FIBROMODULIN PEPTIDE

Information

  • Patent Application
  • 20160304573
  • Publication Number
    20160304573
  • Date Filed
    June 28, 2016
    10 years ago
  • Date Published
    October 20, 2016
    9 years ago
Abstract
Disclosed herein is a method of making a fibromodulin peptide (FMOD-P), compositions thereof, and methods of using the FMOD-P and the compositions thereof for treating or ameliorating a condition.
Description
TECHNICAL FIELD OF THE INVENTION

The present invention generally relates to fibromodulin and a peptide thereof and methods of making and using the same.


BACKGROUND OF THE INVENTION

Fibromodulin (FMOD) is a member of small leucine rich proteoglycan (SLRP) family. Fibromodulin is a cytosolic secreted protein with an expression pattern restricted mainly to cartilage, bone, connective tissue, and tissue rich in collagen (Heinegard, Larsson et al. 1986). Fibromodulin is involved in fibrillogenesis, cell adhesion, and cytokine activity modulation (Yamaguchi, Mann et al. 1990; Hildebrand, Romaris et al. 1994). Previous studies shown that FMOD can combine with both transforming growth factor (TGF)-β isoforms and collagens (Hedbom and Heinegard 1989; Hildebrand, Romaris et al. 1994) to modulate the extracellular matrix. TGF-β is a profibrotic factor that increases fibroblast proliferation, stimulates the synthesis and deposition of connective tissue, and inhibits connective tissue breakdown (Gharaee-Kermani, Hu et al. 2009). Kalamaj ski and Oldberg reported that FMOD binds type I collagen via glu-353 and lys-355 in leucine-rich repeat 11 locates in the C-terminal of the protein (Kalamajski and Oldberg 2007). Svensson et al., have reported that FMOD functions in the assembly of the collagen network in connective tissues and that mice lacking a functional fibromodulin gene exhibit an altered morphological phenotype in tail tendon with fewer and abnormal collagen fiber bundles (Svensson, Aszodi et al. 1999).


It is an objective of the present invention to generate a FMOD-P that binds TGF-β and modulates in vitro TGF-β activity. It is another objective of the present invention to provide a composition for treating, preventing, or ameliorating a body condition by modulating TGF-β activities and/or collagen assembly.


SUMMARY OF THE INVENTION

In one aspect of the present invention, it is provided a method of making an isolated fibromodulin (FMOD) peptide (FMOD-P), the method comprising:


designing a FMOD-P having the function to bind at least one beta-tissue growth factor (TGF-β), and preparing the FMOD-P, wherein FMOD-P is an isoform of a full length FMOD and has consists of an amino acid sequence up to 91 amino acids in length.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, the FMOD-P consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 6 0, SEQ ID NO: 61, SEQ ID NO: 62, and SEQ ID NO: 63.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, preparing comprises splicing FMOD at one or more selected sites to generate the FMOD-P.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, preparing comprises:


expressing the isolated FMOD-P in a recombinant system; or producing the isolated FMOD-P in a cell free translation system.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, preparing comprises expressing the isolated FMOD-P in a bacterial, yeast, mammalian, or plant cell.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, designing is achieved by hydrophobic analysis of a primary or secondary structure of FMOD.


In another aspect of the present invention, it is provided another method, the method comprising:


providing an ingredient selected from any of the following:

    • a) an isolated FMOD-P;
    • b) a combination of isolated FMOD-P;
    • c) an isolated FMOD-P or a combination of isolated FMOD-P and at least one TGF-β isoform;
    • d) isolated FMOD and an isolated FMOD-P or a combination of isolated FMOD-P; and
    • e) any combination of a)-(d),


forming a composition comprising any of ingredients a)-(e),


wherein FMOD-P is an isoform of a full length FMOD and consists of an amino acid sequence up to 91 amino acids in length,


wherein the at least one TGF-β isoform is selected from the group consisting of TGF-β1, TGF-β2, TGF-β3, and a combination thereof, and


wherein the FMOD-P is capable of binding to at least one TGF-β isoform.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, forming further comprises:


providing an excipient, and


forming a formulation comprising the ingredient and the excipient.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, the FMOD-P consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 6 0, SEQ ID NO: 61, SEQ ID NO: 62, and SEQ ID NO: 63.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, the FMOD consists of an amino acid sequence selected from the group consisting of SEQ ID NO. 1, SEQ ID NO.2, SEQ ID NO.3, SEQ ID NO.4, SEQ ID NO.5, SEQ ID NO.6, SEQ ID NO.7, SEQ ID NO.8, SEQ ID NO.9, SEQ ID NO. 10, SEQ ID NO. 11, and SEQ ID NO. 12.


In a further aspect of the present invention, it is provided a method for treating, preventing, or ameliorating a body condition, the method comprising administering a composition to a subject, wherein the composition comprises an effective amount of any of the following ingredients:

    • a) an isolated FMOD-P;
    • b) a combination of isolated FMOD-P;
    • c) an isolated FMOD-P or a combination of isolated FMOD-P and at least one TGF-β isoform;
    • d) isolated FMOD and an isolated FMOD-P or a combination of isolated FMOD-P; and
    • e) any combination of (a)-(d),


wherein FMOD-P is an isoform of a full length FMOD and consists of an amino acid sequence up to 91 amino acids in length,


wherein FMOD-P is an isoform of FMOD having a shorter amino acid sequence than that of FMOD, wherein the at least one TGF-β isoform is selected from the group consisting of TGF-β1, TGF-β2, TGF-β3, and a combination thereof, wherein the FMOD-P is capable of binding to at least one TGF-β isoform, and


wherein the composition is suitable for systemic or local delivery and comprises the composition and an excipient.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, the body condition is selected from the group consisting of excessive fibrosis or scar formation that are associated with high TGF-β expression, hypertrophic scars, keloids, radiation fibrosis, and fibrotic conditions in organ systems other than skin.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, the body condition is pulmonary fibrosis or a liver, kidney, cornea, intra-abdominal, gastrointestinal, urological, neurological, or cardiovascular condition.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, the FMOD-P consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 6 0, SEQ ID NO: 61, SEQ ID NO: 62, and SEQ ID NO: 63.


In some embodimetns of the invention method, optionally in combination with any or all the various embodiments described hereint, the FMOD consists of an amino acid sequence selected from the group consisting of SEQ ID NO. 1, SEQ ID NO.2, SEQ ID NO.3, SEQ ID NO.4, SEQ ID NO.5, SEQ ID NO.6, SEQ ID NO.7, SEQ ID NO.8, SEQ ID NO.9, SEQ ID NO. 10, SEQ ID NO. 11, and SEQ ID NO. 12.





BRIEF DESCRIPTION OF THE DRAWINGS


FIG. 1 shows Plasmid pLZZF01.



FIG. 2 shows the identification of recombinant FMOD by SDS-PAGE (A) and Western blotting (B).



FIG. 3 shows the ELISA analysis of FMOD binding with TGF-β1.



FIG. 4 shows the dimeric bovine tissue-extracted decorin, crystal form 2 (1xec).



FIG. 5 shows structural alignment between human FMOD (query: SEQ ID NO:67) and the template (1xec_A: SEQ ID NO:68). ACCI value indicated the relative solvent accessibility of each residue of the template, from low to high: *, 1, 2, 3, 4, 5, 6, 7, 8, 9; SS and SS_QP indicated the known secondary structure of the template and predicted secondary structure of the FMOD, respectively; H: helix, E: sheet, and C: coil.



FIG. 6 shows the predicted 3D structure of recombinant human FMOD (AA 71-375). Yellow: sheet; red: helix; blue and white: coil.



FIG. 7 shows the predicted 3D structure of recombinant human FMOD (AA 71-375). Red: cysteines could build disulfide binds.



FIG. 8 shows the predicted 3D structure of recombinant human FMOD (AA 71-375) with molecular surface prediction, which was based on the Conolley Method.


Yellow: N-glycoside points.



FIG. 9 shows the predicted 3D structure of recombinant human FMOD (AA 71-375) with hydrophobicity. The hydrophobicity is increased from blue to red.



FIG. 10 shows the predicted 3D structure of recombinant human FMOD (AA 71-375) with electrostatic potential based on Coulomb method. Red: negative charged; blue: positive charged.



FIG. 11 shows the primary structure of human FMOD. C: Cysteines to build disulfide bind; N: N-glycoside points; L: leucine-rich repeat (LRR). Some invention FMOD peptides were designed from the primary structure of human FMOD.



FIG. 12 shows the ELISA analysis of some of the SUMO-fused FMOD peptide fragments binding with TGF-β1.



FIG. 13 shows the binding activity of TGF-β1 to FMOD and/or FMOD-P.



FIG. 14 shows the binding activity of TGF-β2 to FMOD and/or FMOD-P.



FIG. 15 shows the binding activity of TGF-β3 to FMOD and/or FMOD-P.



FIG. 16 shows the effect of TGF-β combined with FMOD on cell proliferation



FIGS. 17A and 17B show the effect of TGF-β combined with F07-C40 on cell proliferation.



FIG. 17C shows the effect of TGF-β combined with F06-C40 on cell proliferation.



FIGS. 18A-18D shows the results of a few examples of tests on the effect of FMOD and/or TGF-β on cell migration.



FIGS. 19A-19D show test results of cell migration/invasion in Matrigel at 200× magnificent after 24 hour treatment and quantitated using DAPI nuclear staining.



FIGS. 20A-20E show test results of cell migration/invasion in Matrigel at 100× magnificent after 24 hour treatment and quantitated using DAPI nuclear staining.



FIGS. 21A-21D show results of tests on the effect of FMOD and TGF-β or FMOD peptides and TGF-β on connective tissue growth factor (CTGF) expression and cell aggregation.



FIG. 22 shows the results on H&E morphology of Rat-2 cells after FMOD, TGF-β1, or FMOD and TGF-β1 treatment.



FIGS. 23A-23E show the results of tests on effects of FMOD, alone or in combination with TGF-β on expression of CTGF. FIG. 23A shows the results from 2-day control treatment. FIG. 23B shows the results from 2-day FMOD mono-treatment. FIG. 23C shows the results from 2-day TGF-β mono-treatment. FIG. 23D shows the results from 2-day FMOD+TGF-β1 combo-treatment. FIG. 23E shows a comparison chart of the results in FIGS. 23A-23D, respectively.



FIG. 24 shows that TGF-β1 treatment increases expression of CTGF (green fluorescence), while TGF-β1/FM26OD combo-treatment significantly increases expression of CTGF (green fluorescence) relative to TGF-β1 mono-treatment.



FIGS. 25A-25D show the results of tests on effects of FMOD and TGF-β or FMOD peptides and TGF-β on α-smooth muscle actin (α-SMA) expression.



FIG. 25A shows the results from control tests, which shows minimal α-SMA staining. FIG. 25B shows the results from 200 nM FMOD treatment, which shows minimal α-SMA staining. FIG. 25C shows the results from 100 pM TGF-β1 treatment, which shows moderate α-SMA staining. FIG. 25D shows the results from 100 pM TGF-β1+200 nM FMOD treatment, which shows significantly increased α-SMA staining accompanied by increased cell density/cell aggregation.



FIGS. 26A-26B show the results of tests on healing by a FMOD-P.





DETAILED DESCRIPTION OF THE INVENTION

According to one aspect of the invention, it is provided a fibromodulin (FMOD) peptide (FMOD-P) comprising at least one site capable of binding to transforming growth factor-β (TGF-β). In some embodiments, the FMOD-P has an amino acid sequence selected from the group, but not limited to consisting of SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, and SEQ ID NO:63.


According to another aspect of the present invention, it is provided a composition. The composition comprises an effective amount of any of the following ingredients:

    • a) a FMOD-P;
    • b) a combination of FMOD-P;
    • c) a FMOD-P or a combination of FMOD-P and at least one TGF-β isoform;
    • d) FMOD and at least one TGF-β isoform;
    • e) FMOD and a FMOD-P or a combination of FMOD-P; and
    • f) any combination of (a)-(e),


wherein the composition is effective for modulating activities of TGF-β and/or collagen assembly.


In some embodiments, the FMOD-P has an amino acid sequence selected from, but not limited to, the group consisting of SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, and SEQ ID NO:63.


In some further embodiments, a TGF-β isoform is one of TGF-β1 (SEQ ID NO:64), TGF-β2 (SEQ ID NO:65), and TGF-133 (SEQ ID NO:66).


In some further embodiments, the composition further comprises an excipient. In some embodiment, the excipient is a pharmaceutically acceptable carrier or dermatologically acceptable carrier.


The composition disclosed herein can be a formulated for systemic or local delivery. In some embodiments, local delivery is topical delivery, transdermal delivery, intradermal delivery, microneedle delivery, delivery as a coating on medical devices (e.g., cardiovascular stents, breast implants), or delivery by impregnating or coating on various scaffold devices (e.g., allograft dermis, Integra dermal regeneration template). In some further embodiments, systemic delivery is injection, oral administration, nasal delivery, or inhalation.


According to a further aspect of the present invention, it is provided a method of making a FMOD-P. The method comprises:


designing a FMOD-P having the function and at least one binding site of FMOD, and


preparing the FMOD-P.


In some embodiments, preparing comprises splicing FMOD at one or more selected sites to generate the FMOD-P.


In some embodiments, preparing comprises expressing the FMOD-P in a recombinant system, e.g., expressing the FMOD-P in a bacterial, yeast, mammalian, or plant cell or producing the peptide in a cell free system (e.g., a cell free translation system).


In some embodiments, preparing comprises synthesizing the FMOD-P using peptide synthesizer machines.


In some embodiments, designing comprises hydrophobic analysis of a primary or secondary structure of FMOD.


According to a further aspect of the present invention, it is provided a method of making a composition. The method comprises:


providing an ingredient selected from any of the following:

    • a) a FMOD-P;
    • b) a combination of FMOD-P;
    • c) a FMOD-P or a combination of FMOD-P and at least one TGF-β isoform;
    • d) FMOD and at least one TGF-β isoform;
    • e) FMOD and a FMOD-P or a combination of FMOD-P; and
    • f) any combination of (a)-(e), and


forming a composition comprising any of ingredients (a)-(f).


In some embodiments, the step forming further comprises: providing an excipient, and forming a formulation comprising the ingredient and the excipient.


According to a still further aspect of the present invention, it is provided a method of treating, preventing, or ameliorating a body condition. The method comprises administering to a subject:


a FMOD-P disclosed herein;


a composition disclosed herein; or


a formulation disclosed herein.


The body condition can be any condition in which modulation of TGF-β activity and/or collagen assembly at ultra-, micro-, and macrostructural levels is desired, for example, such a condition can be one where modulation of TGF-β activity and/or collagen assembly imparts a beneficial effect. Examples of such body conditions can be, diseases such as excessive fibrosis or scar formation that are associated with high TGF-β expression, hypertrophic scars, keloids, radiation fibrosis, fibrotic conditions in organs systems other than skin conditions, such as, but not limited to lung (pulmonary fibrosis) (Gharaee-Kermani, Hu et al. 2009), liver, kidney, cornea, intra-abdominal, gastrointestinal, urological, neurological, or cardiovascular conditions.


The FMOD-P or a composition thereof can be applied to a patient through a suitable mode of delivery, e.g., topical application, injection, local delivery such as delivery via a drug-eluting stent, balloon, or catheter, or delivery through an inhaler. The smaller size of the novel FMOD peptides may make pulmonary delivery using inhalational techniques much more feasible than the much larger FMOD whole protein.


As used herein, the term “fibromodulin (FMOD)” (SEQ ID NO:1; Genebank NM_002023) refers to a fibromodulin molecule as generally known in the art. Examples of FMOD molecules are disclosed in (Heinegard, Larsson et al. 1986), as shown in SEQ ID NO:1, and SEQ ID NO:2 (Genebank BC035381), SEQ ID NO:3 (Genebank U05291), SEQ ID NO:4 (Genebank AK303866), SEQ ID NO:5 (Genebank AK172740), SEQ ID NO:6 (Genebank AK092999), SEQ ID NO:7 (Genebank AK027694), SEQ ID NO:8 (Genebank DQ892112), SEQ ID NO:9 (Genebank X72913), SEQ ID NO:10 (Genebank S75546), SEQ ID NO:11 (Genebank AY890642), SEQ ID NO:12 (Genebank AY893119). Information for these sequences is:









SEQ ID NO: 1: 


NH2-WTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYPY





ETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCD





NRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGN





QITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDH





NQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSY





NHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSH





NSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNR





INEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLA





SLIEI-COOH





SEQ ID NO: 2: 


NH2-MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDP





YPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAM





YCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIAL





HGNQ





ITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHN





QISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYN





HLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHN





SLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRI





NEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCLRLAS





LIEI-COOH





SEQ ID NO: 3: 


NH2-YLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMP


ADAPLCLRLASLIEI-COOH





SEQ ID NO: 4: 


NH2-QWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDPYP





YETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPFVPSRM





KYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSK





LRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNALEGL





ENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLPSA





LEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTF





NSSSLLELDLSYNQLQKIPPVNT





NLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAM





PADAPLCLRLASLIEI-COOH





SEQ ID NO: 5: 


NH2-MKMTLIGGSTTSAASSPPTTIPMTLTRMRPTSLTPMGWMKGQPT





PTALHLDHNQISRVPNNALEGLENLTAMYCDNRNLKYLPFVPSRMKYV





YFQNNQITSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRH





LERLYLDHNNLTRMPGPLPRSLRELHLDHNQIPATAPRNATAHPTS





PRPCTSNTMRSRKWAVP-COOH





SEQ ID NO: 6: 


NH2-MKMTLIGGSTTSAASSPPTTIPMTLTRMRPTSLTPMGWMKGQPT





PTALHPLQIPATAPRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLREL





HLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILL





DLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYV





RLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYL





QGNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAP





LCLRLASLIEI-COOHSEQ





SEQ ID NO: 7: 


NH2-MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDP





YPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAM





YCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIAL





HGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELH





LDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLD





LSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVR





LSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQ





GNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCL





RLASLIEI-COOH





SEQ ID NO: 8: 


NH2-MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDP





YPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAM





YCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIAL





HGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELH





LDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLD





LSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVR





LSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQ





GNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCL





RLASLIEI-COOH





SEQ ID NO: 9: 


NH2-MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDP





YPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAM





YCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIAL





HGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELH





LDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLYLL





DLSYNHLRKVPDGLPSALEQLYMEHINNVYTVPDSYFRGAPKLLY





VRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLY





LQGNRINEFSISSFCTVVDVVNFSQLQVVRLDGNEMKRSAMPAEAP





LCLRLASLIEI-COOH





SEQ ID NO: 10: 


NH2-MQWASLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDP





YPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFLTAM





YCDNRNLKYPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIAL





HGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELH





LDHNQISRVPNNALEGLENLTALYLQHDEIQEVGSSMRGLRSLILLD





LSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRL





SHNSLTNNGLASNTFNSSSLELDLSYNQLQKIPPVNTNLENLYLQGN





RINEFSISSFCTVVDVVNFSKLQVVRLDGNEIKRSAMPADAPLCLRL





ASLIEI-COOH





SEQ ID NO: 11: 


NH2-MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDP





YPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAM





YCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIAL





HGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELH





LDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLD





LSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVR





LSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQ





GNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCL





RLASLIGI-COOH





SEQ ID NO: 12: 


NH2-MQWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDPYDP





YPYETYEPYPYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAM





YCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIAL





HGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELH





LDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLD





LSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVR





LSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQ





GNRINEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCL





RLASLIEIL-COOH






As used herein, the term TGF-β isoform refers to a TGF-β peptide having a shorter amino acid sequence as compared to TGF-β that retains the function and binding sites of TGF-β. In some embodiments, the term TGF-β isoform can be used interchangeably with the term TGF-β peptide. Examples of such TGF-β isoforms are TGF-β-1 (SEQ ID NO:64), TGF-β-2 (SEQ ID NO:65), and TGF-β-3 (SEQ ID NO:66). Information for these sequences is:









SEQ ID NO: 64: 


NH2-ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCL


GPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYY


VGRKPKVEQLSNMIVRSCKCS-COOH





SEQ ID NO: 65: 


NH2-QDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDT


QHRVLSLYNTINPEASASPCCVSQDLEPLTI


LYYIGKTPKIEQLSNMIVKSCKCS-COOH





SEQ ID NO: 66: 


NH2-NCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPYLRSA


DTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQL


SNMVVKSCKCS-COOH






As used herein, the term “beneficial effect” refers to a biologically significant improvement of a body condition, which is readily ascertainable by a person of ordinary or specialized skill in the art, depending on the “beneficial effect” described. For instance, if the “beneficial effect” is improvement in scar appearance, then a person of ordinary skill can make that ascertainment. However, if the “beneficial effect” is decreased biliary stent stenosis or decreased coronary vessel stent stenosis or decreased intra-abdominal adhesions, then a person of specialized skill is required to make that ascertainment.


Fibromodulin Peptides

As used herein, the term fibromodulin peptide (FMOD-P) refers to a FMOD isoform having a shorter amino acid sequence as compared to FMOD that retains some of the function and binding sites of fibromodulin (FMOD) or perhaps novel function and binding sites not normally exposed in FMOD. In some embodiments, FMOD-P can be used interchangeably with the term FMOD isoform. Throughout the whole document of the instant application, FMOD-P is sometimes described as FMOD peptide(s), invention FMOD-P(s) or invention FMOD peptide(s).


In some embodiments, the term FMOD-P encompasses a functional or structural derivative of the invention FMOD-P. Such derivatives can be made by, e.g., derivatizing an invention FMOD-P by established methodology, e.g., chemical modification or physical modification. Chemical modification includes, e.g, modification using an acid, a base, esterification, PEGylation, or alkylation with a short chain alkyl group. Physical modification includes, e.g., heating, moisture treatment, light treatment, mechanical impact, etc.


Examples of FMOD-P include, but are not limited to, peptides of the following sequences: SEQ ID NO:13, SEQ ID NO:14, SEQ ID NO:15, SEQ ID NO:16, SEQ ID NO:17, SEQ ID NO:18, SEQ ID NO:19, SEQ ID NO:20, SEQ ID NO:21, SEQ ID NO:22, SEQ ID NO:23, SEQ ID NO:24, SEQ ID NO:25, SEQ ID NO:26, SEQ ID NO:27, SEQ ID NO:28, SEQ ID NO:29, SEQ ID NO:30, SEQ ID NO:31, SEQ ID NO:32, SEQ ID NO:33, SEQ ID NO:34, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:37, SEQ ID NO:38, SEQ ID NO:39, SEQ ID NO:40, SEQ ID NO:41, SEQ ID NO:42, SEQ ID NO:43, SEQ ID NO:44, SEQ ID NO:45, SEQ ID NO:46, SEQ ID NO:47, SEQ ID NO:48, SEQ ID NO:49, SEQ ID NO:50, SEQ ID NO:51, SEQ ID NO:52, SEQ ID NO:53, SEQ ID NO:54, SEQ ID NO:55, SEQ ID NO:56, SEQ ID NO:57, SEQ ID NO:58, SEQ ID NO:59, SEQ ID NO:60, SEQ ID NO:61, SEQ ID NO:62, and SEQ ID NO:63.


Sequence information for some of the amino acid sequences is listed as follows:









SEQ ID NO: 13: 


NH2-NRNLKYLKPFVPSRMK-COOH





SEQ ID NO: 14: 


NH2-FQNNQITSIQEGVFDNATGLL-COOH





SEQ ID NO: 15: 


NH2-NRNLKYLKPFVPSRMK-COOH





SEQ ID NO: 16: 


NH2-YLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTY


GSPSPPDPRDCPQECDCPPNFPTAMYCD-COOH





SEQ ID NO: 17: 


NH2-PYGVDEGPAYTYGSPSPPDPRDCPQECDCPPNFPTAMYCD-


COOH





SEQ ID NO: 18: 


NH2-SRMKYVYFQNNQITSIQEGVFDNATGLLWIALHGNQITS-


COOH





SEQ ID NO: 19: 


NH2-NRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATGLLWIAL


HGNQITS-COOH





SEQ ID NO: 20: 


NH2-DKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQI-


COOH





SEQ ID NO: 21: 


NH2-SRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDL


SYNHLRKVPDGLPSALEQLYMEHNNV-COOH





SEQ ID NO: 22: 


NH2-YTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELD


LSYNQLQKIPPVNTNLENLYLQGNRI-COOH





SEQ ID NO: 23: 


NH2-NEFSISSFCTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLCL


RLASLIEI-COOH





SEQ ID NO: 24: 


NH2-QWTSLLLLAGLFSLSQAQYEDDPHWWFHYLRSQQSTYYDP-COOH





SEQ ID NO: 25: 


NH2-DDPHWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGP-COOH





SEQ ID NO: 26: 


NH2-DPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQ


ITSIQ-COOH





SEQ ID NO: 27: 


NH2-YGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKY


VYFQNN-COOH





SEQ ID NO: 28: 


NH2-FPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQITSIQEGVFDNATG


LLWIA-COOH





SEQ ID NO: 29: 


NH2-LLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLP


RSLRELHLDHNQI-COOH





SEQ ID NO: 30: 


NH2-AYTYGSPSPPDPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSR


MKYVY-COOH





SEQ ID NO: 31: 


NH2-SRVPNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDLSYN


HL-COOH





SEQ ID NO: 32: 


NH2-RKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSL


T-COOH





SEQ ID NO: 33: 


NH2-NNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRI-


COOH





SEQ ID NO: 34: 


NH2-TSIQEGVFDNATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYL


DHNNL-COOH





SEQ ID NO: 35: 


NH2-TRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEI


QE-COOH





SEQ ID NO: 36: 


NH2-VGSSMRGLRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNV-


COOH





SEQ ID NO: 37: 


NH2-YTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTFNSSSLLELDLSY


NQL-COOH





SEQ ID NO: 38: 


NH2-QKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLR


LDGNEI-COOH





SEQ ID NO: 39: 


NH2-DKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQI


SRVPNNALEGLEN-COOH





SEQ ID NO: 40: 


NH2-NATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNN-COOH





SEQ ID NO: 41: 


NH2-NATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMP


GPLPRSLRELHLDHNQISRVPNNALEGLEN-COOH





SEQ ID NO: 42: 


NH2-NLTALYLQHNEIQEVGSSMRGLRSLILLDLSYNHLRKVPDGLP


SALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGLASNTF


N-COOH





SEQ ID NO: 43: 


NH2-TRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNEI


QEVGSSMRGLRSLILLDLSYNHL-COOH





SEQ ID NO: 44: 


NH2-RKVPDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSL


TNNGLASNTFN-COOH





SEQ ID NO: 45: 


NH2-NSSSLLELDLSYNQLQKIPPVNTNLENLYLQGNRINEFSISSFC-


COOH





SEQ ID NO: 46: 


NH2-CTVVDVVNFSKLQVLRLDGNEIKRSAMPADAPLC-COOH





SEQ ID NO: 47: 


NH2-QKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVVNFSKLQVLR


LDGNEIKRSAMPADAPLC-COOH





SEQ ID NO: 48: 


NH2-CPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQI-


COOH





SEQ ID NO: 49: 


NH2-ATGLLWIALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPG


PLPRSLRELHLDHNQIS-COOH





SEQ ID NO: 50: 


NH2-NLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLENLTALYLQHNE


IQE-COOH





SEQ ID NO: 51: 


NH2-NLTRMPGPLPRSLRELHLDHNQISRVPNNALEGLEN-


COOH





SEQ ID NO: 52: 


NH2-GLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNNGL


AS-COOH





SEQ ID NO: 53: 


NH2-HLDHNQISRVPNNALEGLENLTALYLQHNEIQEVGSSMRG-COOH





SEQ ID NO: 54: 


NH2-FSKLQVLRLDGNEIKRSAMPADAPLCLRLASLIE-COOH





SEQ ID NO: 55: 


NH2-PNNALEGLENLTALYLQHNEIQEVGSSMRGLRSLILLDL-COOH





SEQ ID NO: 56: 


NH2-PDGLPSALEQLYMEHNNVYTVPDSYFRGAPKLLYVRLSHNSLTNN


GLAS-COOH





SEQ ID NO: 57: 


NH2-LLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPDSYFRG-COOH





SEQ ID NO: 58: 


NH2-SKLRHLERLYLDHNNLTRMPGPLPRSLRELHLDHNQISRVPNNAL


EGLEN-COOH





SEQ ID NO: 59: 


NH2-LRSLILLDLSYNHLRKVPDGLPSALEQLYMEHNNVYTVPD-COOH





SEQ ID NO: 60: 


NH2-YVRLSHNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPV-COOH





SEQ ID NO: 61: 


NH2-NNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNLENLYLQ-COOH





SEQ ID NO: 62: 


NH2-HWWFHYLRSQQSTYYDPYDPYPYETYEPYPYGVDEGPAYTYGSPS


PPDPRD-COOH





SEQ ID NO: 63: 


NH2-HNSLTNNGLASNTFNSSSLLELDLSYNQLQKIPPVNTNL-COOH






The FMOD-P disclosed herein can be made by a method comprising: designing a peptide having a shorter amino acid sequence as compared to FMOD that retains the function and binding sites of FMOD or perhaps novel function and binding sites not normally exposed in FMOD; and preparing the peptide.


In some embodiments, the act of designing can include steps of performing a hydrophobic analysis of a primary or secondary structure of FMOD and finding the binding site of FMOD.


In some embodiments, the act of preparing comprises splicing a FMOD at a specific site or sites so as to form a peptide as defined. Splicing a protein to form a peptide at a site or sites are well established laboratory techniques, which can be readily performed by a person of ordinary skill in the art.


In some further embodiments, the act preparing the peptide includes expressing the peptide in a recombinant system or producing the peptide in a cell free system (e.g., a cell free translation system). Such a recombinant system can be a bacteria, yeast, mammalian cell, or plant cell, which can be readily performed by a person of ordinary skill in the art.


In some other embodiments, preparing comprises synthesizing the FMOD-P using peptide synthesizer machines.


Compositions

The composition disclosed herein can include any of the following:

    • a) a FMOD-P;
    • b) a combination of FMOD-P;
    • c) a FMOD-P or a combination of FMOD-P and at least one TGF-β isoform;
    • d) FMOD and at least one TGF-β isoform;
    • e) FMOD and a FMOD-P or a combination of FMOD-P; and
    • f) any combination of (a)-(e).


In some embodiments, the TGF-β isoform can be any TGF-β peptide, e.g., TGF-β1, TGF-β2, TGF-β3, or a combination of TGF-β1, TGF-β2, and TGF-β3, such as (TGF-β1+TGF-β2), (TGF-β1+TGF-β3), or (TGF-β2+TGF-β3).


In the above compositions, the FMOD-P is as defined above. In some embodiments, the composition includes an effective amount of any of the above (a)-(e) elements.


The composition described herein can be formulated into any desired formulation. The composition can include materials and carriers to effect a desired formulation. For example, the composition can include an injectable or moldable material that can set within a pre-defined period of placement. Such a pre-defined period can be, e.g., 10 minutes, 30 minutes, one hour, two hours, etc.


In some embodiments, the composition can include a chemical gel that includes primary bonds formed due to changes in pH, ionic environment, and solvent concentration. Examples of such chemical gels can be, but are not limited to, polysaccharides such as chitosan, chitosan plus ionic salts such as beta-glycerophosphates, aginates plus Ba2+, Sr2+, Ca2+, Mg2+, collagen, fibrin, plasma or combinations thereof.


In some embodiments, the composition can include a physical gel that includes secondary bonds formed due to temperature changes. Examples of such physical gels can be, but are not limited to, alginate, poly(ethylene glycol)-poly(lactic acid-co-glycolic acid)-poly(ethylene glycol) (PEG-PLGA-PEG) tri-block copolymers, agarose, and celluloses. In some embodiments, physical gels that can be used in the composition described herein can include physical gels that are liquid under high shear but gels to solid at low shear. Examples of such physical gels include, but are not limited to, hyaluronic acid, or polyethylene oxides. The physical gels can have pre-formed materials with pre-defined dimensions and shape.


In some embodiments, the composition described herein can include a material that degrades or releases active agents in response to a stimulus. Some examples of such stimuli are mechanical stimuli, light, temperature changes, pH changes, change of ionic strength, or electromagnetic field. Such materials are known in the art. Some examples of such materials are chitosan, alginates, pluronics, methyl cellulose, hyaluronic acids, and polyethylene oxides. Other examples are described by Brandl F, Sommer F, Goepferich A. “Rational design of hydrogels for tissue engineering: Impact of physical factors on cell behavior “in Biomaterials. Epub 2006 Sep. 29.


In some embodiments, the composition described herein can include a gel containing any of hydroxyapatites, apatites, tricalcium phosphates, calcium phosphates, bioactive glass, human allograft bone and cartilage, bovine bone and cartilage, or their mixtures thereof.


In some embodiments, the composition described herein including any of the gels described above can further include a crosslinker to further tailor degradation kinetics and controlled release. Alternatively, in some embodiments, the composition described herein can include an interpenetrating phase composite or interpenetrating network (IPN) that includes any of the above described gels. Some examples of the crosslinker includes, but are not limited to, common crosslinking agents (poly alkylene oxide, ethylene dimethacrylate, N,N′-methylenebisacrylamide, methylenebis(4-phenyl isocyanate), ethylene dimethacrylate, divinylbenzene, allyl methacrylate, carbodiimidazole, sulfonyl chloride, chlorocarbonates, n-hydroxysuccinimide ester, succinimidyl ester, epoxides, aryl halides, sulfasuccinimidyl esters, and maleimides); PEG based crosslinkers (e.g. MAL-dPEGx-NHS-esters, MAL-dPEGx acid, Bis-MAL-dPEGx, etc.) and photo/light activated crosslinkers, N-hydroxysuccinimide-based crosslinkers, dilysine, trilysine, and tetralysine.


The composition described herein can include a carrier. The carrier can be a polymeric carrier or non-polymeric carrier. In some embodiments, the carrier can be biodegradable, such as degradable by enzymatic or hydrolytic mechanisms. Examples of carriers include, but are not limited to synthetic absorbable polymers such as but not limited to poly(α-hydroxy acids) such as poly (L-lactide) (PLLA), poly (D, L-lactide) (PDLLA), polyglycolide (PGA), poly (lactide-co-glycolide (PLGA), poly (-caprolactone), poly (trimethylene carbonate), poly (p-dioxanone), poly (-caprolactone-co-glycolide), poly (glycolide-co-trimethylene carbonate) poly (D, L-lactide-co-trimethylene carbonate), polyarylates, polyhydroxybutyrate (PHB), polyanhydrides, poly (anhydride-co-imide), propylene-co-fumarates, polylactones, polyesters, polycarbonates, polyanionic polymers, polyanhydrides, polyester-amides, poly(amino-acids), homopolypeptides, poly(phosphazenes), poly (glaxanone), polysaccharides, and poly(orthoesters), polyglactin, polyglactic acid, polyaldonic acid, polyacrylic acids, polyalkanoates; copolymers and admixtures thereof, and any derivatives and modifications. See for example, U.S. Pat. No. 4,563,489, and PCT Int. Appl. No. WO/03024316, herein incorporated by reference. Other examples of carriers include cellulosic polymers such as, but not limited to alkylcellulose, hydroxyalkylcellulose, methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose, hydroxypropyl-methylcellulose, carboxymethylcellulose, and their cationic salts. Other examples of carriers include synthetic and natural bioceramics such as, but not limited to calcium carbonates, calcium phosphates, apatites, bioactive glass materials, and coral-derived apatites. See for example U.S. Patent Application 2002187104; PCT Int. Appl. WO/9731661; and PCT Int. Appl. WO/0071083, herein incorporated by reference.


In one embodiment, the carrier can further be coated by compositions, including bioglass and or apatites derived from sol-gel techniques, or from immersion techniques such as, but not limited to simulated body fluids with calcium and phosphate concentrations ranging from about 1.5 to 7-fold the natural serum concentration and adjusted by various means to solutions with pH range of about 2.8-7.8 at temperature from about 15-65 degrees C. See, for example, U.S. Pat. Nos. 6,426,114 and 6,013,591; and PCT Int. Appl. WO/9117965 herein incorporated by reference.


Other examples of carriers include, collagen (e.g. Collastat, Helistat collagen sponges), hyaluronan, fibrin, chitosan, alginate, and gelatin. See for example, PCT Int. Appls. WO/9505846; WO/02085422, herein incorporated by reference.


In one embodiment, the carrier can include heparin-binding agents; including but not limited to heparin-like polymers e.g. dextran sulfate, chondroitin sulfate, heparin sulfate, fucan, alginate, or their derivatives; and peptide fragments with amino acid modifications to increase heparin affinity. See for example, Journal of Biological Chemistry (2003), 278(44), p. 43229-43235, herein incorporated by reference.


In one embodiment, the composition can be in the form of a liquid, solid or gel. In one embodiment, the substrate can include a carrier that is in the form of a flowable gel. The gel can be selected so as to be injectable, such as via a syringe at the site where cartilage formation is desired. The gel can be a chemical gel which can be a chemical gel formed by primary bonds, and controlled by pH, ionic groups, and/or solvent concentration. The gel can also be a physical gel which can be formed by secondary bonds and controlled by temperature and viscosity. Examples of gels include, but are not limited to, pluronics, gelatin, hyaluronan, collagen, polylactide-polyethylene glycol solutions and conjugates, chitosan, chitosan & b-glycerophosphate (BST-gel), alginates, agarose, hydroxypropyl cellulose, methyl cellulose, polyethylene oxide, polylactides/glycolides in N-methyl-2-pyrrolidone. See for example, Anatomical Record (2001), 263(4), 342-349, herein incorporated by reference.


In one embodiment, the carrier can be photopolymerizable, such as by electromagnetic radiation with wavelength of at least about 250 nm. Example of photopolymerizable polymers include polyethylene (PEG) acrylate derivatives, PEG methacrylate derivatives, propylene fumarate-co-ethylene glycol, polyvinyl alcohol derivatives, PEG-co-poly(-hydroxy acid) diacrylate macromers, and modified polysaccharides such as hyaluronic acid derivatives and dextran methacrylate. See for example, U.S. Pat. No. 5,410,016, herein incorporated by reference.


In one embodiment, the composition can include a carrier that is temperature sensitive. Examples include carriers made from N-isopropylacrylamide (NiPAM), or modified NiPAM with lowered lower critical solution temperature (LCST) and enhanced peptide (e.g. NELL1) binding by incorporation of ethyl methacrylate and N-acryloxysuccinimide; or alkyl methacrylates such as butylmethacrylate, hexylmethacrylate and dodecylmethacrylate. PCT Int. Appl. WO/2001070288; U.S. Pat. No. 5,124,151 herein incorporated by reference.


In one embodiment, where the carrier can have a surface that is decorated and/or immobilized with cell adhesion molecules, adhesion peptides, and adhesion peptide analogs which can promote cell-matrix attachment via receptor mediated mechanisms, and/or molecular moieties which can promote adhesion via non-receptor mediated mechanisms binding such as, but not limited to polycationic polyamino-acid-peptides (e.g. poly-lysine), polyanionic polyamino-acid-peptides, Mefp-class adhesive molecules and other DOPA-rich peptides (e.g. poly-lysine-DOPA), polysaccharides, and proteoglycans. See for example, PCT Int. Appl. WO/2004005421; WO/2003008376; WO/9734016, herein incorporated by reference.


In one embodiment, the carrier can include various naturally occurring matrices or their components such as devitalized cartilage matrix, demineralized bone matrix, or other components derived from allograft, xenograft, or any other naturally occurring material derived from Monera, Protista, Fungi, Plantae, or Animalia kingdoms.


In one embodiment, the carrier can include one or more sequestering agents such as, but not limited to, collagen, gelatin, hyaluronic acid, alginate, poly(ethylene glycol), alkylcellulose (including hydroxyalkylcellulose), including methylcellulose, ethylcellulose, hydroxyethylcellulose, hydroxypropylcellulose, hydroxypropyl-methylcellulose, and carboxymethylcellulose, blood, fibrin, polyoxyethylene oxide, calcium sulfate hemihydrate, apatites, carboxyvinyl polymer, and poly(vinyl alcohol). See for example, U.S. Pat. No. 6,620,406, herein incorporated by reference.


In one embodiment, the carrier can include surfactants to promote stability and/or distribution of FMOD-P, FMOD, and/or TGF-β isoform within the carrier materials such as, but not limited to polyoxyester (e.g. polysorbate 80, polysorbate 20 or Pluronic F-68).


In one embodiment, the carrier can include buffering agents such as, but not limited to glycine, glutamic acid hydrochloride, sodium chloride, guanidine, heparin, glutamic acid hydrochloride, acetic acid, succinic acid, polysorbate, dextran sulfate, sucrose, and amino acids. See for example, U.S. Pat. No. 5,385,887, herein incorporated by reference. In one embodiment, the carrier can include a combination of materials such as those listed above. By way of example, the carrier can be a PLGA/collagen carrier membrane. The membrane can be soaked in a solution including FMOD-P, FMOD, and/or TGF-β isoform.


An implant can include a substrate formed into the shape of a stent, mesh, pin, screw, plate, or prosthetic joint. An implant can include a substrate that is resorbable, such as a substrate including collagen.


The FMOD-P, FMOD, and/or TGF-β isoform peptide can be combined with a acceptable carrier to form a pharmacological composition. Acceptable carriers can contain a physiologically acceptable compound that acts, for example, to stabilize the composition or to increase or decrease the absorption of the agent. Physiologically acceptable compounds can include, for example, carbohydrates, such as glucose, sucrose, or dextrans, antioxidants, such as ascorbic acid or glutathione, chelating agents, low molecular weight proteins, compositions that reduce the clearance or hydrolysis of the anti-mitotic agents, or excipients or other stabilizers and/or buffers.


Other physiologically acceptable compounds include wetting agents, emulsifying agents, dispersing agents or preservatives which are particularly useful for preventing the growth or action of microorganisms. Various preservatives are well known and include, for example, phenol and ascorbic acid. One skilled in the art would appreciate that the choice of a carrier, including a physiologically acceptable compound depends, for example, on the route of administration.


The compositions can be administered in a variety of unit dosage forms depending upon the method of administration. For example, unit dosage forms suitable can include powder, or injectable or moldable pastes or suspension.


The compositions of this invention can comprise a solution of the FMOD-P, FMOD, and/or TGF-β isoform dissolved in a pharmaceutically acceptable carrier, such as an aqueous carrier for water-soluble peptides. A variety of carriers can be used, e.g., buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions can be sterilized by conventional, well known sterilization techniques. The compositions can contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like.


The concentration of FMOD-P, FMOD, and/or TGF-β isoform in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs.


The dosage regimen will be determined by the clinical indication being addressed, as well as by various patient variables (e.g. weight, age, sex) and clinical presentation (e.g. extent of injury, site of injury, etc.).


However, a therapeutically effective dose of a FMOD-P, FMOD, and/or TGF-β isoform useful in this invention is one which has a positive clinical effect on a patient or desired effect in cells as measured by the ability of the agent to impart a beneficial effect to a body condition. The therapeutically effective dose of each peptide or agent can be modulated to achieve the desired clinical effect, while minimizing negative side effects. The dosage of the peptide or agent can be selected for an individual patient depending upon the route of administration, severity of the disease, age and weight of the patient, other medications the patient is taking and other factors normally considered by an attending physician, when determining an individual regimen and dose level appropriate for a particular patient.


Dosages

Dosages of FMOD-P, FMOD, and/or TGF-β isoform can be determined according to methods known in the art based on type of agent, the disease, and other factors such as age and gender.


In one embodiment, the dosage of FMOD-P, FMOD, and/or TGF-β isoform generally ranges from 0.001 pg/mm2 to 1 pg/mm2, or more preferably from 0.001 ng/mm2 to 1 ng/mm2, or more preferably from 0.001 μg/mm2 to 1 μg/mm2, or more preferably from 0.001 mg/mm2 to 1 mg/mm2, or more preferably from 0.001 g/mm2 to 1 g/mm2, with or without a particular carrier or scaffold. In another embodiment, the dosage of FMOD-P, FMOD, and/or TGF-β isoform generally ranges from 0.001 pg/ml to 1 pg/ml, or more preferably from 0.001 ng/ml to 1 ng/ml, or more preferably from 0.001 μg/ml to 1 μg/ml, or more preferably from 0.001 mg/ml to 1 mg/ml, or more preferably from 0.001 g/ml to 100 g/ml, with or without a particular carrier or scaffold. In yet another embodiment, the dosage of FMOD-P, FMOD, and/or TGF-β generally ranges from 0.001 pg/kg to 1 pg/kg, or more preferably from 0.001 ng/kg to 1 ng/kg, or more preferably from 0.001 μg/kg to 1 μg/kg, or more preferably from 0.001 mg/kg to 1 mg/kg, or more preferably from 0.001 gm/kg to 1 gm/kg, more preferably from 0.001 kg/kg to 1 kg/kg with or without a particular carrier or scaffold. Furthermore, it is understood that all dosages can be continuously given or divided into dosages given per a given timeframe. Examples of timeframes include but are not limited to every 1 hour, 2 hour, 4 hour, 6 hour, 8 hour, 12 hour, 24 hour, 48 hour, or 72 hour, or every week, 2 weeks, 4 weeks, or every month, 2 months, 4 months, and so forth.


Dosage Form

The therapeutically effective dose of an agent included in the dosage form can be selected by considering the type of agent selected and the route of administration. The dosage form can include an agent in combination with other inert ingredients, including adjutants and pharmaceutically acceptable carriers for the facilitation of dosage to the patient, as is known to those skilled in the pharmaceutical arts.


In one embodiment, the invention can include a method of treating, preventing, or ameliorating (improving) a body condition, comprising administering to a patient a FMOD-P, FMOD, and/or in a therapeutically effective dose in an effective dosage form at a selected interval to improve a body condition.


Method of Use

In another aspect, the present invention provides a method of using the FMOD-P or composition disclosed herein for treating, preventing, or ameliorating a body condition. The method comprises applying FMOD-P or composition disclosed herein to a patient having such a body condition. Such body conditions can be any condition where modulation of TGF-β activities imparts a beneficial effect on the body condition, e.g., diseases such as excessive fibrosis or scar formation that are associated with high TGF-β expression, hypertrophic scars, keloids, radiation fibrosis, fibrotic conditions in organs systems other than skin conditions, such as, but not limited to lung (pulmonary fibrosis) (Gharaee-Kermani, Hu et al. 2009), liver, kidney, cornea, intra-abdominal, gastrointestinal, urological, neurological, or cardiovascular conditions. In addition, there may be other conditions in which modulation of TGF-β activities imparts a beneficial effect on the body condition through modulation of cell proliferation, cell migration, connective tissue growth factor (CTGF) expression and cell aggregation, α-SMA expression, and extra cellular matrix (ECM) organization by FMOD-P or composition disclosed herein.


The FMOD-P or a composition disclosed herein can be also effective for modulating collagen assembly. We have demonstrated that FMOD is also required for proper dermal collagen architecture and that FMOD null animals exhibit profound alterations in collagen ultrastructure as assessed by transmission electron microscopy and in collagen architecture as assessed by confocal laser scanning microscopy and by light microscopy (Khorasani, Zheng et al. 2010).


EXAMPLES

The embodiments of the present invention will be illustrated by the following set forth examples. All parameters and data do not limit the scope of the embodiments of the invention


Example 1
Studies on Binding Site Regulation Process of FMOD on TGF-β
Recombinant FMOD Production

DNA fragment coding human FMOD (SEQ ID NO:1) was obtained from human FMOD cDNA by PCR and inserted into the commercial vector pSecTag2A (Invitrogen) to yield plasmid pLZZF01 (FIG. 1). FMOD coding gene was under the control with CMV promoter and fused with Igκ signal peptide at N-terminal and c-Myc epitope and 6×His tag at C-terminal. The plasmid pLZZF01 was transformed into Chinese hamster ovarian cell line CHO-K1. The stable transfected cell line was cultured in F12-K medium containing 10% fetal bovine serum (FBS) and 300 μg/ml Zeocin. FMOD recombinant protein was isolated by Probond Purification System (Invitrogen) and dissolved in 1×PBS buffer. Recombinant FMOD was identified by SDS-PAGE and Western blotting with anti-FMOD antibody (FIG. 2).


Recombinant FMOD obtained from CHO-K1 was found to be able to bind with TGF-β1 as well as native extract bovine FMOD in ELISA assay (FIG. 3) (Hildebrand, Romaris et al. 1994). Bovine serum albumin (BSA) was used as negative control.


Three Dimensional (3D) Structure Prediction of FMOD

3D structure of FMOD was predicted employing 3D-Jigsaw server. Dimeric bovine tissue-extracted decorin, crystal form 2, Chain A (1xec_A, FIG. 4) (Scott, McEwan et al., 2004) was used as the template.



FIG. 5 presents the structural alignment of human FMOD (SEQ ID NO:67) and the template—dimeric bovine tissue-extracted decorin, crystal form 2, chain A (1xec_A: SEQ ID NO:68).



FIG. 6 presents the predicted 3D structure of human FMOD protein (AA 71-375). Due to the low structural homology, no template can be found to predict the 3-D structure of the N-terminal fragment. FIG. 7 highlights the cysteines which build disulfide binds. Using commercial software Vector NTI 9.0, the predicted molecular surface based on Conolly method (Connolly 1993) was shown in FIG. 8. N-glycoside points were also highlighted in this structure (FIG. 8) (Plaas, Neams et al. 1990).


Hydrophobicity of the FMOD was also analyzed by Vector NTI (FIG. 9). While, electrostatic potential of FMOD was predicted by software Spdbv using Coulomb Method (FIG. 10) (Abagyen, Totrov et al. 2004).


Construct the Plasmids Harboring Different Fragments of FMOD

The first structure of human FMOD was shown in FIG. 11. Employing PCR method, DNA fragments encoding different part of human FMOD were inserted into commercial vector pET_SUMO (Invitrogen) to yield various plasmids pLZZF01-pLZZF040. For instance pLZZF09 (harboring LRR5, LRR6 and LRR7 of human FMOD), pLZZF10 (harboring LRR8, LRR9 and LRR10 of human FMOD), and pLZZF11 (harboring C-terminal of human FMOD including LRR11), respectively. The target peptides were fused with N-terminal SUMO and G-6×His tag.


The fused target peptide-SUMO plasmids (e.g., pLZZF09) were transformed into Escherichia coli BL21 (DE3) strain as well as the control plasmids pET_SUMO/CAT. Recombinant bacteria were cultured in LB medium containing 100 mM IPTG to produced SUMO-fusion protein. Fusion proteins were purified by Probond Purification System (Invitrogen) and dissolved in 1×PBS buffer.


Example 2
Binding Studies on FMOD-P

SUMO Fused FMOD Fragments Binding with TGF-β1


Employing ELISA method, some SUMO-fused FMOD peptide fragments were found to be able to bind with TGF-β1 (SEQ ID NO: 20) (FIG. 12) (Hildebrand, Romaris et al. 1994). SUMO-CAT from the recombinant bacteria harboring control plasmid pET_SUMO/CAT was used as negative control. To the knowledge of inventors, the TGF-binding sites within FMOD have not been reported.


Example 3
Studies Relative Binding Affinities of Invention FMOD Peptides F06 and F07 to the Different TGF-β Isoforms

Binding of FMOD and FMOD Peptides with TGF-β Isoforms


FMOD (whole protein) (SEQ ID NO:1), FMOD peptides and control protein BSA were biotinylated. While, the biotinylated proteins and peptides were bound to commercial available Piece Monomeric Avidin UltraLink Resin (Piece). The amounts of each test peptides/proteins are 1:1, 10:1, 100:1 and 1000:1 to TGF-βs, respectively. After washing out the non-bound residues, appropriate amount TGF-βs (based on the primary test assay) were added to the resin at 4° C. After overnight binding, non-bound TGF-βs were collected, followed by filter sterilization. Then, the TGF-βs residue were diluted 100 times in DEME-0.5% FBS to ensure the concentration was located in the linear region of TGF-βs on Mv1Lu proliferate inhibition.


Diluted TGF-βs was added to overnight serum-starved Mv1Lu, and fresh TGF-βs media were added for another 24 hour before MTT assay. Samples with no TGF-βs added were employed as controls. From the results of Mv1Lu growth inhibition, the binding radio of TGF-β1 (SEQ ID NO:64) are shown in FIG. 13.


The results show that control BSA demonstrated minimal TGF-β1 binding except at very high ratios (1000:1 mol/mol). FMOD protein demonstrated TGF-β1 binding that also increased with higher FMOD protein ratios. Unexpectedly, some FMOD peptides demonstrated significantly greater TGF-β1 binding than FMOD at some of the ratios tested. The significance of the results is even more striking given the relatively low purity of the FMOD peptides. It is anticipated that even greater TGF-β1 binding will be obtained with more highly purified FMOD peptides.


The binding activity of TGF-β2 (SEQ ID NO:65) are shown in FIG. 14.


Similar as to TGF-β1, control BSA demonstrated minimal TGF-β2 binding. FMOD protein demonstrated TGF-β2 binding that also expectedly increased with higher FMOD protein ratios—although not to as great a degree as TGF-β1. Unexpectedly, some FMOD peptides demonstrated significantly greater TGF-β2 binding than FMOD at some of the ratios tested. The significance of these results is even more striking given the relatively low purity of the FMOD peptides. It is anticipated that even greater TGF-β2 binding will be obtained with more highly purified FMOD peptides. Also surprisingly, the peptide FMOD-F06-C40 does not bind TGF-β2. This indicates that F06-C40 can selectively bind TGF-β1 and not TGF-β2.


The binding activity of TGF-β3 (SEQ ID NO:66) is shown in FIG. 15.


In FIG. 15, BSA did not bind to TGF-β3 even at high ratios. FMOD protein demonstrated TGF-β3 binding that also expectedly increased with higher FMOD protein ratios up to 1:100—although to a significantly lesser degree than TGF-β1 or TGF-β2 (i.e., FMOD binds TGF-β1>TGF-β2>TGF-β3). Unexpectedly, some novel FMOD peptides demonstrated significantly greater TGF-β3 binding than FMOD at some of the ratios tested.


In summary these novel data demonstrate that we have created novel FMOD peptides F07 and F07-C40 that can bind all three TGF-β isoforms (TGF-β1, TGF-β2 and TGF-β3) more effectively than FMOD whole protein. We have also created novel FMOD peptides that can selectively bind TGF-β1 and TGF-β3 more effectively than FMOD whole protein.


The different binding characteristics of the FMOD related peptides F06-C40 vs. F07/F07-C40 for different TGF-β isoforms indicates that FMOD has at least two binding sites for TGF-β and that the two binding sites of FMOD have different binding affinities to TGF-β isoforms. It also suggests that the two different TGF-β binding sites of FMOD may have different effects or interactions with TGF-β ligands. Overall, these data indicate that FMOD peptides can exhibit different interactions with TGF-β ligands that was previously impossible to distinguish on the FMOD whole protein.


From a clinical standpoint, these results indicate that novel FMOD peptides can modulate TGF-β activity in a novel fashion than FMOD whole protein.


Example 4
Studies on Combination of TGF-β Combined with FMOD or FMOD Peptides
Introduction

The effect of TGF-β isoforms alone or of FMOD alone on cell proliferation has been described. However, the novel concept of using FMOD and TGF-β isoforms to modulate cell proliferation has not been described. Furthermore, the novel concept of using FMOD peptides and TGF-β isoforms to modulate cell proliferation has also not been described


TGF-β Combined with FMOD or FMOD Peptides on Cell Proliferation


2000 cell/well passage 18 Rat-2 (rat fibroblast cell line) cells were seeded in 96-well plates with 200 μl DMEM-10% FBS for 6 hours, followed by overnight serum starving with 200 μl DMEM-0.5% FBS. 200 μl treatment medium, DMEM-0.5% FBS harboring different concentration of FMOD (SEQ ID NO:1), FMOD-F07-C40 peptide with/without 100 pM TGF-βI (SEQ ID NO:64), was added to the well and refreshed on the second day. After 48 hours treatment, proliferation of Rat-2 cells was evaluated by Click-iT® Microplate Assay (Invitrogen). Results using FMOD (whole protein) are shown in FIG. 16.


Unexpectedly, combination of FMOD and TGF-β1 significantly increased fibroblast proliferation. This is a novel finding that can be applied to chronic wounds (e.g., diabetic foot ulcers) to accelerate healing.


Results using F07-C40 are shown in FIG. 17A and repeat results in FIG. 17B.


Even more unexpectedly, combination of F07-C40 and TGF-β1 increased fibroblast proliferation at low F07-C40 doses but in marked distinction to the FMOD whole protein, F07-C40 significantly inhibited fibroblast proliferation at moderately high doses, and decreased cell viability at high doses. This is a novel finding that combination F07-C40 and TGF-β1 can be modulated so that low F07-C40 doses are used for situations in which increased cell proliferation are desired (e.g., chronic wounds) and moderately high F07-C40 doses are used for situations in which decreased cell proliferation are desired (e.g., hypertrophic scars) and high F07-C40 doses are used for situations in which decreased cell viability are desired (e.g., keloids).


On the other hand, another peptide F06-C40 also exhibits the ability to induce fibroblast proliferation (FIG. 17C).


From a clinical standpoint, these results indicate that FMOD combined with TGF-β can potently induce cell proliferation. Thus, it can be used to treat a large variety of impaired or deficient wound healing conditions. In contrast novel FMOD peptides combined with TGF-β can promote cell proliferation at low FMOD peptide doses and inhibit cell proliferation at moderately high FMOD peptide doses and decrease cell viability at high FMOD peptide doses. Inhibition of cell proliferation and promotion of decreased cell viability can be especially desirable in certain conditions with excessive cell proliferation such as hypertrophic scars and keloids (Lim, Phan et al. 2006).


TGF-β Combined with FMOD or FMOD Peptides on Cell Migration


Introduction


The effect of TGF-β isoforms alone on cell migration/chemotaxis, angiogenesis, and extracellular matrix production and remodeling is well known [reviewed in (Roberts and Sporn 1996)]. The effect of combination of FMOD and TGF-β isoforms on cell migration has not been described. The effect of combination of FMOD peptides and TGF-β isoforms on cell migration has also not been described.


FMOD (Whole Protein)



FIG. 18A shows the results of a few examples of tests on the effect of FMOD (SEQ ID NO:1) and/or TGF-β on cell migration. 1×106 cell/well Rat-2 cells were seeded in 6-well plated with 3 ml DMEM-10% FBS. After 6 hours for adhesion, fresh DMEM-0.5% FBS medium was changed for serum-starving overnight. After pre-warmed DMEM rinsing, four wounds (each 1 mm wide; two horizontal and two vertical) were scratched employing a 1-ml tip for each treatment group. Cells were rinsed by DMEM for three times, followed by incubation with treatment medium [DMEM-0.5 FBS containing 100 pM (2.5 ng/ml) TGF-β1 (SEQ ID NO:64) or -β3 (SEQ ID NO:66) w/o 200 nM (11.2 μg/ml) FMOD (SEQ ID NO:1)] for 24 hours. Photos were captured at both 0-h and 24-h after the scratching. The unclosed distance was measured and quantified as an average gap (A) and migration index (B). Similar results were reproduced in four independent experiments. The scale bar in (A) equal to 100 The asterisks in (B) present P<0.05.


These results show that FMOD alone induced Rat-2 minimal migration, while surprisingly, combination of FMOD and TGF-β1 induced significant migration (FIG. 18B). In contrast, TGF-β3 inhibited migration, while combination of FMOD and TGF-β3 decreased TGF-β3 mediated inhibition of migration.


Cell migration/invasion in Matrigel was documented at 200× magnificent after 24 hour treatment and quantitated using DAPI nuclear staining (results shown in FIG. 19A and repeat results in FIGS. 26B and 26C; DAPI pictures are shown in FIG. 19D). FMOD alone induced Rat-2 moderate migration, while surprisingly, combination of FMOD and TGF-β1 also induced significant migration. In contrast, TGF-β3 inhibited migration, while combination of FMOD and TGF-β3 decreased TGF-β3 mediated inhibition of migration.


These results indicate that FMOD augments the cell migration effects of TGF-β1, while FMOD decreases the inhibitory cell migration effects of TGF-β3.


FMOD Peptides


Similar to FMOD (whole protein), the effect of FMOD peptides and/or TGF-β on cell migration was also evaluated by scratching method (FIGS. 18C and 25D). At the same time, cell migration/invasion in Matrigel was documented at 100× magnificent after 24 hour treatment and quantitated using DAPI nuclear staining (100 rather than 200× magnification was used because one group's invasion is quite low) (see the results in FIG. 20A and DAPI pictures in FIG. 20B). Passage 18 Rat-2 cells (20,000 cells/well) were used for the test under the treatment of 100 pM TGF-β1 (SEQ ID NO:64)/133 (SEQ ID NO:66) with/without 200 nM FMOD-F07-40C in DMEM-0.5% FBS.


F07-C40 alone did not induce significant Rat-2 migration, while completely unexpectedly, combination of F07-C40 and TGF-β1 significantly inhibited TGF-β1 mediated Matrigel migration. This activity of F07-C40 is completely the opposite of FMOD whole protein which increased cell migration effects of TGF-β1. Also remarkably, while TGF-β3 expectedly inhibited migration, combination of F07-C40 and TGF-β3 increased TGF-β3 mediated inhibition of migration. This activity of F07-C40 is also completely the opposite of FMOD whole protein which decreased the inhibitory cell migration effects of TGF-β3.


Passage 18 Rat-2 cells (20,000 cells/well) were used for the test under the treatment of 100 pM TGF-β1/β3 with/without 200 nM FMOD-F06-40C in DMEM-0.5% FBS (FIG. 20C). Repeat results were shown in FIGS. 20D and 27E. Surprisingly, FMOD-F06-40C promotes fibroblasts migration regardless TGF-β1 exists or not. However, FMOD-F06-40C could not eliminate the inhibition of TGF-β3 on fibroblast migration.


These data demonstrate that, when combined with TGF-β, FMOD peptides can demonstrate distinct different biological effects than FMOD whole protein. This difference can be used to regulate cell migration.


From a clinical standpoint, F07-C40 inhibition of TGF-β1 mediated cell migration in Matrigel demonstrates that F07-C40 can be used prevent tumor cell migration/metastasis (Muraoka, Dumont et al. 2002; Yang, Dukhanina et al. 2002) in situations with high basal TGF-β1. Alternatively, combined F07-C40 and TGF-133 can be used even more effectively inhibit cell migration. In addition, FMOD can be added to promote cell migration in situations where cell migration is inhibited by high TGF-β3.


Example 5
Studies on FMOD and TGF-β or FMOD Peptides and TGF-β on CTGF Expression and Cell Aggregation
Introduction

TGF-β1 is a potent stimulator of connective tissue growth factor (CTGF) expression in cells such as fibroblasts and endothelial cells. CTGF has biological effects similar to TGF-β1, and CTGF has been shown to act as an essential downstream mediator of TGF-β1 [reviewed in (Song, Aswad et al. 2007)]. Although the effect of TGF-β1 on inducing CTGF expression has been described, using FMOD and TGF-β isoforms to modulate CTGF expression has not been described. Furthermore, using FMOD peptides and TGF-β isoforms to modulate CTGF expression also has not been described. Also, the effect of FMOD or FMOD peptides alone, FMOD and TGF-β, or FMOD peptides and TGF-β on cell morphology has not been described.


Results of exemplary tests on each of FMOD and FMOD-P, alone or in combination with TGF-β on CTGF expression are shown in FIGS. 28A-28D. In these tests, 4,000 cells/well passage 18 Rat-2 cells were seeded in 8-well chamber slices in DMEM medium with 10% FBS. After 6 h adhesion, fresh DMEM medium with 0.5% FBS was employed for overnight serum starvation and then treatment media added. Treatment media were changed after 24 h. Cells were fixed and staining at 48 h. Photos were captured at 630× magnifications using a confocal microscope. In these figures, the cells were stained for CTGF (connective tissue growth factor, a factor involved in cell proliferation, migration and matrix production) or DAPI (4′,6-diamidino-2-phenylindole a fluorescent stain that binds strongly to DNA-used for nuclear staining). Merged images showing both CTGF and DAPI staining are also shown.


The results of control tests are shown in FIG. 21A. Minimal CTGF expression is present in controls.


Results from 200 nM FMOD (SEQ ID NO:1) treatment are shown in FIG. 21B. Minimal CTGF expression is present in FMOD treated samples. FMOD treated Rat-2 cells appeared more flat and spread out when compared to the control group. Thus, FMOD alone may inhibit cell aggregation.


Results from 100 pM TGF-β1 (SEQ ID NO:64) treatment are shown in FIG. 21C. The data show that moderate CTGF expression is present in TGF-β1 treated samples.


Results from 100 pM TGF-β1+200 nM FMOD treatment are shown in FIG. 21D.



FIGS. 21A-21D show that, unexpectedly, significantly higher CTGF expression is present in FMOD and TGF-β1 treated samples. This is also accompanied by significant cell aggregation.


H&E Morphology of Rat-2 Cells after FMOD, TGF-β1, or FMOD and TGF-β1 Treatment


Exemplary tests were performed to better delineate cell morphology. FIG. 22 shows the results from treatment by combinations of FMOD (SEQ ID NO:1) (0, 200 nM) and TGF-β (SEQ ID NO:20) (0, 100 nM).



FIG. 22 shows that 200 nM FMOD treatment resulted in a flat, spread-out Rat-2 cell morphology as well as lower cell aggregation/density relative to controls. Meanwhile, 100 pM TGF-β1 treat slightly increased the Rat-2 cell density, along with induction of small nodule-like cell aggregations/condensations that were observed rarely (<one nodule/well in 8-well chamber slides). Unexpectedly, 100 pM TGF-β1 and 200 nM FMOD combined treatment resulted in significantly increased cell density as well as increased nodule size and nodule number (about four nodules/well of 8-well chamber slides). These data confirm that FMOD can affect cell density, aggregation, and morphology.


Other Studies

Effects of FMOD, alone or in combination with TGF-β on expression of CTFG were repeated in a few more tests. The results are shown in FIGS. 23A-23E.



FIG. 23A shows the results from 2-day control treatment.



FIG. 23B shows the results from 2-day FMOD (SEQ ID NO:1) mono-treatment.



FIG. 23C shows the results from 2-day TGF-β1 (SEQ ID NO:64) mono-treatment.



FIG. 23D shows the results from 2-day FMOD+TGF-β1 combo-treatment.



FIG. 23E shows a comparison chart of the results in FIGS. 23A-23D, respectively.


In another set of similar studies, we see that TGF-β1 treatment increases expression of CTGF (green fluorescence), while TGF-β1/FMOD combo-treatment significantly increases expression of CTGF (green fluorescence) relative to TGF-β1 mono-treatment (FIG. 24). From a cell morphology standpoint, it can be seen that TGF-β1/FMOD combo-treatment results in much more densely packed, aggregated cells with a significant degree of nodule formation (yellow arrows).


We then performed Z-axes series sequential images to determine the relative height of the nodules as shown in FIG. 24.


As can be seen from FIG. 24, under control or mono-treatment condition (TGF-β1 or FMOD alone), Rat-2 fibroblasts maintained single layer cell morphology (no signals were observed above 8 μm height). But for the nodules formed with FMOD and TGF-β1 treatment (yellow arrows), the cells were stacked on top of one another to a height of about 48 μm. Interestingly, more CTGF expression was noted at the base of the nodule than at the top of the nodule.


From a clinical standpoint, the ability to control cell aggregation and density can be critical for many processes such as cartilage or bone formation (Song, Aswad et al. 2007) and wound healing. For example, FMOD and TGF-β1 can be used to promote mesenchymal condensations for cartilage regeneration.


Example 6
Studies on Effect of FMOD and TGF-β or FMOD Peptides and TGF-β on α-SMA Expression
Introduction

TGF-β profibrotic growth factor that regulates fibroblast proliferation, myofibroblast differentiation, and causes increased collagen deposition during fibrosis (Gharaee-Kermani, Hu et al. 2009). Myofibroblasts are specialized fibroblastic cells that appear during wound healing and in a variety of fibrocontractive diseases where they exert a significant contractile activity; they are characterized by well-developed microfilament bundles, which are analogous to stress fibers of fibroblasts in culture [reviewed in (Hinz, Dugina et al. 2003)]. In contrast, resident tissue fibroblasts do not exhibit such a contractile apparatus. On stimulation with TGF-β myofibroblasts express de novo α-smooth muscle actin (α-SMA); and form specialized adhesion structures with the ECM that are called fibronexus in vivo or “supermature” focal adhesions (FAs) in vitro [reviewed in (Hinz, Dugina et al. 2003)]. Although α-SMA expression is a prototypical myofibroblast feature (Eyden, Banerjee et al. 2009) and is correlated with contractile force generation (Tomasek, McRae et al. 2005), there is evidence that α-SMA absence can cause greater fibrotic response (Takeji, Moriyama et al. 2006). Specifically, α-SMA presence has been shown to decrease renal tissue fibrosis as well as suppress cell proliferation, procollagen synthesis, cell migration, and FA proteins (Takeji, Moriyama et al. 2006). Thus, therapies that increase α-SMA expression early on can suppress cell proliferation, procollagen synthesis, cell migration, and FA proteins—leading to overall less fibrosis. Although the effect of TGF-β1 on inducing α-SMA expression has been described, the novel concept of using FMOD and TGF-β isoforms to modulate α-SMA expression has not been described. Furthermore, the novel concept of using FMOD peptides and TGF-β isoforms to modulate α-SMA expression also has not been described.


Exemplary tests on effects of FMOD and TGF-β or FMOD peptides and TGF-β on α-SMA expression were performed and shown in FIGS. 25A-25D. Expression levels of α-SMA, which is a marker for the transition of fibroblasts to myofibroblasts, were measured and presented in staining in these figures.



FIG. 25A shows the results from control tests, which shows minimal α-SMA staining.



FIG. 25B shows the results from 200 nM FMOD (SEQ ID NO: 1) treatment, which shows minimal α-SMA staining.



FIG. 25C shows the results from 100 pM TGF-β1 (SEQ ID NO:64) treatment, which shows moderate α-SMA staining.



FIG. 25D shows the results from 100 pM TGF-β1+200 nM Fibromodulin treatment, which shows significantly increased α-SMA staining accompanied by increased cell density/cell aggregation.


Overall, these studies demonstrate that FMOD (or FMOD peptides) and TGF-β can significantly promote α-SMA expression. Depending on the time frame FMOD (or FMOD peptides) and TGF-β are applied, it can be used to suppress cell proliferation, procollagen synthesis, cell migration, and FA proteins (applied earlier) or promote contraction (applied later).


From a clinical standpoint, early FMOD (or FMOD peptides) and TGF-β application can be used to decrease fibrosis, while late FMOD (or FMOD peptides) and TGF-β application can be used to promote contraction to decrease the size of open wounds.


Example 7
Studies on Effect of FMOD Peptides on ECM Organization
Introduction

Scar formation is the undesirable sequelae of adult-type tissue repair through fibroplasia rather than regeneration. Radiation-induced fibrosis or scar formation is a common sequela after therapeutic irradiation of head and neck cancers. A scar is comprised of a disorganized collection of collagen and other ECM components with interspersed dermal cells (primarily fibroblasts, myofibroblasts). We created novel FMOD peptides that exhibit significant effects on collagen fibrillogenesis and ECM organization by both qualitative and quantitative analyses. Thus, novel FMOD peptides can be used to reduce fibrosis and to promote more organized ECM architecture in conditions such as healing wounds, radiation fibrosis, and scleroderma.


Skin tissues were collected from pigs at 4 weeks post injury, 630×. Sample A is a control which is an unwounded skin tissue. Sample B is another control which is a wounded, but untreated skin tissue. Sample C is a wounded tissue treated by a FMOD-P at a concentration of 0.5 mg/ml. Sample D is a wounded tissue treated by a FMOD-P at a concentration of 2.0 mg/ml.


Healing by primary intention wounds were observed. The results are shown in FIGS. 26A-26B. FIG. 26B shows the fractal dimension of the control and treated tissues. Fractal dimension (higher FD) provides a measure of how completely an object fills space and increases in value with increasing structural complexity (Smith, Lange et al. 1996). It has a value between 1 and 2. Lacunarity (L) is a measure of the non-uniformity (heterogeneity) of a structure or the degree of structural variance within an object (Smith, Lange et al. 1996). Therefore, low lacunarity objects are homogeneous because all gap sizes are the same, whereas high lacunarity objects are heterogeneous. Lacunarity has a value between 0 and 1 where a minimum value of 0 corresponds to an absolute homogeneous object.


In this study, we have shown that the collagen bundles in scar tissue have significantly denser (higher FD) and significantly more homogeneous architecture (lower L) compared to the basket weaved and randomly organized normal tissue. We have also shown that individual collagen fibrils in scar tissue have much smaller diameter and much more narrow size distribution as compared to normal tissue. In contrast, the FMOD-P treated samples have collagen/ECM architecture that is much closer to unwounded tissue and FD and L measurements that are not significantly different from unwounded tissue.


These results indicate that FMOD peptide can optimize collagen fibrillogenesis and ECM architecture, especially in the closed wounds (E-wounds). No significance was obtained between 0.5 mg/ml and 2.0 mg/ml treatment in FD and L analysis. This indicates that FMOD peptides are effective across a wide dose range.


From a clinical standpoint, FMOD peptides can be used to decrease fibrosis in different organ systems such as, but not limited to lung, liver, kidney, skin, and heart.


While particular embodiments of the present invention have been shown and described, it will be obvious to those skilled in the art that changes and modifications can be made without departing from this invention in its broader aspects. Therefore, the appended claims are to encompass within their scope all such changes and modifications as fall within the true spirit and scope of this invention.


REFERENCES



  • Abagyan, R., M. Totrov, D. Kuznetsov. (2004) “IM-A new method for protein modeling and design: application to docking and structure prediction from the distorted native conformation.” Journal of Computational Chemistry 15 (5): 488-506.

  • Connolly, M. L. (1993) “The molecular surface package” Journal of Molecular Graphics 11 (2): 139-141.

  • Eyden, B., S. S. Banerjee, et al. (2009). “The myofibroblast and its tumours.” J Clin Pathol 62(3): 236-49.

  • Gharaee-Kermani, M., B. Hu, et al. (2009). “Recent Advances in Molecular Targets and Treatment of Idiopathic Pulmonary Fibrosis: Focus on TGFbeta Signaling and the Myofibroblast.” Curr Med Chem 16(11): 1400-17.

  • Hedbom, E. and D. Heinegard (1989). “Interaction of a 59-kDa connective tissue matrix protein with collagen I and collagen II” The Journal of Biological Chemistry 264(12): 6898-6905.

  • Heinegard, D., T. Larsson, et al. (1986). “Two novel matrix proteins isolated from articular cartilage show wide distributions among connective tissues.” J Biol Chem 261(29): 13866-72.

  • Hildebrand, A., M. Romaris, et al. (1994). “Interaction of the small interstitial proteoglycans biglycan, decorin and fibromodulin with transforming growth factor beta.” Biochem J 302 (Pt 2): 527-34.

  • Hildebrand, A., M. Romaris, et al. (1994). “Interaction of the small interstitial proteoglycans biglycan, decorin and fibromodulin with transforming growth factor β.” Biochem. J 302: 527-534.

  • Hinz, B., V. Dugina, et al. (2003). “Alpha-smooth muscle actin is crucial for focal adhesion maturation in myofibroblasts.” Mol Biol Cell 14(6): 2508-19.

  • Kalamaj ski, S. and A. Oldberg (2007). “Fibromodulin binds collagen type I via glu-353 and lys-355 in leucine-rich repeat 11.” Journal of Biological Chemistry 282(37): 26740-26745.

  • Khorasani, H., Z. Zheng, et al. (2010). “A quantitative approach to scar analysis.” In Submission.

  • Lim, C. P., T. T. Phan, et al. (2006). “Stat3 contributes to keloid pathogenesis via promoting collagen production, cell proliferation and migration.” Oncogene 25(39): 5416-25.

  • Muraoka, R. S., N. Dumont, et al. (2002). “Blockade of TGF-beta inhibits mammary tumor cell viability, migration, and metastases.” J Clin Invest 109(12): 1551-9.

  • Plaas, A. H. K., P. J. Neams, et al. (1990). “Identification of the keratan sulfate attachment sites on bovine fibromodulin.” The Journal of Biological Chemistry 265(33): 20634-20640.

  • Roberts, A. B. and M. B. Sporn (1996). Transforming growth factor-beta. The Molecular and Cellular Biology of Wound Repair. R. A. F. Clark. New York, Plenum Press: 275-308.

  • Smith, T. G., Jr., G. D. Lange, et al. (1996). “Fractal methods and results in cellular morphology—dimensions, lacunarity and multifractals.” J Neurosci Methods 69(2): 123-36.

  • Song, J. J., R. Aswad, et al. (2007). “Connective tissue growth factor (CTGF) acts as a downstream mediator of TGF-beta 1 to induce mesenchymal cell condensation.” J Cell Physiol 210(2): 398-410.

  • Svensson, L., A. Aszodi, et al. (1999). “Fibromodulin-null mice have abnormal collagen fibrils, tissue organization, and altered lumican deposition in tendon.” J Biol Chem 274(14): 9636-47.

  • Takeji, M., T. Moriyama, et al. (2006). “Smooth muscle alpha-actin deficiency in myofibroblasts leads to enhanced renal tissue fibrosis.” J Biol Chem 281(52): 40193-200.

  • Tomasek, J. J., J. McRae, et al. (2005). “Regulation of alpha-smooth muscle actin expression in granulation tissue myofibroblasts is dependent on the intronic CArG element and the transforming growth factor-beta1 control element.” Am J Pathol 166(5): 1343-51.

  • Yamaguchi, Y., D. M. Mann, et al. (1990). “Negative regulation of transforming growth factor-beta by the proteoglycan decorin.” Nature 346(6281): 281-4.

  • Yang, Y. A., O. Dukhanina, et al. (2002). “Lifetime exposure to a soluble TGF-beta antagonist protects mice against metastasis without adverse side effects.” J Clin Invest 109(12): 1607-15.


Claims
  • 1. A method of making an isolated fibromodulin (FMOD) peptide (FMOD-P), comprising: designing a FMOD-P having the function to bind at least one beta-tissue growth factor (TGF-β), andpreparing the FMOD-P, wherein FMOD-P is an isoform of a full length FMOD and has consists of an amino acid sequence up to 91 amino acids in length.
  • 2. The method of claim 1, wherein the FMOD-P consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 6 0, SEQ ID NO: 61, SEQ ID NO: 62, and SEQ ID NO: 63.
  • 3. The method of claim 1, wherein preparing comprises splicing FMOD at one or more selected sites to generate the FMOD-P.
  • 4. The method of claim 1, wherein preparing comprises: expressing the isolated FMOD-P in a recombinant system; orproducing the isolated FMOD-P in a cell free translation system.
  • 5. The method of claim 1, wherein preparing comprises expressing the isolated FMOD-P in a bacterial, yeast, mammalian, or plant cell.
  • 6. The method of claim 1, wherein designing is achieved by hydrophobic analysis of a primary or secondary structure of FMOD.
  • 7. A method, comprising: providing an ingredient selected from any of the following: a) an isolated FMOD-P;b) a combination of isolated FMOD-P;c) an isolated FMOD-P or a combination of isolated FMOD-P and at least one TGF-β isoform;d) isolated FMOD and an isolated FMOD-P or a combination of isolated FMOD-P; ande) any combination of a)-(d),forming a composition comprising any of ingredients a)-(e),wherein FMOD-P is an isoform of a full length FMOD and consists of an amino acid sequence up to 91 amino acids in length,wherein the at least one TGF-β isoform is selected from the group consisting of TGF-β1, TGF-β2, TGF-β3, and a combination thereof, andwherein the FMOD-P is capable of binding to at least one TGF-β isoform.
  • 8. The method of claim 7, wherein forming further comprises: providing an excipient, andforming a formulation comprising the ingredient and the excipient.
  • 9. The method of claim 7, wherein the FMOD-P consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 6 0, SEQ ID NO: 61, SEQ ID NO: 62, and SEQ ID NO: 63.
  • 10. The method of claim 7, wherein the FMOD consists of an amino acid sequence selected from the group consisting of SEQ ID NO. 1, SEQ ID NO.2, SEQ ID NO.3, SEQ ID NO.4, SEQ ID NO.5, SEQ ID NO.6, SEQ ID NO.7, SEQ ID NO.8, SEQ ID NO.9, SEQ ID NO. 10, SEQ ID NO. 11, and SEQ ID NO. 12.
  • 11. A method for treating, preventing, or ameliorating a body condition, comprising administering a composition to a subject, wherein the composition comprises an effective amount of any of the following ingredients: a) an isolated FMOD-P;b) a combination of isolated FMOD-P;c) an isolated FMOD-P or a combination of isolated FMOD-P and at least one TGF-β isoform;d) isolated FMOD and an isolated FMOD-P or a combination of isolated FMOD-P; ande) any combination of (a)-(d),wherein FMOD-P is an isoform of a full length FMOD and consists of an amino acid sequence up to 91 amino acids in length,wherein FMOD-P is an isoform of FMOD having a shorter amino acid sequence than that of FMOD, wherein the at least one TGF-β isoform is selected from the group consisting of TGF-β1, TGF-β2, TGF-β3, and a combination thereof, wherein the FMOD-P is capable of binding to at least one TGF-β isoform, andwherein the composition is suitable for systemic or local delivery and comprises the composition and an excipient.
  • 12. The method of claim 11, wherein the body condition is selected from the group consisting of excessive fibrosis or scar formation that are associated with high TGF-β expression, hypertrophic scars, keloids, radiation fibrosis, and fibrotic conditions in organ systems other than skin.
  • 13. The method of claim 11, wherein the body condition is pulmonary fibrosis or a liver, kidney, cornea, intra-abdominal, gastrointestinal, urological, neurological, or cardiovascular condition.
  • 14. The method of claim 11, wherein the FMOD-P consists of an amino acid sequence selected from the group consisting of SEQ ID NO: 13, SEQ ID NO: 14, SEQ ID NO: 16, SEQ ID NO: 17, SEQ ID NO: 18, SEQ ID NO: 19, SEQ ID NO: 20, SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO: 23, SEQ ID NO: 24, SEQ ID NO: 25, SEQ ID NO: 26, SEQ ID NO: 27, SEQ ID NO: 28, SEQ ID NO: 29, SEQ ID NO: 30, SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41, SEQ ID NO: 42, SEQ ID NO: 43, SEQ ID NO: 44, SEQ ID NO: 45, SEQ ID NO: 46, SEQ ID NO: 47, SEQ ID NO: 48, SEQ ID NO: 49, SEQ ID NO: 50, SEQ ID NO: 51, SEQ ID NO: 52, SEQ ID NO: 53, SEQ ID NO: 54, SEQ ID NO: 55, SEQ ID NO: 56, SEQ ID NO: 57, SEQ ID NO: 58, SEQ ID NO: 59, SEQ ID NO: 6 0, SEQ ID NO: 61, SEQ ID NO: 62, and SEQ ID NO: 63.
  • 15. The method of claim 11, wherein the FMOD consists of an amino acid sequence selected from the group consisting of SEQ ID NO. 1, SEQ ID NO.2, SEQ ID NO.3, SEQ ID NO.4, SEQ ID NO.5, SEQ ID NO.6, SEQ ID NO.7, SEQ ID NO.8, SEQ ID NO.9, SEQ ID NO. 10, SEQ ID NO. 11, and SEQ ID NO. 12.
CROSS-REFERENCE TO THE RELATED APPLICATIONS

This application is a division of U.S. application Ser. No. 13/322,124, filed on Mar. 14, 2012, which is a national phase application under 35 U.S.C. §371(c) of International Application No. PCT/US10/36262, filed on May 26, 2010, which claims the benefit of U.S. provisional application Ser. No. 61/181,226, filed on May 26, 2009. The teachings of these applications are incorporated herein in their entirety by reference.

Divisions (1)
Number Date Country
Parent 13322124 Mar 2012 US
Child 15195798 US