAL expression vector using the BamHI and HindIII restriction enzymes. The spacer-ECL (SEQ ID 3) was then inserted into the pMAL-IgA-HN/A DNA using the XbaI and HindIII restriction enzymes. The resultant construct is the final ECL-IgA-HN/A fusion product in the pMAL expression vector (SEQ ID 25 and SEQ ID 26).


EXAMPLE 21
Creation of a Soybean Agglutinin-LC/A-Influenza Haemagglutinin (SBA-LC/A-HA) Expression Clone

The influenza haemagglutinin polypeptide (HA) amino acid sequence is obtained from freely available database sources such as GenBank (accession numbers NP040980 respectively). Information regarding the structure of the influenza haemagglutinin gene, and a description of the HA1 and HA2 domain structure, is available in the literature (Winter, G. et al., Nucleotide sequence of the haemagglutinin gene of a human influenza virus H1 subtype, Nature 292 (5818), 72-75 (1981)). To create a clostridial endopeptidase-HA2-lectin hybrid, amino acids 345-566 of influenza haemagglutinin (GLFG . . . RICI) were identified as the suitable fragment for insertion to the C-terminus of the LC/A. To maintain the proximity of the cysteines within the original LHN/A endopeptidase, the HA sequence was engineered onto the C-terminus of the clostridial activation loop in place of the HN domain. Within the activation loop the recognition sequence for Factor Xa was incorporated to allow specific protease activation. This hybrid amino acid sequence was back translated using the Backtranslation tool v2.0 (Entelechon). Using Backtranslation tool v2.0 (Entelechon), the DNA sequence encoding the LC/A-HA fusion modified for E. coli expression was determined. A BamHI recognition sequence was incorporated at the 5′ end and XbaI plus HindIII recognition sequences were incorporated at the 3′ end of the LC/A-HA. Two stop codons were inserted between the XbaI and HindIII sites for efficient translation termination. Two further restriction sites, SalI and PstI, were inserted to flank the linker region between the cysteines. The DNA sequence was screened using MapDraw, (DNASTAR Inc.) for restriction enzyme cleavage sequences incorporated during the back translation. Any cleavage sequences that are found to be common to those required for cloning were removed manually from the proposed coding sequence ensuring common E. coli codon usage is maintained. E. coli codon usage was assessed Graphical Codon Usage Analyser (Geneart), and the % GC content and codon usage ratio assessed by reference to published codon usage tables. This optimised DNA sequence (SEQ ID 27) containing the LC/A-HA open reading frame (ORF) was then commercially synthesized.


The LC/A-HA (SEQ ID27) was inserted into the pMAL expression vector using the BamHI and HindIII restriction enzymes. The spacer-SBA (SEQ ID 13) was then inserted into the pMAL-LC/A-HA DNA using the XbaI and HindIII restriction enzymes. The resultant construct is the final SBA-LC/A-HA fusion product in the pMAL expression vector (SEQ ID 28 and SEQ ID 29.


EXAMPLE 22
Creation of an Erythrina cristagalli Lectin-LHN/B (ECL-LHN/B) Expression Clone

The LHN/B amino acid sequence obtained from freely available database sources such as GenBank (accession number P10844) was synthesised with a modified linker region including an Enterokinase activation site (SEQ ID 30) using the methods described in Example 2. The spacer-ECL was also created using the method described in Example 2 (SEQ ID 3). The LHN/B was inserted into the pMAL (NEB) expression vector using the BamHI and HindIII restriction enzymes. The spacer-ECL was then inserted into the pMAL-LHN/B DNA using the XbaI and HindIII restriction enzymes. The resultant construct is the final ECL-LHN/B fusion product in the pMAL expression vector (SEQ ID 31 and SEQ ID 32).


EXAMPLE 23
Expression, Purification And Characterisation of ECL-LHN/B

The pMAL expression vector expressing ECL-LHN/B was transformed into E. coli HMS174 or AD494(DE3) (Novagen). Cultures were grown in Terrific broth complex medium supplemented with ZnCl2 (1 μM), ampicillin (100 μg/ml), 0.2% (w/v) glucose. Parameters for expression of the constructs were initially determined in shake flask cultures. Pre-induction bacterial growth was maintained at 37° C. to an OD600 nm of 0.5, at which stage expression of ECL-LHN/B was induced by addition of IPTG to 0.5 mM and a reduction in temperature to 30° C. After 4 h at 30° C. the bacteria were harvested by centrifugation and the resulting paste was stored at −70° C.


Typically, 16 g of cell paste was suspended in 160 ml PBS and lysed by sonication (MSE Soniprep 150). The resulting lysate was clarified by centrifugation prior loading onto a 25 ml amylose column and eluted with 10 mM maltose in PBS. The eluant was treated with Factor Xa (1 U Factor Xa/100 μg fusion protein) and Enterokinase (0.00064 μg Enterokinase/100 μg fusion protein) for 20 hours at 26° C. to remove the maltose binding protein fusion partner and cleave the LC-HN junction to activate the protein. After incubation, the sample was filtered (0.45 μm) and diluted twofold with water to give a 0.5×PBS buffer composition. The cleaved, filtered, and diluted ECL-LHN/B was processed through a Q-Sepharose FF column (10 ml) and eluted within a 0-500 mM NaCl gradient.


See FIG. 13 for an illustration of the purified soluble ECL-LHN/B and its activation by treatment with protease.


SEQ ID NOs:




  • SEQ ID 1 PCR amplified DNA sequence of ECL

  • SEQ ID 2 Synthesised DNA sequence of LHN/A with Factor Xa activation site

  • SEQ ID 3 PCR amplified DNA sequence of GSspacer-ECL

  • SEQ ID 4 DNA sequence of ORF from pMAL-LHN/A-GSspacer-ECL

  • SEQ ID 5 Protein sequence of ORF from pMAL-LHN/A-GSspacer-ECL

  • SEQ ID 6 Synthesised DNA sequence of LHN/C

  • SEQ ID 7 PCR amplified DNA sequence of HXspacer-ECL

  • SEQ ID 8 DNA sequence of ORF from pMAL-LHN/C-HXspacer-ECL

  • SEQ ID 9 Protein sequence of ORF from pMAL-LHN/C-HXspacer-ECL

  • SEQ ID 10 Synthesised DNA sequence of GSspacer-ECorL

  • SEQ ID 11 DNA sequence of ORF from pMAL-LHN/A-GSspacer-ECorL

  • SEQ ID 12 Protein sequence of ORF from pMAL-LHN/A-GSspacer-ECorL

  • SEQ ID 13 Synthesised DNA sequence of GSspacer-SBA

  • SEQ ID 14 DNA sequence of ORF from pMAL-LHN/C-GSspacer-SBA

  • SEQ ID 15 Protein sequence of ORF from pMAL-LHN/C-GSspacer-SBA

  • SEQ ID 16 Synthesised DNA sequence of GSspacer-PA-I

  • SEQ ID 17 DNA sequence of ORF from pMAL-LHN/A-GSspacer-PA-I

  • SEQ ID 18 Protein sequence of ORF from pMAL-LHN/A-GSspacer-PA-I

  • SEQ ID 19 Synthesised DNA sequence of LC/A-DT with a Factor Xa activation site

  • SEQ ID 20 DNA sequence of ORF from pMAL-LC/A-DT-GSspacer-ECL

  • SEQ ID 21 Protein sequence of ORF from pMAL-LC/A-DT-GSspacer-ECL

  • SEQ ID 22 DNA sequence of ORF from pMAL-LC/A-HN/C-GSspacer-ECL

  • SEQ ID 23 Protein sequence of ORF from pMAL-LC/A-HN/C-GSspacer-ECL

  • SEQ ID 24 Synthesised DNA sequence of IgA-HN/A with Factor Xa activation site

  • SEQ ID 25 DNA sequence of ORF from pMAL-IgA-HN/A-GSspacer-ECL

  • SEQ ID 26 Protein sequence of ORF from pMAL-IgA-HN/A-GSspacer-ECL

  • SEQ ID 27 Synthesised DNA sequence of LC/A-HA with Factor Xa activation site

  • SEQ ID 28 DNA sequence of ORF from pMAL-LC/A-HA-GSspacer-SBA

  • SEQ ID 29 Protein sequence of ORF from pMAL-LC/A-HA-GSspacer-SBA

  • SEQ ID 30 Synthesised DNA sequence of LHN/B with Enterokinase activation site

  • SEQ ID 31 DNA sequence of ORF from pMAL-LHN/B-GSspacer-ECL

  • SEQ ID 32 Protein sequence of ORF from pMAL-LHN/B-GSspacer-ECL


Claims
  • 1. An agent for the treatment of pain that comprises a galactose-binding lectin linked to a derivative of a clostridial neurotoxin, in which the derivative of the clostridial neurotoxin comprises the L-chain or a fragment thereof, which includes the active proteolytic enzyme domain of the light (L) chain, linked to a molecule or domain with membrane translocating activity.
  • 2. An agent according to claim 1 in which the membrane translocation domain is derived from the heavy chain of a clostridial toxin.
  • 3. An agent according to claim 1 in which the membrane translocation domain is derived from a non-clostridial source.
  • 4. An agent according to any preceding claim in which the lectin binds to oligosaccharides that contain terminal β-D-galactosyl residues
  • 5. An agent according to any preceding claim in which the lectin binds to oligosaccharides that contain terminal α-D-galactosyl residues
  • 6. An agent according to any preceding claim in which the lectin binds to oligosaccharides that contain N-acetylgalactosamine
  • 7. An agent according to any previous claim in which the lectin is derived from a species of plant.
  • 8. An agent according to the previous claim in which the lectin is derived from a species of the genus Erythrina.
  • 9. An agent according to claim 8 in which the lectin is derived from E. cristagalli.
  • 10. An agent according to claim 8 in which the lectin is derived from E. corallodendron.
  • 11. An agent according to claims 7 in which the lectin is obtained from Glycine max.
  • 12. An agent according to claims 7 in which the lectin is obtained from Arachis hypogaea.
  • 13. An agent according to claims 7 in which the lectin is obtained from Bandeirea simplicifolia.
  • 14. An agent according to claim 1-6 in which the lectin is of mammalian origin.
  • 15. An agent according to claim 1-6 in which the lectin is obtained from bacteria.
  • 16. An agent according to claim 15 in which the lectin is obtained from Pseudomonas aeruginosa.
  • 17. An agent according to any preceding claim in which the lectin has been produced using recombinant technology.
  • 18. An agent according to any preceding claim in which the lectin has been enzymatically modified.
  • 19. An agent according to any preceding claim in which the lectin has been chemically modified.
  • 20. An agent according to any preceding claim which comprises the lectin coupled to a clostridial neurotoxin in which the HC domain of the H-chain is removed or modified.
  • 21. An agent according to any preceding claim in which the H-chain is modified by chemical derivatisation to reduce or remove its native binding affinity for motor neurons.
  • 22. An agent according to any of claims 1-20 in which the H-chain is modified by mutation to reduce or remove its native binding affinity for motor neurons.
  • 23. An agent according to any of claims 1-20 in which the H-chain is modified by proteolysis.
  • 24. An agent according to claim 20 in which the Hc domain is completely removed leaving only the HN-fragment of a clostridial neurotoxin.
  • 25. An agent according to any preceding claim in which the clostridial neurotoxin component is obtained from botulinum neurotoxin.
  • 26. An agent according to any preceding claim in which the clostridial neurotoxin component is obtained from botulinum neurotoxin type A.
  • 27. An agent according to claims 1-25 in which the clostridial neurotoxin component is obtained from botulinum neurotoxin type B.
  • 28. An agent according to any of claims 1-25 which is formed by the coupling of a galactose-binding lectin to the LHN fragment of botulinum neurotoxin type A.
  • 29. An agent according to claim 28 which is formed by the coupling of the galactose-binding lectin from Erythrina cristagalli to the LHN fragment of botulinum neurotoxin type A.
  • 30. An agent according to claim 28 which is formed by the coupling of the galactose-binding lectin from Erythrina corallodendron to the LHN fragment of botulinum neurotoxin type A.
  • 31. An agent according to claim 28 which is formed by the coupling of the galactose-binding lectin from Glycine max to the LHN fragment of botulinum neurotoxin type A.
  • 32. An agent according to any preceding claim in which the H-chain is obtained from a different clostridial neurotoxin than that from which the L-chain is obtained.
  • 33. An agent according to claim 32 in which the H-chain is obtained from botulinum neurotoxin type A and the L-chain from botulinum neurotoxin type B.
  • 34. An agent according to claim 32 in which the H-chain is obtained from botulinum neurotoxin type A and the L-chain from tetanus neurotoxin.
  • 35. An agent according to claims 33 and 34 in which the H-chain component is the HN fragment of botulinum neurotoxin type A.
  • 36. An agent according to any preceding claim in which the L-chain or L-chain fragment is linked to the H-chain by a direct covalent linkage.
  • 37. An agent according to any of claims 1-35 in which the L-chain or L-chain fragment is linked to the H-chain by a covalent linkage which includes one or more spacer regions.
  • 38. An agent according to any preceding claim in which the clostridial neurotoxin derivative incorporates polypeptides produced by recombinant technology.
  • 39. An agent according to any preceding claim in which the lectin is linked to the clostridial neurotoxin-derived component by a direct covalent linkage.
  • 40. An agent according to any of claims 1-38 in which the lectin is linked to the clostridial neurotoxin-derived component by a covalent linkage which includes one or more spacer regions.
  • 41. An agent according to any preceding claim in which the lectin and clostridial neurotoxin components are produced as a recombinant fusion protein.
  • 42. An agent according to any preceding claim in which the lectin protein has been modified from its native polypeptide sequence whilst retaining an ability for the protein to bind to oligosaccharide structures, in which the terminal residue is derived from galactose or N-acetylgalactosamine.
  • 43. An agent according to claim 42 in which the protein modification results from modification of the nucleic acid coding for the lectin protein from its native sequence.
  • 44. An agent according to any preceding claim which prevents the release of a neurotransmitter or neuromodulator from a primary sensory afferent.
  • 45. An agent according to any preceding claim which inhibits the release of a neurotransmitter or neuromodulator from a primary nociceptive afferent.
  • 46. A method for obtaining an agent according to any preceding claim which comprises the covalent attachment of a galactose-binding lectin to a derivative of a clostridial neurotoxin, in which the derivative of the clostridial neurotoxin comprises the L-chain or an L-chain fragment which includes the active proteolytic enzyme domain of the light (L) chain, linked to a molecule or domain with membrane translocating activity.
  • 47. A method for obtaining an agent according to any of claims 1-58 which comprises the covalent attachment of a galactose-binding lectin to a derivative of a clostridial neurotoxin with the inclusion of one or more spacer regions, in which the derivative of the clostridial neurotoxin comprises the L-chain or an L-chain fragment which includes the active proteolytic enzyme domain of the light (L) chain, linked to a molecule or domain with membrane translocating activity.
  • 48. An method according to claim 47 in which the membrane translocation domain is derived from the heavy chain of a clostridial toxin.
  • 49. An method according to claim 47 in which the membrane translocation domain is derived from a non-clostridial source.
  • 50. A method for obtaining an agent according to any of claims 1-45 which comprises constructing a genetic construct which codes for the agent, incorporating said construct into a host organism and expressing the construct to produce the agent.
  • 51. A method of controlling the release of a neurotransmitter or neuromodulator from a primary sensory afferent by applying the agent of any one of claims 1-45.
  • 52. A method of controlling the release of a neurotransmitter or neuromodulator from a primary nociceptive afferent by applying the agent of any one of claims 1-45.
  • 53. A method of controlling the transmission of sensory information from a primary sensory afferent to a projection neuron by applying the agent of any one of claims 1-45.
  • 54. A method of controlling the transmission of sensory information from a primary nociceptive afferent to a projection neuron by applying the agent of any one of claims 1-45.
  • 55. A method of controlling the sensation of pain by applying the agent of any one of claims 1-45.
  • 56. Use of the agent according to any one of claims 1-45 or a pharmaceutically acceptable salt thereof as a medicament for the alleviation of pain.
  • 57. Use of the agent according to any one of claims 1-45 or a pharmaceutically acceptable salt thereof as a medicament for the prevention of pain.
  • 58. Use of the agent according to any one of claims 1-45 in the manufacture of a medicament for the alleviation of pain.
  • 59. Use of the agent according to any one of claims 1-45 in the manufacture of a medicament for the prevention of pain.
  • 60. A method of alleviating pain which comprises administering an effective dose of the agent according to any one of claims 1-45.
  • 61. A method of preventing pain which comprises administering an effective dose of the agent according to any one of claims 1-45.
  • 62. A method for preparing an agent in the form of a fusion protein, wherein the agent is for the treatment of pain, the agent comprising: a galactose-binding or an N-acetylgalactosamine-binding lectin; a non-cytotoxic protease or a fragment thereof, which protease or protease fragment is capable of cleaving a protein of the exocytic fusion apparatus of a target cell; and a translocating domain that translocates the protease or protease fragment into the target cell; said method comprising expressing in a host organism a genetic construct that codes for the agent.
  • 63. A method according to claim 62, wherein the galactose-binding or an N-acetylgalactosamine-binding lectin is selected from the group consisting of Erythrina cristagalli lectin, Erythrina corallodendron lectin, Arachis hypogaea lectin, Bandeirea simplicifolia lectin, soybean agglutinin, or Pseudomonas aeringuosa lectin.
  • 64. A method according to claim 62, wherein the protease or protease fragment is an L-chain or L-chain fragment of a clostridial neurotoxin, which L-chain or L-chain fragment contains a proteolytically active enzyme domain of the L-chain.
  • 65. A method according to claim 62, wherein the protease or protease fragment is an IgA protease of Neisseria gonorrhoeae.
  • 66. A method according to claim 62, wherein said translocating domain is a translocating domain of a microbial protein.
  • 67. A method according to claim 62, wherein said translocating domain is a translocating domain of a bacterial or viral protein.
  • 68. A method according to claim 62, wherein said translocating domain is a translocating domain of a bacterial toxin, or a translocating domain of a virally expressed membrane fusion protein.
  • 69. A method according to claim 62, wherein said translocating domain is selected from the group consisting of the HN domain of a clostridial neurotoxin, a translocating domain of diphtheria toxin, domain II of pseudomonas exotoxin A, a translocating domain of influenza virus haemagglutinin, a translocating domain of a fusogenic protein of Semliki Forest virus, a translocating domain of vesicular stomatitis virus glycoprotein G, a translocating domain of SER virus F protein, and a translocating domain of Foamy virus envelope glycoprotein.
  • 70. An agent for the treatment of pain, wherein the agent has been obtained in the form of a fusion protein by a method according to claim 62, said agent comprising: a galactose-binding or an N-acetylgalactosamine-binding lectin; a non-cytotoxic protease or a fragment thereof, which protease or protease fragment is capable of cleaving a protein of the exocytic fusion apparatus of a target cell; and a translocating domain that translocates the protease or protease fragment into a target cell; wherein the agent is a fusion protein.
  • 71. An agent according to claim 70, wherein the galactose-binding or an N-acetylgalactosamine-binding lectin is selected from the group consisting of Erythrina cristagalli lectin, Erythrina corallodendron lectin, soybean agglutinin, or Pseudomonas aeringuosa lectin.
  • 72. An agent according to claim 70, wherein the protease or protease fragment is an L-chain or L-chain fragment of a clostridial neurotoxin, which L-chain or L-chain fragment contains a proteolytically active enzyme domain of the L-chain.
  • 73. An agent according to claim 70, wherein the protease or protease fragment is an IgA protease of Neisseria gonorrhoeae.
  • 74. An agent according to claim 70, wherein said translocating domain is a translocating domain of a microbial protein.
  • 75. An agent according to claim 70, wherein said translocating domain is a translocating domain of a bacterial or viral protein.
  • 76. An agent according to claim 70, wherein said translocating domain is a translocating domain of a bacterial toxin, or a translocating domain of a virally expressed membrane fusion protein.
  • 77. An agent according to claim 70, wherein said translocating domain is selected from the group consisting of the HN domain of a clostridial neurotoxin, a translocating domain of diphtheria toxin, domain II of pseudomonas exotoxin A, a translocating domain of influenza virus haemagglutinin, a translocating domain of a fusogenic protein of Semliki Forest virus, a translocating domain of vesicular stomatitis virus glycoprotein G, a translocating domain of SER virus F protein, and a translocating domain of Foamy virus envelope glycoprotein.
Priority Claims (1)
Number Date Country Kind
9721189.0 Oct 1997 GB national
Continuation in Parts (1)
Number Date Country
Parent 09529130 Jun 2000 US
Child 11257500 Oct 2005 US