DNA ANTIBODY CONSTRUCTS FOR USE AGAINST HEPATITIS B VIRUS

Information

  • Patent Application
  • 20230203133
  • Publication Number
    20230203133
  • Date Filed
    May 06, 2021
    5 years ago
  • Date Published
    June 29, 2023
    3 years ago
Abstract
Disclosed herein is a composition including a recombinant nucleic acid sequence that encodes an antibody to a Hepatitis B viral antigen. Also disclosed herein is a method of generating a synthetic antibody in a subject by administering the composition to the subject. The disclosure also provides a method of preventing and/or treating a Hepatitis B virus infection in a subject using said composition and method of generation.
Description
TECHNICAL FIELD

The present invention relates to a composition comprising a recombinant nucleic acid sequence for generating one or more synthetic antibodies, and functional fragments thereof, in vivo, and a method of preventing and/or treating viral infection in a subject by administering said composition.


BACKGROUND

Chronic hepatitis caused by Hepatitis B virus (HBV) infection represents a major health burden globally (Hofmeister et al., 2019, Cold Spring Harb Perspect Med, 9:a033431; Nelson, 2015, J Infect Dis, 212:171-172). More than 250 million people are chronically infected with HBV, out of which 1 million people die each year due to life-threatening complications of this infection including liver cirrhosis and hepatocellular carcinoma (Dosik and Jhaveri, 1978, N Engl J Med, 298:602-603). Current therapies of chronic hepatitis include interferon-γ (IFN-γ) and nucleos(t)ide analogue inhibitors against viral reverse transcriptase (Coleman, 2006, Emerg Infect Dis, 12:198-203; Chirikov et al., 2018, Adv Ther, 35:1087-1102). These antiviral therapies have been demonstrated to control HBV replication, but fail to eliminate infection because of the tendency of HBV to integrate into the host genome or remain latent episomally as covalently closed circular DNA (cccDNA). Moreover, these approaches are associated with the development of acquired drug resistance, resulting in low response rates, and risk of numerous side-effects.


The current commercially available vaccine for hepatitis B contains yeast derived recombinant major surface protein HBsAg of HBV (Dosik and Jhaveri, 1978, N Engl J Med, 298:602-603; Park et al., 2000, Microbiol Immunol, 44:703-710; Brown et al., 1984, Lancet, 2:184-187). Despite its proven immunogenicity and high efficacy overall, the vaccine is unable to induce adequate immune response in approximately 5-15% of healthy adults. Such individuals remain susceptible to HBV infection (Nelson, 2015, J Infect Dis, 212:171-172; Said and Abdelwahab, 2015, World J Hepatol, 7:1660-70).


Thus, there is need in the art for improved therapeutics that prevent and/or treat HBV infection. The current invention satisfies this need.


SUMMARY

In one embodiment, the invention relates to a nucleic acid molecule encoding one or more synthetic antibodies, wherein the nucleic acid molecule comprises a) a nucleotide sequence encoding an anti-Hepatitis B surface antigen (HBsAg) synthetic antibody; or b) a nucleotide sequence encoding a fragment of an anti-HBsAg synthetic antibody.


In one embodiment, the nucleic acid molecule further comprises a nucleotide sequence encoding a cleavage domain.


In one embodiment, the nucleotide sequence encodes an anti-HBsAg antibody comprising a sequence having at least 80% identity to SEQ ID NO:2.


In one embodiment, the nucleotide sequence encodes an anti-HBsAg antibody comprising a sequence having at least 95% identity to SEQ ID NO:2.


In one embodiment, the nucleic acid molecule comprises a nucleotide sequence having at least about 80% identity over an entire length of the nucleic acid sequence to SEQ ID NO:1.


In one embodiment, the nucleic acid molecule comprises a nucleotide sequence having at least about 95% identity over an entire length of the nucleic acid sequence to SEQ ID NO:1.


In one embodiment, the nucleotide sequence encodes a fragment of an anti-HBsAg antibody comprising at least 60% of the full length of SEQ ID NO:2.


In one embodiment, the nucleotide sequence encodes a fragment of an anti-HBsAg antibody comprising at least 80% of the full length of SEQ ID NO:2.


In one embodiment, the nucleic acid molecule comprises a fragment comprising at least about 60% of the full length of SEQ ID NO:1.


In one embodiment, the nucleic acid molecule comprises a fragment comprising at least about 80% of the full length of SEQ ID NO:1.


In one embodiment, the nucleotide sequence encodes a leader sequence.


In one embodiment, the nucleic acid molecule comprises an expression vector.


In one embodiment, the invention relates to a composition comprising the nucleic acid molecule encoding one or more synthetic antibodies, wherein the nucleic acid molecule comprises a) a nucleotide sequence encoding an anti-Hepatitis B surface antigen (HBsAg) synthetic antibody; or b) a nucleotide sequence encoding a fragment of an anti-HBsAg synthetic antibody.


In one embodiment, the composition further comprises a pharmaceutically acceptable excipient.


In one embodiment, the invention relates to a method of preventing or treating a disease in a subject, the method comprising administering to the subject nucleic acid molecule encoding one or more synthetic antibodies, wherein the nucleic acid molecule comprises a) a nucleotide sequence encoding an anti-Hepatitis B surface antigen (HBsAg) synthetic antibody; or b) a nucleotide sequence encoding a fragment of an anti-HBsAg synthetic antibody or a composition comprising a nucleic acid molecule encoding one or more synthetic antibodies, wherein the nucleic acid molecule comprises a) a nucleotide sequence encoding an anti-Hepatitis B surface antigen (HBsAg) synthetic antibody; or b) a nucleotide sequence encoding a fragment of an anti-HBsAg synthetic antibody.


In one embodiment, the disease is a Hepatitis B virus infection.


In one embodiment, the Hepatitis B virus infection is a chronic infection or an acute infection.


In one embodiment, the subject is a pregnant woman. In one embodiment, the subject is an infant.


In one embodiment, the method further comprises administering at least one additional HBV vaccine or therapeutic agent for the treatment of HBV to the subject.


In one embodiment, nucleic acid molecule encoding one or more synthetic antibodies, wherein the nucleic acid molecule comprises a) a nucleotide sequence encoding an anti-Hepatitis B surface antigen (HBsAg) synthetic antibody; or b) a nucleotide sequence encoding a fragment of an anti-HBsAg synthetic antibody or a composition comprising a nucleic acid molecule encoding one or more synthetic antibodies, wherein the nucleic acid molecule comprises a) a nucleotide sequence encoding an anti-Hepatitis B surface antigen (HBsAg) synthetic antibody; or b) a nucleotide sequence encoding a fragment of an anti-HBsAg synthetic antibody is administered by way of at least one selected from the group consisting of intramuscular injection and electroporation.





BRIEF DESCRIPTION OF THE DRAWINGS


FIG. 1A through FIG. 1E, depict exemplary experimental results demonstrating HBV virus amplification and characterization from HepG2.2.15 cells. FIG. 1A depicts a western blot for detection of M-HBsAg in cell lysate of HepG2.2.15 cells. Detection of M-HBsAg in the cell lysate of HepG2.2.15 cells. 10, 20, 30 and 40 μg of cell lysate was loaded in the lanes. FIG. 1B depicts detection of S-HBsAg. ELISA for detection of s-HBsAg in the supernatant and cell lysate of HepG2.2.15 cells. FIG. 1C depicts immunofluorescence detection of HBsAg preS2 antigen in HepG2.2.15 cells. FIG. 1D depicts the quantification of HBV DNA copies in the supernatant of HepG2.2.15 cells by qPCR. DNA was extracted from the HepG2.2.15 cell culture supernatant and concentrated 100-fold with Centricon. Agarose gel showing 81 bp amplicon obtained after qPCR of HBV DNA extracted from supernatant of HepG2.2.15 cells. Concentrated supernatant of HepG2.2.15 cell line (that contains HBV) ˜100 fold by Amicon filtration and quantified HBV DNA copies in the concentrated supernatant by qPCR using synthetic HBV DNA from ATCC as a standard. Quantification of HBV DNA copies in the concentrated supernatant by qPCR. Supernatant from Vero cells was used as a negative control. Agarose gel electrophoresis of reaction system after qPCR to check the amplicon size. An 81 bp amplicon is identified as the correct amplicon size. FIG. 1E depicts an agarose gel electrophoresis of reaction system after qPCR to check the amplicon size. An 81 bp amplicon is identified as the correct amplicon size.



FIG. 2A through FIG. 2F depict exemplary experimental results demonstrating HBV-DMAb expression in vitro and in vivo. FIG. 2A depicts cloning of HBsAg DMAb in pVax1 expression vector. FIG. 2B depicts 293T cells were transfected with HBV-DMAb or pVax1. Human IgG expression in culture supernatant and cell lysate was quantified by ELISA (n=3 biological replicates, mean±SD). FIG. 2C depicts western blot analysis of human IgG heavy and light chain in reduced supernatant and cell lysates of 293T cells transfected with HBV-DMAb or pVax1. HBV-DMAb purified from serum from mice immunized with HBV-DMAb was loaded as a control (right). FIG. 2D depicts HBV-DMAb expression in CAnN.Cg-Foxn1 nu/Crl nude mice after electroporation-enhanced intramuscular inoculation with 100 μg HBV-DMAb (FIG. 2D) and 400 μg HBV-DMAb. Sera were collected up to 35 days post administration (n=5 mice per group, mean±SD). FIG. 2E depicts the mean expression level in mice sera of HBV-DMAb. FIG. 2F depicts ELISA binding of mouse serum collected 21 days post administration of HBV-DMAb to plasma purified native HBsAg.



FIG. 3A through FIG. 3C depict exemplary experimental results demonstrating that the HBV-DMAb binds a specific epitope of HBsAg. FIG. 3A depicts that IFA was used to detect HBV-DMAb binding to HBV in HepG2.2.15 cells. Cells were incubated with serum from mice immunized with HBV-DMAb or pVax1 followed by staining with the Alexa fluor 594 antibody conjugate. The cell nuclei were stained with DAPI. FIG. 3B depicts a western blot of HBsAG after SDS-PAGE separation under reducing (denatured) conditions. No binding of HBV-DMAb was observed when reduced HBsAg was used in SDS-PAGE. FIG. 3C depicts a native PAGE and western blot analysis of HBsAg using sera from mice immunized with HBV DMAb. Detection of DMAb binding to purified HBsAg was performed using goat anti-human IgG-HRP conjugate by chemiluminescence. No binding of HBV-DMAb was observed when denatured HBsAg was used in SDS-PAGE. However, the DMAb strongly bound to native HBsAg in Native-PAGE which indicates that antibody binds to a conformational epitope of HBsAg.



FIG. 4A through FIG. 4E depict exemplary experimental results demonstrating that HBV-DMAb neutralizes HBV and blocks infection of HepaRG cells. FIG. 4A depicts a schematic of infection of HepaRG cells with HBV. FIG. 4B depicts quantification of viral load in the culture supernatant of HepaRG cells by qPCR. FIG. 4C and FIG. 4D depict the relative quantification of total HBV RNA (FIG. 4C) and 3.5 kb pregenomic RNA (FIG. 4D) in HepaRG cells by qRT-PCR. Values represent mRNA expression relative to cells treated with Nabi-HB. FIG. 4E depicts the measurement of HBsAg secreted in the culture medium by ELISA. Quantity of antibody used for neutralization assay: Nabi-HB: 1.25 mg and HBV-DMAb: 10 μg.





DETAILED DESCRIPTION

The present invention relates to compositions comprising a recombinant nucleic acid sequence encoding an antibody, a fragment thereof, a variant thereof, or a combination thereof. The composition can be administered to a subject in need thereof to facilitate in vivo expression and formation of a synthetic antibody.


In particular, the heavy chain and light chain polypeptides expressed from the recombinant nucleic acid sequences can assemble into the synthetic antibody. The heavy chain polypeptide and the light chain polypeptide can interact with one another such that assembly results in the synthetic antibody being capable of binding the antigen, being more immunogenic as compared to an antibody not assembled as described herein, and being capable of eliciting or inducing an immune response against the antigen.


Additionally, these synthetic antibodies are generated more rapidly in the subject than antibodies that are produced in response to antigen induced immune response. The synthetic antibodies are able to effectively bind and neutralize a range of antigens. The synthetic antibodies are also able to effectively protect against and/or promote survival of disease.


1. DEFINITIONS

Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. In case of conflict, the present document, including definitions, will control. Preferred methods and materials are described below, although methods and materials similar or equivalent to those described herein can be used in practice or testing of the present invention. All publications, patent applications, patents and other references mentioned herein are incorporated by reference in their entirety. The materials, methods, and examples disclosed herein are illustrative only and not intended to be limiting.


The terms “comprise(s),” “include(s),” “having,” “has,” “can,” “contain(s),” and variants thereof, as used herein, are intended to be open-ended transitional phrases, terms, or words that do not preclude the possibility of additional acts or structures. The singular forms “a,” “and” and “the” include plural references unless the context clearly dictates otherwise. The present disclosure also contemplates other embodiments “comprising,” “consisting of” and “consisting essentially of,” the embodiments or elements presented herein, whether explicitly set forth or not.


“Antibody” may mean an antibody of classes IgG, IgM, IgA, IgD or IgE, or fragments, fragments or derivatives thereof, including Fab, F(ab′)2, Fd, and single chain antibodies, and derivatives thereof. The antibody may be an antibody isolated from the serum sample of mammal, a polyclonal antibody, affinity purified antibody, or mixtures thereof which exhibits sufficient binding specificity to a desired epitope or a sequence derived therefrom.


“Antibody fragment” or “fragment of an antibody” as used interchangeably herein refers to a portion of an intact antibody comprising the antigen-binding site or variable region. The portion does not include the constant heavy chain domains (i.e. CH2, CH3, or CH4, depending on the antibody isotype) of the Fc region of the intact antibody. Examples of antibody fragments include, but are not limited to, Fab fragments, Fab′ fragments, Fab′-SH fragments, F(ab′)2 fragments, Fd fragments, Fv fragments, diabodies, single-chain Fv (scFv) molecules, single-chain polypeptides containing only one light chain variable domain, single-chain polypeptides containing the three CDRs of the light-chain variable domain, single-chain polypeptides containing only one heavy chain variable region, and single-chain polypeptides containing the three CDRs of the heavy chain variable region.


“Antigen” refers to proteins that have the ability to generate an immune response in a host. An antigen may be recognized and bound by an antibody. An antigen may originate from within the body or from the external environment.


“Coding sequence” or “encoding nucleic acid” as used herein may mean refers to the nucleic acid (RNA or DNA molecule) that comprise a nucleotide sequence which encodes an antibody as set forth herein. The coding sequence may also comprise a DNA sequence which encodes an RNA sequence. The coding sequence may further include initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of an individual or mammal to whom the nucleic acid is administered. The coding sequence may further include sequences that encode signal peptides.


“Complement” or “complementary” as used herein may mean a nucleic acid may mean Watson-Crick (e.g., A-T/U and C-G) or Hoogsteen base pairing between nucleotides or nucleotide analogs of nucleic acid molecules.


“Constant current” as used herein to define a current that is received or experienced by a tissue, or cells defining said tissue, over the duration of an electrical pulse delivered to same tissue. The electrical pulse is delivered from the electroporation devices described herein. This current remains at a constant amperage in said tissue over the life of an electrical pulse because the electroporation device provided herein has a feedback element, preferably having instantaneous feedback. The feedback element can measure the resistance of the tissue (or cells) throughout the duration of the pulse and cause the electroporation device to alter its electrical energy output (e.g., increase voltage) so current in same tissue remains constant throughout the electrical pulse (on the order of microseconds), and from pulse to pulse. In some embodiments, the feedback element comprises a controller.


“Current feedback” or “feedback” as used herein may be used interchangeably and may mean the active response of the provided electroporation devices, which comprises measuring the current in tissue between electrodes and altering the energy output delivered by the EP device accordingly in order to maintain the current at a constant level. This constant level is preset by a user prior to initiation of a pulse sequence or electrical treatment. The feedback may be accomplished by the electroporation component, e.g., controller, of the electroporation device, as the electrical circuit therein is able to continuously monitor the current in tissue between electrodes and compare that monitored current (or current within tissue) to a preset current and continuously make energy-output adjustments to maintain the monitored current at preset levels. The feedback loop may be instantaneous as it is an analog closed-loop feedback.


“Decentralized current” as used herein may mean the pattern of electrical currents delivered from the various needle electrode arrays of the electroporation devices described herein, wherein the patterns minimize, or preferably eliminate, the occurrence of electroporation related heat stress on any area of tissue being electroporated.


“Electroporation,” “electro-permeabilization,” or “electro-kinetic enhancement” (“EP”) as used interchangeably herein may refer to the use of a transmembrane electric field pulse to induce microscopic pathways (pores) in a bio-membrane; their presence allows biomolecules such as plasmids, oligonucleotides, siRNA, drugs, ions, and water to pass from one side of the cellular membrane to the other.


“Endogenous antibody” as used herein may refer to an antibody that is generated in a subject that is administered an effective dose of an antigen for induction of a humoral immune response.


“Feedback mechanism” as used herein may refer to a process performed by either software or hardware (or firmware), which process receives and compares the impedance of the desired tissue (before, during, and/or after the delivery of pulse of energy) with a present value, preferably current, and adjusts the pulse of energy delivered to achieve the preset value. A feedback mechanism may be performed by an analog closed loop circuit.


“Fragment” may mean a polypeptide fragment of an antibody that is function, i.e., can bind to desired target and have the same intended effect as a full length antibody. A fragment of an antibody may be 100% identical to the full length except missing at least one amino acid from the N and/or C terminal, in each case with or without signal peptides and/or a methionine at position 1. Fragments may comprise 20% or more, 25% or more, 30% or more, 35% or more, 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more percent of the length of the particular full length antibody, excluding any heterologous signal peptide added. The fragment may comprise a fragment of a polypeptide that is 95% or more, 96% or more, 97% or more, 98% or more or 99% or more identical to the antibody and additionally comprise an N terminal methionine or heterologous signal peptide which is not included when calculating percent identity. Fragments may further comprise an N terminal methionine and/or a signal peptide such as an immunoglobulin signal peptide, for example an IgE or IgG signal peptide. The N terminal methionine and/or signal peptide may be linked to a fragment of an antibody.


A fragment of a nucleic acid sequence that encodes an antibody may be 100% identical to the full length except missing at least one nucleotide from the 5′ and/or 3′ end, in each case with or without sequences encoding signal peptides and/or a methionine at position 1. Fragments may comprise 20% or more, 25% or more, 30% or more, 35% or more, 40% or more, 45% or more, 50% or more, 55% or more, 60% or more, 65% or more, 70% or more, 75% or more, 80% or more, 85% or more, 90% or more, 91% or more, 92% or more, 93% or more, 94% or more, 95% or more, 96% or more, 97% or more, 98% or more, 99% or more percent of the length of the particular full length coding sequence, excluding any heterologous signal peptide added. The fragment may comprise a fragment that encode a polypeptide that is 95% or more, 96% or more, 97% or more, 98% or more or 99% or more identical to the antibody and additionally optionally comprise sequence encoding an N terminal methionine or heterologous signal peptide which is not included when calculating percent identity. Fragments may further comprise coding sequences for an N terminal methionine and/or a signal peptide such as an immunoglobulin signal peptide, for example an IgE or IgG signal peptide. The coding sequence encoding the N terminal methionine and/or signal peptide may be linked to a fragment of coding sequence.


“Genetic construct” as used herein refers to the DNA or RNA molecules that comprise a nucleotide sequence which encodes a protein, such as an antibody. The genetic construct may also refer to a DNA molecule which transcribes an RNA. The coding sequence includes initiation and termination signals operably linked to regulatory elements including a promoter and polyadenylation signal capable of directing expression in the cells of the individual to whom the nucleic acid molecule is administered. As used herein, the term “expressible form” refers to gene constructs that contain the necessary regulatory elements operable linked to a coding sequence that encodes a protein such that when present in the cell of the individual, the coding sequence will be expressed.


“Identical” or “identity” as used herein in the context of two or more nucleic acids or polypeptide sequences, may mean that the sequences have a specified percentage of residues that are the same over a specified region. The percentage may be calculated by optimally aligning the two sequences, comparing the two sequences over the specified region, determining the number of positions at which the identical residue occurs in both sequences to yield the number of matched positions, dividing the number of matched positions by the total number of positions in the specified region, and multiplying the result by 100 to yield the percentage of sequence identity. In cases where the two sequences are of different lengths or the alignment produces one or more staggered ends and the specified region of comparison includes only a single sequence, the residues of single sequence are included in the denominator but not the numerator of the calculation. When comparing DNA and RNA, thymine (T) and uracil (U) may be considered equivalent. Identity may be performed manually or by using a computer sequence algorithm such as BLAST or BLAST 2.0.


“Impedance” as used herein may be used when discussing the feedback mechanism and can be converted to a current value according to Ohm's law, thus enabling comparisons with the preset current.


“Immune response” as used herein may mean the activation of a host's immune system, e.g., that of a mammal, in response to the introduction of one or more nucleic acids and/or peptides. The immune response can be in the form of a cellular or humoral response, or both.


“Nucleic acid” or “oligonucleotide” or “polynucleotide” as used herein may mean at least two nucleotides covalently linked together. The depiction of a single strand also defines the sequence of the complementary strand. Thus, a nucleic acid also encompasses the complementary strand of a depicted single strand. Many variants of a nucleic acid may be used for the same purpose as a given nucleic acid. Thus, a nucleic acid also encompasses substantially identical nucleic acids and complements thereof. A single strand provides a probe that may hybridize to a target sequence under stringent hybridization conditions. Thus, a nucleic acid also encompasses a probe that hybridizes under stringent hybridization conditions.


Nucleic acids may be single stranded or double stranded, or may contain portions of both double stranded and single stranded sequence. The nucleic acid may be DNA, both genomic and cDNA, RNA, or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine and isoguanine. Nucleic acids may be obtained by chemical synthesis methods or by recombinant methods.


“Operably linked” as used herein may mean that expression of a gene is under the control of a promoter with which it is spatially connected. A promoter may be positioned 5′ (upstream) or 3′ (downstream) of a gene under its control. The distance between the promoter and a gene may be approximately the same as the distance between that promoter and the gene it controls in the gene from which the promoter is derived. As is known in the art, variation in this distance may be accommodated without loss of promoter function.


A “peptide,” “protein,” or “polypeptide” as used herein can mean a linked sequence of amino acids and can be natural, synthetic, or a modification or combination of natural and synthetic.


“Promoter” as used herein may mean a synthetic or naturally-derived molecule which is capable of conferring, activating or enhancing expression of a nucleic acid in a cell. A promoter may comprise one or more specific transcriptional regulatory sequences to further enhance expression and/or to alter the spatial expression and/or temporal expression of same. A promoter may also comprise distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. A promoter may be derived from sources including viral, bacterial, fungal, plants, insects, and animals. A promoter may regulate the expression of a gene component constitutively, or differentially with respect to cell, the tissue or organ in which expression occurs or, with respect to the developmental stage at which expression occurs, or in response to external stimuli such as physiological stresses, pathogens, metal ions, or inducing agents. Representative examples of promoters include the bacteriophage T7 promoter, bacteriophage T3 promoter, SP6 promoter, lac operator-promoter, tac promoter, RSV-LTR promoter, SV40 early promoter or SV40 late promoter and the CMV IE promoter.


“Signal peptide” and “leader sequence” are used interchangeably herein and refer to an amino acid sequence that can be linked at the amino terminus of a protein set forth herein. Signal peptides/leader sequences typically direct localization of a protein. Signal peptides/leader sequences used herein preferably facilitate secretion of the protein from the cell in which it is produced. Signal peptides/leader sequences are often cleaved from the remainder of the protein, often referred to as the mature protein, upon secretion from the cell. Signal peptides/leader sequences are linked at the N terminus of the protein.


“Stringent hybridization conditions” as used herein may mean conditions under which a first nucleic acid sequence (e.g., probe) will hybridize to a second nucleic acid sequence (e.g., target), such as in a complex mixture of nucleic acids. Stringent conditions are sequence dependent and will be different in different circumstances. Stringent conditions may be selected to be about 5-10° C. lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength pH. The Tm may be the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50% of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at Tm, 50% of the probes are occupied at equilibrium). Stringent conditions may be those in which the salt concentration is less than about 1.0 M sodium ion, such as about 0.01-1.0 M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30° C. for short probes (e.g., about 10-50 nucleotides) and at least about 60° C. for long probes (e.g., greater than about 50 nucleotides). Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal may be at least 2 to 10 times background hybridization. Exemplary stringent hybridization conditions include the following: 50% formamide, 5×SSC, and 1% SDS, incubating at 42° C., or, 5×SSC, 1% SDS, incubating at 65° C., with wash in 0.2×SSC, and 0.1% SDS at 65° C.


“Subject” and “patient” as used herein interchangeably refers to any vertebrate, including, but not limited to, a mammal (e.g., cow, pig, camel, llama, horse, goat, rabbit, sheep, hamsters, guinea pig, cat, dog, rat, and mouse, a non-human primate (for example, a monkey, such as a cynomolgous or rhesus monkey, chimpanzee, etc) and a human). In some embodiments, the subject may be a human or a non-human. The subject or patient may be undergoing other forms of treatment.


“Substantially complementary” as used herein may mean that a first sequence is at least 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% identical to the complement of a second sequence over a region of 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100 or more nucleotides or amino acids, or that the two sequences hybridize under stringent hybridization conditions.


“Substantially identical” as used herein may mean that a first and second sequence are at least 60%, 65%, 70%, 75%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% over a region of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 200, 300, 400, 500, 600, 700, 800, 900, 1000, 1100 or more nucleotides or amino acids, or with respect to nucleic acids, if the first sequence is substantially complementary to the complement of the second sequence.


“Synthetic antibody” as used herein refers to an antibody that is encoded by the recombinant nucleic acid sequence described herein and is generated in a subject.


“Treatment” or “treating,” as used herein can mean protecting of a subject from a disease through means of preventing, suppressing, repressing, or completely eliminating the disease. Preventing the disease involves administering a vaccine of the present invention to a subject prior to onset of the disease. Suppressing the disease involves administering a vaccine of the present invention to a subject after induction of the disease but before its clinical appearance. Repressing the disease involves administering a vaccine of the present invention to a subject after clinical appearance of the disease.


“Variant” used herein with respect to a nucleic acid may mean (i) a portion or fragment of a referenced nucleotide sequence; (ii) the complement of a referenced nucleotide sequence or portion thereof; (iii) a nucleic acid that is substantially identical to a referenced nucleic acid or the complement thereof; or (iv) a nucleic acid that hybridizes under stringent conditions to the referenced nucleic acid, complement thereof, or sequences substantially identical thereto.


“Variant” with respect to a peptide or polypeptide that differs in amino acid sequence by the insertion, deletion, or conservative substitution of amino acids, but retain at least one biological activity. Variant may also mean a protein with an amino acid sequence that is substantially identical to a referenced protein with an amino acid sequence that retains at least one biological activity. A conservative substitution of an amino acid, i.e., replacing an amino acid with a different amino acid of similar properties (e.g., hydrophilicity, degree and distribution of charged regions) is recognized in the art as typically involving a minor change. These minor changes can be identified, in part, by considering the hydropathic index of amino acids, as understood in the art. Kyte et al., J. Mol. Biol. 157:105-132 (1982). The hydropathic index of an amino acid is based on a consideration of its hydrophobicity and charge. It is known in the art that amino acids of similar hydropathic indexes can be substituted and still retain protein function. In one aspect, amino acids having hydropathic indexes of ±2 are substituted. The hydrophilicity of amino acids can also be used to reveal substitutions that would result in proteins retaining biological function. A consideration of the hydrophilicity of amino acids in the context of a peptide permits calculation of the greatest local average hydrophilicity of that peptide, a useful measure that has been reported to correlate well with antigenicity and immunogenicity. U.S. Pat. No. 4,554,101, incorporated fully herein by reference. Substitution of amino acids having similar hydrophilicity values can result in peptides retaining biological activity, for example immunogenicity, as is understood in the art. Substitutions may be performed with amino acids having hydrophilicity values within ±2 of each other. Both the hydrophobicity index and the hydrophilicity value of amino acids are influenced by the particular side chain of that amino acid. Consistent with that observation, amino acid substitutions that are compatible with biological function are understood to depend on the relative similarity of the amino acids, and particularly the side chains of those amino acids, as revealed by the hydrophobicity, hydrophilicity, charge, size, and other properties.


A variant may be a nucleic acid sequence that is substantially identical over the full length of the full gene sequence or a fragment thereof. The nucleic acid sequence may be 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the full length of the gene sequence or a fragment thereof. A variant may be an amino acid sequence that is substantially identical over the full length of the amino acid sequence or fragment thereof. The amino acid sequence may be 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical over the full length of the amino acid sequence or a fragment thereof.


“Vector” as used herein may mean a nucleic acid sequence containing an origin of replication. A vector may be a plasmid, bacteriophage, bacterial artificial chromosome or yeast artificial chromosome. A vector may be a DNA or RNA vector. A vector may be either a self-replicating extrachromosomal vector or a vector which integrates into a host genome.


For the recitation of numeric ranges herein, each intervening number there between with the same degree of precision is explicitly contemplated. For example, for the range of 6-9, the numbers 7 and 8 are contemplated in addition to 6 and 9, and for the range 6.0-7.0, the number 6.0, 6.1, 6.2, 6.3, 6.4, 6.5, 6.6, 6.7, 6.8, 6.9, and 7.0 are explicitly contemplated.


2. COMPOSITIONS

The instant invention relates to the design and development of a synthetic DNA plasmid-encoding a human anti-HBV monoclonal antibody sequences as a novel approach to immunotherapy of HBV infection. A single inoculation with this anti-HBV-DMAb generates functional anti-HBV activity for several weeks in the serum of inoculated animals. Anti-HBV DMAbs can function as an immune-prophylaxis strategy for HBV infection.


The present invention relates to a composition comprising a recombinant nucleic acid sequence encoding an antibody, a fragment thereof, a variant thereof, or a combination thereof. The composition, when administered to a subject in need thereof, can result in the generation of a synthetic antibody in the subject. The synthetic antibody can bind a target molecule (i.e., an antigen) present in the subject. Such binding can neutralize the antigen, block recognition of the antigen by another molecule, for example, a protein or nucleic acid, and elicit or induce an immune response to the antigen.


In one embodiment, the composition comprises a nucleotide sequence encoding a synthetic antibody. In one embodiment, the composition comprises a nucleic acid molecule comprising a first nucleotide sequence encoding a first synthetic antibody and a second nucleotide sequence encoding a second synthetic antibody. In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding a cleavage domain.


In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding an anti-surface antigen antibody to the surface antigen of the hepatitis B virus (anti-HBsAg).


In one embodiment, the nucleic acid molecule comprises a nucleotide sequence encoding a variable heavy chain region and a nucleotide sequence encoding a variable light chain region of an anti-HBsAg antibody.


In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises a codon optimized nucleic acid sequences encoding an amino acid sequence having at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence as set forth in SEQ ID NO:2. In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises a codon optimized nucleic acid sequence encoding SEQ ID NO:2. In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises a codon optimized nucleic acid sequence encoding a fragment comprising at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% of the full length of SEQ ID NO:2.


In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises an RNA sequence transcribed from a DNA sequence encoding an amino acid sequence having at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identity to an amino acid sequence as set forth in SEQ ID NO:2. In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises an RNA sequence transcribed from a DNA sequence encoding an amino acid sequence as set forth in SEQ ID NO:2. In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises an RNA sequence transcribed from a DNA sequence encoding a fragment comprising at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% of the full length of SEQ ID NO:2.


In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises a codon optimized nucleic acid sequences having at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identity to a nucleic acid sequence as set forth in SEQ ID NO:1. In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises a DNA sequence as set forth in SEQ ID NO:1. In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises a fragment comprising at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% of the full length of SEQ ID NO:1.


In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises an RNA sequence transcribed from a codon optimized nucleic acid sequences having at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% identity to a nucleic acid sequence as set forth in SEQ ID NO:1. In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises an RNA sequence transcribed from a DNA sequence as set forth in SEQ ID NO:1. In one embodiment, the nucleotide sequence encoding an anti-HBsAg antibody comprises an RNA sequence transcribed from a fragment comprising at least 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% of the full length of SEQ ID NO:1.


The composition of the invention can treat, prevent and/or protect against any disease, disorder, or condition associated with Hepatitis B infection. In certain embodiments, the composition can treat, prevent, and or/protect against viral infection. In certain embodiments, the composition can treat, prevent, and or/protect against condition associated with Hepatitis B infection.


The composition can result in the generation of the synthetic antibody in the subject within at least about 1 hour, 2 hours, 3 hours, 4 hours, 5 hours, 6 hours, 7 hours, 8 hours, 9 hours, 10 hours, 11 hours, 12 hours, 13 hours, 14 hours, 15 hours, 20 hours, 25 hours, 30 hours, 35 hours, 40 hours, 45 hours, 50 hours, or 60 hours of administration of the composition to the subject. The composition can result in generation of the synthetic antibody in the subject within at least about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, or 10 days of administration of the composition to the subject. The composition can result in generation of the synthetic antibody in the subject within about 1 hour to about 6 days, about 1 hour to about 5 days, about 1 hour to about 4 days, about 1 hour to about 3 days, about 1 hour to about 2 days, about 1 hour to about 1 day, about 1 hour to about 72 hours, about 1 hour to about 60 hours, about 1 hour to about 48 hours, about 1 hour to about 36 hours, about 1 hour to about 24 hours, about 1 hour to about 12 hours, or about 1 hour to about 6 hours of administration of the composition to the subject.


The composition, when administered to the subject in need thereof, can result in the generation of the synthetic antibody in the subject more quickly than the generation of an endogenous antibody in a subject who is administered an antigen to induce a humoral immune response. The composition can result in the generation of the synthetic antibody at least about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, or 10 days before the generation of the endogenous antibody in the subject who was administered an antigen to induce a humoral immune response.


The composition of the present invention can have features required of effective compositions such as being safe so that the composition does not cause illness or death; being protective against illness; and providing ease of administration, few side effects, biological stability and low cost per dose.


Recombinant Nucleic Acid Sequence

As described above, the composition can comprise a recombinant nucleic acid sequence. The recombinant nucleic acid sequence can encode the antibody, a fragment thereof, a variant thereof, or a combination thereof. The antibody is described in more detail below.


The recombinant nucleic acid sequence can be a heterologous nucleic acid sequence. The recombinant nucleic acid sequence can include one or more heterologous nucleic acid sequences.


The recombinant nucleic acid sequence can be an optimized nucleic acid sequence. Such optimization can increase or alter the immunogenicity of the antibody. Optimization can also improve transcription and/or translation. Optimization can include one or more of the following: low GC content leader sequence to increase transcription; mRNA stability and codon optimization; addition of a kozak sequence for increased translation; addition of an immunoglobulin (Ig) leader sequence encoding a signal peptide; addition of an internal IRES sequence and eliminating to the extent possible cis-acting sequence motifs (i.e., internal TATA boxes).


Recombinant Nucleic Acid Sequence Construct

The recombinant nucleic acid sequence can include one or more recombinant nucleic acid sequence constructs. The recombinant nucleic acid sequence construct can include one or more components, which are described in more detail below.


The recombinant nucleic acid sequence construct can include a heterologous nucleic acid sequence that encodes a heavy chain polypeptide, a fragment thereof, a variant thereof, or a combination thereof. The recombinant nucleic acid sequence construct can include a heterologous nucleic acid sequence that encodes a light chain polypeptide, a fragment thereof, a variant thereof, or a combination thereof. The recombinant nucleic acid sequence construct can also include a heterologous nucleic acid sequence that encodes a protease or peptidase cleavage site. The recombinant nucleic acid sequence construct can also include a heterologous nucleic acid sequence that encodes an internal ribosome entry site (IRES). An IRES may be either a viral IRES or an eukaryotic IRES. The recombinant nucleic acid sequence construct can include one or more leader sequences, in which each leader sequence encodes a signal peptide. The recombinant nucleic acid sequence construct can include one or more promoters, one or more introns, one or more transcription termination regions, one or more initiation codons, one or more termination or stop codons, and/or one or more polyadenylation signals. The recombinant nucleic acid sequence construct can also include one or more linker or tag sequences. The tag sequence can encode a hemagglutinin (HA) tag.


(1) Heavy Chain Polypeptide


The recombinant nucleic acid sequence construct can include the heterologous nucleic acid encoding the heavy chain polypeptide, a fragment thereof, a variant thereof, or a combination thereof. The heavy chain polypeptide can include a variable heavy chain (VH) region and/or at least one constant heavy chain (CH) region. The at least one constant heavy chain region can include a constant heavy chain region 1 (CH1), a constant heavy chain region 2 (CH2), and a constant heavy chain region 3 (CH3), and/or a hinge region.


In some embodiments, the heavy chain polypeptide can include a VH region and a CH1 region. In other embodiments, the heavy chain polypeptide can include a VH region, a CH1 region, a hinge region, a CH2 region, and a CH3 region.


The heavy chain polypeptide can include a complementarity determining region (“CDR”) set. The CDR set can contain three hypervariable regions of the VH region. Proceeding from N-terminus of the heavy chain polypeptide, these CDRs are denoted “CDR1,” “CDR2,” and “CDR3,” respectively. CDR1, CDR2, and CDR3 of the heavy chain polypeptide can contribute to binding or recognition of the antigen.


(2) Light Chain Polypeptide


The recombinant nucleic acid sequence construct can include the heterologous nucleic acid sequence encoding the light chain polypeptide, a fragment thereof, a variant thereof, or a combination thereof. The light chain polypeptide can include a variable light chain (VL) region and/or a constant light chain (CL) region.


The light chain polypeptide can include a complementarity determining region (“CDR”) set. The CDR set can contain three hypervariable regions of the VL region. Proceeding from N-terminus of the light chain polypeptide, these CDRs are denoted “CDR1,” “CDR2,” and “CDR3,” respectively. CDR1, CDR2, and CDR3 of the light chain polypeptide can contribute to binding or recognition of the antigen.


(3) Protease Cleavage Site


The recombinant nucleic acid sequence construct can include heterologous nucleic acid sequence encoding a protease cleavage site. The protease cleavage site can be recognized by a protease or peptidase. The protease can be an endopeptidase or endoprotease, for example, but not limited to, furin, elastase, HtrA, calpain, trypsin, chymotrypsin, trypsin, and pepsin. The protease can be furin. In other embodiments, the protease can be a serine protease, a threonine protease, cysteine protease, aspartate protease, metalloprotease, glutamic acid protease, or any protease that cleaves an internal peptide bond (i.e., does not cleave the N-terminal or C-terminal peptide bond).


The protease cleavage site can include one or more amino acid sequences that promote or increase the efficiency of cleavage. The one or more amino acid sequences can promote or increase the efficiency of forming or generating discrete polypeptides. The one or more amino acids sequences can include a 2A peptide sequence.


(4) Linker Sequence


The recombinant nucleic acid sequence construct can include one or more linker sequences. The linker sequence can spatially separate or link the one or more components described herein. In other embodiments, the linker sequence can encode an amino acid sequence that spatially separates or links two or more polypeptides.


(5) Promoter


The recombinant nucleic acid sequence construct can include one or more promoters. The one or more promoters may be any promoter that is capable of driving gene expression and regulating gene expression. Such a promoter is a cis-acting sequence element required for transcription via a DNA dependent RNA polymerase. Selection of the promoter used to direct gene expression depends on the particular application. The promoter may be positioned about the same distance from the transcription start in the recombinant nucleic acid sequence construct as it is from the transcription start site in its natural setting. However, variation in this distance may be accommodated without loss of promoter function.


The promoter may be operably linked to the heterologous nucleic acid sequence encoding the heavy chain polypeptide and/or light chain polypeptide. The promoter may be a promoter shown effective for expression in eukaryotic cells. The promoter operably linked to the coding sequence may be a CMV promoter, a promoter from simian virus 40 (SV40), such as SV40 early promoter and SV40 later promoter, a mouse mammary tumor virus (MMTV) promoter, a human immunodeficiency virus (HIV) promoter such as the bovine immunodeficiency virus (BIV) long terminal repeat (LTR) promoter, a Moloney virus promoter, an avian leukosis virus (ALV) promoter, a cytomegalovirus (CMV) promoter such as the CMV immediate early promoter, Epstein Barr virus (EBV) promoter, or a Rous sarcoma virus (RSV) promoter. The promoter may also be a promoter from a human gene such as human actin, human myosin, human hemoglobin, human muscle creatine, human polyhedrin, or human metalothionein.


The promoter can be a constitutive promoter or an inducible promoter, which initiates transcription only when the host cell is exposed to some particular external stimulus. In the case of a multicellular organism, the promoter can also be specific to a particular tissue or organ or stage of development. The promoter may also be a tissue specific promoter, such as a muscle or skin specific promoter, natural or synthetic. Examples of such promoters are described in US patent application publication no. US20040175727, the contents of which are incorporated herein in its entirety.


The promoter can be associated with an enhancer. The enhancer can be located upstream of the coding sequence. The enhancer may be human actin, human myosin, human hemoglobin, human muscle creatine or a viral enhancer such as one from CMV, FMDV, RSV or EBV. Polynucleotide function enhances are described in U.S. Pat. Nos. 5,593,972, 5,962,428, and WO94/016737, the contents of each are fully incorporated by reference.


(6) Intron


The recombinant nucleic acid sequence construct can include one or more introns. Each intron can include functional splice donor and acceptor sites. The intron can include an enhancer of splicing. The intron can include one or more signals required for efficient splicing.


(7) Transcription Termination Region


The recombinant nucleic acid sequence construct can include one or more transcription termination regions. The transcription termination region can be downstream of the coding sequence to provide for efficient termination. The transcription termination region can be obtained from the same gene as the promoter described above or can be obtained from one or more different genes.


(8) Initiation Codon


The recombinant nucleic acid sequence construct can include one or more initiation codons. The initiation codon can be located upstream of the coding sequence. The initiation codon can be in frame with the coding sequence. The initiation codon can be associated with one or more signals required for efficient translation initiation, for example, but not limited to, a ribosome binding site.


(9) Termination Codon


The recombinant nucleic acid sequence construct can include one or more termination or stop codons. The termination codon can be downstream of the coding sequence. The termination codon can be in frame with the coding sequence. The termination codon can be associated with one or more signals required for efficient translation termination.


(10) Polyadenylation Signal


The recombinant nucleic acid sequence construct can include one or more polyadenylation signals. The polyadenylation signal can include one or more signals required for efficient polyadenylation of the transcript. The polyadenylation signal can be positioned downstream of the coding sequence. The polyadenylation signal may be a SV40 polyadenylation signal, LTR polyadenylation signal, bovine growth hormone (bGH) polyadenylation signal, human growth hormone (hGH) polyadenylation signal, or human β-globin polyadenylation signal. The SV40 polyadenylation signal may be a polyadenylation signal from a pCEP4 plasmid (Invitrogen, San Diego, Calif.).


(11) Leader Sequence


The recombinant nucleic acid sequence construct can include one or more leader sequences. The leader sequence can encode a signal peptide. The signal peptide can be an immunoglobulin (Ig) signal peptide, for example, but not limited to, an IgG signal peptide and a IgE signal peptide.


Arrangement of the Recombinant Nucleic Acid Sequence Construct

As described above, the recombinant nucleic acid sequence can include one or more recombinant nucleic acid sequence constructs, in which each recombinant nucleic acid sequence construct can include one or more components. The one or more components are described in detail above. The one or more components, when included in the recombinant nucleic acid sequence construct, can be arranged in any order relative to one another. In some embodiments, the one or more components can be arranged in the recombinant nucleic acid sequence construct as described below.


(12) Arrangement 1


In one arrangement, a first recombinant nucleic acid sequence construct can include the heterologous nucleic acid sequence encoding the heavy chain polypeptide and a second recombinant nucleic acid sequence construct can include the heterologous nucleic acid sequence encoding the light chain polypeptide. The first recombinant nucleic acid sequence construct can be placed in a vector. The second recombinant nucleic acid sequence construct can be placed in a second or separate vector. Placement of the recombinant nucleic acid sequence construct into the vector is described in more detail below.


The first recombinant nucleic acid sequence construct can also include the promoter, intron, transcription termination region, initiation codon, termination codon, and/or polyadenylation signal. The first recombinant nucleic acid sequence construct can further include the leader sequence, in which the leader sequence is located upstream (or 5′) of the heterologous nucleic acid sequence encoding the heavy chain polypeptide. Accordingly, the signal peptide encoded by the leader sequence can be linked by a peptide bond to the heavy chain polypeptide.


The second recombinant nucleic acid sequence construct can also include the promoter, initiation codon, termination codon, and polyadenylation signal. The second recombinant nucleic acid sequence construct can further include the leader sequence, in which the leader sequence is located upstream (or 5′) of the heterologous nucleic acid sequence encoding the light chain polypeptide. Accordingly, the signal peptide encoded by the leader sequence can be linked by a peptide bond to the light chain polypeptide.


Accordingly, one example of arrangement 1 can include the first vector (and thus first recombinant nucleic acid sequence construct) encoding the heavy chain polypeptide that includes VH and CH1, and the second vector (and thus second recombinant nucleic acid sequence construct) encoding the light chain polypeptide that includes VL and CL. A second example of arrangement 1 can include the first vector (and thus first recombinant nucleic acid sequence construct) encoding the heavy chain polypeptide that includes VH, CH1, hinge region, CH2, and CH3, and the second vector (and thus second recombinant nucleic acid sequence construct) encoding the light chain polypeptide that includes VL and CL.


(13) Arrangement 2


In a second arrangement, the recombinant nucleic acid sequence construct can include the heterologous nucleic acid sequence encoding the heavy chain polypeptide and the heterologous nucleic acid sequence encoding the light chain polypeptide. The heterologous nucleic acid sequence encoding the heavy chain polypeptide can be positioned upstream (or 5′) of the heterologous nucleic acid sequence encoding the light chain polypeptide. Alternatively, the heterologous nucleic acid sequence encoding the light chain polypeptide can be positioned upstream (or 5′) of the heterologous nucleic acid sequence encoding the heavy chain polypeptide.


The recombinant nucleic acid sequence construct can be placed in the vector as described in more detail below.


The recombinant nucleic acid sequence construct can include the heterologous nucleic acid sequence encoding the protease cleavage site and/or the linker sequence. If included in the recombinant nucleic acid sequence construct, the heterologous nucleic acid sequence encoding the protease cleavage site can be positioned between the heterologous nucleic acid sequence encoding the heavy chain polypeptide and the heterologous nucleic acid sequence encoding the light chain polypeptide. Accordingly, the protease cleavage site allows for separation of the heavy chain polypeptide and the light chain polypeptide into distinct polypeptides upon expression. In other embodiments, if the linker sequence is included in the recombinant nucleic acid sequence construct, then the linker sequence can be positioned between the heterologous nucleic acid sequence encoding the heavy chain polypeptide and the heterologous nucleic acid sequence encoding the light chain polypeptide.


The recombinant nucleic acid sequence construct can also include the promoter, intron, transcription termination region, initiation codon, termination codon, and/or polyadenylation signal. The recombinant nucleic acid sequence construct can include one or more promoters. The recombinant nucleic acid sequence construct can include two promoters such that one promoter can be associated with the heterologous nucleic acid sequence encoding the heavy chain polypeptide and the second promoter can be associated with the heterologous nucleic acid sequence encoding the light chain polypeptide. In still other embodiments, the recombinant nucleic acid sequence construct can include one promoter that is associated with the heterologous nucleic acid sequence encoding the heavy chain polypeptide and the heterologous nucleic acid sequence encoding the light chain polypeptide.


The recombinant nucleic acid sequence construct can further include two leader sequences, in which a first leader sequence is located upstream (or 5′) of the heterologous nucleic acid sequence encoding the heavy chain polypeptide and a second leader sequence is located upstream (or 5′) of the heterologous nucleic acid sequence encoding the light chain polypeptide. Accordingly, a first signal peptide encoded by the first leader sequence can be linked by a peptide bond to the heavy chain polypeptide and a second signal peptide encoded by the second leader sequence can be linked by a peptide bond to the light chain polypeptide.


Accordingly, one example of arrangement 2 can include the vector (and thus recombinant nucleic acid sequence construct) encoding the heavy chain polypeptide that includes VH and CH1, and the light chain polypeptide that includes VL and CL, in which the linker sequence is positioned between the heterologous nucleic acid sequence encoding the heavy chain polypeptide and the heterologous nucleic acid sequence encoding the light chain polypeptide.


A second example of arrangement of 2 can include the vector (and thus recombinant nucleic acid sequence construct) encoding the heavy chain polypeptide that includes VH and CH1, and the light chain polypeptide that includes VL and CL, in which the heterologous nucleic acid sequence encoding the protease cleavage site is positioned between the heterologous nucleic acid sequence encoding the heavy chain polypeptide and the heterologous nucleic acid sequence encoding the light chain polypeptide.


A third example of arrangement 2 can include the vector (and thus recombinant nucleic acid sequence construct) encoding the heavy chain polypeptide that includes VH, CH1, hinge region, CH2, and CH3, and the light chain polypeptide that includes VL and CL, in which the linker sequence is positioned between the heterologous nucleic acid sequence encoding the heavy chain polypeptide and the heterologous nucleic acid sequence encoding the light chain polypeptide.


A forth example of arrangement of 2 can include the vector (and thus recombinant nucleic acid sequence construct) encoding the heavy chain polypeptide that includes VH, CH1, hinge region, CH2, and CH3, and the light chain polypeptide that includes VL and CL, in which the heterologous nucleic acid sequence encoding the protease cleavage site is positioned between the heterologous nucleic acid sequence encoding the heavy chain polypeptide and the heterologous nucleic acid sequence encoding the light chain polypeptide.


Expression from the Recombinant Nucleic Acid Sequence Construct


As described above, the recombinant nucleic acid sequence construct can include, amongst the one or more components, the heterologous nucleic acid sequence encoding the heavy chain polypeptide and/or the heterologous nucleic acid sequence encoding the light chain polypeptide. Accordingly, the recombinant nucleic acid sequence construct can facilitate expression of the heavy chain polypeptide and/or the light chain polypeptide.


When arrangement 1 as described above is utilized, the first recombinant nucleic acid sequence construct can facilitate the expression of the heavy chain polypeptide and the second recombinant nucleic acid sequence construct can facilitate expression of the light chain polypeptide. When arrangement 2 as described above is utilized, the recombinant nucleic acid sequence construct can facilitate the expression of the heavy chain polypeptide and the light chain polypeptide.


Upon expression, for example, but not limited to, in a cell, organism, or mammal, the heavy chain polypeptide and the light chain polypeptide can assemble into the synthetic antibody. In particular, the heavy chain polypeptide and the light chain polypeptide can interact with one another such that assembly results in the synthetic antibody being capable of binding the antigen. In other embodiments, the heavy chain polypeptide and the light chain polypeptide can interact with one another such that assembly results in the synthetic antibody being more immunogenic as compared to an antibody not assembled as described herein. In still other embodiments, the heavy chain polypeptide and the light chain polypeptide can interact with one another such that assembly results in the synthetic antibody being capable of eliciting or inducing an immune response against the antigen.


Vector

The recombinant nucleic acid sequence construct described above can be placed in one or more vectors. The one or more vectors can contain an origin of replication. The one or more vectors can be a plasmid, bacteriophage, bacterial artificial chromosome or yeast artificial chromosome. The one or more vectors can be either a self-replication extra chromosomal vector, or a vector which integrates into a host genome.


Vectors include, but are not limited to, plasmids, expression vectors, recombinant viruses, any form of recombinant “naked DNA” vector, and the like. A “vector” comprises a nucleic acid which can infect, transfect, transiently or permanently transduce a cell. It will be recognized that a vector can be a naked nucleic acid, or a nucleic acid complexed with protein or lipid. The vector optionally comprises viral or bacterial nucleic acids and/or proteins, and/or membranes (e.g., a cell membrane, a viral lipid envelope, etc.). Vectors include, but are not limited to replicons (e.g., RNA replicons, bacteriophages) to which fragments of DNA may be attached and become replicated. Vectors thus include, but are not limited to RNA, autonomous self-replicating circular or linear DNA or RNA (e.g., plasmids, viruses, and the like, see, e.g., U.S. Pat. No. 5,217,879), and include both the expression and non-expression plasmids. In some embodiments, the vector includes linear DNA, enzymatic DNA or synthetic DNA. Where a recombinant microorganism or cell culture is described as hosting an “expression vector” this includes both extra-chromosomal circular and linear DNA and DNA that has been incorporated into the host chromosome(s). Where a vector is being maintained by a host cell, the vector may either be stably replicated by the cells during mitosis as an autonomous structure, or is incorporated within the host's genome.


The one or more vectors can be a heterologous expression construct, which is generally a plasmid that is used to introduce a specific gene into a target cell. Once the expression vector is inside the cell, the heavy chain polypeptide and/or light chain polypeptide that are encoded by the recombinant nucleic acid sequence construct is produced by the cellular-transcription and translation machinery ribosomal complexes. The one or more vectors can express large amounts of stable messenger RNA, and therefore proteins.


(14) Expression Vector


The one or more vectors can be a circular plasmid or a linear nucleic acid. The circular plasmid and linear nucleic acid are capable of directing expression of a particular nucleotide sequence in an appropriate subject cell. The one or more vectors comprising the recombinant nucleic acid sequence construct may be chimeric, meaning that at least one of its components is heterologous with respect to at least one of its other components.


(15) Plasmid


The one or more vectors can be a plasmid. The plasmid may be useful for transfecting cells with the recombinant nucleic acid sequence construct. The plasmid may be useful for introducing the recombinant nucleic acid sequence construct into the subject. The plasmid may also comprise a regulatory sequence, which may be well suited for gene expression in a cell into which the plasmid is administered.


The plasmid may also comprise a mammalian origin of replication in order to maintain the plasmid extra-chromosomally and produce multiple copies of the plasmid in a cell. The plasmid may be pVAX1, pCEP4 or pREP4 from Invitrogen (San Diego, Calif.), which may comprise the Epstein Barr virus origin of replication and nuclear antigen EBNA-1 coding region, which may produce high copy episomal replication without integration. The backbone of the plasmid may be pAV0242. The plasmid may be a replication defective adenovirus type 5 (Ad5) plasmid.


The plasmid may be pSE420 (Invitrogen, San Diego, Calif.), which may be used for protein production in Escherichia coli (E. coli). The plasmid may also be pYES2 (Invitrogen, San Diego, Calif.), which may be used for protein production in Saccharomyces cerevisiae strains of yeast. The plasmid may also be of the MAXBAC™ complete baculovirus expression system (Invitrogen, San Diego, Calif.), which may be used for protein production in insect cells. The plasmid may also be pcDNAI or pcDNA3 (Invitrogen, San Diego, Calif.), which may be used for protein production in mammalian cells such as Chinese hamster ovary (CHO) cells.


(16) RNA


In one embodiment, the nucleic acid is an RNA molecule. In one embodiment, the RNA molecule is transcribed from a DNA sequence described herein. For example, in some embodiments, the RNA molecule is encoded by a DNA sequence at least 90% homologous to SEQ ID NO: 1, or a variant thereof or a fragment thereof. In another embodiment, the nucleotide sequence comprises an RNA sequence transcribed by a DNA sequence encoding a polypeptide sequence of SEQ ID NO:2, or a variant thereof or a fragment thereof. Accordingly, in one embodiment, the invention provides an RNA molecule encoding one or more of the DMAbs. The RNA may be plus-stranded. Accordingly, in some embodiments, the RNA molecule can be translated by cells without needing any intervening replication steps such as reverse transcription. A RNA molecule useful with the invention may have a 5′ cap (e.g. a 7-methylguanosine). This cap can enhance in vivo translation of the RNA. The 5′ nucleotide of a RNA molecule useful with the invention may have a 5′ triphosphate group. In a capped RNA this may be linked to a 7-methylguanosine via a 5′-to-5′ bridge. A RNA molecule may have a 3′ poly-A tail. It may also include a poly-A polymerase recognition sequence (e.g. AAUAAA) near its 3′ end. A RNA molecule useful with the invention may be single-stranded. A RNA molecule useful with the invention may comprise synthetic RNA. In some embodiments, the RNA molecule is a naked RNA molecule. In one embodiment, the RNA molecule is comprised within a vector.


In one embodiment, the RNA has 5′ and 3′ UTRs. In one embodiment, the 5′ UTR is between zero and 3000 nucleotides in length. The length of 5′ and 3′ UTR sequences to be added to the coding region can be altered by different methods, including, but not limited to, designing primers for PCR that anneal to different regions of the UTRs. Using this approach, one of ordinary skill in the art can modify the 5′ and 3′ UTR lengths required to achieve optimal translation efficiency following transfection of the transcribed RNA.


The 5′ and 3′ UTRs can be the naturally occurring, endogenous 5′ and 3′ UTRs for the gene of interest. Alternatively, UTR sequences that are not endogenous to the gene of interest can be added by incorporating the UTR sequences into the forward and reverse primers or by any other modifications of the template. The use of UTR sequences that are not endogenous to the gene of interest can be useful for modifying the stability and/or translation efficiency of the RNA. For example, it is known that AU-rich elements in 3′ UTR sequences can decrease the stability of RNA. Therefore, 3′ UTRs can be selected or designed to increase the stability of the transcribed RNA based on properties of UTRs that are well known in the art.


In one embodiment, the 5′ UTR can contain the Kozak sequence of the endogenous gene. Alternatively, when a 5′ UTR that is not endogenous to the gene of interest is being added by PCR as described above, a consensus Kozak sequence can be redesigned by adding the 5′ UTR sequence. Kozak sequences can increase the efficiency of translation of some RNA transcripts, but does not appear to be required for all RNAs to enable efficient translation. The requirement for Kozak sequences for many RNAs is known in the art. In other embodiments, the 5′ UTR can be derived from an RNA virus whose RNA genome is stable in cells. In other embodiments, various nucleotide analogues can be used in the 3′ or 5′ UTR to impede exonuclease degradation of the RNA.


In one embodiment, the RNA has both a cap on the 5′ end and a 3′ poly(A) tail which determine ribosome binding, initiation of translation and stability of RNA in the cell.


In one embodiment, the RNA is a nucleoside-modified RNA. Nucleoside-modified RNA have particular advantages over non-modified RNA, including for example, increased stability, low or absent innate immunogenicity, and enhanced translation.


(17) Circular and Linear Vector


The one or more vectors may be circular plasmid, which may transform a target cell by integration into the cellular genome or exist extra-chromosomally (e.g., autonomous replicating plasmid with an origin of replication). The vector can be pVAX, pcDNA3.0, or provax, or any other expression vector capable of expressing the heavy chain polypeptide and/or light chain polypeptide encoded by the recombinant nucleic acid sequence construct.


Also provided herein is a linear nucleic acid, or linear expression cassette (“LEC”), that is capable of being efficiently delivered to a subject via electroporation and expressing the heavy chain polypeptide and/or light chain polypeptide encoded by the recombinant nucleic acid sequence construct. The LEC may be any linear DNA devoid of any phosphate backbone. The LEC may not contain any antibiotic resistance genes and/or a phosphate backbone. The LEC may not contain other nucleic acid sequences unrelated to the desired gene expression.


The LEC may be derived from any plasmid capable of being linearized. The plasmid may be capable of expressing the heavy chain polypeptide and/or light chain polypeptide encoded by the recombinant nucleic acid sequence construct. The plasmid can be pNP (Puerto Rico/34) or pM2 (New Caledonia/99). The plasmid may be WLV009, pVAX, pcDNA3.0, or provax, or any other expression vector capable of expressing the heavy chain polypeptide and/or light chain polypeptide encoded by the recombinant nucleic acid sequence construct.


The LEC can be perM2. The LEC can be perNP. perNP and perMR can be derived from pNP (Puerto Rico/34) and pM2 (New Caledonia/99), respectively.


(18) Viral Vectors


In one embodiment, viral vectors are provided herein which are capable of delivering a nucleic acid of the invention to a cell. The expression vector may be provided to a cell in the form of a viral vector. Viral vector technology is well known in the art and is described, for example, in Sambrook et al. (2001), and in Ausubel et al. (1997), and in other virology and molecular biology manuals. Viruses, which are useful as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. In general, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction endonuclease sites, and one or more selectable markers. (See, e.g., WO 01/96584; WO 01/29058; and U.S. Pat. No. 6,326,193. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.


(19) Method of Preparing the Vector


Provided herein is a method for preparing the one or more vectors in which the recombinant nucleic acid sequence construct has been placed. After the final subcloning step, the vector can be used to inoculate a cell culture in a large scale fermentation tank, using known methods in the art.


In other embodiments, after the final subcloning step, the vector can be used with one or more electroporation (EP) devices. The EP devices are described below in more detail.


The one or more vectors can be formulated or manufactured using a combination of known devices and techniques, but preferably they are manufactured using a plasmid manufacturing technique that is described in a licensed, co-pending U.S. provisional application U.S. Ser. No. 60/939,792, which was filed on May 23, 2007. In some examples, the DNA plasmids described herein can be formulated at concentrations greater than or equal to 10 mg/mL. The manufacturing techniques also include or incorporate various devices and protocols that are commonly known to those of ordinary skill in the art, in addition to those described in U.S. Ser. No. 60/939,792, including those described in a licensed patent, U.S. Pat. No. 7,238,522, which issued on Jul. 3, 2007. The above-referenced application and patent, U.S. Ser. No. 60/939,792 and U.S. Pat. No. 7,238,522, respectively, are hereby incorporated in their entirety.


3. ANTIBODY

As described above, the recombinant nucleic acid sequence can encode the antibody, a fragment thereof, a variant thereof, or a combination thereof. The antibody can bind or react with the antigen, which is described in more detail below.


The antibody may comprise a heavy chain and a light chain complementarity determining region (“CDR”) set, respectively interposed between a heavy chain and a light chain framework (“FR”) set which provide support to the CDRs and define the spatial relationship of the CDRs relative to each other. The CDR set may contain three hypervariable regions of a heavy or light chain V region. Proceeding from the N-terminus of a heavy or light chain, these regions are denoted as “CDR1,” “CDR2,” and “CDR3,” respectively. An antigen-binding site, therefore, may include six CDRs, comprising the CDR set from each of a heavy and a light chain V region.


The proteolytic enzyme papain preferentially cleaves IgG molecules to yield several fragments, two of which (the F(ab) fragments) each comprise a covalent heterodimer that includes an intact antigen-binding site. The enzyme pepsin is able to cleave IgG molecules to provide several fragments, including the F(ab)2 fragment, which comprises both antigen-binding sites. Accordingly, the antibody can be the Fab or F(ab′)2. The Fab can include the heavy chain polypeptide and the light chain polypeptide. The heavy chain polypeptide of the Fab can include the VH region and the CH1 region. The light chain of the Fab can include the VL region and CL region.


The antibody can be an immunoglobulin (Ig). The Ig can be, for example, IgA, IgM, IgD, IgE, and IgG. The immunoglobulin can include the heavy chain polypeptide and the light chain polypeptide. The heavy chain polypeptide of the immunoglobulin can include a VH region, a CH1 region, a hinge region, a CH2 region, and a CH3 region. The light chain polypeptide of the immunoglobulin can include a VL region and CL region.


The antibody can be a polyclonal or monoclonal antibody. The antibody can be a chimeric antibody, a single chain antibody, an affinity matured antibody, a human antibody, a humanized antibody, or a fully human antibody. The humanized antibody can be an antibody from a non-human species that binds the desired antigen having one or more complementarity determining regions (CDRs) from the non-human species and framework regions from a human immunoglobulin molecule.


The antibody can be a bispecific antibody as described below in more detail. The antibody can be a bifunctional antibody as also described below in more detail.


As described above, the antibody can be generated in the subject upon administration of the composition to the subject. The antibody may have a half-life within the subject. In some embodiments, the antibody may be modified to extend or shorten its half-life within the subject. Such modifications are described below in more detail.


The antibody can be defucosylated as described in more detail below.


In one embodiment, the antibody binds a Hepatitis B virus antigen. In one embodiment, the antibody binds a Hepatitis B virus surface antigen. In one embodiment, the antibody binds at least one epitope of a Hepatitis B virus surface antigen. For example, in one embodiment, the antibody binds Hepatitis B virus surface antigen epitope comprising the reside W531, 1527, or both.


The antibody may be modified to reduce or prevent antibody-dependent enhancement (ADE) of disease associated with the antigen as described in more detail below.


Bispecific Antibody

The recombinant nucleic acid sequence can encode a bispecific antibody, a fragment thereof, a variant thereof, or a combination thereof. The bispecific antibody can bind or react with two antigens, for example, two of the antigens described below in more detail. The bispecific antibody can be comprised of fragments of two of the antibodies described herein, thereby allowing the bispecific antibody to bind or react with two desired target molecules, which may include the antigen, which is described below in more detail, a ligand, including a ligand for a receptor, a receptor, including a ligand-binding site on the receptor, a ligand-receptor complex, and a marker.


The invention provides novel bispecific antibodies comprising a first antigen-binding site that specifically binds to a first target and a second antigen-binding site that specifically binds to a second target, with particularly advantageous properties such as producibility, stability, binding affinity, biological activity, specific targeting of certain T cells, targeting efficiency and reduced toxicity. In some instances, there are bispecific antibodies, wherein the bispecific antibody binds to the first target with high affinity and to the second target with low affinity. In other instances, there are bispecific antibodies, wherein the bispecific antibody binds to the first target with low affinity and to the second target with high affinity. In other instances, there are bispecific antibodies, wherein the bispecific antibody binds to the first target with a desired affinity and to the second target with a desired affinity.


In one embodiment, the bispecific antibody is a bivalent antibody comprising a) a first light chain and a first heavy chain of an antibody specifically binding to a first antigen, and b) a second light chain and a second heavy chain of an antibody specifically binding to a second antigen.


A bispecific antibody molecule according to the invention may have two binding sites of any desired specificity. In some embodiments one of the binding sites is capable of binding a tumor associated antigen. In some embodiments, the binding site included in the Fab fragment is a binding site specific for a Hepatitis B virus antigen. In some embodiments, the binding site included in the single chain Fv fragment is a binding site specific for a Hepatitis B virus antigen such as a Hepatitis B virus surface antigen.


In some embodiments, one of the binding sites of a bispecific antibody molecule according to the invention is able to bind a T-cell specific receptor molecule and/or a natural killer cell (NK cell) specific receptor molecule. A T-cell specific receptor is the so called “T-cell receptor” (TCRs), which allows a T cell to bind to and, if additional signals are present, to be activated by and respond to an epitope/antigen presented by another cell called the antigen-presenting cell or APC. The T cell receptor is known to resemble a Fab fragment of a naturally occurring immunoglobulin. It is generally monovalent, encompassing. alpha. - and .beta.-chains, in some embodiments it encompasses .gamma.-chains and .delta-chains (supra). Accordingly, in some embodiments the TCR is TCR (alpha/beta) and in some embodiments it is TCR (gamma/delta). The T cell receptor forms a complex with the CD3 T-Cell co-receptor. CD3 is a protein complex and is composed of four distinct chains. In mammals, the complex contains a CD3γ chain, a CD36 chain, and two CD3E chains. These chains associate with a molecule known as the T cell receptor (TCR) and the ζ-chain to generate an activation signal in T lymphocytes. Hence, in some embodiments a T-cell specific receptor is the CD3 T-Cell co-receptor. In some embodiments, a T-cell specific receptor is CD28, a protein that is also expressed on T cells. CD28 can provide co-stimulatory signals, which are required for T cell activation. CD28 plays important roles in T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Yet a further example of a T-cell specific receptor is CD134, also termed Ox40. CD134/OX40 is being expressed after 24 to 72 hours following activation and can be taken to define a secondary costimulatory molecule. Another example of a T-cell receptor is 4-1 BB capable of binding to 4-1 BB-Ligand on antigen presenting cells (APCs), whereby a costimulatory signal for the T cell is generated. Another example of a receptor predominantly found on T-cells is CD5, which is also found on B cells at low levels. A further example of a receptor modifying T cell functions is CD95, also known as the Fas receptor, which mediates apoptotic signaling by Fas-ligand expressed on the surface of other cells. CD95 has been reported to modulate TCR/CD3-driven signaling pathways in resting T lymphocytes.


An example of a NK cell specific receptor molecule is CD16, a low affinity Fc receptor and NKG2D. An example of a receptor molecule that is present on the surface of both T cells and natural killer (NK) cells is CD2 and further members of the CD2-superfamily. CD2 is able to act as a co-stimulatory molecule on T and NK cells.


In some embodiments, the first binding site of a bispecific antibody molecule binds a Hepatitis B virus antigen and the second binding site binds a T cell specific receptor molecule and/or a natural killer (NK) cell specific receptor molecule.


In some embodiments, the first binding site of the antibody molecule binds the Hepatitis B virus surface antigen, and the second binding site binds a T cell specific receptor molecule and/or a natural killer (NK) cell specific receptor molecule. In some embodiments, the first binding site of the antibody molecule binds a Hepatitis B virus surface antigen and the second binding site binds one of CD3, the T cell receptor (TCR), CD28, CD16, NKG2D, Ox40, 4-1BB, CD2, CD5 and CD95.


In some embodiments, the first binding site of the antibody molecule binds a T cell specific receptor molecule and/or a natural killer (NK) cell specific receptor molecule and the second binding site binds a Hepatitis B virus antigen. In some embodiments, the first binding site of the antibody binds a T cell specific receptor molecule and/or a natural killer (NK) cell specific receptor molecule and the second binding site binds the Hepatitis B virus surface antigen. In some embodiments, the first binding site of the antibody binds one of CD3, the T cell receptor (TCR), CD28, CD16, NKG2D, Ox40, 4-1BB, CD2, CD5 and CD95, and the second binding site binds the Hepatitis B virus surface antigen.


Bifunctional Antibody

The recombinant nucleic acid sequence can encode a bifunctional antibody, a fragment thereof, a variant thereof, or a combination thereof. The bifunctional antibody can bind or react with the antigen described below. The bifunctional antibody can also be modified to impart an additional functionality to the antibody beyond recognition of and binding to the antigen. Such a modification can include, but is not limited to, coupling to factor H or a fragment thereof. Factor H is a soluble regulator of complement activation and thus, may contribute to an immune response via complement-mediated lysis (CML).


Extension of Antibody Half-Life

As described above, the antibody may be modified to extend or shorten the half-life of the antibody in the subject. The modification may extend or shorten the half-life of the antibody in the serum of the subject.


The modification may be present in a constant region of the antibody. The modification may be one or more amino acid substitutions in a constant region of the antibody that extend the half-life of the antibody as compared to a half-life of an antibody not containing the one or more amino acid substitutions. The modification may be one or more amino acid substitutions in the CH2 domain of the antibody that extend the half-life of the antibody as compared to a half-life of an antibody not containing the one or more amino acid substitutions.


In some embodiments, the one or more amino acid substitutions in the constant region may include replacing a methionine residue in the constant region with a tyrosine residue, a serine residue in the constant region with a threonine residue, a threonine residue in the constant region with a glutamate residue, or any combination thereof, thereby extending the half-life of the antibody.


In other embodiments, the one or more amino acid substitutions in the constant region may include replacing a methionine residue in the CH2 domain with a tyrosine residue, a serine residue in the CH2 domain with a threonine residue, a threonine residue in the CH2 domain with a glutamate residue, or any combination thereof, thereby extending the half-life of the antibody.


Defucosylation

The recombinant nucleic acid sequence can encode an antibody that is not fucosylated (i.e., a defucosylated antibody or a non-fucosylated antibody), a fragment thereof, a variant thereof, or a combination thereof. Fucosylation includes the addition of the sugar fucose to a molecule, for example, the attachment of fucose to N-glycans, 0-glycans and glycolipids. Accordingly, in a defucosylated antibody, fucose is not attached to the carbohydrate chains of the constant region. In turn, this lack of fucosylation may improve FcγRIIIa binding and antibody directed cellular cytotoxic (ADCC) activity by the antibody as compared to the fucosylated antibody. Therefore, in some embodiments, the non-fucosylated antibody may exhibit increased ADCC activity as compared to the fucosylated antibody.


The antibody may be modified so as to prevent or inhibit fucosylation of the antibody. In some embodiments, such a modified antibody may exhibit increased ADCC activity as compared to the unmodified antibody. The modification may be in the heavy chain, light chain, or a combination thereof. The modification may be one or more amino acid substitutions in the heavy chain, one or more amino acid substitutions in the light chain, or a combination thereof.


Reduced ADE Response

The antibody may be modified to reduce or prevent antibody-dependent enhancement (ADE) of disease associated with the antigen, but still neutralize the antigen.


In some embodiments, the antibody may be modified to include one or more amino acid substitutions that reduce or prevent binding of the antibody to FcγR1a. The one or more amino acid substitutions may be in the constant region of the antibody. The one or more amino acid substitutions may include replacing a leucine residue with an alanine residue in the constant region of the antibody, i.e., also known herein as LA, LA mutation or LA substitution. The one or more amino acid substitutions may include replacing two leucine residues, each with an alanine residue, in the constant region of the antibody and also known herein as LALA, LALA mutation, or LALA substitution. The presence of the LALA substitutions may prevent or block the antibody from binding to FcγR1a, and thus, the modified antibody does not enhance or cause ADE of disease associated with the antigen, but still neutralizes the antigen.


4. ANTIGEN

The synthetic antibody is directed to the antigen or fragment or variant thereof. The antigen can be a nucleic acid sequence, an amino acid sequence, a polysaccharide or a combination thereof. The nucleic acid sequence can be DNA, RNA, cDNA, a variant thereof, a fragment thereof, or a combination thereof. The amino acid sequence can be a protein, a peptide, a variant thereof, a fragment thereof, or a combination thereof. The polysaccharide can be a nucleic acid encoded polysaccharide.


The antigen can be from a virus. The antigen can be associated with viral infection. In one embodiment, the antigen can be associated with Hepatitis B infection. In one embodiment, the antigen can be a Hepatitis B surface antigen.


In one embodiment, the antigen can be a fragment of a Hepatitis B surface antigen. For example, in one embodiment, the antigen is a fragment of a Hepatitis B surface antigen.


In one embodiment, a synthetic antibody of the invention targets two or more antigens. In one embodiment, at least one antigen of a bispecific antibody is selected from the antigens described herein. In one embodiment, the two or more antigens are selected from the antigens described herein.


Viral Antigens

The viral antigen can be a viral antigen or fragment or variant thereof The virus can be a disease causing virus. The virus can be the Hepatitis B virus.


The antigen may be a Hepatitis B viral antigen, or fragment thereof, or variant thereof. The Hepatitis B antigen can be from a factor that allows the virus to replicate, infect or survive. Factors that allow a Hepatitis B virus to replicate or survive include, but are not limited to structural proteins and non-structural proteins. Such a protein can be a surface antigen.


5. EXCIPIENTS AND OTHER COMPONENTS OF THE COMPOSITION

The composition may further comprise a pharmaceutically acceptable excipient. The pharmaceutically acceptable excipient can be functional molecules such as vehicles, carriers, or diluents. The pharmaceutically acceptable excipient can be a transfection facilitating agent, which can include surface active agents, such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs, vesicles such as squalene and squalene, hyaluronic acid, lipids, liposomes, calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents.


The transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid. The transfection facilitating agent is poly-L-glutamate, and the poly-L-glutamate may be present in the composition at a concentration less than 6 mg/ml. The transfection facilitating agent may also include surface active agents such as immune-stimulating complexes (ISCOMS), Freunds incomplete adjuvant, LPS analog including monophosphoryl lipid A, muramyl peptides, quinone analogs and vesicles such as squalene and squalene, and hyaluronic acid may also be used administered in conjunction with the composition. The composition may also include a transfection facilitating agent such as lipids, liposomes, including lecithin liposomes or other liposomes known in the art, as a DNA-liposome mixture (see for example WO9324640), calcium ions, viral proteins, polyanions, polycations, or nanoparticles, or other known transfection facilitating agents. The transfection facilitating agent is a polyanion, polycation, including poly-L-glutamate (LGS), or lipid. Concentration of the transfection agent in the vaccine is less than 4 mg/ml, less than 2 mg/ml, less than 1 mg/ml, less than 0.750 mg/ml, less than 0.500 mg/ml, less than 0.250 mg/ml, less than 0.100 mg/ml, less than 0.050 mg/ml, or less than 0.010 mg/ml.


The composition may further comprise a genetic facilitator agent as described in U.S. Serial No. 021,579 filed Apr. 1, 1994, which is fully incorporated by reference.


The composition may comprise DNA at quantities of from about 1 nanogram to 100 milligrams; about 1 microgram to about 10 milligrams; or preferably about 0.1 microgram to about 10 milligrams; or more preferably about 1 milligram to about 2 milligrams. In some preferred embodiments, composition according to the present invention comprises about 5 nanogram to about 1000 micrograms of DNA. In some preferred embodiments, composition can contain about 10 nanograms to about 800 micrograms of DNA. In some preferred embodiments, the composition can contain about 0.1 to about 500 micrograms of DNA. In some preferred embodiments, the composition can contain about 1 to about 350 micrograms of DNA. In some preferred embodiments, the composition can contain about 25 to about 250 micrograms, from about 100 to about 200 micrograms, from about 1 nanogram to 100 milligrams; from about 1 microgram to about 10 milligrams; from about 0.1 microgram to about 10 milligrams; from about 1 milligram to about 2 milligrams, from about 5 nanograms to about 1000 micrograms, from about 10 nanograms to about 800 micrograms, from about 0.1 to about 500 micrograms, from about 1 to about 350 micrograms, from about 25 to about 250 micrograms, from about 100 to about 200 microgram of DNA.


The composition can be formulated according to the mode of administration to be used. An injectable pharmaceutical composition can be sterile, pyrogen free and particulate free. An isotonic formulation or solution can be used. Additives for isotonicity can include sodium chloride, dextrose, mannitol, sorbitol, and lactose. The composition can comprise a vasoconstriction agent. The isotonic solutions can include phosphate buffered saline. The composition can further comprise stabilizers including gelatin and albumin. The stabilizers can allow the formulation to be stable at room or ambient temperature for extended periods of time, including LGS or polycations or polyanions.


6. METHOD OF GENERATING THE SYNTHETIC ANTIBODY

The present invention also relates a method of generating the synthetic antibody. The method can include administering the composition to the subject in need thereof by using the method of delivery described in more detail below. Accordingly, the synthetic antibody is generated in the subject or in vivo upon administration of the composition to the subject.


The method can also include introducing the composition into one or more cells, and therefore, the synthetic antibody can be generated or produced in the one or more cells. The method can further include introducing the composition into one or more tissues, for example, but not limited to, skin and muscle, and therefore, the synthetic antibody can be generated or produced in the one or more tissues.


7. METHOD OF IDENTIFYING OR SCREENING FOR THE ANTIBODY

The present invention further relates to a method of identifying or screening for the antibody described above, which is reactive to or binds the antigen described above. The method of identifying or screening for the antibody can use the antigen in methodologies known in those skilled in art to identify or screen for the antibody. Such methodologies can include, but are not limited to, selection of the antibody from a library (e.g., phage display) and immunization of an animal followed by isolation and/or purification of the antibody.


8. METHOD OF DELIVERY OF THE COMPOSITION

The present invention also relates to a method of delivering the composition to the subject in need thereof. The method of delivery can include, administering the composition to the subject. Administration can include, but is not limited to, DNA injection with and without in vivo electroporation, liposome mediated delivery, and nanoparticle facilitated delivery.


The mammal receiving delivery of the composition may be human, primate, non-human primate, cow, cattle, sheep, goat, antelope, bison, water buffalo, bison, bovids, deer, hedgehogs, elephants, llama, alpaca, mice, rats, and chicken.


The composition may be administered by different routes including orally, parenterally, sublingually, transdermally, rectally, transmucosally, topically, via inhalation, via buccal administration, intrapleurally, intravenous, intraarterial, intraperitoneal, subcutaneous, intramuscular, intranasal intrathecal, and intraarticular or combinations thereof. For veterinary use, the composition may be administered as a suitably acceptable formulation in accordance with normal veterinary practice. The veterinarian can readily determine the dosing regimen and route of administration that is most appropriate for a particular animal. The composition may be administered by traditional syringes, needleless injection devices, “microprojectile bombardment gone guns”, or other physical methods such as electroporation (“EP”), “hydrodynamic method”, or ultrasound.


Electroporation

Administration of the composition via electroporation may be accomplished using electroporation devices that can be configured to deliver to a desired tissue of a mammal, a pulse of energy effective to cause reversible pores to form in cell membranes, and preferable the pulse of energy is a constant current similar to a preset current input by a user. The electroporation device may comprise an electroporation component and an electrode assembly or handle assembly. The electroporation component may include and incorporate one or more of the various elements of the electroporation devices, including: controller, current waveform generator, impedance tester, waveform logger, input element, status reporting element, communication port, memory component, power source, and power switch. The electroporation may be accomplished using an in vivo electroporation device, for example CELLECTRA EP system (Inovio Pharmaceuticals, Plymouth Meeting, Pa.) or Elgen electroporator (Inovio Pharmaceuticals, Plymouth Meeting, Pa.) to facilitate transfection of cells by the plasmid.


The electroporation component may function as one element of the electroporation devices, and the other elements are separate elements (or components) in communication with the electroporation component. The electroporation component may function as more than one element of the electroporation devices, which may be in communication with still other elements of the electroporation devices separate from the electroporation component. The elements of the electroporation devices existing as parts of one electromechanical or mechanical device may not be limited as the elements can function as one device or as separate elements in communication with one another. The electroporation component may be capable of delivering the pulse of energy that produces the constant current in the desired tissue, and includes a feedback mechanism. The electrode assembly may include an electrode array having a plurality of electrodes in a spatial arrangement, wherein the electrode assembly receives the pulse of energy from the electroporation component and delivers same to the desired tissue through the electrodes. At least one of the plurality of electrodes is neutral during delivery of the pulse of energy and measures impedance in the desired tissue and communicates the impedance to the electroporation component. The feedback mechanism may receive the measured impedance and can adjust the pulse of energy delivered by the electroporation component to maintain the constant current.


A plurality of electrodes may deliver the pulse of energy in a decentralized pattern. The plurality of electrodes may deliver the pulse of energy in the decentralized pattern through the control of the electrodes under a programmed sequence, and the programmed sequence is input by a user to the electroporation component. The programmed sequence may comprise a plurality of pulses delivered in sequence, wherein each pulse of the plurality of pulses is delivered by at least two active electrodes with one neutral electrode that measures impedance, and wherein a subsequent pulse of the plurality of pulses is delivered by a different one of at least two active electrodes with one neutral electrode that measures impedance.


The feedback mechanism may be performed by either hardware or software. The feedback mechanism may be performed by an analog closed-loop circuit. The feedback occurs every 50 μs, 20 μs, 10 μs or 1 μs, but is preferably a real-time feedback or instantaneous (i.e., substantially instantaneous as determined by available techniques for determining response time). The neutral electrode may measure the impedance in the desired tissue and communicates the impedance to the feedback mechanism, and the feedback mechanism responds to the impedance and adjusts the pulse of energy to maintain the constant current at a value similar to the preset current. The feedback mechanism may maintain the constant current continuously and instantaneously during the delivery of the pulse of energy.


Examples of electroporation devices and electroporation methods that may facilitate delivery of the composition of the present invention, include those described in U.S. Pat. No. 7,245,963 by Draghia-Akli, et al., U.S. Patent Pub. 2005/0052630 submitted by Smith, et al., the contents of which are hereby incorporated by reference in their entirety. Other electroporation devices and electroporation methods that may be used for facilitating delivery of the composition include those provided in co-pending and co-owned U.S. patent application Ser. No. 11/874,072, filed Oct. 17, 2007, which claims the benefit under 35 USC 119(e) to U.S. Provisional Application Ser. No. 60/852,149, filed Oct. 17, 2006, and 60/978,982, filed Oct. 10, 2007, all of which are hereby incorporated in their entirety.


U.S. Pat. No. 7,245,963 by Draghia-Akli, et al. describes modular electrode systems and their use for facilitating the introduction of a biomolecule into cells of a selected tissue in a body or plant. The modular electrode systems may comprise a plurality of needle electrodes; a hypodermic needle; an electrical connector that provides a conductive link from a programmable constant-current pulse controller to the plurality of needle electrodes; and a power source. An operator can grasp the plurality of needle electrodes that are mounted on a support structure and firmly insert them into the selected tissue in a body or plant. The biomolecules are then delivered via the hypodermic needle into the selected tissue. The programmable constant-current pulse controller is activated and constant-current electrical pulse is applied to the plurality of needle electrodes. The applied constant-current electrical pulse facilitates the introduction of the biomolecule into the cell between the plurality of electrodes. The entire content of U.S. Pat. No. 7,245,963 is hereby incorporated by reference.


U.S. Patent Pub. 2005/0052630 submitted by Smith, et al. describes an electroporation device which may be used to effectively facilitate the introduction of a biomolecule into cells of a selected tissue in a body or plant. The electroporation device comprises an electro-kinetic device (“EKD device”) whose operation is specified by software or firmware. The EKD device produces a series of programmable constant-current pulse patterns between electrodes in an array based on user control and input of the pulse parameters, and allows the storage and acquisition of current waveform data. The electroporation device also comprises a replaceable electrode disk having an array of needle electrodes, a central injection channel for an injection needle, and a removable guide disk. The entire content of U.S. Patent Pub. 2005/0052630 is hereby incorporated by reference.


The electrode arrays and methods described in U.S. Pat. No. 7,245,963 and U.S. Patent Pub. 2005/0052630 may be adapted for deep penetration into not only tissues such as muscle, but also other tissues or organs. Because of the configuration of the electrode array, the injection needle (to deliver the biomolecule of choice) is also inserted completely into the target organ, and the injection is administered perpendicular to the target issue, in the area that is pre-delineated by the electrodes The electrodes described in U.S. Pat. No. 7,245,963 and U.S. Patent Pub. 2005/005263 are preferably 20 mm long and 21 gauge.


Additionally, contemplated in some embodiments that incorporate electroporation devices and uses thereof, there are electroporation devices that are those described in the following patents: U.S. Pat. No. 5,273,525 issued Dec. 28, 1993, U.S. Pat. No. 6,110,161 issued Aug. 29, 2000, U.S. Pat. No. 6,261,281 issued Jul. 17, 2001, and U.S. Pat. No. 6,958,060 issued Oct. 25, 2005, and U.S. Pat. No. 6,939,862 issued Sep. 6, 2005. Furthermore, patents covering subject matter provided in U.S. Pat. No. 6,697,669 issued Feb. 24, 2004, which concerns delivery of DNA using any of a variety of devices, and U.S. Pat. No. 7,328,064 issued Feb. 5, 2008, drawn to method of injecting DNA are contemplated herein. The above-patents are incorporated by reference in their entirety.


9. METHOD OF TREATMENT

Also provided herein is a method of treating, protecting against, and/or preventing disease in a subject in need thereof by generating the synthetic antibody in the subject. The method can include administering the composition to the subject. Administration of the composition to the subject can be done using the method of delivery described above.


In certain embodiments, the invention provides a method of treating protecting against, and/or preventing a Hepatitis B virus infection. In one embodiment, the method treats, protects against, and/or prevents a disease associated with Hepatitis B virus. In certain embodiments, the invention provides a method of treating protecting against, and/or preventing both acute as well as chronic stages of hepatitis B infection.


In one embodiment the subject is has or is at risk of hepatitis B infection. In one embodiment, the subject is a pregnant woman infected with hepatitis B, and the method protects against maternal transmission of hepatitis B infection to an infant during childbirth. In one embodiment, the subject is an infant. In one embodiment, an infant is vaccinated and also given a passive antibody preparation to prevent them from getting infected and developing the disease.


Upon generation of the synthetic antibody in the subject, the synthetic antibody can bind to or react with the antigen. Such binding can neutralize the antigen, block recognition of the antigen by another molecule, for example, a protein or nucleic acid, and elicit or induce an immune response to the antigen, thereby treating, protecting against, and/or preventing the disease associated with the antigen in the subject.


The synthetic antibody can treat, prevent, and/or protect against disease in the subject administered the composition. The synthetic antibody by binding the antigen can treat, prevent, and/or protect against disease in the subject administered the composition. The synthetic antibody can promote survival of the disease in the subject administered the composition. In one embodiment, the synthetic antibody can provide increased survival of the disease in the subject over the expected survival of a subject having the disease who has not been administered the synthetic antibody. In various embodiments, the synthetic antibody can provide at least about a 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or a 100% increase in survival of the disease in subjects administered the composition over the expected survival in the absence of the composition. In one embodiment, the synthetic antibody can provide increased protection against the disease in the subject over the expected protection of a subject who has not been administered the synthetic antibody. In various embodiments, the synthetic antibody can protect against disease in at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 15%, 20%, 25%, 30%, 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, or 100% of subjects administered the composition over the expected protection in the absence of the composition.


The composition dose can be between 1 μg to 10 mg active component/kg body weight/time, and can be 20 μg to 10 mg component/kg body weight/time. The composition can be administered every 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or 31 days. The number of composition doses for effective treatment can be 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10.


In one embodiment, immunotherapy with the anti-HBsAg DMAb of the invention will have a direct HBsAg suppression effect. In one embodiment, immunotherapy with the anti-HBsAg DMAb of the invention can be used as immune “adjuvant” treatment to reduce viral protein load, in order to provide host immunity and optimize the effect of antiviral drugs.


10. USE IN COMBINATION

The present invention also provides a method of treating, protecting against, and/or preventing disease in a subject in need thereof by administering a combination of the synthetic antibody and a therapeutic agent. In one embodiment, the therapeutic agent is an antiviral agent. In one embodiment, the therapeutic is an antibiotic agent. In one embodiment, the therapeutic agent is an HBV vaccine. In one embodiment, the therapeutic agent is an DNA vaccine encoding at least one HBV antigen. In one embodiment, the therapeutic agent is a small-molecule drug or biologic.


The synthetic antibody and a therapeutic agent may be administered using any suitable method such that a combination of the synthetic antibody and therapeutic agent are both present in the subject. In one embodiment, the method may comprise administration of a first composition comprising a synthetic antibody of the invention by any of the methods described in detail above and administration of a second composition comprising a therapeutic agent less than 1, less than 2, less than 3, less than 4, less than 5, less than 6, less than 7, less than 8, less than 9 or less than 10 days following administration of the synthetic antibody. In one embodiment, the method may comprise administration of a first composition comprising a synthetic antibody of the invention by any of the methods described in detail above and administration of a second composition comprising a therapeutic agent more than 1, more than 2, more than 3, more than 4, more than 5, more than 6, more than 7, more than 8, more than 9 or more than 10 days following administration of the synthetic antibody. In one embodiment, the method may comprise administration of a first composition comprising a therapeutic agent and administration of a second composition comprising a synthetic antibody of the invention by any of the methods described in detail above less than 1, less than 2, less than 3, less than 4, less than 5, less than 6, less than 7, less than 8, less than 9 or less than 10 days following administration of the therapeutic agent. In one embodiment, the method may comprise administration of a first composition comprising a therapeutic agent and administration of a second composition comprising a synthetic antibody of the invention by any of the methods described in detail above more than 1, more than 2, more than 3, more than 4, more than 5, more than 6, more than 7, more than 8, more than 9 or more than 10 days following administration of the therapeutic agent. In one embodiment, the method may comprise administration of a first composition comprising a synthetic antibody of the invention by any of the methods described in detail above and a second composition comprising a therapeutic agent concurrently. In one embodiment, the method may comprise administration of a first composition comprising a synthetic antibody of the invention by any of the methods described in detail above and a second composition comprising a therapeutic agent concurrently. In one embodiment, the method may comprise administration of a single composition comprising a synthetic antibody of the invention and a therapeutic agent.


Non-limiting examples of antibiotics that can be used in combination with the synthetic antibody of the invention include aminoglycosides (e.g., gentamicin, amikacin, tobramycin), quinolones (e.g., ciprofloxacin, levofloxacin), cephalosporins (e.g., ceftazidime, cefepime, cefoperazone, cefpirome, ceftobiprole), antipseudomonal penicillins: carboxypenicillins (e.g., carbenicillin and ticarcillin) and ureidopenicillins (e.g., mezlocillin, azlocillin, and piperacillin), carbapenems (e.g., meropenem, imipenem, doripenem), polymyxins (e.g., polymyxin B and colistin) and monobactams (e.g., aztreonam).


11. GENERATION OF SYNTHETIC ANTIBODIES IN VITRO AND EX VIVO

In one embodiment, the synthetic antibody is generated in vitro or ex vivo. For example, in one embodiment, a nucleic acid encoding a synthetic antibody can be introduced and expressed in an in vitro or ex vivo cell. Methods of introducing and expressing genes into a cell are known in the art. In the context of an expression vector, the vector can be readily introduced into a host cell, e.g., mammalian, bacterial, yeast, or insect cell by any method in the art. For example, the expression vector can be transferred into a host cell by physical, chemical, or biological means.


Physical methods for introducing a polynucleotide into a host cell include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, and the like. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (2012, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). A preferred method for the introduction of a polynucleotide into a host cell is calcium phosphate transfection.


Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, and especially retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors can be derived from lentivirus, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, and the like. See, for example, U.S. Pat. Nos. 5,350,674 and 5,585,362.


Chemical means for introducing a polynucleotide into a host cell include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system for use as a delivery vehicle in vitro and in vivo is a liposome (e.g., an artificial membrane vesicle).


In the case where a non-viral delivery system is utilized, an exemplary delivery vehicle is a liposome. The use of lipid formulations is contemplated for the introduction of the nucleic acids into a host cell (in vitro, ex vivo or in vivo). In another aspect, the nucleic acid may be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of a liposome, interspersed within the lipid bilayer of a liposome, attached to a liposome via a linking molecule that is associated with both the liposome and the oligonucleotide, entrapped in a liposome, complexed with a liposome, dispersed in a solution containing a lipid, mixed with a lipid, combined with a lipid, contained as a suspension in a lipid, contained or complexed with a micelle, or otherwise associated with a lipid. Lipid, lipid/DNA or lipid/expression vector associated compositions are not limited to any particular structure in solution. For example, they may be present in a bilayer structure, as micelles, or with a “collapsed” structure. They may also simply be interspersed in a solution, possibly forming aggregates that are not uniform in size or shape. Lipids are fatty substances which may be naturally occurring or synthetic lipids. For example, lipids include the fatty droplets that naturally occur in the cytoplasm as well as the class of compounds which contain long-chain aliphatic hydrocarbons and their derivatives, such as fatty acids, alcohols, amines, amino alcohols, and aldehydes.


The present invention has multiple aspects, illustrated by the following non-limiting examples.


12. EXAMPLES

The present invention is further illustrated in the following Examples. It should be understood that these Examples, while indicating preferred embodiments of the invention, are given by way of illustration only. From the above discussion and these Examples, one skilled in the art can ascertain the essential characteristics of this invention, and without departing from the spirit and scope thereof, can make various changes and modifications of the invention to adapt it to various usages and conditions. Thus, various modifications of the invention in addition to those shown and described herein will be apparent to those skilled in the art from the foregoing description. Such modifications are also intended to fall within the scope of the appended claims.


Example 1: Neutralization of Hepatitis B Virus by a Novel DNA-Encoded Monoclonal Antibody

Hepatitis B virus infection is an important cause of acute and chronic liver disease in the United States and globally (Michailidis et al., 2017, Sci Rep, 7:16616; Scheel et al., 2016, Cell Host Microbe, 19:409-423; Kourtis et al., 2012, N Engl J Med, 366:1749-1752; Jourdain et al., 2018, N Engl J Med, 378:911-923). The total costs for this infection due to hospitalizations in the United States in 2006 was estimated to be $1.3 billion. The expenditure for prophylaxis for patients receiving liver transplantation (LT) is extremely high ranging between $2,000 to $10,000 per month in various countries for an undefined period and presumably for life (Hofmeister et al., 2019, Cold Spring Harb Perspect Med, 9:a033431; Hyun Kim et al., 2018, Clin Liver Dis, 12:1-4). As a consequence, there is a need for additional non-blood based and more cost-efficient modes of therapy to treat HBV infection.


In the present study, the construction and in vivo delivery of an optimized plasmid DNA which was designed to express an anti-HBV human monoclonal antibody which targets a functional region of the HBsAg is reported. The human DMAb is directed against the common “a determinant region” of HBsAg which carries a major HBV neutralizing epitope for anti-HBs that is highly conserved (Cerino et al., 2015, PLoS One, 10:e0125704; Shlomai et al., 2014, Proc Natl Acad Sci USA, 111:12193-12198). The DMAb reacted well with the native antigen as well as HepG2.2.15 cells but reacted poorly with the denatured antigen, supporting the three-dimensional nature of the epitope targeted. Advantages of the DMAb platform include the ease and cost effectiveness of producing DNA plasmids compared to protein therapies and the ease of delivery of plasmid DNA as well as its ability to generate sustained in vivo monoclonal antibody expression which in the present study lasted at least one-month post administration. Moreover, the epitope specificity of the monoclonal antibody was known and is well characterized. For HBIG, the preparation method is based on the physical characteristic of immunoglobulins and not on the specificity of the antibodies, the precise antigen specificity of most HBV immunoglobulin preparations is not known and thus far, are only determined to be reactive with HBV surface antigen proteins in general. This provides a source of variability in these preparations, that can facilitate poor control or viral escape as well as having the complication of being a blood-based product. The DMAb technology might have advantages in this regard as a stand-alone additional tool or to be used in combination with current HBV immunotherapies.


The ability of HBV-DMAb to neutralize HBV is relevant. Using the Nabi-HB as a positive control for viral neutralization it was observed that the concentration of HBV DMAb required to neutralize HBV was 100× less than the required dose of Nabi-HB (10 μg DMAb vs 1.25 mg of Nabi-HB) supporting the potency of this platform. This was illustrative in the drastic reduction of HBV 3.5 kb pre-genomic RNA and total HBV specific RNAs detected in cells treated with HBV DMAb as compared to untreated cells and the reduction in the level of secreted HBsAg from HBV infected HepaRG cells which was studied in the treatment groups.


Delivery of DMAbs is a novel approach, which only recently has been developed (Perales-Puchalt et al., 2019, JCI Insight, 4:126086; Muthumani et al., 2016, J Infect Dis, 214:369-378; Flingai et al., 2015, Sci Rep, 5:12616; Esquivel et al., 2019, Mol Ther, 27:974-985; Patel et al., 2018, Cell Rep, 25:1982-1993 e4). Utilizing this approach, protein IgG delivery can be bypassed, and a potential alternative technology is provided, which may address the limitations of conventional delivery of protein-based IgG. DMAbs have the potential to provide rapid protection against infectious diseases such as HBV through in vivo antibody production. Conceptually, this technology provides the simplicity of immunization with the power of specific mAb delivery. Advantages of this approach include rapid protection or treatment of affected populations, including health care workers, travelers, and immune compromised personnel. Furthermore, this technology has the possibility to enable routine mAb delivery to treat other circulating and emerging infectious diseases. Immune escape by hepatitis B viruses is a challenge for all form of antiviral therapeutics, including DMAbs, however through the use of combination therapeutics such as co-administration of broadly neutralizing DMAbs with small molecule antivirals or HBIG, potentially superior control over the HBV infection could be achieved. Also, it is necessary to determine that with each DMAb target and strategy that a sufficient level of mAb is produced to mediate the desired biological effect in terms of quantity and duration compared to conventional delivery of protein-based mAbs.


In conclusion, the experiments presented herein demonstrate the expression of a human monoclonal antibody from a DMAb platform with a potent HBV neutralizing ability which may be used for immunoprophylaxis of HBV infection.


The materials and methods used in the experiments are now described


Antibody Plasmid Construction


A synthetic DNA cassette was designed that encoded the variable heavy (VH) and light (VL) chain sequences of the anti-HBV MAb ADRI-2F3 based on sequences from a published description (Cerino et al., 2015, PLoS One, 10:e0125704). This information was used to design optimized synthetic DNA expression cassettes encoding full-length IgG (Ig) which encodes for both an anti-HBV-VH and VL. The VH chain and VL chain domain constructs were designed to be expressed at high levels using modification/optimization strategies which can lead to drastic increases in DMAb expression levels. The final construct is named HBV-DMAb and the control plasmid backbone is pVax1. Both were synthesized by Genscript and cloned into modified mammalian expression vectors under the control of the human cytomegalovirus immediate-early promoter (Perales-Puchalt et al., 2019, JCI Insight, 4:126086).


Cell Lines and Reagents


HepG2.2.15 cells were used as a source of HBV for infection experiments (Michailidis et al., 2017, Sci Rep, 7:16616). The cells are stably transfected with complete genome of HBV (adw2 subtype) and are able to support replication of HBV-DNA and intact virus particles. Production of HBV by HepG2.2.15 cell line was done by performing western blot of HepG2.2.15 cell lysates to determine presence of M-HBsAg (FIG. 1A). s-HBsAg production by HepG2.2.15 cells were detected in the supernatant and cell lysates using Bio-Rad GS HBsAg ELISA kit (FIG. 1B). and immunofluorescence for detection of HBsAg preS2 antigen (FIG. 1C).


HepG2.2.15 cells and human 293T cells (ATCC) and were cultured using Dulbecco's Modified Eagle Medium containing 10% FBS, 100U/ml penicillin and 100 μg/ml streptomycin. For HBV neutralization assay, terminally differentiated No spin HepaRG cells (Lonza) were used (Michailidis et al., 2017, Sci Rep, 7:16616). The cells were plated and cultured according to supplier's instructions. Nabi-HB (Hepatitis B Immune Globulin (HBIG), >312 IU/ml) was purchased from Biotest Pharmaceuticals Corporation, USA.


Animals and DMAb Immunizations


Female, 6-8-week-old B6.Cg-Foxn1nuJ and BALB/c mice were purchased. Mice were injected with 100 μg and 400 μg of pMV101 empty vector or HBV-DMAb plasmids were formulated in sterile water, by IM injection in the anterior tibialis (TA) muscle as previously described (Muthumani et al., 2017, Cancer Immunol Immunother, 66:1577-1588; Duperret et al., 2018, Cancer Res, 78:6363-6370). Serum levels of DMAbs were monitored following administration.


Transfection and Western Blot


One day prior to transfection, 293T cells were plated at a density of 0.5×106 cells in a 6-well plate and transfected with 1 μg plasmid DNA using Gene Jammer (Agilent Technologies). 48 hours post transfection, culture supernatants were collected, and cells were lysed using cell lysis buffer (Cell Signaling) containing protease inhibitor cocktail (Cell Signaling). Approximately 50 μg of culture supernatants and cell lysates were run with an Odyssey Protein Molecular weight ladder (Licor) on 4-12% pre-cast bis-tris gel (Invitrogen). The separated peptides were transferred to PVDF membrane (iblot 2, Thermo Fisher). The membrane was blocked with Odyssey blocking buffer (Licor) for 1 hour at room temperature. Heavy and light chains were detected using IRDye 680RD goat anti-human IgG (H+L) (Licor). The blot was scanned using Odyssey CLx (Licor).


Enzyme-Linked Immunosorbent Assay (ELISA)


To assess in vitro binding of HBV-DMAb to HBsAg, 96 well maxisorp plate (Nunc) were coated with 1 μg/ml plasma purified HBsAg subtype ad (Fitzgerald) for overnight at 4° C. Wells were blocked with PBS containing 10% FBS at room temperature for 1 hour. Serially diluted mouse sera were added to the wells. Bound antibodies were detected using 1:10000 diluted goat anti-human IgG lambda light chain HRP conjugate (Bethyl Laboratories). Plates was developed using SigmaFast OPD substrate (Sigma Aldrich) for 30 minutes. Absorbance was measured at 492 nm using Synergy2 plate reader (Biotek). Measurement of HBsAg secreted in the culture supernatant was done using GS HBsAg 3.0 ELISA kit (Bio-Rad) according to manufacturer's instructions. Absorbance was measured using Synergy2 plate reader (Biotek).


Quantitative Enzyme-Linked Immunosorbent Assay (ELISA)


For quantification of human IgG in culture supernatant, cell lysate and mouse sera, 96 well Maxisorp plates (Nunc) were coated overnight at 4° C. with 10 μg/ml goat anti-human IgG-Fc fragment (Bethyl Laboratories). Plates were washed with phosphate buffered saline containing 0.05% tween 20 (PBST) followed by blocking with PBS containing 10% FBS at room temperature for 1 hour. Samples were diluted in PBST containing 1% FBS and added to the wells. Detection of bound antibodies was performed using 1:10000 diluted goat anti-human IgG lambda light chain HRP conjugate (Bethyl Laboratories). Plates were developed using Sigmafast OPD substrate (Sigma Aldrich). A standard curve was generated using purified human IgG lambda light chain (Bethyl Laboratories). Absorbance was measured at 492 nm using Synergy2 plate reader (Biotek).


Preparation of HBV Stock and Quantification by qPCR


HepG2.2.15 cells were cultured for production of HBV as described previously. The culture supernatants were harvested, pooled and filtered using 0.45 μM filter to remove cell debris. The filtered supernatant was concentrated using an Amicon centrifugal filter (EMD Millipore, MWCO 100 kD) and stored in aliquots at −80° C. HBV DNA was extracted from 50 μl concentrated supernatant using PureLink viral DNA/RNA kit (Invitrogen) according to manufacturer's instructions. Quantification of HBV DNA copies was performed by qPCR using TaqMan Universal PCR master mix (Applied Biosystems) and the following primers (5′-GTCCTCCAATTTGTCCTGG-3′-forward primer, SEQ ID NO:3), 5′-TGAGGCATAGCAGCAGGAT-3′ (reverse primer; SEQ ID NO:4) 5′-/56¬FAM/CTGGATGTG/ZEN/TCTGCGGCGTTTTATCAT/3IABkFQ/-3′ (probe; SEQ ID NO:5). PCR was performed on 7900 HT Fast Real-Time PCR system (Applied Biosystems) using the following cycling conditions: 50° C. for 2 minutes, an initial denaturation at 95° C. for 10 minutes and 40 cycles at 95° C. for 15 seconds and 60° C. for 1 minute. A standard curve composed of 101 to 106 copies of synthetic HBV DNA (ATCC VR-3232SD) was generated and HBV DNA copies in the concentrated supernatant was determined (FIG. 1D) (Michailidis et al., 2017, Sci Rep, 7:16616; Scheel et al., 2016, Cell Host Microbe, 19:409-423). Following qPCR, agarose gel electrophoresis was performed using the qPCR reaction system and synthetic HBV DNA (ATCC) as positive control to determine presence of HBV specific 81 bp amplicon (FIG. 1E). All the analyses were performed using the SDS v2.4 statistical software.


Quantification of HBV Specific mRNAs by Quantitative RT-PCR


Total RNA from HBV infected HepaRG cells was isolated using a RNeasy Mini kit (Qiagen). On-column DNase digestion of extracted RNA was performed using RNase-free DNase set (Qiagen). Quantification of extracted RNA was done using a Nanodrop 2000 spectrophotometer (Thermo Fisher). Approximately 500 ng of total RNA was reverse transcribed into cDNA using high capacity cDNA Reverse Transcription Kit (Thermo Fisher). qPCR was performed using SYBR Green PCR Master Mix (Thermo Fisher) and primers (HBV3.5F: 5′-GAGTGTGGATTCGCACTCC-3′; SEQ ID NO:6) and (HBV3.5R: 5′-GAGGCGAGGGAGTTCTTCT-3′; SEQ ID NO:7) for HBV 3.5 kB transcript, (HBVtotalF: 5′-TCACCAGCACCATGCAAC-3; SEQ ID NO:8) and (HBVtotalR: 5′-AAGCCACCCAAGGCACAG-3; SEQ ID NO:9) for total HBV specific transcripts, (GAPDHF: CCTGCACCACCAACTGCTTA-3′; SEQ ID NO:10) and (GAPDHR: 5′-AGTGATGGCATGGACTGTGGT-3′; SEQ ID NO:11) for GAPDH mRNA. PCR was performed on 7900 HT Fast Real-Time PCR system (Applied Biosystems) using the following cycling conditions: initial denaturation at 95° C. for 10 minutes and 40 cycles at 95° C. for 15 second and 60° C. for 1 minute. Levels of HBV specific mRNAs was normalized to GAPDH and expressed relative to cells treated with Nabi-HB by the ΔΔCt method.


Native PAGE and Western Blot Analysis


For native PAGE, plasma purified HBsAg (Fitzgerald) was run on pre-cast 3-12% Native PAGE Bis-Tris gel (Thermo Fisher) along with NativeMark Unstained Protein Standard (Thermo Fisher). The gel was cut into two sections. One section was stained using Biosafe Coomassie stain (Bio-Rad) to visualize the migration of HBsAg under native conditions and the remaining half was used for electroblotting of HBsAg onto PVDF membrane using an iblot 2 dry blotting system (Thermo Fisher).Following electroblotting, the membrane was blocked with 5% skimmed milk in PBS for 1 hour at room temperature. The membrane was incubated with pooled mouse sera for 1 hour. HBsAg was detected using 1:5000 diluted goat anti-human IgG lambda light chain HRP conjugate (Bethyl Laboratories) by chemiluminescence using LumiGLO reagent (Cell Signaling). Image was captured using ImageQuant LAS 4000 system (GE Healthcare).


Immunofluorescence Assay (IFA)


To determine if DMAb binds HBV, immunofluorescence was performed as described 22. HepG2.2.15 cells were grown on 4 chambered tissue culture treated slides (BD Falcon). Cells were washed with PBS and fixed with 4% paraformaldehyde. After being permeabilized with 0.1% Triton-X 100 in PBS, non-specific binding was blocked with 5% goat serum (Jackson Immunoresearch) at room temperature for 1 hour. The cells were washed with PBS and incubated with mouse serum diluted 1:20 in 1% BSA at room temperature for 1 hour. HBsAg staining was performed using Goat-anti human IgG (H+L) Alexa Fluor 594 conjugate (Thermo Fisher). Fluoroshield mounting media with DAPI (Abcam) was added to stain the nuclei of cells. Coverslips were mounted on the slides and observed under Nikon 80i Upright Microscope for fluorescence imaging. For detection of HBV production by HepG2.2.15 cells by immunofluorescence, mouse anti-hepatitis B virus preS2 antigen antibody S26 (Abcam) was used as primary antibody while goat anti-mouse IgG (H+L) Alexa Fluor 594 (Abcam) was used as secondary antibody.


Infection with HBV


Plating and culture of HepaRG cells: HepaRG cells were resuspended in Basal Medium for thawing and plating (Lonza) and viability was checked by the Trypan Blue dye exclusion. The cells were seeded in collagen coated 24-well tissue culture plates at a density of 0.48×106 cells/well. 24 hours post plating, the medium was changed to Basal medium for maintenance (Lonza). The cells were maintained at 37° C. in a 5% humified CO2 incubator.


Neutralization Assay


At 96-hour post plating, cells were infected with HBV at a MOI of 500 HBV DNA copies/cell as described below. HBV inoculum was mixed either with medium alone, Nabi-HB (1.25 mg) or HBV-DMAb containing sera (10 μg) and incubated at 37° C. for 90 minutes. Following incubation, the mixture was added to HepaRG cells in the presence of 4% PEG-8000 for 24 hours at 37° C. After 24 hours, the inoculum was removed, and the cells were washed thrice with fresh culture medium. Culture medium was changed every two days. Culture supernatant and cells were harvested 8 days post infection and viral infection was analyzed by measuring HBsAg secreted in the culture supernatant and expression of HBV specific mRNAs in the cells by qRT-PCR 21, 23.


Statistics


Differences between the means of experimental groups were calculated using a two-tailed unpaired Student's t test or one-way ANOVA where two categorical variables were measured. Repeated measures were analyzed using 2-way ANOVA. Error bars represent standard error of the mean. Survival rates were compared using the log-rank test. All statistical analyses were done using Graph Pad Prism 7.0. p<0.05 was considered statistically significant.


The results of the experiments are now described.


HBV DMAb Expresses In Vitro and In Vivo


Multiple reports have been published regarding the immune potency of highly optimized synthetic DNA vaccines delivered by in vivo electroporation, and this platform has been adapted to deliver monoclonal antibodies (MAb) in vivo by encoding them in DNA plasmids. This novel platform is capable of inducing sufficient MAb levels to protect mice in a number of specific infectious disease models (Perales-Puchalt et al., 2019, JCI Insight, 4:126086; Muthumani et al., 2017, Cancer Immunol Immunother, 66:1577-1588; Muthumani et al., 2016, J Infect Dis, 214:369-378; Elliott et al., 2017, NPJ Vaccines 2017; 2:18; Flingai et al., 2015, Sci Rep, 5:12616; Patel et al., 2017, Nat Commun, 8:637; Khoshnejad et al., 2019, Mol Ther, 27:188-199). Recently, this approach was demonstrated to generate protective levels of MAb in an NHP challenge model (Esquivel et al., 2019, Mol Ther, 27:974-985). This approach was used for developing more enhanced levels of expression in the context of immunotherapy for HBV infection. Such an approach could provide an additional serum free tool for protection in sero negative, at-risk persons (Nelson, 2015, J Infect Dis, 212:171-172; Nassal, 2015, Gut, 64:1972-1984; Ditah et al., 2014, Hepatology, 60:815-822).


Multiple immunotherapeutic approaches for preventing HBV infection and treatment have been evaluated over the past several decades. The focus of these experiments is on developing a protective antibody response against regions of the HBsAg important in immune protection from viral infection. The HBsAg contains a highly antigenic segment known as the major hydrophilic region (MHR) from amino acids 100-169 (Suehiro et al., 2005, Liver Int, 25:1169-1174). The MHR consists of a complex set of continuous and discontinuous epitopes defined by disulfide bridging. The common “a determinant region” of MHR classically includes amino acids 124-147 of the HBsAg and is shared by all HBV genotypes and serotypes (adw, ady, ayw, ayr) (Coleman, 2006, Emerg Infect Dis, 12:198-203; Ditah et al., 2014, J Hepatol 2014; 60:691-698). It contains a major conformation-dependent neutralizing epitope of HBV which is the principal binding site of anti-HBs following natural infection, after immunization with Hepatitis B vaccine, and during HBIG prophylaxis (Coleman, 2006, Emerg Infect Dis, 12:198-203; Nassal, 2015, Gut, 64:1972-1984; Shields et al., 1999, Gut, 45:306-309). Recent reports describe monoclonal antibodies that target this region of HBV (Cerino et al., 2015, PLoS One, 10:e0125704).


An anti-HBV MAb sequence was systematically converted into a single-plasmid antibody-encoding DNA cassette for insertion into a DNA plasmid and optimized it with the aim of increasing HBV-specific human IgG production from the construct. The leader sequences were optimized from the Ig and RNA and codon optimization were performed. The synthetic DNA encoding the human H and L chains were synthesized independently and cloned into a mammalian expression plasmid pVax1 (FIG. 2A). The in vitro expression was studied in cell lines for the HBV-DNA construct by quantitative enzyme linked immunosorbent assay (ELISA) of supernatant and cell lysates of 293T cells transfected with HBV-DMAb. These analyses confirmed intracellular expression as well as potent secretion of human IgG (FIG. 2B). Moreover, Western blot analyses demonstrated the presence of IgG heavy and light chains in the supernatant and cell lysate of HBV-DMAb transfected cells (FIG. 2C). To then study if the HBV-DMAb was expressed in vivo, athymic nude CAnN.Cg-Foxn1nu/Crl mice were administered HBV-IgG plasmid DNA at dose of 100 μg or 400 μg utilizing Cellectra 3P electroporation. Notably, significant human IgG expression persisted for at least 4-5-weeks post a single injection (FIG. 2D) with 100 μg dose. Mean expression levels in mice sera immunized with HBV-DMAb was 41.6 μg/ml (FIG. 2E). The DMAb-expressed antibody exhibited substantial reactivity to HBV viral antigen in ELISA assay (FIG. 2F). These results demonstrate that the synthetic DMAb plasmid is capable of inducing HBV-specific antibody expression in vitro and in vivo.


Functional Binding Activity of In Vivo Expressed DMAb


The in vitro binding activity of the human IgG in sera collected from nude mice immunized with HBV-DMAb plasmid was next determined as previously described (Perales-Puchalt et al., 2019, JCI Insight, 4:126086; Elliott et al., 2017, NPJ Vaccines 2017; 2:18; Patel et al., 2017, Nat Commun, 8:637; Esquivel et al., 2019, Mol Ther, 27:974-985). The sera from the mice was found to bind plasma purified native HBsAg. The binding specificity of HBV-DMAb was also tested using HepG2.2.15 cells by IFA to determine reactivity against HBV-viral produced antigen. Sera from mice immunized with HBV-DMAb was found to bind to HBV produced by HepG2.2.15 cells the surface of these HBV-infected cells in this IFA-analysis (FIG. 3A).


HBV-DMAb Recognition of Conformational Antigenic Epitope


The HBV-DMAb was developed from an antibody sequence reported to recognize a conformational epitope in the common “a determinant region” of s-HBsAg. To test whether the DMAb produced in vivo identified a conformational epitope, plasma purified HBsAg and total cell lysate of HepG2.2.15 cells were separated under denaturing (reducing) and native conditions by polyacrylamide gel electrophoresis. Western blot analysis of denatured and native HBsAg using sera from nude mice immunized with HBV-DMAb indicated that the sera did not bind denatured HBsAg (FIG. 3B) but only to HBsAg in its native conformation (FIG. 3C). These results indicated that the DMAb bound to a conformational epitope of s-HBsAg (FIG. 3C). The functionality of this approach was next studied.


HBV-DMAb Neutralizes Hepatitis B Virus


The neutralizing potential of HBV-DMAb produced IgG was tested using differentiated HepaRG cells. Cells were infected at a multiplicity of infection of 500 HBV DNA copies/cell in the presence or absence of HBV-DMAb containing sera (10n). Nabi-HB-(Hepatitis B Immune Globulin in a sterile solution of immunoglobulin containing antibodies to hepatitis B surface antigen; 1.25 mg) served as a positive control for the neutralization experiment. Analysis of infection in HepaRG cells was performed using culture supernatants and cells collected 8 days post infection as indicated in FIG. 4A. Analysis of viral load in the culture supernatant was followed by quantitative PCR. Analysis of viral load in the culture supernatant demonstrated that there was a significant reduction in the level of HBV-DNA in culture supernatant of cells treated with HBV-DMAb containing sera as compared to untreated cells (p=0.0001) (FIG. 4B). Quantification of total HBV-RNA and 3.5 kb pre-genomic RNA in HepaRG cells was performed by Real-Time Quantitative Reverse Transcription PCR (qRT-PCR). The expression of total HBV-RNA in DMAb-containing sera treated cells was over 80-fold lower compared to untreated cells (p=0.0001) (FIG. 4C) and was further reduced compared to Nabi-HB treated samples.


A similar trend in the expression level of 3.5 kB HBV mRNA was observed for HepaRG cells treated with DMAb containing sera where a more than 150-fold reduction in virus was observed (FIG. 4D). ELISA based detection of HBsAg secreted into the culture supernatants demonstrated close to complete suppression of viral antigen (HBsAg) as compared to untreated cells (p=0.0001) (FIG. 4E). HBV-DMAb performed exceedingly well in neutralizing HBV as compared to Nabi-HB treated, as just 10 μg HBV-DMAb containing sera administered was compared to 1.25 mg Nabi-HB in these neutralization experiments demonstrating the high potency of DMAb containing sera for prevention of infection in this important assay system.


Example 2: Sequences









Optimized DMAb DNA sequence


(SEQ ID NO: 1)


ATGGACTGGACTTGGAGGATTCTGTTTCTGGTCGCTGCTGCTAC





CGGGACTCACGCCGAGGTGCAGGTGCTGGAGAGCGGGGGAGGGCTGGTG





CAGCCAGGCGGCAGCCTGAGGCTGTCCTGCGCAGCATCTGGCTTCAGGT





TCAGCAGCTACGCCATGTCCTGGGTGCGGCAGGCACCAGGCAAGGGCCT





GGAGTGGGTGTCCGGCATCTCTGGCACCGGCGAGAACACATACTATGCC





GACAGCGTGAAGGGCAGGTTTACCATCAGCAGAGATAACTCCAAGAATA





CACTGTACGTGCAGATGAATTCTCTGCGGGCCGAGGACACCGCCGTGTA





CTATTGCGCAAAGGATGCAATCCTGGGCAGCGGACACCCATGGTATTTT





CACGTGTGGGGAAGGGGCACCCTGGTGACAGTGTCTAGCGCCTCCACAA





AGGGACCTAGCGTGTTCCCACTGGCACCCTCCTCTAAGTCCACCTCTGG





CGGCACAGCCGCCCTGGGCTGTCTGGTGAAGGACTACTTCCCCGAGCCT





GTGACCGTGAGCTGGAACTCCGGCGCCCTGACCAGCGGAGTGCACACAT





TTCCTGCCGTGCTGCAGAGCTCCGGCCTGTACTCCCTGTCTAGCGTGGT





GACCGTGCCATCCTCTAGCCTGGGCACACAGACCTATATCTGCAACGTG





AATCACAAGCCTAGCAATACAAAGGTGGACAAGAAGGTGGAGCCAAAGT





CCTGTGATAAGACACACACCTGCCCTCCCTGTCCAGCACCAGAGCTGCT





GGGCGGCCCATCCGTGTTCCTGTTTCCACCCAAGCCTAAGGACACACTG





ATGATCTCTCGGACCCCAGAGGTGACATGCGTGGTGGTGGACGTGAGCC





ACGAGGACCCCGAGGTGAAGTTCAACTGGTACGTGGATGGCGTGGAGGT





GCACAATGCCAAGACCAAGCCCCGGGAGGAGCAGTACAACTCTACCTAT





CGCGTGGTGAGCGTGCTGACAGTGCTGCACCAGGATTGGCTGAACGGCA





AGGAGTATAAGTGCAAGGTGTCCAATAAGGCCCTGCCTGCCCCAATCGA





GAAGACCATCTCTAAGGCCAAGGGCCAGCCTAGGGAGCCACAGGTGTAC





ACACTGCCTCCATCCAGAGACGAGCTGACCAAGAACCAGGTGTCTCTGA





CATGTCTGGTGAAGGGCTTTTATCCCAGCGATATCGCCGTGGAGTGGGA





GTCCAATGGCCAGCCTGAGAACAATTACAAGACCACACCCCCTGTGCTG





GACTCTGATGGCAGCTTCTTTCTGTATTCCAAGCTGACCGTGGACAAGT





CTCGCTGGCAGCAGGGCAACGTGTTCAGCTGCTCCGTGATGCACGAGGC





CCTGCACAATCACTACACCCAGAAGTCTCTGAGCCTGTCCCCAGGCAAG





AGGGGAAGGAAGAGGAGATCTGGCAGCGGCGCCACAAACTTTTCCCTGC





TGAAGCAGGCAGGCGATGTGGAGGAGAATCCAGGACCTATGGTGCTGCA





GACCCAGGTGTTCATCAGCCTGCTGCTGTGGATCAGCGGCGCCTACGGC





TCCTATGTGCTGACACAGCCACCCTCCGTGTCTGTGGCACCTGGACAGA





CCGCCAGGATGACATGTGGCGGAAACAATATCGGCAGCGAGTCCGTGCA





CTGGTTTCAGCAGAAGCCAGGACAGGCACCTGTGCTGGTGGTGTATGAC





GATTCTGACCGGCCAAGCGGCATCCCCGAGAGGTTCAGCGGCAGCAACT





CCGGCAATACAGCCACCCTGACAATCAGCAGAGTGGAGGCAGGCGACGA





GGCAGATTACTATTGCCAAGTGTGGGACTCCTCTAGCGATCACGCCGTG





TTCGGCGGCGGAACCCAGCTGACAGTGCTGGGACAGCCTAAGGCAGCAC





CATCCGTGACCCTGTTTCCTCCATCCTCTGAGGAGCTGCAGGCCAACAA





GGCCACCCTGGTGTGCCTGATCAGCGACTTCTACCCTGGAGCAGTGACA





GTGGCATGGAAGGCCGATAGCTCCCCAGTGAAGGCCGGCGTGGAGACAA





CAACCCCCTCCAAGCAGTCTAACAATAAGTACGCCGCCTCTAGCTATCT





GTCTCTGACCCCAGAGCAGTGGAAGAGCCACAAGTCTTATAGCTGCCAG





GTCACTCACGAAGGCTCAACTGTGGAAAAAACCGTCGCTCCTACCGAAT





GTTCTTGATAA





Optimized DMAb amino acid sequence


(SEQ ID NO: 2)


MDWTWRILFLVAAATGTHAEVQVLESGGGLVQPGGSLRLSCAASGFRFS





SYAMSWVRQAPGKGLEWVSGISGTGENTYYADSVKGRFTISRDNSKNTL





YVQMNSLRAEDTAVYYCAKDAILGSGHPWYFHVWGRGTLVTVSSASTKG





PSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP





AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC





DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE





DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKE





YKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTC





LVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSR





WQQGNVFSCSVMHEALHNHYTQKSLSLSPGKRGRKRRSGSGATNFSLLK





QAGDVEENPGPMVLQTQVFISLLLWISGAYGSYVLTQPPSVSVAPGQTA





RMTCGGNNIGSESVHWFQQKPGQAPVLVVYDDSDRPSGIPERFSGSNSG





NTATLTISRVEAGDEADYYCQVWDSSSDHAVFGGGTQLTVLGQPKAAPS





VTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTT





PSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAPTECS






It is understood that the foregoing detailed description and accompanying examples are merely illustrative and are not to be taken as limitations upon the scope of the invention, which is defined solely by the appended claims and their equivalents.


Various changes and modifications to the disclosed embodiments will be apparent to those skilled in the art. Such changes and modifications, including without limitation those relating to the chemical structures, substituents, derivatives, intermediates, syntheses, compositions, formulations, or methods of use of the invention, may be made without departing from the spirit and scope thereof.

Claims
  • 1. A nucleic acid molecule encoding one or more synthetic antibodies, wherein the nucleic acid molecule comprises at least one selected from the group consisting of a) a nucleotide sequence encoding an anti-Hepatitis B surface antigen (HBsAg) synthetic antibody; andb) a nucleotide sequence encoding a fragment of an anti-HBsAg synthetic antibody.
  • 2. The nucleic acid molecule of claim 1, further comprising a nucleotide sequence encoding a cleavage domain.
  • 3. The nucleic acid molecule of claim 1, wherein the nucleotide sequence encodes an anti-HBsAg antibody comprising a sequence having at least 80% identity to SEQ ID NO:2.
  • 4. The nucleic acid molecule of claim 3, wherein the nucleotide sequence encodes an anti-HBsAg antibody comprising a sequence having at least 95% identity to SEQ ID NO:2.
  • 5. The nucleic acid molecule of claim 3, wherein the nucleic acid molecule comprises a nucleotide sequence having at least about 80% identity over an entire length of the nucleic acid sequence to SEQ ID NO:1.
  • 6. The nucleic acid molecule of claim 5, wherein the nucleic acid molecule comprises a nucleotide sequence having at least about 95% identity over an entire length of the nucleic acid sequence to SEQ ID NO:1.
  • 7. The nucleic acid molecule of claim 1, wherein the nucleotide sequence encodes a fragment of an anti-HBsAg antibody comprising at least 60% of the full length of SEQ ID NO:2.
  • 8. The nucleic acid molecule of claim 7, wherein the nucleotide sequence encodes a fragment of an anti-HBsAg antibody comprising at least 80% of the full length of SEQ ID NO:2.
  • 9. The nucleic acid molecule of claim 7, wherein the nucleic acid molecule comprises a fragment comprising at least about 60% of the full length of SEQ ID NO:1.
  • 10. The nucleic acid molecule of claim 9, wherein the nucleic acid molecule comprises a fragment comprising at least about 80% of the full length of SEQ ID NO:1.
  • 11. The nucleic acid molecule of claim 1, wherein the nucleotide sequence encodes a leader sequence.
  • 12. The nucleic acid molecule of claim 1, wherein the nucleic acid molecule comprises an expression vector.
  • 13. A composition comprising the nucleic acid molecule of claim 1.
  • 14. The composition of claim 13, further comprising a pharmaceutically acceptable excipient.
  • 15. A method of preventing or treating a disease in a subject, the method comprising administering to the subject the nucleic acid molecule of claim 1 or a composition thereof.
  • 16. The method of claim 15, wherein the disease is a Hepatitis B virus infection.
  • 17. The method of claim 15, wherein the Hepatitis B virus infection is selected from the group consisting of a chronic infection and an acute infection.
  • 18. The method of claim 15, wherein the subject is selected from the group consisting of a pregnant woman and an infant.
  • 19. The method of claim 15, further comprising administering at least one additional HBV vaccine or therapeutic agent for the treatment of HBV to the subject.
  • 20. The method of claim 15, wherein the nucleic acid molecule or the composition thereof is administered by way of at least one selected from the group consisting of intramuscular injection and electroporation.
CROSS-REFERENCE TO RELATED APPLICATIONS

This application claims priority to U.S. Provisional Application No. 63/021,189, filed May 7, 2020 which is hereby incorporated by reference herein in its entirety.

PCT Information
Filing Document Filing Date Country Kind
PCT/US2021/031104 5/6/2021 WO
Provisional Applications (1)
Number Date Country
63021189 May 2020 US