DEVICE FOR DETECTING ORGANOPHOSPHATES

Abstract
This invention relates to a device that can be used is used to detect organophosphates and carbamate on surfaces including food, clothing (including as wearable pesticide detectors) and machinery.
Description
FIELD OF THE INVENTION

This invention relates to a device that can be used to detect organophosphate (OP) and carbamates (C) compounds, on surfaces including food, clothing (including as wearable pesticide detectors), environmental samples and machinery.


DESCRIPTION OF THE RELATED ART

Worldwide, the routine use of pesticides including organophosphates to control agricultural, household and structural pests has reached greater than 5 billion tons annually, which potentially exposes greater than 1.8 billion civilians and tons of agricultural produce. In the USA, levels are high enough to result in 10,000-20,000 pesticide poisonings among just the ˜2 million agricultural workers annually. While pesticides greatly increase food production by reducing insect infestations, they are toxic compounds and have environmental and health effects. WHO Class I and Class II OP and carbamate pesticides constitute a diverse group of chemical structures, but all potentially exhibit a common mechanism of toxicity similar to nerve agents, that is, active site modification of acetylcholinesterase (AChE) resulting in its inhibition, accumulation of acetylcholine, over-stimulation of cholinergic receptors, and consequent clinical signs of cholinergic toxicity.


Although safe for humans and other mammals at the low doses used, there is a growing concern about the effects of long-term exposure to these chemicals by farm workers and the level of pesticide consumed with food. This is especially true in Asia. At high exposures, acute toxicity can occur leading to seizures, brain damage and cognitive and behavioral defects and often death by respiratory failure. In addition to


occupational exposure to prolonged or high pesticide, OP and carbamate doses, their potency has been associated with a major cause of disability and death. In this context, insecticide poisoning is often the preferred method of suicide in Asia, killing more than 100,000 people annually in India alone. In addition, pesticide use has been associated with the neurocognitive deficits and neuroendocrine alterations described in veterans as Gulf War syndrome and more recently, it is thought that pesticides were used by Islamist terrorists to attack schools In Afghanistan from 2010-2013 injuring over 2,000 girls.


The neurotoxicity caused by spraying of insecticides may result from dermal or inhalation exposure from the particles in the air, on clothing or machinery or orally from the residue on food. In the latter context, the effect on children appears to happen at lower levels than for adult exposure. These health consequences, particularly associated with the use of OP and carbamate (“C”) insecticides, could be reduced by monitoring produce and eliminating the consumption of OP-contaminated food. See, e.g., www.who.int/ipcs/publications/pesticides_hazard_2009.pdf. In the US, the level of pesticide residue allowed on food we eat will likely be determined by decisions made based on specific pesticide usage and environmental and health assessments. In Asia, however, monitoring of insecticides on food and health concerns may take prominence over rulings on pesticide usage, particularly for exported crops.


Although the US EPA ban of most residential uses of organophosphates in 2001, as well as some for agricultural purposes, resulted in decreases in both the level and percentage of OP insecticides employed in the USA, approximately 20 million pounds of OP pesticides were still sprayed agriculturally on fruits and vegetables in 2012; representing 33% of all insecticides (EPA Pesticide Industry Sales and Usage 2008-2012 estimates). The most used OP, chlorpyrifos, which while now under pressure, still ranks as the fourteenth most commonly used conventional pesticide in the US and has recently been linked to autism and ADHD (EPA Revised Human Health Risk Assessment for Registration Review, November 2016). Aldicarb, the active substance in the pesticide Temik, is one of the most widely used insecticide and also one of the most environmentally toxic one. One consideration with banning all OPs is that, in contrast to other pesticides, they are hydrolyzed slowly in a moist atmosphere and in water and show a low propensity to move up the food chain as happened with DDT and other chlorohydrocarbons. However, in contrast to the USA, Australia and the European Union, which have banned or severely restricted many pesticides, their use in Asia and developing countries is still widespread and even parathion is still widely used despite its ban. Thus, a very large market will exist domestically and overseas for many years for OP/C pesticides alone. Moreover, monitoring use and residuals of other pesticides will become more and more important due to increasing awareness and concerns of environmental and health impact. Recent reports from Germany showed massive decline in insect population and diversity and this is becoming a major public concern for the use of insecticides in agriculture. A step increasing demand for rapid testing of environmental samples for pesticides including organophosphates is anticipated.


Several biosensor devices have been developed for detection of pesticides, OP insecticides and nerve agents based on electrical, amperometric, spectroscopic and color readouts. For example, available pesticide detection kits include NIDS Rapid Pesticide Test kit (ANP Technologies), Pesticide Detection cards (RenekaBio), and Agri-Screen Ticket kit (Neogen). However, these kits are multicomponent, have imprecise endpoints, require long incubation periods, and/or require chopping up food or testing fluids after washing. Thus, use of these kits at test sites to obtain rapid results (in less than 20 minutes), or to test more than 1,000 fruit/vegetables within a few hours (e.g. 1-8 hours), for example, is not practical or even possible, and cost-effective high-throughput screening of agricultural products for consumer safety and assurance is thus not feasible. However, rapid onsite testing is an essential prerequisite for withdrawing contaminated food from the market to efficiently protect consumers, and to detect illegal use.


Because the kits currently on the market to detect insecticides and other pesticides have been shown to have imprecise endpoints, require long incubation periods and use complex “kits” with several solutions, what is required is a more robust and self-contained test which detects OP/C rapidly (e.g., 2-20 minutes) and with high sensitivity and selectivity.


SUMMARY OF THE INVENTION

This summary is provided to introduce a selection of concepts in a simplified form that are further described below in the Detailed Description. This summary is not intended to identify key features or essential features of the claimed subject matter, nor is it intended to be used as an aid in determining the scope of the claimed subject.


As described herein, the innovative features are the engineering of the first efficient, small, inexpensive, hand-held device for rapid, sensitive and specific detection of organophosphate and carbamate compounds on surfaces, agricultural produce and environmental samples, without the need for sophisticated equipment.


As described herein, the invention relates to a device for detecting an OP/C compound comprising the following elements (1) a top piece comprising a first carrier material, wherein said first carrier material comprises an immobilized OP/C Detecting Enzyme; (2) a first substrate; (3) a second enzyme, (4) a second substrate; (5) a pH Sensitive Dye; (6) a second carrier material; (7) an ampoule comprising a buffer; (8) a middle piece and (9) a bottom piece, wherein the middle piece is associated with the top piece and the bottom piece, wherein the middle piece comprises the second carrier material and the ampoule, and wherein when the middle piece is turned relative to either the top piece or the bottom piece, the ampoule is capable of being cracked to release the buffer to contact the first carrier material and the second carrier material causing (i) the enzymatic conversion of the first substrate by the OP-detecting enzyme to produce an acidic reaction product; and (ii) the enzymatic conversion of the second substrate by the second enzyme to produce a basic reaction product. This device may also include an Oxidizer.


In preferred embodiments, the OP/C Detecting Enzyme is (a) a hydrolase; (b) a lipase, a phosphatase, an amylase, a cellulase, a protease, a peptidase, a urease or a deaminase; (c) a carboxylesterase (CES), acetylcholinesterase (AChE), butyrylcholinesterase (BChE), organophosphorus hydrolase or organophosphorus acid anhydrolase; (d) CES1 or CES2; (d) selected from Tables 2-5; or (e) an OP/C Detecting Enzyme Variant having at least 70%, at least 75%, at least 80%, at least 85%, at least 90, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the OP/C Detecting Enzyme amino acid sequence of (a)-(d). As described herein the OP/C Detecting Enzyme Variant both (1) retains the ability to hydrolyse the first substrate; and (2) maintains that ability to be inhibited by an OP/C.


In preferred embodiment, the OP/C Detecting Enzyme: (a) can detect at least 10 ug, at least 20 ug, at least 30 ug, at least 40 ug, at least 50 ug, at least 60 ug, at least 70 ug, at least 80 ug, at least 90 ug or at least 100 ug of an OP/C compound; (b) can detect between 10-100 ug, between 20-100 ug, between 30-100 ug, between 40-100 ug, between 50-100 ug, between 60-100 ug, between 70-100 ug, between 80-100 ug, between 90-100 ug of an OP/C compound; (c) comprises an inhibition rate constant ki of at least 103 M−1·min−1 to 108 M−1·min−1, at least 104 M−1·min−1 to 108M−1·min−1, at least 105 M−1·min−1 to 108M−1·min−1, at least 106 M−1·min−1 to 108M−1·min−1, or at least 107 M−1·min−1 to 108M−1·min−1; and/or (d) comprises an inhibition rate constant ki of 103-105 M−1·min−1, ki of 104-105 M−1·min−1, 105-106 M−1·min−1, 106 M−1·min−1 to 107 M−1·min−1, or 106 to 108 M−1·min−1.


In preferred embodiments, the first carrier material is comprised of: (a) natural polymers, including but not limited to cellulose, hemicellulose, pectin, chitin, silk, lignin, starch, polypeptides, collagens, keratins, polysaccharides, nucleic acids, and/or rubbers; or (b) derivatives of natural polymers, including but not limited to methylation, carboxylation, amidation, sulfation, hydroxylation, condensation, iodination, reduction, oxidation, esterification, alkylation, and/or halogenation; and/or (c) synthetic polymers and copolymers, including but not limited to polyurethanes, thermoplastic polyurethanes, silicones, polyamides, polystyrenes, bakelite, polyethylene, polypropylene, polyvinyl chloride, Polytetrafluoroethylene, Polychloroprene, and/or polyimides. In preferred embodiments, the first carrier material is a sponge and/or is made of polyurethane.


In further embodiments, the first substrate is selected from acetylcholine, butyrylcholine4-nitrophenyl acetate, 4-nitrophenyl propionate, 4 -nitrophenyl butyrate, 4-nitrophenyl valerate, 4-nitrophenyl dimethylacetate, 4-nitrophenyl trimethylacetate, 4-nitrophenyl 4-guanidinobenzoate, n-Glycero-3-phosphocholine, or 6-nitrocoumarin. First substrate may further be selected from Thioesters such as acetylthiocholine, butyrylthiocholine, S-4-Nitrobenzyl thioacetate, S-Phenyl-thioacetate.


In further embodiments, the second enzyme and second substrate is selected from Table 6. In further preferred embodiments, the second enzyme is urease, the second substrate is urea, and/or the basic reaction product is ammonia.


In further preferred embodiments, the pH Sensitive Dye is selected from nitrazine, phenol red, chlorophenol red, bromocresol green, cresol red, bromomethyl blue, or bromocresol purple.


In certain embodiments, the Oxidizer is included in the device and converts an inactive OP/C compound to an active OP/C compound. Examples of such Oxidizers include, but are not limited to Fenton, a halogen (e.g. iodine, bromine, chlorine and fluorine), or a P450 enzyme in the presence of the cofactor NADPH. Preferred example of P450 enzyme is the wildtype or triple mutant of CYP1A2 (P450 BM-3 (CYP102-A1).


In preferred embodiments, besides the OP/C Detecting Enzyme, the first carrier material can further comprise the first enzyme, the second enzyme and/or the Oxidizer. In other embodiments, the ampoule further comprises the pH Sensitive Dye; and/or the second carrier material comprises the pH Sensitive Dye, the first substrate, the second substrate, and/or the Oxidizer.


In further preferred embodiments, the second carrier material is selected from: a test strip comprising dried filter paper or a second polymer.


In further preferred embodiments, the pH Sensitive Dye, the first substrate, the second substrate, and/or the Oxidizer are lyophilized as a microtablet.


In further preferred embodiments, the top piece and the middle piece are connected. Additionally, in preferred embodiments the ampoule extends into the bottom piece. In further embodiments, the middle piece contains one or more holes to permit flow of released contents of the ampoule between the bottom piece and the middle piece. Additionally, the device as described herein further comprises a lid, and this lid can be transparent and/or comprise a window.


In further preferred embodiments, the device comprises at least one O-ring that can be place in between the top piece and the middle piece and/or between the middle piece and the bottom piece to ensure sealing of the connected pieces so that the reaction solutions stay in place.


In additional preferred embodiments, the device is operably associated with a smart phone.


As described herein, additional embodiments include a method of detecting an OP/C comprising: (a) contacting the device as described herein with a surface; (b) turning the middle piece relative to either the top piece or the bottom piece thereby cracking the ampoule to release the buffer to contact the first carrier material and the second carrier material causing the enzymatic conversion of a second substrate by a second enzyme; and wherein: (1) in the absence of an OP/C, the enzymatic conversion of the first substrate by the OP/C Detecting Enzyme occurs, resulting in a maintenance of a baseline pH; or (2) in the presence of an OP/C, the enzymatic conversion of the first substrate by the OP/C Detecting Enzyme is inhibited by the OP/C compound, resulting in an increase in pH above the baseline pH due to the production of the basic reaction product.


As described herein and as known in the art, many OPs and carbamates ran be detected using the device or the method. Particularly, the OP/C compound that can be detected includes but is not limited to: (a) an insecticide selected from: acephate, aldicarb (Temik), carbachol, carbamate, carbaryl (Sevin), carbofuran (Furadan), carisoprodol, chlorfenvinphos, Chlorophyrifos-oxon, Chlorphyrifos, Dementon-S, Diazoxon, diazinon, Dichlorvos, dicrotophos, dimethoate, dithiocarbamates, EA-3990, eserine, ethienocarb, ethoprophos, ethyl carbamate, felbamate, fenobucarb, fenamiphos, isocarbophos, Malathion, mebutamate, meprobamate, Methamidaphos, methomyl, methyl carbamate, methyl parathion, Methyl-PDX, monocrotophos, naled, neostigmine, omethoate, oxamyl, Paraoxon, Parathion, phorate, phosmet, phosphamidon, rivastigmine, T-1123, terbufos, tetrachlorvinphos, Tetriso, thiocarbamates (e.g., O-thiocarbamate or S-thiocarbamates), triazophos, and/or tybamate; (b) a G agent, such as Tabun (GA), Sarin (GB), Chlorsarin (GC), Soman (GD), methylsarin, n-butylsarin, iso-butylsarin, n-propylsarin, ethylsarin (GE), and/or cyclosarin (GF), GV; (c) a V agent, such as EA-3148, VE, VG, VM, VP, VR, VS, and/or VX; and/or (d) a Novichok Agent, such as A-234.


As also described herein and in preferred embodiments, the device (a) can detect at least 10 ug, at least 20 ug, at least 30 ug, at least 40 ug, at least 50 ug, at least 60 ug, at least 70 ug, at least 80 ug, at least 90 ug or at least 100 ug of an OP/C compound; and/or (b) can detect between 10-100 ug, between 20-100 ug, between 30-100 ug, between 40-100 ug, between 50-100 ug, between 60-100 ug, between 70-100 ug, between 80-100 ug, between 90-100 ug of an OP/C compound.


Examples of surfaces that can be tested with the device as described herein include, but are not limited to food, clothing, or machinery.


It is to be understood that both the foregoing general description and the following detailed description are exemplary and explanatory only and are intended to provide further explanation of the invention as claimed. The accompanying drawings are included to provide a further understanding of the invention and are incorporated in and constitute part of this specification, illustrate several embodiments of the invention, and together with the description serve to explain the principles of the invention.





DESCRIPTION OF THE DRAWINGS

Embodiments are illustrated by way of example (and not limitation) in the figures of the accompanying drawings, in which like references, indicate similar elements and in which:



FIG. 1A shows the Bimolecular rate constants (ki) of plant-derived rHuCES (recombinant human carboxylesterase) extracts tested against a battery of OP insecticides.



FIG. 1B shows the in vitro conversion of parathion to paraoxon using cytochrome P450 (CYP1A2)/NADPH microsomes (Fisher Scientific).



FIG. 1C shows the bi-molecular rate constants of the plant-derived rHuCE extracts against a battery of OP insecticides as compared to the purified rHuCE controls produced in E. coli.



FIG. 1D shows the results of a second experiment demonstrating the in vitro conversion of parathion to paraoxon using cytochrome P450 (CYP1A2)/NADPH microsomes. Increased inhibition rate constants (ki) against rHuCES of parathion (L) and chlorpyrifos (R) following conversion to their oxons after a 10min incubation with NADPH and P450(CYP) from two sources. Paraoxon was used as a control.



FIG. 2 shows a representative example of OP/C Detecting Enzyme sequences that can be used in the device as described herein.



FIG. 3 shows the individual different components of the device.



FIG. 4 shows a top view of the device.



FIG. 5 shows the side view of the device.



FIG. 6 shows a close-up view of the device.



FIG. 7 shows a further schematic of the device.



FIG. 8 shows the structures of the most commonly used OP insecticides showing the presence of P═O and P═S bonds which determine their bimolecular rate constants and toxicity against rHuCES. It should be noted that currently omethoate is the only exception in that it has a P═O bond and a low ki (101 M−1·min−1) against CES possibly related to the leaving group slowing the reaction or a steric hindrance effect. A carbamate is included since they also inhibit AChE and CES.





DETAILED DESCRIPTION OF THE INVENTION

Before describing the present invention in detail, it is to be understood that this invention is not limited to particularly exemplified materials or process parameters as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments of the invention only and is not intended to be limiting of the use of alternative terminology to describe the present invention.


All publications, patents and patent applications cited herein, whether supra or infra, are hereby incorporated by reference in their entirety for all purposes.


A. Definitions

As used in this specification and the appended claims, the singular forms “a,” “an” and “the” include plural nouns unless the content clearly dictates otherwise. For example, reference to “a polypeptide” includes a mixture of two or more such polypeptide molecules or a plurality of such polypeptide molecules. Similarly, reference to a “polynucleotide” includes a mixture of two or more such polynucleotide molecules or a plurality of such polynucleotide molecules.


As used herein, the term “comprise” or variations thereof such as “comprises” or “comprising” are to be read to indicate the inclusion of any recited integer (e.g. a feature, element, characteristic, property, method/process step or limitation) or group of integers (e.g. features, element, characteristics, properties, method/process steps or limitations) but not the exclusion of any other integer or group of integers. Thus, as used herein, the term “comprising” is inclusive and does not exclude additional, unrecited integers or method/process steps.


In embodiments of any of the compositions and methods provided herein, “comprising” may be replaced with “consisting essentially of” or “consisting of”. The phrase “consisting essentially of” is used herein to require the specified integer(s) or steps as well as those which do not materially affect the character or function of the claimed invention. As used herein, the term “consisting” is used to indicate the presence of the recited integer (e.g. a feature, element, characteristic, property, method/process step or limitation) or group of integers (e.g. features, element, characteristics, properties, method/process steps or limitations) alone.


As used herein, “OP/C” is used to define an organophosphorus or carbamate insecticide or nerve agent. Representative examples of OP/Cs include, but are not limited to:

    • (a) an insecticide selected from: acephate, aldicarb (Temik, AgLogic 15G), carbachol, carbamate, carbaryl (Sevin), carbofuran (Furadan), carisoprodol, chlorfenvinphos, Chlorophyrifos-oxon, Chlorphyrifos, Dementon-S, Diazoxon, diazinon, Dichlorvos, dicrotophos, dimethoate, dithiocarbamates, EA-3990, eserine, ethienocarb, ethoprophos, ethyl carbamate, felbamate, fenobucarb, fenamiphos, isocarbophos, Malathion, mebutamate, meprobamate, Methamidaphos, methomyl, methyl carbamate, methyl parathion, Methyl-PDX, monocrotophos, naled, neostigmine, omethoate, oxamyl, Paraoxon, Parathion, phorate, phosmet, phosphamidon, rivastigmine, T-1123, terbufos, tetrachlorvinphos, Tetriso, thiocarbamates (e.g., O-thiocarbamate or S-thiocarbamates), triazophos, and/or tybamate;
    • (b) a G agent, such as Tabun (GA), Sarin (GB), Chlorsarin (GC), Soman (GD), methylsarin, n-butylsarin, iso-butylsarin, n-propylsarin, ethylsarin (GE), and/or cyclosarin (GF), GV;
    • (c) a V agent, such as EA-3148, VE, VG, VM, VP, VR, VS, and/or VX; and/or
    • (d) a Novichok Agent, such as A-234.


As all OP/Cs work by inhibiting the ability of an OP/C Detecting Enzyme to convert the first substrate, the OP/C can be detected using the same colorimetric assay described herein.


Although not formally classified as OPs, the mechanism of inhibiting AChE also occurs with carbamate insecticides/nerve agents. Thus, the device described herein can also be used to detected carbamate agents, including carbamate and/or carbamate insecticides/nerve agents. Examples of such agents include, but are not limited to: aldicarb (Temik), carbofuran (Furadan), carbaryl (Sevin), ethienocarb, fenobucarb, oxamyl, methomyl, T-1123, EA-3990, ethyl carbamate, methyl carbamate, neostigmine, rivastigmine, meprobamate, carisoprodol, felbamate, mebutamate, tybamate, carbachol, thiocarbamates (e.g., O-thiocarbamate, S-thiocarbamates), and/or dithiocarbamates. As used herein, “OP” or “OPs” will include carbamate insecticides/nerve agents.


As used herein, an “OP/C Detecting Enzyme” refers to is (a) a hydrolase; (b) a lipase, a phosphatase, an amylase, a cellulase, a protease, a peptidase, a urease or a deaminase; (c) a carboxylesterase (CES), acetylcholinesterase (AChE), butyrylcholinesterase (BChE), organophosphorus hydrolase or organophosphorus acid anhydrolase; (d) CES1 or CES2; (d) selected from Tables 2-5; or (e) an OP/C Detecting Enzyme Variant having at least 70%, at least 75%, at least 80%, at least 85%, at least 90, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the OP/C Detecting Enzyme amino acid sequence of (a)-(d). As described herein the OP/C Detecting Enzyme Variant both (1) retains the ability to convert the first substrate into acetic acid; and (2) maintains that ability to be inhibited by an OP/C. As the sequences for these families of enzymes are known and published in public databases, they have not been included in the present specification, yet are hereby incorporated by reference in their entirety if necessary. Particularly, in preferred embodiments, the term “OP/C Detecting Enzymes” also includes variants of such CES, AChE, or BChE enzymes so long as the variant (a) has at least 70%, at least 75%, at least 80%, at least 85%, at least 90, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the amino acid sequence from which is was derived, (b) retains the ability to convert the first substrate into acetic acid and (c) maintains that ability to be inhibited by an OP/C. Those skilled in the art will readily acknowledge that the method according to this invention is not limited to any single enzymes or enzyme family and can generally be applied to enzymes that catalyze a first reaction that leads to a pH decrease. Thus, the device can be used for diverse reactions and enzymes including but not limited to hydrolases and oxidoreductases.


In preferred embodiments, the OP/C Detecting Enzyme: (a) can detect at least 10 ug, at least 20 ug, at least 30 ug, at least 40 ug, at least 50 ug, at least 60 ug, at least 70 ug, at least 80 ug, at least 90 ug or at least 100 ug of an OP/C compound; (b) can detect between 10-100 ug, between 20-100 ug, between 30-100 ug, between 40-100 ug, between 50-100 ug, between 60-100 ug, between 70-100 ug, between 80-100 ug, between 90-100 ug of an OP/C compound; (c) comprises an inhibition rate constant ki of at least 103 M−1·min−1 to 108 M−1·min−1, at least 104M−1·min−1 to 108M−1·min−1, at least 105 M−1·min−1 to 108M−1·min−1, at least 106 M−1·min−1 to 108M−1·min−1 , or at least 107 M−1·min−1 to 108M−1·min−1; and/or (d) comprises an inhibition rate constant ki of 103-105 M−1·min−1, ki of 104-105 M−1·min−1, 105-106 M−1·min−1, 106 M−1·min−1 to 107 M−1·min−1, or 106 M−1·min−1 to 108 M−1·min−1.


As used herein, when an OP/C is classified as “not detected” by the device as described herein, there still may be very low amounts of OP/C present on the surface. However, the amount is at a level that is below the limit of detection of the device.


As used herein “baseline pH” refers to the pH or pH change in the absence of any inhibitor of the first enzyme, i.e. the OP/C Detecting Enzyme. This baseline pH is set by the two reactions occurring within the device upon release of the buffer from the ampoule. Conversion of the first substrate by the first enzyme acidifies, i.e. decreases the pH the reaction buffer, and conversion of the second substrate by the second enzymes basifies, i.e. increases the reaction buffer. The reaction rates for the first and second reaction are chosen such that the overall change of the pH is zero (idealized) or decreases slightly, and the pH responsive molecule, e.g. the halochromic chemical compound (pH indicator), does not change its optical properties. However, in the presence of an inhibitor of the first enzyme, the reaction rate of the first reaction, and thus the acidification (decrease of the pH) due to conversion of the first substrate is reduced, thus resulting in a net increase in pH evidenced by the color change of the pH indicator. The speed and degree of the color change reflect the inhibition kinetics and the bimolecular rate constant (ki) of the first enzyme for the OP/C and amount of inhibitor present, i.e. OP/C pesticide for an OP/C Detecting Enzyme. In preferred embodiments, the increase in pH is indicated when at least 0.5, at least 1.0, at least 2.0, or at least 3.0 pH levels have been obtained. And in preferred embodiments, a product of the second reaction is ammonia.


As used herein, a “CES” is enzyme classified as a carboxylesterase, which is a well-studied, multigene family of enzymes (E.C. 3.1.1.1) broadly found in organisms ranging from bacteria to mammals. These enzymes are members of the serine hydrolase superfamily, in which a serine residue is involved in the hydrolysis of ester, amide, or carbamate bonds. See, e.g., Sogorb M A, Vilanova E. “Enzymes involved in the detoxification of organophosphorus, carbamate and pyrethroid insecticides through hydrolysis,” Toxicol. Lett. (2002) 128:215-228. Organophosphate, carbamate, and pyrethroid insecticides are metabolized by CES. The OP/C binding site acyl-binding poket (Hopkins et al, Biochemistry (2017) 56:5512-5525). A recent genomic analysis defined five distinct mammalian CES subfamilies (Williams et al. 2010) based on the genetic sequence and genomic structure, with CES1 and CES2 subfamily proteins being most extensively studied. There are significant sequence similarities for the five CES families, especially for key regions previously identified for human liver CES1 (Bencharit et al. 2003, 2006; Fleming et al. 2005). Three-dimensional structural analyses of human CES1 have identified three major ligand binding sites, including the broad-specificity active site, the “side door,” and the “Z-site,” where substrates, fatty acids, and cholesterol analogs, respectively, are bound; and an active site ‘gate’, which may facilitate product release following catalysis (Bencharit et al. 2003, 2006; Fleming et al. 2005). The OP/C binding site acyl-binding pocket See, e.g., Holmes et al., Mamm. Genome. 2010 Oct; 21(9-10): 427-441 for further description of amino acid conservation between CES subfamilies, crystal structure, and conserved amino acids between different species of CES (herein incorporated by reference in its entirety). As used herein, any known CES enzymes (see, for example FIG. 2, Table 2, and/or the enzymes described in Holmes et al.) can be included in the device described herein and used to detect OP, as well as variants of such known CES enzymes that retain carboxylesterase activity. In preferred embodiments CES1 or CES2 enzymes (including variants) are used.


As used herein “AChE” refers to the class of proteins referred to as acetyl cholinesterase and “BChE” refers to the class of proteins referred to as butyrylcholinesterase (“BChE”) (classified as EC 3.1.1.7 and EC 3.1.1.8 respectively). The 3D structure of acetylcholinesterase has been determined and published. [e.g., PMID: 1678899]. This protein has a 3-layer alpha-beta-alpha sandwich fold common to members of the alpha/beta hydrolase family. Surprisingly, given the high turnover number of acetylcholinesterase, the active site of these enzymes has been determined to be located at the bottom of a deep and narrow cleft, named the active-site gorge. As used herein, any known AChE/BChE enzyme can be included in the device described herein and used to detect OP, as well as variants of such known AChE/BChE enzymes. Representative examples of such AChE/BChE enzymes are shown in Tables 2-5 and FIG. 2.


As used herein, a “first substrate” is used to refer to a molecule that can be enzymatically converted into an acid by the first enzyme, e.g. an OP/C Detecting Enzyme. Representative examples of a first substrate include, but are not limited to acetylcholine, acetylthiocholine, butyrylcholine, butyrylthiocholine, 4-nitrophenyl acetate, 4-nitrophenyl propionate, 4 -nitrophenyl butyrate, 4-nitrophenyl valerate, 4-nitrophenyl dimethylacetate, 4-nitrophenyl trimethylacetate, 4-nitrophenyl 4-guanidinobenzoate, or 6-nitrocoumarin. See, for example, Williams et al., Drug Metabolism and Disposition, Vol. 39, No. 12 (2011) (incorporated by reference in its entirety).


As used herein a “pH Sensitive Dye” refers to an indicator composition that is capable of undergoing an observable change of state (for example, a change in optical properties/color) as a result of the reactions taking place within the device. Preferably, such a dye changes optical properties in a manner that is visible to the human eye. Examples of pH-sensitive dyes include, but are not limited to: nitrazine, phenol red, chlorophenol red, bromocresol green, cresol red, bromomethyl blue, or bromocresol purple. The degree of color change can be correlated to the amount of conversion of the first substrate. Therefore, color change of varying degree not only indicates the presence of an OP/C, but also the inhibition kinetics and the quantity of OP/C present.


As described herein, the conversion of the second substrate by the second enzyme results in basification of the reaction buffer (i.e., the act or process of making something more basic resulting in the raising of the pH of something). Representative examples of a second substrate and second enzyme include, but are not limited to urea and urease (classified as EC 3.5.1.5), urea and urea amidolyase (classified as EC 6.3.4.6 and EC 3.5.1.54), biuret and biuret amidohydrolase (classified as EC 3.5.1.84), [beta-hydroxypyruvate+glycolaldehyde] and transketolase (classified as EC 2.2.1.1, with representative examples of substrates being: D-fructose 6-phosphate, D-glyceraldehyde 3-phosphate, D-ribose 5-phosphate, or D-xylulose 5-phosphate), adenosine and adenosine deaminase (classified as EC3.5.4.4), adenine and adenine deaminase (classified as EC 3.5.4.15), guanosine and guanosine deaminase (classified as EC 3.5.4.15), guanine and guanine deaminase (classified as EC 3.5.4.3), cytosine and cytosine deaminase (classified as EC 3.5.4.5).


As used herein, an “Oxidizer” is used to refer to a molecule capable of converting an inactive phosphorothionate “thion” or carbamate form of an OP/C into an active (e.g. axon) form (see FIG. 8). Representative examples of an Oxidizer but are not limited: to Fenton, a halogen (e.g. iodine, bromine, chlorine and fluorine), or a P450 enzyme in the presence of the cofactor NADPH. Preferred example of P450 enzyme is a triple mutant of CYP1A2 (P450 BM-3 (CYP102-A1).


In the present invention, a “polynucleotide” refers to the phosphate ester polymeric form of ribonucleosides (adenosine, guanosine, uridine or cytidine; “RNA molecules”) or deoxyribonucleosides (deoxyadenosine, deoxyguanosine, deoxythymidine, or deoxycytidine; “DNA molecules”), or any phosphoester analogs thereof, such as phosphorothioates and thioesters, in either single stranded form, or a double-stranded helix. Double stranded DNA-DNA, DNA-RNA and RNA-RNA helices are possible. The term nucleic acid molecule, and in particular DNA or RNA molecule, refers only to the primary and secondary structure of the molecule, and does not limit it to any particular tertiary forms. Thus, this term includes double-stranded DNA found, inter alia, in linear (e.g., restriction fragments) or circular DNA molecules, plasmids, and chromosomes. In discussing the structure of particular double-stranded DNA molecules, sequences may be described herein according to the normal convention of giving only the sequence in the 5′ to 3′ direction along the non-transcribed strand of DNA (i.e., the strand having a sequence homologous to the mRNA). A “recombinant DNA molecule” is a DNA molecule that has undergone a molecular biological manipulation.


The terms “percent (%) sequence similarity”, “percent (%) sequence identity”, and the like, generally refer to the degree of identity or correspondence between different nucleotide sequences of nucleic acid molecules or amino acid sequences of polypeptides that may or may not share a common evolutionary origin (see Reeck et al., supra). Sequence identity can be determined using any of a number of publicly available sequence comparison algorithms, such as BLAST, FASTA, DNA Strider, GCG (Genetics Computer Group, Program Manual for the GCG Package, Version 7, Madison, Wis.), etc.


To determine the percent identity between two amino acid sequences or two nucleic acid molecules, the sequences are aligned for optimal comparison purposes. The percent identity between the two sequences is a function of the number of identical positions shared by the sequences (i.e., percent identity=number of identical positions/total number of positions (e.g., overlapping positions)×100). In one embodiment, the two sequences are, or are about, of the same length. The percent identity between two sequences can be determined using techniques similar to those described below, with or without allowing gaps. In calculating percent sequence identity, typically exact matches are counted.


The determination of percent identity between two sequences can be accomplished using a mathematical algorithm. A non-limiting example of a mathematical algorithm utilized for the comparison of two sequences is the algorithm of Karlin and Altschul, Proc. Natl. Acad. Sci. USA 1990, 87:2264, modified as in Karlin and Altschul, Proc. Natl. Acad. Sci. USA 1993, 90:5873-5877. Such an algorithm is incorporated into the NBLAST and XBLAST programs of Altschul et al, J. Mol. Biol. 1990; 215: 403. BLAST nucleotide searches can be performed with the NBLAST program, score=100, wordlength=12, to obtain nucleotide sequences homologous to sequences of the invention. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3, to obtain amino acid sequences homologous to protein sequences of the invention. To obtain gapped alignments for comparison purposes, Gapped BLAST can be utilized as described in Altschul et al, Nucleic Acids Res. 1997, 25:3389. Alternatively, PSI-Blast can be used to perform an iterated search that detects distant relationship between molecules. See Altschul et al. (1997) supra. When utilizing BLAST, Gapped BLAST, and PSI-Blast programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. See ncbi.nlm.nih.gov/BLAST/ on the WorldWideWeb.


Another non-limiting example of a mathematical algorithm utilized for the comparison of sequences is the algorithm of Myers and Miller, CABIOS 1988; 4: 1 1-17. Such an algorithm is incorporated into the ALIGN program (version 2.0), which is part of the GCG sequence alignment software package. When utilizing the ALIGN program for comparing amino acid sequences, a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4 can be used.


In a preferred embodiment, the percent identity between two amino acid sequences is determined using the algorithm of Needleman and Wunsch (J. Mol. Biol. 1970, 48:444-453), which has been incorporated into the GAP program in the GCG software package (Accelrys, Burlington, Mass.; available at accelrys.com on the WorldWideWeb), using either a Blossum 62 matrix or a PAM250 matrix, a gap weight of 16, 14, 12, 10, 8, 6, or 4, and a length weight of 1, 2, 3, 4, 5, or 6. In yet another preferred embodiment, the percent identity between two nucleotide sequences is determined using the GAP program in the GCG software package using a NWSgapdna.CMP matrix, a gap weight of 40, 50, 60, 70, or 80, and a length weight of 1, 2, 3, 4, 5, or 6. A particularly preferred set of parameters (and the one that can be used if the practitioner is uncertain about what parameters should be applied to determine if a molecule is a sequence identity or homology limitation of the invention) is using a Blossum 62 scoring matrix with a gap open penalty of 12, a gap extend penalty of 4, and a frameshift gap penalty of 5.


In the present invention, “isolated polypeptide” means the polypeptide is separated from its environment and present in sufficient quantity to permit its identification or use. Isolated polypeptides include recombinantly produced polypeptides. This means, for example, the polypeptide may be (i) selectively produced by expression cloning or (ii) purified by chromatography or electrophoresis. Isolated proteins or polypeptides may be, but need not be, substantially pure. Because an isolated polypeptide may be admixed with a pharmaceutically acceptable carrier in a pharmaceutical preparation, the polypeptide may comprise only a small percentage by weight of the preparation. The polypeptide is nonetheless isolated in that it has been separated from the substances with which it may be associated in living systems, e.g., isolated from other proteins. Any of the peptides or polypeptides provided herein may be isolated.


B. Device

As described herein the “device” is designed to contain all sensing components in a self-enclosed system which is substantially simpler to manufacture and use as compared to the ten or more components used for other pens currently on the market to detect nerve agents. This innovation provides for an efficient, small, inexpensive, hand-held device for rapid, sensitive and specific detection of OP/C.


As shown in FIG. 3, the device described herein comprise the following components: a first carrier material (100) which fits into a top piece (110). An ampoule (120) is contained within and protected by a middle piece (130) which attaches to a bottom piece (140). The ampoule can be optionally be also within the bottom piece. The device can optionally also comprise a separate cap or lid, alternatively, as shown in FIG. 3, the top piece (110) can be manufactured to include a cap or lid. Besides the ampoule (120), the middle piece (130) also houses a second carrier material (not shown).


The substrates and enzymes that are used to detect the OP/C can be configured differently within the device. For example, the substrates, enzymes and pH sensitive dye can be configured in the following different embodiments based on intended use. For example, short term storage can allow for the enzymes, substrates and/or dyes to be included in the ampoule. In contrast, long term storage would have a preferred configuration where only the buffer would be included in the ampoule. In further preferred embodiments, the matching substrates and enzymes should not be configurated in the same location within the device.











TABLE 1





First carrier material
Ampoule
Second carrier materials







1st Enzyme (1)
Buffer
2nd Enzyme




1st and 2nd substrate




pH Dependent Dye


1st Enzyme
Buffer
2nd Enzyme


pH Dependent Dye

1st and 2nd substrate


1st Enzyme
Buffer
2nd Enzyme



pH Dependent Dye
1st and 2nd substrate


1st and 2nd Enzyme
Buffer
1st and 2nd substrate




pH Dependent Dye


1st and 2nd Enzyme
Buffer
1st and 2nd substrate


pH Dependent Dye


1st and 2nd Enzyme
Buffer
1st substrate


pH Dependent Dye
2nd substrate


1st and 2nd Enzyme
Buffer
2nd substrate


pH Dependent Dye
1st substrate


1st and 2nd Enzyme
Buffer
Empty


pH Dependent Dye
1st and 2nd substrate


1st Enzyme
Buffer
1st and 2nd substrate



pH Dependent Dye


1st and 2nd Enzyme
Buffer
1st and 2nd substrate



pH Dependent Dye


1st Enzyme
Buffer
1st substrate



2nd substrate
2nd Enzyme




pH Dependent Dye


1st Enzyme
Buffer
1st substrate


pH Dependent Dye
2nd substrate
2nd Enzyme


1st Enzyme
Buffer
1st substrate



2nd substrate
2nd Enzyme



pH Dependent Dye


1st and 2nd Enzyme
Buffer
1st substrate



2nd substrate
pH Dependent Dye


2nd Enzyme
Buffer
1st Enzyme




1st and 2nd substrate




pH Dependent Dye


2nd Enzyme
Buffer
1st Enzyme


pH Dependent Dye

1st and 2nd substrate


2nd Enzyme
Buffer
1st Enzyme



pH Dependent Dye
1st and 2nd substrate


2nd Enzyme
Buffer
1st Enzyme



2nd substrate
1st substrate




pH Dependent Dye


2nd Enzyme
Buffer
1st Enzyme


pH Dependent Dye
2nd substrate
1st substrate


pH Dependent Dye
Buffer
1st and 2nd Enzyme


1st Enzyme
Buffer
pH Dependent Dye



1st and 2nd substrate
2nd Enzyme






(1) e.g. OP/C detecting Enzyme







Within the context of this invention the term “buffer” means a composition (any combination) of water +/− solutes (including salts including but not limited to NaCl, KCl, MgSO4, CaCl, NiCl2, CuCl2) a pH buffering compound (including salts including but not limited to Tris, MES, HEPES, Phosphate, Citrate), a reducing agent or anti-oxidant (2-ME, DTT, Na2S2O5, ascorbic acid, glutathione, Cystine), an excipient (glucose, sucrose, glycerol, mannitol, proline, arginine, trehalose, erythritol, imidazol), a detergent (Tween-20, Tween-80, Triton-X100, Triton-X114, deoxycholic acid, maltoside, octyl-thioglucoside, CHAPS), a stabilizer (polyvinylpyrrolidone, chitosan, gelatin, elastin-like peptides, PEG, dendrimers, serum albumin, radical scavengers, Butylated hydroxytoluene, alkylated diphenylamine), preservative (benzoic acid, sulfur dioxide, gallic acid) or chelators of metal ions (ETDA, EGTA).


For example, the substrates and colorimetric reporters are dried onto the second carrier housed in the middle piece (130), along with a glass ampoule (120) filled with dilute buffer. The enzymes (either the OP/C Detecting Enzyme and/or the second enzyme) can be immobilized covalently or non-covalently on the first carrier material (100). The carrier materials (either the first and/or the second carrier material) can be a natural polymer, including but not limited to cellulose, hemicellulose, pectin, chitin, silk, lignin, starch, polypeptides, collagens, keratins, polysaccharides, nucleic acids, and/or rubbers; or (b) derivatives of natural polymers, including but not limited to methylation, carboxylation, amidation, sulfation, hydroxylation, condensation, iodination, reduction, oxidation, esterification, alkylation, and/or halogenation; and/or (c) synthetic polymers and copolymers, including but not limited to polyurethanes, thermoplastic polyurethanes, silicones, polyamides, polystyrenes, bakelite, polyethylene, polypropylene, polyvinyl chloride, Polytetrafluoroethylene, Polychloroprene, and/or polyimides) separated by the top piece (110) at the top of the device. In one embodiment, the OP/C Detecting Enzyme and, optionally, the pH Dependent Dye are incorporated into the polymer matrix of the first carrier material during synthesis of the polymer, For example, if polyurethane is used, the first carrier material can be formed by mixing water, the OP/C Detecting Enzyme, optionally the pH Dependent Dye, and an isocyanate functionalized polyurethane prepolymer, which incorporates the OP/C Detecting Enzyme, optionally the pH Dependent Dye into the polymer network, See, for example, U.S. Pat. No. 6,291,200 (incorporated by reference in its entirety),


In a further embodiment, the second carrier material can comprise lyophilized substrate(s) and enzyme(s), for example, in the form of a powder, film or tablet. In another embodiment, the substrate(s), pH dependent dye and/or the enzyme(s) can be spatially separated on the second carrier material, for example, by drying the components on separate pieces. In yet another embodiment, the second carrier material can be comprised of two or more materials, for example, two different filter papers, or a filter paper and a tablet, or two different tablets.


To employ, the user simply activates the chemistry by, in preferred embodiments, cracking the ampoule (120) and dissolving and mixing the components, then shaking the device or optionally pressing a valve which wets the first carrier material (100). The user then simply removes the cap and wipes the top piece of the device on the contaminated surface. Alternatively, the first carrier material (100) (with open cap) can be wiped on the wet or wetted surface, the cap be closed, the ampoule be cracked, the released components be mixed and distributed by shaking, followed by observation of the color change.


The user can then replace the cap and monitor the color of the first carrier material (100) for up to 5, 10, 15, etc. minutes to detect any color change. Ideally, the entire system is self-contained, with no waste or leaks, and presents virtually no hazard to the user. Further, because the first carrier material (100) is made up of an adsorptive material it can effectively pick up OPs from the surface with very high efficiency. The device leverages the high selectivity of the enzyme system for the OP/C inhibitor while ignoring nearly all environmental interferents, and also provides a nearly thousand-fold amplification of signal thanks to the unique dynamic buffering equilibrium response mechanism.


In preferred embodiments, the device is 68 mm high×50 mm wide. In the final optimized pen, some of the enzymes, substrates, ampoule and dye may be in different compartments but the chemistry may be the same.


To deploy and activate the chemistry the user simply breaks the ampoule (120) by holding the middle piece (130) with one hand and twisting the bottom piece (140) 90 degrees with the other hand; dissolving the chemicals contained in the second carrier material, e.g., dried paper (urea, a pH sensitive colorimetric yellow to red dye, and enzyme substrates e.g. 4-nitrophenol acetate (4-NPA). After cracking the ampoule (120), the device is inverted, and gravity and some gentle shaking mixes the buffer with the second carrier material containing the substrates and then the first carrier material (100) with embedded OP/C Detecting Enzyme while the cap is still on. The user then opens the cap, swabs the contaminated surface with the inverted pen; pressing down on the first carrier material (100) several times to wet the first carrier material (100) and ensure proper sampling. The cap is replaced, and the color of the first carrier material is monitored for 5 -10 minutes to detect any change. The entire system is self-contained, with no waste or leaks, and presents virtually no hazard to the user. Further, the first carrier material is made of adsorptive material for the chemicals and picks them up from the surface with very high efficiency. The device leverages the high selectivity of the enzyme system for the OP/C inhibitor while ignoring nearly all environmental interferents, and also provides a nearly thousand-fold amplification of signal thanks to the unique dynamic buffering equilibrium response mechanism


C. Reaction used to Detect OP/C


In the absence of OP/Cs, the device relies on an enzymatic reaction catalyzed by an OP/C Detecting Enzyme on a first substrate resulting in acidic reaction products to decrease the pH. At the same time, the second reaction system comprising the second enzyme and a second substrate produces basic reaction products which increase pH. The reaction rates of the first and second reaction are adjusted such that the net change of the pH is zero or decreases slightly. This sets the baseline pH. However, if OPs are present on a surface and transferred to the first carrier material of the device, the OP/C Detecting Enzyme is inhibited and unable to convert the first substrate and thereby decrease the pH. Thus, inhibition of the OP/C Detecting Enzyme by a pesticide or OP/C results in a net increase of the pH of the system over the baseline pH. By a pH Dependent Dye in the device, a change in pH can be reported by a change in color.


For example, U.S. Pat. No. 6,861,252 (hereby incorporated by reference in its entirety) teaches that a pH responsive colorimetric dye rapidly changes from yellow to red when OP/C nerve agents are detected (see, for example, FIG. 2 of this patent). When the OP/C Detecting Enzyme (this patent exemplifies AChE) is inhibited by an OP, substrate hydrolysis and the concurrent decrease in pH shuts off, and the base-producing second enzyme continues to make ammonia driving the system pH dramatically from e.g. 5 to 8. A colorimetric pH-responsive dye (pKa 6.5) is in turn titrated from yellow to red, providing a localized visual assessment of the presence of the OP/C. As described herein, this colorimetric reaction can be used in combination with the device to detect OP/C.


As a further example, nitrazine yellow dye can be used in the device described herein to detect OPs. For example, a nitrazine yellow dye can be incorporated into the first carrier material making up the first carrier material. In preferred embodiments, the synthesized first carrier material has a dye content of approximately 0.4 mg dye/g dry polymer. Physical property differences clearly visible to the naked human eye occur when the polymers were incubated within aqueous solutions of varying pH. The color of the samples ranges from bright orange at pH 6.5 to blue at pH 9.0. Distinctions in color were clearly discernable to the naked eye between each of samples exposed to a pH of 6, 6.4, 6.8, 7.2, 7.6, 8, 8.5 and 9. The series of colors observed in the polymers of the present invention was the same as the series of colors that is produced by suspending the soluble dye within aqueous solution (e.g., in the Ampoule (120)) over the same pH range.


Moreover, one approach proposed in this application is the use of CES rather than AChE or BChE as the OP/C Detecting Enzyme. We have found that the inhibition constants for OP/C insecticides are much higher (100-1000 fold) for CES than for AChE. Thus, CES enzymes are preferably used in the device to detect OP/C insecticides.


Additionally, variants can be created using standard mutational tools to generate improved variants that have improved sensitivity to different forms of OP/C insecticides so as to be inhibited at lower concentrations of the OP/C pesticides as compared to the protein from which the variant is derived. For example, enzymes and proposed mutants that can be used to detect OP/C pesticides are selected from:

    • a. Wild type carboxylesterase αE7 from the Australian blow fly Lucilia cuprina (LcΕE7);
    • b. mutant form of LcαE7G137D
    • c. LcαE7 mutants E183, K275, E78 and/or E292
    • d. Wild type AChE;
    • e. Mutant AChE, such as as rHuAChE containing two mutations in the acyl pocket residues (F295L, F297V);
    • f. Carboxylesterase (Cqestβ2) from the Culex quinquefasciatus mosquito
    • g. Any one of the enzymes listed in Tables 2-5.


Specially, one approach is to produce the blow fly wild type CES LcαE7 and mutated forms of LcαE7 (e.g, LcαE7G137D). See, GenBank Accession Q25252_LUCCU for wildtype sequence. It should be noted that recombinant LcαE7 produced in the E. coli system is monomeric and dimeric while native human CES is trimeric. To examine how trimerization occurs, crystal structures of trimeric human CES produced in HEK293-derived hCES1 have been studied by de Sousa et al. which revealed that trimers were generated by the space group symmetry with the K78:E183 and K275:E292 salt bridges. Since the LcαE7 sequence contains the E183 and K275 but not the E78 or E292, a mutant of LcαE7 expressing all four of these amino acids have been produced in order to generate trimers with potentially increased stability.









TABLE 2







Enzymes Classified as EC 3.1.1.8










Entry
Entry name
Protein names
Organism





Q95000
CHLE1_BRALA
Cholinesterase 1 (Fragment)

Branchiostoma lanceolatum (Common






lancelet) (Amphioxus lanceolatum)


Q95001
CHLE2_BRALA
Cholinesterase 2 (Fragment)

Branchiostoma lanceolatum (Common






lancelet) (Amphioxus lanceolatum)


P06276
CHLE_HUMAN
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Homo sapiens (Human)





(Choline esterase II) (Pseudocholinesterase)


P32751
CHLE_MACMU
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Macaca mulatta (Rhesus macaque)





(Choline esterase II) (Pseudocholinesterase) (Fragment)


Q5UR02
CHLE_MIMIV
Probable cholinesterase (Acylcholine acylhydrolase)
Acanthamoeba polyphaga mimivirus (APMV)


P32749
CHLE_BOVIN
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Bos taurus (Bovine)





(Choline esterase II) (Pseudocholinesterase)


P32750
CHLE_CANLF
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Canis lupus familiaris (Dog) (Canis familiaris)





(Choline esterase II) (Pseudocholinesterase) (Fragment)


O62760
CHLE_FELCA
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Felis catus (Cat) (Felis silvestris catus)





(Choline esterase II) (Pseudocholinesterase)


P81908
CHLE_HORSE
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Equus caballus (Horse)





(Choline esterase II) (EQ-BCHE) (Pseudocholinesterase)


Q03311
CHLE_MOUSE
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Mus musculus (Mouse)





(Choline esterase II) (Pseudocholinesterase)


O62761
CHLE_PANTT
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Panthera tigris tigris (Bengal tiger)





(Choline esterase II) (Pseudocholinesterase)


P32752
CHLE_PIG
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Sus scrota (Pig)





(Choline esterase II) (Pseudocholinesterase) (Fragment)


P21927
CHLE_RABIT
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Oryctolagus cuniculus (Rabbit)





(Choline esterase II) (Pseudocholinesterase)


P32753
CHLE_SHEEP
Cholinesterase (Acylcholine acylhydrolase) (Butyrylcholine esterase)

Ovis aries (Sheep)





(Choline esterase II) (Pseudocholinesterase) (Fragment)
















TABLE 3







Enzymes Classified as EC 3.1.1.1











Entry
Entry name
Protein names
Gene names
Organism





A1CFK9
PATB_ASPCL
Carboxylesterase patB (Patulin synthesis
patB ACLA_093570

Aspergillus clavatus





protein B)

(strain ATCC 1007/CBS






513.65/DSM 816/NCTC






3887/NRRL 1)


A0A075TXZ3
PATB_PENEN
Carboxylesterase patB (Patulin
patB PEX2_082800

Penicillium expansum





biosynthesis cluster protein B)

(Blue mold rot fungus)


D4AV38
LIP4_ARTBC
Probable secreted lipase ARB_00047
ARB_00047

Arthroderma benhamiae







(strain ATCC MYA-4681/






CBS 112371)






(Trichophyton mentagrophytes)


Q4F883
SG101_ARATH
Senescence-associated carboxylesterase
SAG101 At5g14930

Arabidopsis thaliana





101
F2G14.50
(Mouse-ear cress)


O31452
YBFK_BACSU
Carboxylesterase YbfK
ybfK BSU02260

Bacillus subtilis (strain 168)



Q8VCT4
CES1D_MOUSE
Carboxylesterase 1D (Carboxylesterase
Ces1d Ces1 Ces3

Mus musculus (Mouse)





3) (EC 3.1.1.67) (Fatty acid ethyl ester




synthase) (FAEE synthase)




(Triacylglycerol hydrolase) (TGH)


P16303
CES1D_RAT
Carboxylesterase 1D (Carboxyesterase
Ces1d Ces3

Rattus norvegicus (Rat)





ES-10) (Carboxylesterase 3) (EC




3.1.1.67) (ES-HVEL) (Fatty acid ethyl




ester synthase) (FAEE synthase) (Liver




carboxylesterase 10) (pl 6.1 esterase)


Q91WU0
CES1F_MOUSE
Carboxylesterase 1F (Carboxylic ester
Ces1f CesML1

Mus musculus (Mouse)





hydrolase) (Triacylglycerol hydrolase 2)




(TGH-2)


Q9SMM9
CXE13_ARATH
Probable carboxylesterase 13 (AtCXE13)
CXE13 At3g48700

Arabidopsis thaliana






T8P19.210
(Mouse-ear cress)


Q9LVB8
CXE20_ARATH
Probable carboxylesterase 120
CXE20 At5g62180

Arabidopsis thaliana





(AtCXE20)
MMI9.26
(Mouse-ear cress)


Q9SX78
CXE2_ARATH
Probable carboxylesterase 2 (AtCXE2)
CXE2 At1g47480

Arabidopsis thaliana






F16N3.25
(Mouse-ear cress)


Q9FX92
CXE3_ARATH
Probable carboxylesterase 3 (AtCXE3)
CXE3 At1g49640

Arabidopsis thaliana






F14J22.12
(Mouse-ear cress)


Q9FG13
CXE15_ARATH
Probable carboxylesterase 15 (AtCXE15)
CXE15 At5g06570

Arabidopsis thaliana






F15M7.10
(Mouse-ear cress)


Q9FX93
CXE4_ARATH
Probable carboxylesterase 4,
CXE4 At1g49650

Arabidopsis thaliana





mitochondrial (AtCXE4)
F14J22.21
(Mouse-ear cress)


Q9LK21
CXE11_ARATH
Probable carboxylesterase 11 (AtCXE11)
CXE11 At3g27320

Arabidopsis thaliana






K17E12.14
(Mouse-ear cress)


Q9SMN0
CXE12_ARATH
Probable carboxylesterase 12 (AtCXE12)
CXE12 At3g48690

Arabidopsis thaliana






T8P19.200
(Mouse-ear cress)


Q8LED9
CXE16_ARATH
Probable carboxylesterase 16 (AtCXE16)
CXE16 At5g14310

Arabidopsis thaliana






F18O22.100
(Mouse-ear cress)


Q9LFR7
CXE17_ARATH
Probable carboxylesterase 17 (AtCXE17)
CXE17 At5g16080

Arabidopsis thaliana






F1N13.220
(Mouse-ear cress)


Q9LT10
CXE18_ARATH
Probable carboxylesterase 18 (AtCXE18)
CXE18 At5g23530

Arabidopsis thaliana






MQM1.21
(Mouse-ear cress)


O64641
CXE9_ARATH
Probable carboxylesterase 9 (AtCXE9)
CXE9 At2g45610

Arabidopsis thaliana






F17K2.14
(Mouse-ear cress)


Q0ZPV7
CXE1_ACTER
Carboxylesterase 1 (AeCXE1)
CXE1

Actinidia eriantha







(Velvet vine)






(Actinidia fulvicoma






var. lanata)


Q9LMA7
CXE1_ARATH
Probable carboxylesterase 1 (AtCXE1)
CXE1 At1g19190

Arabidopsis thaliana






T29M8.6
(Mouse-ear cress)


Q9FX94
CXE5_ARATH
Probable carboxylesterase 5 (AtCXE5)
CXE5 At1g49660

Arabidopsis thaliana






F14J22.11
(Mouse-ear cress)


Q9SX25
CXE6_ARATH
Probable carboxylesterase 6 (AtCXE6)
CXE6 At1g68620

Arabidopsis thaliana






F24J5.14
(Mouse-ear cress)


Q9ZQ91
CXE7_ARATH
Probable carboxylesterase 7 (AtCXE7)
CXE7 At2g03550

Arabidopsis thaliana






T4M8.1
(Mouse-ear cress)


O64640
CXE8_ARATH
Probable carboxylesterase 8 (AtCXE8)
CXE8 At2g45600

Arabidopsis thaliana






17K2.13
(Mouse-ear cress)


B3PI89
BIOHC_CELJU
Biotin biosynthesis bifunctional protein
bioC CJA_0428

Cellvibrio japonicus





BioHC [Includes: Carboxylesterase BioH

(strain Ueda107)




(Biotin synthesis protein BioH); Malonyl-

(Pseudomonas fluorescens




[acyl-carrier protein] O-methyltransferase

subsp. cellulosa)




(Malonyl-ACP O-methyltransferase) (EC




2.1.1.197) (Biotin synthesis protein BioC)]


Q21FY5
BIOHC_SACD2
Biotin biosynthesis bifunctional protein
bioC Sde_3137

Saccharophagus degradans





BioHC [Includes: Carboxylesterase BioH

(strain 2-40/ATCC




(Biotin synthesis protein BioH); Malonyl-

43961/DSM 17024)




[acyl-carrier protein] O-methyltransferase




(Malonyl-ACP O-methyltransferase) (EC




2.1.1.197) (Biotin synthesis protein BioC)]


C5BMZ8
BIOHC_TERTT
Biotin biosynthesis bifunctional protein
bioC TERTU_0492

Teredinibacter turnerae





BioHC [Includes: Carboxylesterase BioH

(strain ATCC 39867/




(Biotin synthesis protein BioH); Malonyl-

T7901)




[acyl-carrier protein] O-methyltransferase




(Malonyl-ACP O-methyltransferase) (EC




2.1.1.197) (Biotin synthesis protein BioC)]


Q5NUF3
HIDH_SOYBN
2-hydroxyisoflavanone dehydratase (EC
HIDH Glyma01g45020

Glycine max (Soybean)





4.2.1.105) (Carboxylesterase HIDH)

(Glycine hispida)


Q5NUF4
HIDM_GLYEC
2-hydroxyisoflavanone dehydratase (EC
HIDM

Glycyrrhiza echinata





4.2.1.105) (Carboxylesterase HIDM)

(Licorice)


P81098
SFAH_HELAN
Seed fatty acyl-ester hydrolase


Helianthus annuus





(Fragment)

(Common sunflower)


P23141
EST1_HUMAN
Liver carboxylesterase 1 (Acyl-coenzyme
CES1 CES2 SES1

Homo sapiens (Human)





A:cholesterol acyltransferase) (ACAT)




(Brain carboxylesterase hBr1)




(Carboxylesterase 1) (CE-1) (hCE-1)




(Cocaine carboxylesterase) (Egasyn)




(HMSE) (Methylumbelliferyl-acetate




deacetylase 1) (EC 3.1.1.56)




(Monocyte/macrophage serine esterase)




(Retinyl ester hydrolase) (REH) (Serine




esterase 1) (Triacylglycerol hydrolase)




(TGH)


O46421
EST1_MACFA
Liver carboxylesterase 1
CES1

Macaca fascicularis







(Crab-eating macaque)






(Cynomolgus monkey)


Q64419
EST1_MESAU
Liver carboxylesterase


Mesocricetus auratus







(Golden hamster)


Q5RCL7
EST3_PONAB
Carboxylesterase 3 (Liver
CES3

Pongo abelii





carboxylesterase 31 homolog)

(Sumatran orangutan)






(Pongo pygmaeus abelii)


P81429
EST1_SCHGA
Esterase SG1 (Carboxylic-ester
SG1

Schizaphis graminum





hydrolase) (Fragment)

(Green bug aphid)


Q47M62
EST1_THEFY
Carboxylesterase
Tfu_2427

Thermobifida fusca







(strain YX)


Q64573
EST4_RAT
Liver carboxylesterase 4


Rattus norvegicus (Rat)





(Carboxyesterase ES-4) (Kidney




microsomal carboxylesterase)




(Microsomal palmitoyl-CoA hydrolase)


P25727
EST5A_DROPS
Esterase-5A (Est-5A) (Carboxylic-ester
Est-5A Est5A GA23705

Drosophila pseudoobscura





hydrolase 5A) (Carboxylesterase-5A)


pseudoobscura (Fruit fly)



Q8I034
EST5A_FELCA
Carboxylesterase 5A (Carboxylesterase-
CES5A CES7

Felis catus (Cat)





like urinary excreted protein) (Cauxin)

(Felis silvestris catus)


O00748
EST2_HUMAN
Cocaine esterase (EC 3.1.1.84)
CES2 ICE

Homo sapiens (Human)





(Carboxylesterase 2) (CE-2) (hCE-2)




(Methylumbelliferyl-acetate deacetylase




2) (EC 3.1.1.56)


Q3T930
EST5A_SHEEP
Carboxylesterase 5A (Carboxylesterase-
CES5A CES7

Ovis aries (Sheep)





like urinary excreted protein homolog)




(Cauxin) (Fragment)


O16170
EST5B_DROMI
Esterase-5B (Est-5B) (Carboxylic-ester
Est-5B Est5B

Drosophila miranda





hydrolase 5B) (Carboxylesterase-5B)

(Fruit fly)


Q64176
EST1E_MOUSE
Carboxylesterase 1E (Egasyn) (Liver
Ces1e Es22

Mus musculus (Mouse)





carboxylesterase 22) (Es-22) (Esterase-




22)


Q63108
EST1E_RAT
Carboxylesterase 1E (Carboxyesterase
Ces1e Ces1

Rattus norvegicus (Rat)





ES-3) (ES-HTEL) (Egasyn) (Liver




carboxylesterase 3) (pl 5.5 esterase)


P16854
EST1_CULPI
Esterase B1
B1

Culex pipiens







(House mosquito)


Q6UWW8
EST3_HUMAN
Carboxylesterase 3 (Liver
CES3

Homo sapiens (Human)





carboxylesterase 31 homolog)
UNQ869/PRO1887


Q51758
EST1_PSEFL
Carboxylesterase 1 (Esterase I)
estA
Pseudomonas fluorescens


P10094
EST4_DROMO
Esterase-4 (Fragment)
Est-4 Est4

Drosophila mojavensis







(Fruit fly)


O16173
EST5A_DROPE
Esterase-5A (Est-5A) (Carboxylic-ester
Est-5A Est5A

Drosophila persimilis





hydrolase 5A) (Carboxylesterase-5A)

(Fruit fly)


Q07085
EST2_CAEEL
Esterase CM06B1
F13H6.3
Caenorhabditis elegans


Q6NT32
EST5A_HUMAN
Carboxylesterase 5A (Carboxylesterase-
CES5A CES7

Homo sapiens (Human)





like urinary excreted protein homolog)




(Cauxin)


Q5GRG2
EST5A_RAT
Carboxylesterase 5A (Carboxylesterase-
Ces5a Ces7

Rattus norvegicus (Rat)





like urinary excreted protein homolog)




(Cauxin) (Epididymis-specific gene 615




protein)


Q53547
EST2_PSEFL
Carboxylesterase 2 (Esterase II)
estB
Pseudomonas fluorescens


O16171
EST5C_DROPE
Esterase-5C (Est-5C) (Carboxylic-ester
Est-5C Est5C

Drosophila persimilis





hydrolase 5C) (Carboxylesterase-5C)

(Fruit fly)


P47982
EST6_DROMA
Esterase 6 (Est-6) (Carboxylic-ester
Est-6 est6

Drosophila mauritiana





hydrolase 6) (Carboxylesterase-6)

(Fruit fly)


Q08662
EST6_DROSI
Esterase 6 (Est-6) (Carboxylic-ester
Est-6 est6

Drosophila simulans





hydrolase 6) (Carboxylesterase-6)

(Fruit fly)


O33407
ESTA_PSEAE
Esterase EstA (Autotransporter esterase
estA papA PA5112

Pseudomonas aeruginosa





EstA)

(strain ATCC 15692/






DSM 22644/CIP 104116/






JCM 14847/LMG 12228/






1C/PRS 101/PAO1)


P81012
ESTA_SCHGA
Esterase 52 kDa subunit (Carboxylic-


Schizaphis graminum





ester hydrolase) (Fragment)

(Green bug aphid)


P81011
ESTB_SCHGA
Esterase 56 kDa subunit (Carboxylic-


Schizaphis graminum





ester hydrolase) (Fragment)

(Green bug aphid)


Q9WYH1
ESTD_THEMA
Esterase EstD
estD TM_0336

Thermotoga maritima






THEMA_03040
(strain ATCC 43589/MSB8/





Tmari_0334
DSM 3109/JCM 10099)


A4KX74
ESTE_HVAVE
Putative esterase
ORF19
Heliothis virescens






ascovirus 3e (HvAV-3e)


P35501
ESTE_MYZPE
Esterase E4 (Carboxylic-ester hydrolase)


Myzus persicae







(Green peach aphid)






(Aphis persicae)


Q0E588
ESTE_SFAVA
Putative esterase
ORF13
Spodoptera frugiperda






ascovirus 1a (SfAV-1a)


P18167
ESTP_DROME
Esterase P (Est-P) (Carboxylic-ester
Est-P EstP CG17148

Drosophila melanogaster





hydrolase P) (Carboxylesterase-P)

(Fruit fly)


Q06174
EST_GEOSE
Carboxylesterase
est est30
Geobacillus stearothermophilus






(Bacillus stearothermophilus)


P23953
EST1C_MOUSE
Carboxylesterase 1C (Liver
Ces1c Es1

Mus musculus (Mouse)





carboxylesterase N) (Lung surfactant




convertase) (PES-N)


P10959
EST1C_RAT
Carboxylesterase 1C (Carboxyesterase
Ces1c Es2

Rattus norvegicus (Rat)





ES-1) (E1) (ES-THET) (Esterase-2) (Liver




carboxylesterase 1) (Neutral retinyl ester




hydrolase) (NREH) (Retinyl ester




hydrolase) (REH)


Q04456
EST1_CAEBR
Gut esterase 1 (Non-specific
ges-1 CBG06418
Caenorhabditis briggsae




carboxylesterase)


Q04457
EST1_CAEEL
Gut esterase 1 (Non-specific
ges-1 R12A1.4
Caenorhabditis elegans




carboxylesterase)


Q63880
EST3A_MOUSE
Carboxylesterase 3A (ES-male) (Liver
Ces3a Es31

Mus musculus (Mouse)





carboxylesterase 31) (Esterase-31)


Q8VCU1
EST3B_MOUSE
Carboxylesterase 3B (Liver
Ces3b Gm4738

Mus musculus (Mouse)





carboxylesterase 31-like)


Q8VCC2
EST1_MOUSE
Liver carboxylesterase 1 (Acyl-coenzyme
Ces1 Ces1g

Mus musculus (Mouse)





A: cholesterol acyltransferase)




(Carboxylesterase 1G) (ES-x)


Q29550
EST1_PIG
Liver carboxylesterase (Proline-beta-


Sus scrofa (Pig)





naphthylamidase) (Retinyl ester




hydrolase) (REH)


P12337
EST1_RABIT
Liver carboxylesterase 1 (Acyl-coenzyme


Oryctolagus cuniculus





A: cholesterol acyltransferase)

(Rabbit)


P86325
EST1_THEFU
Carboxylesterase

Thermobifida fusca






(Thermomonospora fusca)


Q6AW47
EST5A_CANLF
Carboxylesterase 5A (Carboxylesterase-
CES5A CES7

Canis lupus familiaris (Dog)





like urinary excreted protein homolog)

(Canis familiaris)




(Cauxin)


O16168
EST5A_DROMI
Esterase-5A (Est-5A) (Carboxylic-ester
Est-5A Est5A

Drosophila miranda





hydrolase 5A) (Carboxylesterase-5A)

(Fruit fly)


P21370
EST2_CULPI
Esterase B2 (Fragment)


Culex pipiens







(House mosquito)


Q6AW46
EST5A_MOUSE
Carboxylesterase 5A (Carboxylesterase-
Ces5a Ces7

Mus musculus (Mouse)





like urinary excreted protein homolog)




(Cauxin)


P14943
EST2_RABIT
Liver carboxylesterase 2
CES2 ICE

Oryctolagus cuniculus







(Rabbit)


O16172
EST5B_DROPE
Esterase-5B (Est-5B) (Carboxylic-ester
Est-5B Est5B

Drosophila persimilis





hydrolase 5B) (Carboxylesterase-5B)

(Fruit fly)


P25726
EST5B_DROPS
Esterase-5B (Est-5B) (Carboxylic-ester
Est-5B Est5b GA14349

Drosophila pseudoobscura





hydrolase 5B) (Carboxylesterase-5B)


pseudoobscura (Fruit fly)



O16169
EST5C_DROMI
Esterase-5C (Est-5C) (Carboxylic-ester
Est-5C Est5C

Drosophila miranda





hydrolase 5C) (Carboxylesterase-5C)

(Fruit fly)


P25725
EST5C_DROPS
Esterase-5C (Est-5C) (Carboxylic-ester
Est-5C Est5C GA19955

Drosophila pseudoobscura





hydrolase 5C) (Carboxylesterase-5C)


pseudoobscura (Fruit fly)



P10095
EST5_DROMO
Esterase-5 (Fragment)
Est-5 Est5

Drosophila mojavensis







(Fruit fly)


Q63010
EST5_RAT
Liver carboxylesterase B-1 (Liver


Rattus norvegicus (Rat)





microsomal carboxylesterase)


B2D0J5
EST6_APIME
Venom carboxylesterase-6 (allergen Api


Apis mellifera (Honeybee)





m 8)


P08171
EST6_DROME
Esterase-6 (Est-6) (Carboxylic-ester
Est-6 EST6 CG6917

Drosophila melanogaster





hydrolase 6) (Carboxylesterase-6)

(Fruit fly)


Q6B6R8
ESTA_PSEPU
Esterase EstA
estA

Pseudomonas putida







(Arthrobacter siderocapsulatus)


P35502
ESTF_MYZPE
Esterase FE4 (Carboxylic-ester


Myzus persicae





hydrolase)

(Green peach aphid)






(Aphis persicae)


Q88QS0
ESTP_PSEPK
Esterase EstP (Autotransporter esterase
estP PP_0418

Pseudomonas putida





EstP) (Palmitoyl-CoA hydrolase) (EC

(strain ATCC 47054/DSM




3.1.2.2)

6125/NCIMB 11950/KT2440)


Q05487
ESTS_DROVI
Esterase S (Est-S) (Carboxylic-ester
EstS

Drosophila virilis





hydrolase S) (Carboxylesterase-S)

(Fruit fly)


O32232
EST_BACSU
Carboxylesterase
est yvaK BSU33620

Bacillus subtilis







(strain 168)


Q9HZY8
EST_PSEAE
Esterase TesA
tesA PA2856

Pseudomonas aeruginosa







(strain ATCC 15692/






DSM 22644/CIP 104116/






JCM 14847/LMG 12228/






1C/PRS 101/PAO1)


P9WK87
NLHH_MYCTU
Carboxylesterase NlhH
nlhH lipH Rv1399c

Mycobacterium tuberculosis







(strain ATCC 25618/H37Rv)


O06350
LIPF_MYCTU
Carboxylesterase LipF
lipF Rv3487c

Mycobacterium tuberculosis







(strain ATCC 25618/H37Rv)


L0TC47
LIPV_MYCTU
Lipase LipV
lipV Rv3203

Mycobacterium tuberculosis







(strain ATCC 25618/H37Rv)


P9WK86
NLHH_MYCTO
Carboxylesterase NlhH
nlhH lipH MT1443

Mycobacterium tuberculosis







(strain CDC 1551/Oshkosh)


P96688
NAP_BACSU
Uncharacterized carboxylesterase nap
nap BSU05440

Bacillus subtilis (strain 168)

















TABLE 4







Enzymes Classified as EC 3.1.1.7











Entry
Entry name
Protein names
Gene Name
Organism





Q867X3
ACES_CULPP
Acetylcholinesterase
ACE-1

Culex pipiens pipiens (Northern house







mosquito)


P04058
ACES_TETCF
Acetylcholinesterase
Ache

Tetronarce californica (Pacific electric ray)







(Torpedo californica)


Q867X2
ACES_CULQU
Acetylcholinesterase
ACE-1

Culex quinquefasciatus (Southern house







mosquito) (Culex pungens)


P38433
ACE1_CAEEL
Acetylcholinesterase 1
ace-1 W09B12.1
Caenorhabditis elegans


P21836
ACES_MOUSE
Acetylcholinesterase
Ache

Mus musculus (Mouse)



P56161
ACES_ANOST
Acetylcholinesterase


Anopheles stephensi (Indo-Pakistan malaria







mosquito)


P07140
ACES_DROME
Acetylcholinesterase
Ace CG17907

Drosophila melanogaster (Fruit fly)



O62763
ACES_FELCA
Acetylcholinesterase
ACHE

Felis catus (Cat) (Felis silvestris catus)



P36196
ACES_CHICK
Acetylcholinesterase
ACHE

Gallus gallus (Chicken)



Q92081
ACES_MYXGL
Acetylcholinesterase
ache ace1

Myxine glutinosa (Atlantic hagfish)



Q869C3
ACES_ANOGA
Acetylcholinesterase
Ace ACE1, ACHE1,

Anopheles gambiae (African malaria mosquito)






AGAP001356


Q27459
ACE1_CAEBR
Acetylcholinesterase 1
ace-1 CBG16374
Caenorhabditis briggsae


O42275
ACES_ELEEL
Acetylcholinesterase
Ache

Electrophorus electricus (Electric eel)







(Gymnotus electricus)


P07692
ACES_TORMA
Acetylcholinesterase
Ache

Torpedo marmorata (Marbled electric ray)



P23795
ACES_BOVIN
Acetylcholinesterase
ACHE

Bos taurus (Bovine)



Q86GC8
ACES_CULPI
Acetylcholinesterase
ACHE1

Culex pipiens (House mosquito)



Q27677
ACES_LEPDE
Acetylcholinesterase


Leptinotarsa decemlineata (Colorado potato







beetle) (Doryphora decemlineata)


P37136
ACES_RAT
Acetylcholinesterase
Ache

Rattus norvegicus (Rat)



Q86GC9
ACES_CULTO
Acetylcholinesterase
ACE-1

Culex torrentium (Mosquito)



W4VSJ0
ACES_TRILK
Acetylcholinesterase-1


Trittame loki (Brush-footed trapdoor spider)



Q9DDE3
ACES_DANRE
Acetylcholinesterase
Ache

Danio rerio (Zebrafish) (Brachydanio rerio)



P22303
ACES_HUMAN
Acetylcholinesterase
ACHE

Homo sapiens (Human)



Q7LZG1
ACES_NAJOX
Acetylcholinesterase
ACHE

Naja oxiana (Central Asian cobra) (Oxus cobra)



Q9NDG8
ACE4_CAEBR
Acetylcholinesterase 4
ace-4 CBG02827
Caenorhabditis briggsae


Q29499
ACES_RABIT
Acetylcholinesterase
ACHE

Oryctolagus cuniculus (Rabbit)



Q92035
ACES_BUNFA
Acetylcholinesterase
ACHE

Bungarus fasciatus (Banded krait) (Pseudoboa








fasciata)

















TABLE 5







Mutations in Lucilia cuprina









Mutation
Comments
Literature





E217M
mutant in anionic site, p1 subsite, pyrethroid hydrolysis similar to wild-type
668944


F309L
mutant in acyl pocket p2 subsite, marked increase in pyrethroid hydrolysis
668944



both for cis-substrate, strong increase for trans-substrate


F354L
mutant in anionic site, p1 subsite, pyrethroid hydrolysis similar to wild-type
668944


F354W
mutant in anionic site, p1 subsite, marked increase in pyrethroid hydrolysis
668944



both for cis- and trans-substrate


G137D
mutant in oxyanion hole, marked decrease in pyrethroid hydrolysis
668944


G137E
mutant in oxyanion hole, strong decrease in pyrethroid hydrolysis
668944


G137H
mutant in oxyanion hole, marked decrease in pyrethroid hydrolysis
668944


G137R
mutant in oxyanion hole, pyrethroid hydrolysis similar to wild-type
668944


M364L/I419F/
the mutant shows enhanced activity
730817


A472T/I505T/


K530E/D554G


W251A
mutant in acyl pocket p2 subsite, marked increase in pyrethroid hydrolysis
668944



both for cis- and trans-substrate


W251G
mutant in acyl pocket p2 subsite, marked increase in pyrethroid hydrolysis
668944



both for cis- and trans-substrate


W251L
mutant in acyl pocket p2 subsite, strong increase in pyrethroid hydrolysis
668944



both for cis- and trans-substrate. Trans:cis ratio for preference of substrate is



2:1 compared to 27:1 in wild-type


W251L/D449G
the mutant shows a loss of activity for most substrates
729826


W251L/D473N
the mutant shows a loss of activity for most substrates
729826


W251L/F309L
mutant in acyl pocket p2 subsite, marked increase in pyrethroid hydrolysis
668944



both for cis- and trans-substrate. Trans:cis ratio for preference of substrate is



2:1 compared to 27:1 in wild-type


W251L/G137D
mutant in acyl pocket p2 subsite, marked increase in pyrethroid hydrolysis
668944



both for cis- and trans-substrate. Trans:cis ratio for preference of substrate is



2:1 compared to 27:1 in wild-type


W251L/I140F
the mutant shows a loss of activity for most substrates
729826


W251L/I459N
the mutant shows a loss of activity for most substrates
729826


W251L/P250S
mutant in acyl pocket p2 subsite, marked increase in pyrethroid hydrolysis
668944



both for cis- and trans-substrate. Trans:cis ratio for preference of substrate is



3:1 compared to 27:1 in wild-type


W251L/R458C
the mutant shows a loss of activity for most substrates
729826


W251L/R461H
the mutant shows a loss of activity for most substrates
729826









As described herein, the conversion of the second substrate by the second enzyme results in basification of the reaction buffer. Representative examples of a second substrate and second enzyme include, but are not limited to urea and urease (classified as EC 3.5.1.5), urea and urea amidolyase (classified as EC 6.3.4.6 and EC 3.5.1.54), biuret and biuret amidohydrolase (classified as EC 3.5.1.84), [beta-hydroxypyruvate+glycolaldehyde] and transketolase (classified as EC 2.2.1.1, with representative examples of substrates being: D-fructose 6-phosphate, D-glyceraldehyde 3-phosphate, D-ribose 5-phosphate, or D-xylulose 5-phosphate), adenosine and adenosine deaminase (classified as EC3.5.4.4), adenine and adenine deaminase (classified as EC 3.5.4.15), guanosine and guanosine deaminase (classified as EC 3.5.4.15), guanine and guanine deaminase (classified as EC 3.5.4.3), cytosine and cytosine deaminase (classified as EC 3.5.4.5).


Moreover, representative second enzyme/second substrate combinations can be selected from those shown in Table 6.


In preferred embodiments, ureases are used as the second enzyme. Ureases (EC 3.5.1.5) are highly homologous nickel-dependent enzymes widespread among plants, bacteria and fungi, that hydrolyse urea into ammonia and carbon dioxide [1, 2]. Plant and fungal ureases are homotrimers or hexamers of a ˜90 kD subunit, while bacterial ureases are multimers of two or three subunits complexes [3-4]. The N-terminal halves of plant or fungal urease single chain align with the primary sequence of the small subunits of most bacterial enzymes (e.g. β and γ chains of Bacillus pasteurii urease or the A subunit of Helicobacter pylori urease). The C-terminal portions of plant and fungal chains resemble the large subunits of bacterial ureases (e.g. α chain of B. pasteurii urease or the B subunit of H. pylori enzyme). Considering the similarity in their sequences, all ureases are likely to possess similar tertiary structures and catalytic mechanisms indicating they are variants of the same ancestral protein [2]. H. pylori urease (1 E9Z) and jackbean (Canavalia ensiformis) major urease (P07374), share about 50% identity despite differences in their quaternary structures. The 3D crystallographic structures of three bacterial ureases were successfully resolved: Klebsiella aerogenes (1FWJ), B. pasteurii (4UBP) and H. pylori (1E9Z).














TABLE 6








Enzyme




Enzyme
substrate
Reaction products
class
Reference(s)
Seq-ID examples







urease
urea
CO2 + 2 NH3
3.5.1.5
Balasubramanian 2010;
P07374, I1K3K3,






Wassermann 2010;
1FWJ, 4UBP, 1E9Z






Kappaun 2018;






Filiz 2016


allophanate
Allophanate (1)
CO2 + 2 NH3
3.5.1.54
Zhao 2018
Q936X2, 4CP8


hydrolase


Urea amidolyase
Urea + ATP +
2 CO2 + 2 NH3
6.3.4.6 +
Zhao 2018



HCO3−

3.5.1.54


Biuret
biuret
urea + CO2 + NH3
3.5.1.84
Esquirol 2018
A0A075T5U3,


amidohydrolase




Q1M7F4


Transketolase
β-hydroxypyruvate +
L-erythrulose + CO2
2.2.1.1
Gruber 2017



glycolaldehyde


Adenosine
Adenosine
Inosine + NH3
3.5.4.4
Alberty 2007
P00813, P22333,


deaminase


Adenine deaminase
Adenine
Hypoxanthine + NH3
3.5.4.2


Guanosine
Guanosine
Xanthosine + NH3
3.5.4.15

P76641


deaminase


Guanine
Guanine
Xanthine + NH3
3.5.4.3
Bitra 2013a, Bitra 2013b
Q82Y41


deaminase (Cypin)


Cytidine deaminase
Cytidine
Uridine + NH3
3.5.4.5
Dong 2015
P0ABF6









Ph changes can be measured using standard techniques known in the art. For example, techniques such as described in Gruber et al., “Real-time pH monitoring of industrially relevant enzymatic reactions in a microfluidic side-entry reactor (μSER) shows potential for pH control” Biotechnology Journal, Vol. 12:6 (June 2017) can be used. In this example, enzyme activity was determined by mixing 250 μL of a 100 mM lithium-β-hydroxypyruvate (HPA) and 100 mM glycolaldehyde (GA) solution with 250 μL of a transketolase lysate solution (250 μL of TK lysate, 4.8 mM thiamine diphosphate ThDP and 19.6 mM magnesium chloride MgCl2). Both solutions were prepared in 50 mM Tris-HCl buffer pH 7.0.


In another example, biuret hydrolase can also be used to measure pH change as described in Esquirol et al. “Structural and biochemical characterization of the biuret hydrolase (BiuH) from the cyanuric acid catabolism pathway of Rhizobium leguminasorum by. viciae 3841” PLOS/ONE (2018). Here Biuret hydrolase specific activity was obtained by using 22 nM of biuret hydrolase wild type or 0.22 μM of the variants and 5 mU/μL of GDH in presence of 1.2 mM of biuret in 25 mM potassium phosphate buffer pH 8.5, at 28 ° C. Biuret hydrolase kinetic data were measured for the wild type and all the variants having a residual specific activity above 1% of the wild type enzymes, by using 22 nM of biuret hydrolase enzyme and either 2.9 μM or 0.9 μM of the variants, depending on their performance in presence of various concentrations of biuret ranging from 0-4 mM, using the GDH-coupled assay. All the kinetics constants were calculated using GraphPad Prism (GraphPad Software, San Diego, USA) fitting the rate data to the Michaelis-Menten equation.


D. Device Used to Detect Phosphorothionate “thion” Forms of OP


However, unlike OP nerve agents, which are potent inhibitors in their native non-activated forms, certain phosphorothionate insecticides such as chlorpyrifos, malathion and parathion must first be converted to replace the P=S bond with a P=O bond, e.g. by P450 to generate the active oxon form (e.g., chlorpyrifos oxon (CPO), malathion oxon (MX) and paraoxon (PX)) for their insecticidal action. Moreover, the ki values obtained for AChE by oxons (e.g., CPO, MO, PX) are 10-fold to 100-fold lower than nerve agents (˜1.0×107 M−1·min−1) while the unmodified forms (e.g., malathion) is up to 1,000-fold lower. This translates into a very slow yellow to pink (Y-P) color change and requires modification in the OP/C Detecting Enzyme (amount and activity) in the first carrier material of the device to convert the thion to the oxon form in order to enhance the rate of reaction and produce an efficient device as described herein.


Thus, to detect certain OP/C insecticides, the device needs to further comprise the ability to convert a thion form of the OP to the oxon form.


Another approach in obtaining satisfactorily low inhibition constants (e.g., a ki in the range of 105-106 M−1 ·min−1) includes producing and incorporating the P450 (such as for example, (CYP1A2, CYP6G1) along with cytochrome c reductase (NAPDH) into the first carrier material, ampoule or second carrier material to enzymatically convert the OP/C pesticide thion to the oxon forms. For example, OPs with sufficient inhibition of the OP/C Detecting Enzyme (e.g. ki=105 M−1·min−1), can be immediately used in the device. However, OP/C having low inhibition (e.g. ki=105 M−1·min−1, such as in the case of the thion forms of OP/C insecticides) will need conversion to the oxon forms either chemically (e.g., by chemical oxidizers such as for example halogens (e.g., fluorine, chlorine, bromine and iodine) or by the P450 (plus NADPH). FIG. 8 shows the structure of the most commonly used OP/C insecticides in Asia, Central America, India and the USA and how the (kihigh) already containing the P=O bond and thus highly toxic, represent some of the most widely used toxic OP/C insecticides in these regions (Table 7). Thus, it is anticipated that food samples, for example, from these regions can be quickly tested for the presence of OP/C pesticides when then device converts the thion form to oxon forms.









TABLE 7







Some of the most commonly used OP insecticides used in each country.











United States
Mexico
China
India
Thailand





Chlorpyrifos
Chlorpyrifos
Dichlorvos*
Monocrotophos*
Chlorpyrifos


Acephate*
Omethoate*
Methamidophos*
Triazophos
Malathion


Malathion
Dimethoate*
Omethoate*
Phosphamidon
Monocrotophos*


Naled
Acephate*
Acephate
Methyl parathion
Diazinon


Phorate
Triazophos
Dimethoate
Phorate
Omethoate*


Dicrotophos*
Methyl Parathion
Isocarbophos

Dicrotophos*


Phosmet
Monocrotophos*


Methyl Parathion


Dimethoate
Phorate


Terbufos
Milk#


Ethoprophos
Dichlorvos*


Tetrachlorvinphos
Phorate



Chlorpyrifos,



chlorfenvinphos





The insecticides are listed as to usage (tonnes) where it is known. Many of these insecticides are used despite ban in many countries. Many other less used insecticides are not listed.


*Toxic kihigh insecticides against CES tested to date.


#Widely used as dairy cattle ectoparasiticides or in crops used for animal feed, in homogenized and pasteurized Mexican milk samples.






For example, by using a P450 enzyme along with the co-factor NAPDH, the efficiency of the enzymatic conversion of the substrate by the OP/C Detecting Enzyme is improved, thereby increasing the ability to detect OPs having high ki. Representative P450 proteins that can be used include but are not limited to example of P450 enzyme is a triple mutant of CYP1A2 (P450 BM-3 (CYP102-A1). The P450/NAPDH can be included on the second carrier material, within the ampoule or included within the first carrier material. Expression of P450 CYP6G1 in plants has been described and thus we intend to explore in-house production in plants. In addition, several commercial recombinant cytochrome P450/NADPH reagents, both human (CYP1A2 (Sigma #C8113 made in Baculovirus-infected insect cells; #E9288 expressed in Saccharomyces cerevisiae) and insects (CYP6G1 kindly provided by Dr. Colin Jackson, ANU, Australia) are available and will also be tested. Also, cytochrome P450 (CYP1A2)/ NADPH microsomes (Fischer Scientific) are available and were used in FIG. 1b.


EXAMPLES

The invention will now be further illustrated with reference to the following examples. It will be appreciated that what follows is by way of example only and that modifications to detail may be made while still falling within the scope of the invention.


Example 1
Production of Plant-Derived CES Extract or Purified Protein

Representative OP/C Detecting Enzymes, human carboxylase CES1 and CES 2, was produced in leaf extract as described below. Constructs were engineered using methods and strategies described previously. See, Rosenberg, Y. J. et al. “A Highly Stable Minimally Processed Plant-Derived Recombinant Acetylcholinesterase For Nerve Agent Detection In Adverse Conditions,” Sci. Rep. 5, 13247; doi: 10.1038/srep13247 (2015).














Homo sapiens carboxylesterase 1


GenBank: BC012418.1)(/protein_id = ″AAH12418.1)








Has
1). K78:E183 and K275:E292 salt bridges (yellow)



2). C87-C116 & C274-C285 disulphide bridges (green)



3). N79Q, S221A mutation not present (blue)







>hCES1


(SEQ ID NO:5)




embedded image









embedded image







KKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFSTGDEHSRGNWGHL







embedded image









embedded image







TVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIPMLMSYPLSEGQLDQKTAMSLLWKS





YPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDLIADVMFGVPSVIVARNHRDAGAPTYMYEF





QYRPSFSSDMKPKTVIGDHGDELFSVFGAPFLKEGASEEEIRLSKMVMKFWANFARNGNPNGEG







embedded image







>hCES2 (ACCESSION U60553)


MSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLGIPFAKPPLGPLRF





APPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMSEDCLYLSIYTPAHSHEG





SNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLGVLGFFSTGDKHATGNWGYLDQ





VAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSLVVSPISQGLFHGAIMESGVALLPGLIAS





SADVISTVVANLSACDQVDSEALVGCLRGKSKEEILAINKPFKMIPGVVDGVFLPRHPQELLAS





ADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQKEMDREASQAALQKMLTLLMLPPTFGDLLREEY





IGDNGDPQTLQAQFQEMMADSMFVIPALQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADH





GDELPFVFRSFFGGNYIKFTEEEEQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLN





LQPAVGRALKAHRLQFWKKALPQKIQELEEPEERHTEL









Additionally, OP/C Detecting Enzyme constructs comprising human AChE and/or BChE were generated as described previously in US2017/0081649, which is herein incorporated by reference in its entirety. Production of any of the enzymes can performed as follows.


One liter of a modified extraction buffer containing 5mM MgCl2, 4 mM DTT, 150 mM sodium metabisulfite and 10% sucrose in PBS pH 7.4 was prepared and chilled at 4° C. before use. Chitosan was prepared (Chitosan, low molecular weight, Sigma Aldrich 448869-50g) by adding 1% w/v chitosan into 1% acetic acid and the solution stirred for at least 30 minutes until dissolved and taking on a gelatinous looking appearance. Frozen leaves were ground in a Vitamix blender with 5× w/v extraction buffer. After grinding, the slurry was passed through Miracloth (Calbiochem #475855), poured into centrifuge bottles and centrifuged at 20,000×g for 15 minutes. After centrifugation, the supernatant was poured into a beaker, pH changed to 7.4 and chitosan added at 0.2% v/v. The extract containing chitosan was then stirred at 4° C. for 30 minutes, removed from the stirrer, and left for an additional 30 minutes at 4° C. The extract was poured into centrifuge bottles and centrifuged at 1500 rpm in a refrigerated Sorvall RT6000 at 4° C. for 5 minutes. Supernatant was decanted and left at 4° C. until enzyme level was determined. In some cases, collagen hydrolysate was added to the extract prior to it being aliquoted and frozen at −20° C.


The rHuCES1 was expressed and the extract and purified essentially as described previously for AChE (Rosenberg 2015). Briefly, the C-terminally His-tagged rHuCES1 was expressed by in N. b benthamiana using the Agrobacterium leaf infiltration method and extracted from the leaves using a blender and 5 mL of extraction buffer per gram of leaf biomass. The homogenate was filtered through miracloth, clarified by centrifugation and the pH adjusted to 7.4 before adding chitosan to precipitate phenols, fatty compounds and other impurities. After a second centrifugation step the pH was adjusted to 8.0 and DEAE Sephadex A-25 was added to remove further contaminants by negative ion exchange batch chromatography. The supernatant was 0.45 μm filtered, pH re-adjusted to 8.0, centrifuged and loaded onto a Ni2+-NTA resin. Bound proteins were eluted by step gradients of 30 mM and 100 mM imidazole and elution fractions tested for enzyme activity. Positive fractions were pooled, concentrated by ultrafiltration, dialyzed against 10 mM Tris pH 8.0 and stored at 4° C.


OP/C Detecting Enzyme activity can be determined spectrophometrically at 25° C. according to the Ellman method. See Ellman et al., 1961, which is herein incorporated by reference. For example, to assess AChE activity, the assay mixture contains 1 mM aceylthiocholine as the substrate and 1 mM 5,5-dithiobisnitrobenzoic acid (DTNB) in 50 mM sodium phosphate, pH 8.0. at room temperature (RT). In assays using mammalian cells, 20 uM ethopropazine is used as a BChE-specific inhibitor. BChE activity was assessed similarly using 1 mM butyrylthiocholine (BTC) as an example as substrate and 0.5 mM 5,5-dithiobis 2-nitrobenzoic acid (DTNB), The was followed by monitoring the increase in absorbance of 5-thio-2-nitrobenzoic acid at 412 nm using a molar extinction coefficient of 14,150 M−1 cm−1. One unit of the enzyme activity is defined as the amount required to hydrolyze 1 μmol of substrate/min.


Carboxylesterase activity can be assessed was determined by conversion of 4-Nitrophenyl acetate and determination of the liberated 4-Nitrophenyl by absorbance at 405 nm. Buffer was used as negative control. Kinetic measurements and Vmax determination were performed on a Spectramax plus 384 microplate reader (Molecular Devices) using Softmax Pro. Several alternative substrates are readily available and will be analyzed for increased turnover rates. Previous studies showed that 4-nitrophenyl-butyrate is the best substrate for HuCES2 among several 4-nitrophenyl esters [31,33].


Alternatively, the OP/C Detecting Enzyme can be readily produced using a transient N. benthamiana plant expression system which is inexpensive and can produce kilogram amounts of extract in <2 weeks. See, for example U.S. Pat. No. 10,221,402 which is hereby incorporated by reference in its entirety. Specifically, transient plant expression can generate extracts that contain sufficient OP/C Detecting Enzyme activity and purification was not needed for purposes of detection of OPs in the device. Recombinant enzymes in supernatants (SN) or extracts can be purified using procainamide sepharose chromatography as described previously (De la Hoz et al., 1986). After loading the SN or extract and washing the column, BChE is generally eluted with a 0.1-1 M NaCl gradient but both AChE and BChE can be efficiently eluted using either 0.2 M procainamide, 0.2 M acetylcholine, 0.02 M decamethodium, 0.5 M chlorine chloride or 0.5 M tetra methyl ammonium bromide.


Besides plant expression, a variety of host-expression vector systems may also be utilized to express OP/C Detecting Enzyme. Such host-expression systems represent vehicles by which the coding sequences of interest may be produced and subsequently purified, but also represent cells which may, when transformed or transfected, with the appropriate nucleotide coding sequences, express the OP/C Detecting Enzyme. These include, but are not limited to, microorganisms such as bacteria (e.g., E. coli, B. subtilis) transformed with recombinant bacteriophage DNA, plasmid DNA or cosmid DNA expression vectors containing sequences; yeast (e.g., Saccharomyces, Pichia) transformed with recombinant yeast expression vectors containing coding sequences; insect cell systems infected with recombinant virus expression vectors (e.g., baculovirus) containing coding sequences; plant cell systems infected with recombinant virus expression vectors (e.g., cauliflower mosaic virus, CaMV; tobacco mosaic virus, TMV) or transformed with recombinant plasmid expression vectors (e.g., Ti plasmid) containing coding sequences; or mammalian cell systems (e.g., COS, CHO, BHK, 293, 3T3 cells) harboring recombinant expression constructs containing promoters derived from the genome of mammalian cells (e.g., metallothionein promoter) or from mammalian viruses (e.g., the adenovirus late promoter; the vaccinia virus 7.5 K promoter). Preferably, bacterial cells such as Escherichia coli, and more preferably, eukaryotic cells, are used for the expression of the OP/C Detecting Enzyme. For example, mammalian cells such as Chinese hamster ovary cells (CHO), in conjunction with a vector such as the major intermediate early gene promoter element from human cytomegalovirus is an effective expression system (Foecking et al., Gene 45:101 (1986); Cockett et al., Bio/Technology 8:2 (1990)).


In bacterial systems, a number of expression vectors may be advantageously selected depending upon the intended use. For example, when a large quantity of a protein is to be produced, vectors which direct the expression of high levels of OP/C Detecting Enzyme that are readily purified may be desirable. Such vectors include, but are not limited to, the E. coli expression vector pUR278 (Ruther et al., EMBO 1. 2:1791 (1983)), in which the coding sequence may be ligated individually into the vector in frame with the lac Z coding region so that a fusion protein is produced; pIN vectors (Inouye & Inouye, Nucleic Acids Res. 13:3101-3109 (1985); Van Heeke & Schuster, J. Biol. Chem. 24:5503-5509 (1989)); and the like. pGEX vectors may also be used to express foreign polypeptides as fusion proteins with glutathione 5-transferase (GST). In general, such fusion proteins are soluble and can easily be purified from lysed cells by adsorption and binding to matrix glutathione agarose beads followed by elution in the presence of free glutathione. The pGEX vectors are designed to include thrombin or Factor Xa protease cleavage sites so that the cloned target gene product (e.g., OP/C Detecting Enzyme) can be released from the GST moiety.


In an insect system, Autographa californica nuclear polyhedrosis virus (AcNPV) may be used as a vector to express an OP/C Detecting Enzyme. The virus grows in Spodoptera frugiperda cells. Coding sequences may be cloned individually into non-essential regions (for example, the polyhedrin gene) of the virus and placed under control of an AcNPV promoter (for example, the polyhedrin promoter).


In mammalian host cells, a number of viral-based expression systems may be utilized express the OP/C Detecting Enzyme. In cases where an adenovirus is used as an expression vector, the coding sequence of interest may be ligated to an adenovirus transcription/translation control complex, e.g., the late promoter and tripartite leader sequence. This chimeric gene may then be inserted in the adenovirus genome by in vitro or in vivo recombination.


Insertion in a non-essential region of the viral genome (e.g., region EI or E3) will result in a recombinant virus that is viable and capable of expressing the OP/C Detecting Enzyme in infected hosts (e.g., see Logan & Shenk, Proc. Natl. Acad. Sci. USA 8 1:355-359 (1984)).


Example 2
Bimolecular Rate Constants (ki) of AChE Inhibition of CES and rHuAChE by Thion and Oxon Forms of OP Insecticides.

While the ki for rHuAChE for nerve agents is high (˜108 M−1·min−1), the inhibition constants (ki) of rHuAChE for selected OP insecticides (dichlorvos, chlorpyrifos and malathion) (paraoxon control) were found to be 10-1,000 lower than that for OP nerve agents. By comparison, carboxylesterase (CES) exhibits 10-1,000 higher inhibition parameters for both the thion and oxon forms of pesticides than rHuAChE. Thus, in preferred embodiments, HuCES can be used in the device as described herein.


For example, previously published results have shown that the Australian blow fly Lucilia cuprina carboxylesterase (LcαE7) has a high affinity (˜5 μM) and kinetic parameters (˜1.0×107 M−1·min−1) for a thion form of OP insecticide (17) and that the αE7 mutant form (LcαE7G137D) had an increased rate of turnover by two orders of magnitudes for paraoxon hydrolysis. Based on these data, we propose to include these OP/C Detecting Enzymes in the device as described herein.


Specifically, the human carboxylesterase 1 (CES1) gene (GenBank Accession # AAH12418.1) and the CES2 gene (GenBank Accession # AAB03611.1) are produced transiently in N. bentiamiana as described above. Two forms with and without N-terminal His tags were compared and purified: the former giving better yields in preliminary studies. The plant-derived rHuCE extracts were tested against a battery of OP insecticides. Results showing different levels of plant rHuCE inhibition by different oxon and thion forms of OP insecticides are shown in FIG. 1 A


While certain OP insecticides had sufficiently high ki against rHuCE to elicit a rapid color change in a PESTpen (˜105M−1·min−1) values of many others e.g., parathion, omethoate, malathion, chlorpyrifos, daizonin, etc. were only 101-3 M−1·min−1, and needed to undergo oxidation to convert the thion form to an oxon. In a preliminary in vitro study, the addition of an oxidizer, such as for example, CYPP450/NADPH microsomes (Fischer) increased the ki of parathion 10-fold while chlorpyrifos increased only slightly. See FIG. 1B. These early data demonstrate that thion conversion can be optimized using an oxidizer such as P450/NADPH.


In fact, when this experiment was repeated, a greater than 50-fold increase was observed. Here, 25 and 50 ul cytochrome P450 (CYP1A2) (Fischer Scientific and Sigma Aldrich) plus NADPH (1 mM) were added to 58 ug of parathion and 70 ug of chlorpyrifos, incubated for 10, 20 and 40 mins, and serially diluted prior to the addition of rHuCES for an additional 10 mins. FIG. 1D shows 50-fold increases in the ki of parathion and 20-fold for chlorpyrifos after 10 mins incubation with P450 with clear positives at 5.8 and 7 ug respectively. No differences were observed when pre-incubation of OP with P450 was extended to 20 and 40 mins and only small differences were seen using 25 vs 50 ul P450.



FIG. 1C indicates that the bi-molecular rate constants of the plant-derived rHuCE extracts against a battery of OP insecticides were similar to the purified in-house rHuCE controls produced in E. coli. FIG. 1C also shows that the OP insecticides fell into two groups; those with low ki (101-103 M−1·min−1) versus those with high ki (105 M−1·min−1). This was shown to correlate with their structure in that insecticides e.g.


malathion, parathion, chlorpyrifos exhibiting low ki had P=S bonds and required desulfuration for their phosphorylating activity, while dichlorvos, fenamiphos and methamidophos already had a P=O bond and already active.


Example 3
Device Capable of Detecting OPs

In preferred embodiments, the enzymatic components, including the recombinant OP/C Detecting Enzymes produced in Example 1 will be manufactured together with an applicator first carrier material, such as for example a polyurethane foam applicator sponge, while the first substrate and other additives (tinting compounds, surfactants, rheological thickeners and enzyme substrates) are kept in one reservoir, i.e. second carrier material and buffers in a second reservoir, i.e. the ampoule.


For example, in one embodiment, rHuCE will be embedded in the first carrier material (preferably a polyurethane foam) in the device described herein. The bottom piece (130) of the device contains dried chemistries and a glass ampoule (120) full of aqueous buffer. The user cracks the ampoule to activate the device, then inverts the device and turns the barrel to introduce the wet chemistry to the enzymatic foam. Once activated, the cap can then be removed and the first carrier material (100) can be used to sample surfaces.


hi further details, an OP/C Detecting Enzyme, such as for example CES, can be co-immobilized on the first carrier material with nitrazine yellow dye. The first carder material (150 mg disks) can be incubated (2 ml) with various concentrations of dimethylmethylphosphonate (DMMP), for thirty minutes. A concentrated solution (2 ml) of the first substrate (Le., 50 mM of a 4-nitrophenyl ester) can then be applied to each first carrier material by breaking of the ampoule. As CES catalyzes the first substrate hydrolysis, the pH is reduced, and the first carder material underwent a transition from bluish-brown to orange. However, if the first carrier material comes in contact with an OP/C, the conversion of the first substrate to acetic acid is inhibited and the color change occurs,


Once a surface is sampled, the cap can then be replaced, and the colorimetric scheme (yellow to red) reports on whether there are any OPs present within two to 20 minutes (FIG. 2d-4). In preferred embodiments, the enzyme shelf-life times for the products in device must exceed 60 days when incubated at 37° C.


In certain embodiments, both a minimally processed OP/C Detecting Enzyme (including but not limited to a plant extract) as well as purified protein can be used in the first carrier material for optimal costs savings.


Example 4
Device Capable of Detecting Thion OPs and/or OPs with Low Ki

As noted, in insects and mammals, cytochrome c P450 in the liver (in the presence of NADPH converts OPs from the thion form to the oxon form. In preliminary studies (FIGS. 1B and 1D) a 10-fold, and even a 50-fold, increase in ki of rHuCE against parathion was achieved in vitro. These chemical oxidizers are much more powerful than P450 and should more rapidly convert the thions to oxons and this increase the speed of OP/C detection. Likewise, the P450 assay can be optimized in the same manner to optimize the oxidation conditions.


For chemical oxidation, it has been demonstrated that oxidation by iodine or Fenton's reagent catalysts readily converts parathion into paraoxon; with readily increased toxicity in AChE-based assays. This same strategy can readily be optimized in vitro and translated into the device form factor to rapidly demonstrate the capability with rHuCE. Such chemicals may be more powerful than P450 and may greatly increase the reaction rate and color change in a device


The reference to any prior art in this specification is not, and should not be taken as, an acknowledgement of any form of suggestion that such prior art forms part of the common general knowledge.


It will be appreciated that the disclosure is not limited to the embodiment or embodiments disclosed, but is capable of numerous rearrangements, modifications and substitutions without departing from the scope of the disclosure as set forth and defined by the following claims. The entire teachings of any patents, patent applications or other publications referred to herein are incorporated by reference herein as if fully set forth herein.

Claims
  • 1. A device for detecting an OP/C compound comprising: (a) a top piece comprising first carrier material, wherein said first carrier material comprises an immobilized OP/C Detecting Enzyme;(b) a first substrate;(c) a second enzyme;(d) a second substrate;(e) a pH Sensitive Dye;(f) a second carrier material;(g) an ampoule comprising a buffer;(h) a middle piece; and(i) a bottom piece,wherein the middle piece is associated with the top piece and the bottom piece,wherein the middle piece comprises the second carrier material and the ampoule, andwherein when the middle piece is turned relative to either the top piece or the bottom piece, the ampoule is capable of being cracked to release the buffer to contact the first carrier material and the second carrier material causing: (i) the enzymatic conversion of the first substrate by the OP-detecting enzyme to produce an acidic reaction product; and(ii) the enzymatic conversion of the second substrate by the second enzyme to produce a basic reaction product; and(j) optionally an Oxidizer.
  • 2. The device of claim 1, wherein the OP/C Detecting Enzyme is: a) a hydrolase;b) a lipase, a phosphatase, an amylase, a cellulase, a protease, a peptidase, a urease or a deaminase;c) a carboxylesterase (CES), acetylcholinesterase (AChE), butyrylcholinesterase (BChE), organophosphorus hydrolase or organophosphorus acid anhydrolase;d) CES1 or CES2;e) Wild type carboxylesterase αE7 from the Australian blow fly Lucilia cuprina (LcαE7);f) mutant form of LcαE7G137D g) LcαE7 mutants E183, K275, E78 and/or E292h) Wild type AChE;i) Mutant AChE, such as as rHuAChE containing two mutations in the acyl pocket residues (F295L, F297V);j) Carboxylesterase (Cqestβ2) from the Culex quinquefasciatus mosquitok) selected from Tables 2-5; orl) an OP/C Detecting Enzyme Variant having at least 70%, at least 75%, at least 80%, at least 85%, at least 90, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity to the OP/C Detecting Enzyme amino acid sequence of (a)-(k), wherein the OP/C Detecting Enzyme Variant: (1) retains the ability to convert the first substrate into acetic acid; and(2) maintains that ability to be inhibited by an OP
  • 3. The device of claim 1, wherein the OP/C Detecting Enzyme: (a) can detect at least 10 ug, at least 20 ug, at least 30 ug, at least 40 ug, at least 50 ug, at least 60 ug, at least 70 ug, at least 80 ug, at least 90 ug or at least 100 ug of an OP/C compound;(b) can detect between 10-100 ug, between 20-100 ug, between 30-100 ug, between 40-100 ug, between 50-100 ug, between 60-100 ug, between 70-100 ug, between 80-100 ug, between 90-100 ug of an OP/C compound;(c) comprises an inhibition rate constant ki of at least 103 M−1·min−1 to 108 M−1·min−1, at least 104 m−1·min−1 to 108M−1·min−1, at least 105 M−1·min−1 to 108M−1·min−1, at least 106 M−1·min−1 to 108M−1·min−1, or at least 107 M−1·min−1 to 108M−1·min−1; and/or(d) comprises an inhibition rate constant ki of 103-105 M−1·min−1, ki of 104-105 M−1·min−1, 105-106 M−1·min−1, 106 M−1·min−1 to 107 M−1·min−1, or 106 M−1·min−1 to 108 M−1·min-−1.
  • 4. The device of claim 1, wherein the first carrier material is comprised of: (a) natural polymers, including but not limited to cellulose, hemicellulose, pectin, chitin, silk, lignin, starch, polypeptides, collagens, keratins, polysaccharides, nucleic acids, and/or rubbers; or(b) derivatives of natural polymers, including but not limited to methylation, carboxylation, amidation, sulfation, hydroxylation, condensation, iodination, reduction, oxidation, esterification, alkylation, and/or halogenation; and/or(c) synthetic polymers and copolymers, including but not limited to polyurethanes, thermoplastic polyurethanes, silicones, polyamides, polystyrenes, bakelite, polyethylene, polypropylene, polyvinyl chloride, Polytetrafluoroethylene, Polychloroprene, and/or polyimides.
  • 5. The device of claim 1 wherein the first carrier material is a sponge.
  • 6. The device of claim 1 wherein the first carrier material is composed of polyurethane.
  • 7. The device of claim 1, wherein the first substrate is selected from acetylcholine, acetylthiocholine, butyrylcholine, butyrylthiocholine, 4-nitrophenyl acetate, 4-nitrophenyl propionate, 4 -nitrophenyl butyrate, 4-nitrophenyl valerate, 4-nitrophenyl dimethylacetate, 4-nitrophenyl trimethylacetate, 4-nitrophenyl 4-guanidinobenzoate, or 6-nitrocoumarin.
  • 8. The device of claim 1, wherein the second enzyme and second substrate is selected from Table 6.
  • 9. The device of claim 1 wherein the second enzyme is urease and the second substrate is urea.
  • 10. The device of claim 1 wherein the basic reaction product is ammonia.
  • 11. The device of claim 1, wherein the pH Sensitive Dye is selected from nitrazine, phenol red, chlorophenol red, bromocresol green, cresol red, bromomethyl blue, or bromocresol purple.
  • 12. The device of claim 1 wherein the device further comprises an Oxidizer that converts an inactive OP/C compound to an active OP/C compound.
  • 13. The device of claim 12, wherein the Oxidizer is a P450 enzyme in the presence of the cofactor NADPH.
  • 14. The device of claim 13, wherein the P450 enzyme is a wildtype or a triple mutant of CYP1A2 (P450 BM-3 (CYP102-A1).
  • 15. The device of claim 1, wherein: a) the first carrier material further comprises the pH Sensitive Dye, the second enzyme and/or the Oxidizer;b) the ampoule further comprises the pH Sensitive Dye; and/orc) the second carrier material comprises the pH Sensitive Dye, the first substrate, the second substrate, and/or the Oxidizer.
  • 16. The device of claim 1, wherein the second carrier material is selected from: (a) natural polymers, including but not limited to cellulose, hemicellulose, pectin, chitin, silk, lignin, starch, polypeptides, collagens, keratins, polysaccharides, nucleic acids, and/or rubbers; or(b) derivatives of natural polymers, including but not limited to methylation, carboxylation, amidation, sulfation, hydroxylation, condensation, iodination, reduction, oxidation, esterification, alkylation, and/or halogenation; and/or(c) synthetic polymers and copolymers, including but not limited to polyurethanes, thermoplastic polyurethanes, silicones, polyamides, polystyrenes, bakelite, polyethylene, polypropylene, polyvinyl chloride, Polytetrafluoroethylene, Polychloroprene, and/or polyimides.
  • 17. The device of claim 1, wherein the pH Sensitive Dye, the first substrate, the second substrate, and/or the Oxidizer are lyophilized as a microtablet.
  • 18. The device of claim 1, wherein the top piece and the middle piece are connected.
  • 19. The device of claim 1, wherein the ampoule extends into the bottom piece.
  • 20. The device of claim 19, wherein the middle piece contains one or more holes to permit flow of released contents of the ampoule between the bottom piece and the middle piece.
  • 21. The device of claim 1, wherein the device further comprises a lid.
  • 22. The device of claim 21, wherein the lid is transparent and/or comprises a window.
  • 23. The device of claim 1, wherein the device comprises at least one O-ring.
  • 24. The device of claim 1, wherein the device is operably associated with a smart phone.
  • 25. The device of claim 1 wherein the OP/C Detecting Enzyme is produced by a plant cell, a mammalian cell, or a bacterial cell.
  • 26. A method of detecting an OP/C comprising: (a) contacting the device of claim 1 with a surface;(b) turning the middle piece relative to either the top piece or the bottom piece thereby cracking the ampoule to release the buffer to contact the first carrier material and the second carrier material causing the enzymatic conversion of a second substrate by a second enzyme to produce ammonia; and wherein: (1) in the absence of an OP/C, the enzymatic conversion of the first substrate by the OP/C Detecting Enzyme occurs, resulting in a maintenance of a baseline pH; or(2) in the presence of an OP/C, the enzymatic conversion of the first substrate by the OP/C Detecting Enzyme is inhibited by the OP/C compound, resulting in an increase in pH above the baseline pH due to the production of the basic reaction product.
  • 27. The method of claim 26, wherein the OP/C compound is selected from: (a) an insecticide selected from: acephate, aldicarb (Temik), carbachol, carbamate, carbaryl (Sevin), carbofuran (Furadan), carisoprodol, chlorfenvinphos, Chlorophyrifos-oxon, Chlorphyrifos, Dementon-S, Diazoxon, diazinon, Dichlorvos, dicrotophos, dimethoate, dithiocarbamates, EA-3990, eserine, ethienocarb, ethoprophos, ethyl carbamate, felbamate, fenobucarb, fenamiphos, isocarbophos, Malathion, mebutamate, meprobamate, Methamidaphos, methomyl, methyl carbamate, methyl parathion, Methyl-PDX, monocrotophos, naled, neostigmine, omethoate, oxamyl, Paraoxon, Parathion, phorate, phosmet, phosphamidon, rivastigmine, T-1123, terbufos, tetrachlorvinphos, Tetriso, thiocarbamates (e.g., O-thiocarbamate or S-thiocarbamates), triazophos, and/or tybamate;(b) a G agent, such as Tabun (GA), Sarin (GB), Chlorsarin (GC), Soman (GD), methylsarin, n-butylsarin, iso-butylsarin, n-propylsarin, ethylsarin (GE), and/or cyclosarin (GF), GV;(c) a V agent, such as EA-3148, VE, VG, VM, VP, VR, VS, and/or VX; and/or(d) a Novichok Agent, such as A-234.
  • 28. The method of claim 26, wherein the device: (a) can detect at least 10 ug, at least 20 ug, at least 30 ug, at least 40 ug, at least 50 ug, at least 60 ug, at least 70 ug, at least 80 ug, at least 90 ug or at least 100 ug of an OP/C compound; and/or(b) can detect between 10-100 ug, between 20-100 ug, between 30-100 ug, between 40-100 ug, between 50-100 ug, between 60-100 ug, between 70-100 ug, between 80-100 ug, between 90-100 ug of an OP/C compound.
  • 29. The method of any one of claims 26-28, wherein the surface comprises food, clothing, or machinery.
Government Interests

The invention was made with Government support under NIH grant No. 1R43ES029405. The Government may have certain rights to the invention

PCT Information
Filing Document Filing Date Country Kind
PCT/US20/31682 5/6/2020 WO 00