Patent Application
20240336657
The Sequence Listing written in file 048536-708001WO_Sequence_Listing_ST25.TXT, created Apr. 19, 2022, 22,109 bytes, machine format IBM-PC, MS Windows operating system, is hereby incorporated by reference.
The GNAS gene encodes the Gas stimulatory subunit of heterotrimeric G proteins, which mediate G-protein-coupled receptor (GPCR) signaling, a central mechanism by which cells sense and respond to extracellular stimuli. Multiple human cancer types exhibit recurrent gain-of-function mutations in the pathway, most frequently targeting GNAS. The most lethal tumor type where GNAS is frequently mutated is the intraductal papillary mucinous neoplasm (IPMN), a precursor of invasive pancreatic cancer. Disclosed herein, inter alia, are solutions to these and other problems in the art.
In an aspect is provided a compound having the formula:
L1A, L2A, L3A, L4A, L5A, L6A, L7A, L8A, L9A, L10A, L11A, and L12A are independently a bond, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene.
L5 is
R1A is substituted or unsubstituted aryl.
R2A and R5A are independently hydrogen, —OH, —NH2, substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
R3A, R4A, and R11A are independently hydrogen, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl3, —OCF3, —OCBr3, —OCI3, —OCHCl2, —OCHBr2, —OCHI2, —OCHF2, —OCH2Cl, —OCH2Br, —OCH2I, —OCH2F, substituted or unsubstituted alkyl, or substituted or unsubstituted heteroalkyl.
R6A is —NH2, —CONH2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, or substituted or unsubstituted aryl.
R7A, R8A, and R12A are independently hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
R9A is substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
R10A is hydrogen or substituted or unsubstituted alkyl.
R1D, R2D, R3D, R4D, R5D, R6D, R7D, R8D, R9D, R10D, R11D, and R12D are independently hydrogen or unsubstituted C1-C8 alkyl.
R5E is hydrogen, —OH, —NH2, substituted or unsubstituted alkyl, or substituted or unsubstituted heteroalkyl.
L16 is a covalent linker.
In an aspect is provided a compound having the formula:
R1D, R2D, R3D, R4D, R5D, R6D, R7D, R8D, R9D, R10D, R11D, R12D, and L16 are as described herein, including in embodiments.
L1B, L2B, L3B, L4B, L5B, L6B, L7B, L8B, L9B, L10B, L11B, L12B, and L13B are independently a bond, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene.
L13 is a bond,
R1B is substituted or unsubstituted aryl.
R2B, R4B, R5B, R8B, R9B, and R13B are independently hydrogen, —OH, —NH2, —C(O)OH, —C(O)NH2, —NO2, —SO3H, —OSO3H, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
R3B is hydrogen, —OH, —CN, —NH2, —C(O)NH2, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHOH, substituted or unsubstituted alkyl, or substituted or unsubstituted heteroalkyl.
R6B, R7B, R10B, R1B, and R12B are independently hydrogen, —OH, —NH2, —C(O)OH, —C(O)NH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl3, —OCF3, —OCBr3, —OCI3, —OCHCl2, —OCHBr2, —OCHI2, —OCHF2, —OCH2Cl, —OCH2Br, —OCH2I, —OCH2F, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
R13D is independently hydrogen or unsubstituted C1-C4 alkyl.
R13E is hydrogen, —OH, —NH2, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl.
In an aspect is provided a pharmaceutical composition including a compound described herein, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
In an aspect is provided a method of treating a cancer in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient.
In an aspect is provided a method of treating a bone condition in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient.
In an aspect is provided a method of treating McCune-Albright syndrome in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient.
In an aspect is provided a method of treating cholera in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient.
In an aspect is provided a method of treating a G protein-associated disease in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient.
In an aspect is provided a method of modulating (e.g., reducing) the activity of a human Gαs protein, the method including contacting the human Gαs protein with an effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof.
The data moving from left to right in the graph correspond to the legend moving from top to bottom. The data represent the mean±SD of three independent replicates. Two-tailed unpaired t-tests were performed and P<0.05 was considered significant. *p<0.05, **p<0.005, ns >0.05.
The abbreviations used herein have their conventional meaning within the chemical and biological arts. The chemical structures and formulae set forth herein are constructed according to the standard rules of chemical valency known in the chemical arts.
Where substituent groups are specified by their conventional chemical formulae, written from left to right, they equally encompass the chemically identical substituents that would result from writing the structure from right to left, e.g., —CH2O— is equivalent to —OCH2—.
The term “alkyl,” by itself or as part of another substituent, means, unless otherwise stated, a straight (i.e., unbranched) or branched carbon chain (or carbon), or combination thereof, which may be fully saturated, mono- or polyunsaturated and can include mono-, di-, and multivalent radicals. The alkyl may include a designated number of carbons (e.g., C1-C10 means one to ten carbons). In embodiments, the alkyl is fully saturated. In embodiments, the alkyl is monounsaturated. In embodiments, the alkyl is polyunsaturated. Alkyl is an uncyclized chain. Examples of saturated hydrocarbon radicals include, but are not limited to, groups such as methyl, ethyl, n-propyl, isopropyl, n-butyl, t-butyl, isobutyl, sec-butyl, methyl, homologs and isomers of, for example, n-pentyl, n-hexyl, n-heptyl, n-octyl, and the like. An unsaturated alkyl group is one having one or more double bonds or triple bonds. Examples of unsaturated alkyl groups include, but are not limited to, vinyl, 2-propenyl, crotyl, 2-isopentenyl, 2-(butadienyl), 2,4-pentadienyl, 3-(1,4-pentadienyl), ethynyl, 1- and 3-propynyl, 3-butynyl, and the higher homologs and isomers. An alkoxy is an alkyl attached to the remainder of the molecule via an oxygen linker (—O—). An alkyl moiety may be an alkenyl moiety. An alkyl moiety may be an alkynyl moiety. An alkenyl includes one or more double bonds. An alkynyl includes one or more triple bonds.
The term “alkylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkyl, as exemplified, but not limited by, —CH2CH2CH2CH2—. Typically, an alkyl (or alkylene) group will have from 1 to 24 carbon atoms, with those groups having 10 or fewer carbon atoms being preferred herein. A “lower alkyl” or “lower alkylene” is a shorter chain alkyl or alkylene group, generally having eight or fewer carbon atoms. The term “alkenylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkene. The term “alkynylene” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from an alkyne. In embodiments, the alkylene is fully saturated. In embodiments, the alkylene is monounsaturated. In embodiments, the alkylene is polyunsaturated. An alkenylene includes one or more double bonds. An alkynylene includes one or more triple bonds.
The term “heteroalkyl,” by itself or in combination with another term, means, unless otherwise stated, a stable straight or branched chain, or combinations thereof, including at least one carbon atom and at least one heteroatom (e.g., O, N, P, Si, and S), and wherein the nitrogen and sulfur atoms may optionally be oxidized, and the nitrogen heteroatom may optionally be quaternized. The heteroatom(s) (e.g., N, S, Si, or P) may be placed at any interior position of the heteroalkyl group or at the position at which the alkyl group is attached to the remainder of the molecule. Heteroalkyl is an uncyclized chain. Examples include, but are not limited to: —CH2—CH2—O—CH3, —CH2—CH2—NH—CH3, —CH2—CH2—N(CH3)—CH3, —CH2—S—CH2—CH3, —S—CH2—CH2, —S(O)—CH3, —CH2—CH2—S(O)2—CH3, —CH═CHO—CH3, —Si(CH3)3, —CH2—CH═N—OCH3, —CH═CH—N(CH3)—CH3, —O—CH3, —O—CH2—CH3, and —CN. Up to two or three heteroatoms may be consecutive, such as, for example, —CH2—NH—OCH3 and —CH2—O—Si(CH3)3. A heteroalkyl moiety may include one heteroatom (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include two optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include three optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include four optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include five optionally different heteroatoms (e.g., O, N, S, Si, or P). A heteroalkyl moiety may include up to 8 optionally different heteroatoms (e.g., O, N, S, Si, or P). The term “heteroalkenyl,” by itself or in combination with another term, means, unless otherwise stated, a heteroalkyl including at least one double bond. A heteroalkenyl may optionally include more than one double bond and/or one or more triple bonds in additional to the one or more double bonds. The term “heteroalkynyl,” by itself or in combination with another term, means, unless otherwise stated, a heteroalkyl including at least one triple bond. A heteroalkynyl may optionally include more than one triple bond and/or one or more double bonds in additional to the one or more triple bonds. In embodiments, the heteroalkyl is fully saturated. In embodiments, the heteroalkyl is monounsaturated. In embodiments, the heteroalkyl is polyunsaturated.
Similarly, the term “heteroalkylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from heteroalkyl, as exemplified, but not limited by, —CH2—CH2—S—CH2—CH2— and —CH2—S—CH2—CH2—NH—CH2—. For heteroalkylene groups, heteroatoms can also occupy either or both of the chain termini (e.g., alkyleneoxy, alkylenedioxy, alkyleneamino, alkylenediamino, and the like). Still further, for alkylene and heteroalkylene linking groups, no orientation of the linking group is implied by the direction in which the formula of the linking group is written. For example, the formula —C(O)2R′— represents both —C(O)2R′— and —R′C(O)2—. As described above, heteroalkyl groups, as used herein, include those groups that are attached to the remainder of the molecule through a heteroatom, such as —C(O)R′, —C(O)NR′, —NR′R″, —OR′, —SR′, and/or —SO2R′. Where “heteroalkyl” is recited, followed by recitations of specific heteroalkyl groups, such as —NR′R″ or the like, it will be understood that the terms heteroalkyl and —NR′R″ are not redundant or mutually exclusive. Rather, the specific heteroalkyl groups are recited to add clarity. Thus, the term “heteroalkyl” should not be interpreted herein as excluding specific heteroalkyl groups, such as —NR′R″ or the like. The term “heteroalkenylene,” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from a heteroalkene. The term “heteroalkynylene” by itself or as part of another substituent, means, unless otherwise stated, a divalent radical derived from a heteroalkyne. In embodiments, the heteroalkylene is fully saturated. In embodiments, the heteroalkylene is monounsaturated. In embodiments, the heteroalkylene is polyunsaturated. A heteroalkenylene includes one or more double bonds. A heteroalkynylene includes one or more triple bonds.
The terms “cycloalkyl” and “heterocycloalkyl,” by themselves or in combination with other terms, mean, unless otherwise stated, cyclic versions of “alkyl” and “heteroalkyl,” respectively. Cycloalkyl and heterocycloalkyl are not aromatic. Additionally, for heterocycloalkyl, a heteroatom can occupy the position at which the heterocycle is attached to the remainder of the molecule. Examples of cycloalkyl include, but are not limited to, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, 1-cyclohexenyl, 3-cyclohexenyl, cycloheptyl, and the like. Examples of heterocycloalkyl include, but are not limited to, 1-(1,2,5,6-tetrahydropyridyl), 1-piperidinyl, 2-piperidinyl, 3-piperidinyl, 4-morpholinyl, 3-morpholinyl, tetrahydrofuran-2-yl, tetrahydrofuran-3-yl, tetrahydrothien-2-yl, tetrahydrothien-3-yl, 1-piperazinyl, 2-piperazinyl, and the like. A “cycloalkylene” and a “heterocycloalkylene,” alone or as part of another substituent, means a divalent radical derived from a cycloalkyl and heterocycloalkyl, respectively. In embodiments, the cycloalkyl is fully saturated. In embodiments, the cycloalkyl is monounsaturated. In embodiments, the cycloalkyl is polyunsaturated. In embodiments, the heterocycloalkyl is fully saturated. In embodiments, the heterocycloalkyl is monounsaturated. In embodiments, the heterocycloalkyl is polyunsaturated.
In embodiments, the term “cycloalkyl” means a monocyclic, bicyclic, or a multicyclic cycloalkyl ring system. In embodiments, monocyclic ring systems are cyclic hydrocarbon groups containing from 3 to 8 carbon atoms, where such groups can be saturated or unsaturated, but not aromatic. In embodiments, cycloalkyl groups are fully saturated. A bicyclic or multicyclic cycloalkyl ring system refers to multiple rings fused together wherein at least one of the fused rings is a cycloalkyl ring and wherein the multiple rings are attached to the parent molecular moiety through any carbon atom contained within a cycloalkyl ring of the multiple rings.
In embodiments, a cycloalkyl is a cycloalkenyl. The term “cycloalkenyl” is used in accordance with its plain ordinary meaning. In embodiments, a cycloalkenyl is a monocyclic, bicyclic, or a multicyclic cycloalkenyl ring system. A bicyclic or multicyclic cycloalkenyl ring system refers to multiple rings fused together wherein at least one of the fused rings is a cycloalkenyl ring and wherein the multiple rings are attached to the parent molecular moiety through any carbon atom contained within a cycloalkenyl ring of the multiple rings.
In embodiments, the term “heterocycloalkyl” means a monocyclic, bicyclic, or a multicyclic heterocycloalkyl ring system. In embodiments, heterocycloalkyl groups are fully saturated. A bicyclic or multicyclic heterocycloalkyl ring system refers to multiple rings fused together wherein at least one of the fused rings is a heterocycloalkyl ring and wherein the multiple rings are attached to the parent molecular moiety through any atom contained within a heterocycloalkyl ring of the multiple rings.
The terms “halo” or “halogen,” by themselves or as part of another substituent, mean, unless otherwise stated, a fluorine, chlorine, bromine, or iodine atom. Additionally, terms such as “haloalkyl” are meant to include monohaloalkyl and polyhaloalkyl. For example, the term “halo(C1-C4)alkyl” includes, but is not limited to, fluoromethyl, difluoromethyl, trifluoromethyl, 2,2,2-trifluoroethyl, 4-chlorobutyl, 3-bromopropyl, and the like.
The term “acyl” means, unless otherwise stated, —C(O)R where R is a substituted or unsubstituted alkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl.
The term “aryl” means, unless otherwise stated, a polyunsaturated, aromatic, hydrocarbon substituent, which can be a single ring or multiple rings (preferably from 1 to 3 rings) that are fused together (i.e., a fused ring aryl) or linked covalently. A fused ring aryl refers to multiple rings fused together wherein at least one of the fused rings is an aryl ring and wherein the multiple rings are attached to the parent molecular moiety through any carbon atom contained within an aryl ring of the multiple rings. The term “heteroaryl” refers to aryl groups (or rings) that contain at least one heteroatom such as N, O, or S, wherein the nitrogen and sulfur atoms are optionally oxidized, and the nitrogen atom(s) are optionally quaternized. Thus, the term “heteroaryl” includes fused ring heteroaryl groups (i.e., multiple rings fused together wherein at least one of the fused rings is a heteroaromatic ring and wherein the multiple rings are attached to the parent molecular moiety through any atom contained within a heteroaromatic ring of the multiple rings). A 5,6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 5 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. Likewise, a 6,6-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 6 members, and wherein at least one ring is a heteroaryl ring. And a 6,5-fused ring heteroarylene refers to two rings fused together, wherein one ring has 6 members and the other ring has 5 members, and wherein at least one ring is a heteroaryl ring. A heteroaryl group can be attached to the remainder of the molecule through a carbon or heteroatom. Non-limiting examples of aryl and heteroaryl groups include phenyl, naphthyl, pyrrolyl, pyrazolyl, pyridazinyl, triazinyl, pyrimidinyl, imidazolyl, pyrazinyl, purinyl, oxazolyl, isoxazolyl, thiazolyl, furyl, thienyl, pyridyl, pyrimidyl, benzothiazolyl, benzoxazoyl benzimidazolyl, benzofuran, isobenzofuranyl, indolyl, isoindolyl, benzothiophenyl, isoquinolyl, quinoxalinyl, quinolyl, 1-naphthyl, 2-naphthyl, 4-biphenyl, 1-pyrrolyl, 2-pyrrolyl, 3-pyrrolyl, 3-pyrazolyl, 2-imidazolyl, 4-imidazolyl, pyrazinyl, 2-oxazolyl, 4-oxazolyl, 2-phenyl-4-oxazolyl, 5-oxazolyl, 3-isoxazolyl, 4-isoxazolyl, 5-isoxazolyl, 2-thiazolyl, 4-thiazolyl, 5-thiazolyl, 2-furyl, 3-furyl, 2-thienyl, 3-thienyl, 2-pyridyl, 3-pyridyl, 4-pyridyl, 2-pyrimidyl, 4-pyrimidyl, 5-benzothiazolyl, purinyl, 2-benzimidazolyl, 5-indolyl, 1-isoquinolyl, 5-isoquinolyl, 2-quinoxalinyl, 5-quinoxalinyl, 3-quinolyl, and 6-quinolyl. Substituents for each of the above noted aryl and heteroaryl ring systems are selected from the group of acceptable substituents described below. An “arylene” and a “heteroarylene,” alone or as part of another substituent, mean a divalent radical derived from an aryl and heteroaryl, respectively. A heteroaryl group substituent may be —O— bonded to a ring heteroatom nitrogen.
A fused ring heterocyloalkyl-aryl is an aryl fused to a heterocycloalkyl. A fused ring heterocycloalkyl-heteroaryl is a heteroaryl fused to a heterocycloalkyl. A fused ring heterocycloalkyl-cycloalkyl is a heterocycloalkyl fused to a cycloalkyl. A fused ring heterocycloalkyl-heterocycloalkyl is a heterocycloalkyl fused to another heterocycloalkyl. Fused ring heterocycloalkyl-aryl, fused ring heterocycloalkyl-heteroaryl, fused ring heterocycloalkyl-cycloalkyl, or fused ring heterocycloalkyl-heterocycloalkyl may each independently be unsubstituted or substituted with one or more of the substituents described herein.
Spirocyclic rings are two or more rings wherein adjacent rings are attached through a single atom. The individual rings within spirocyclic rings may be identical or different. Individual rings in spirocyclic rings may be substituted or unsubstituted and may have different substituents from other individual rings within a set of spirocyclic rings. Possible substituents for individual rings within spirocyclic rings are the possible substituents for the same ring when not part of spirocyclic rings (e.g., substituents for cycloalkyl or heterocycloalkyl rings). Spirocylic rings may be substituted or unsubstituted cycloalkyl, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkyl or substituted or unsubstituted heterocycloalkylene and individual rings within a spirocyclic ring group may be any of the immediately previous list, including having all rings of one type (e.g., all rings being substituted heterocycloalkylene wherein each ring may be the same or different substituted heterocycloalkylene). When referring to a spirocyclic ring system, heterocyclic spirocyclic rings means a spirocyclic rings wherein at least one ring is a heterocyclic ring and wherein each ring may be a different ring. When referring to a spirocyclic ring system, substituted spirocyclic rings means that at least one ring is substituted and each substituent may optionally be different.
The symbol “” denotes the point of attachment of a chemical moiety to the remainder of a molecule or chemical formula.
The term “oxo,” as used herein, means an oxygen that is double bonded to a carbon atom.
The term “alkylarylene” as an arylene moiety covalently bonded to an alkylene moiety (also referred to herein as an alkylene linker). In embodiments, the alkylarylene group has the formula:
An alkylarylene moiety may be substituted (e.g., with a substituent group) on the alkylene moiety or the arylene linker (e.g., at carbons 2, 3, 4, or 6) with halogen, oxo, —N3, —CF3, —CCl3, —CBr3, —CI3, —CN, —CHO, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO2CH3, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, substituted or unsubstituted C1-C5 alkyl or substituted or unsubstituted 2 to 5 membered heteroalkyl). In embodiments, the alkylarylene is unsubstituted.
The term “alkylsulfonyl,” as used herein, means a moiety having the formula —S(O2)—R′, where R′ is a substituted or unsubstituted alkyl group as defined above. R′ may have a specified number of carbons (e.g., “C1-C4 alkylsulfonyl”).
Each of the above terms (e.g., “alkyl,” “heteroalkyl,” “cycloalkyl,” “heterocycloalkyl,” “aryl,” and “heteroaryl”) includes both substituted and unsubstituted forms of the indicated radical. Preferred substituents for each type of radical are provided below.
Substituents for the alkyl and heteroalkyl radicals (including those groups often referred to as alkylene, alkenyl, heteroalkylene, heteroalkenyl, alkynyl, cycloalkyl, heterocycloalkyl, cycloalkenyl, and heterocycloalkenyl) can be one or more of a variety of groups selected from, but not limited to, —OR′, ═O, ═NR′, ═N—OR′, —NR′R″, —SR′, halogen, —SiR′R″R′″, —OC(O)R′, —C(O)R′, —CO2R′, —CONR′R″, —OC(O)NR′R″, —NR″C(O)R′, —NR′C(O)NR″R′″, —NR″C(O)2R′, —NRC(NR′R″R′″)═NR′″, —NRC(NR′R″)═NR′″, —S(O)R′, —S(O)2R′, —S(O)2NR′R″, —NRSO2R′, —NR′NR″R′″, —ONR′R″, —NR′C(O)NR″NR′″R′″, —CN, —NO2, —NR′SO2R″, —NR′C(O)R″, —NR′C(O)OR″, —NR′OR″, in a number ranging from zero to (2m′+1), where m′ is the total number of carbon atoms in such radical. R, R′, R″, R′″, and R″″ each preferably independently refer to hydrogen, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl (e.g., aryl substituted with 1-3 halogens), substituted or unsubstituted heteroaryl, substituted or unsubstituted alkyl, alkoxy, or thioalkoxy groups, or arylalkyl groups. When a compound described herein includes more than one R group, for example, each of the R groups is independently selected as are each R′, R″, R′″, and R″″ group when more than one of these groups is present. When R′ and R″ are attached to the same nitrogen atom, they can be combined with the nitrogen atom to form a 4-, 5-, 6-, or 7-membered ring. For example, —NR′R″ includes, but is not limited to, 1-pyrrolidinyl and 4-morpholinyl. From the above discussion of substituents, one of skill in the art will understand that the term “alkyl” is meant to include groups including carbon atoms bound to groups other than hydrogen groups, such as haloalkyl (e.g., —CF3 and —CH2CF3) and acyl (e.g., —C(O)CH3, —C(O)CF3, —C(O)CH2OCH3, and the like).
Similar to the substituents described for the alkyl radical, substituents for the aryl and heteroaryl groups are varied and are selected from, for example: —OR′, —NR′R″, —SR′, halogen, —SiR′R″R′″, —OC(O)R′, —C(O)R′, —CO2R′, —CONR′R″, —OC(O)NR′R″, —NR″C(O)R′, —NR′C(O)NR″R′″, —NR″C(O)2R′, —NR—C(NR′R″R′″)═NR′″, —NR—C(NR′R″)═NR′″, —S(O)R′, —S(O)2R′, —S(O)2NR′R″, —NRSO2R′, —NR′NR″R′″, —ONR′R″, —NR′C(O)NR″NR′″R′″, —CN, —NO2, —R′, —N3, —CH(Ph)2, fluoro(C1-C4)alkoxy, and fluoro(C1-C4)alkyl, —NR′SO2R″, —NR′C(O)R″, —NR′C(O)OR″, —NR′OR″, in a number ranging from zero to the total number of open valences on the aromatic ring system; and where R′, R″, R′″, and R″″ are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl. When a compound described herein includes more than one R group, for example, each of the R groups is independently selected as are each R′, R″, R′″, and R″″ groups when more than one of these groups is present.
Substituents for rings (e.g., cycloalkyl, heterocycloalkyl, aryl, heteroaryl, cycloalkylene, heterocycloalkylene, arylene, or heteroarylene) may be depicted as substituents on the ring rather than on a specific atom of a ring (commonly referred to as a floating substituent). In such a case, the substituent may be attached to any of the ring atoms (obeying the rules of chemical valency) and in the case of fused rings or spirocyclic rings, a substituent depicted as associated with one member of the fused rings or spirocyclic rings (a floating substituent on a single ring), may be a substituent on any of the fused rings or spirocyclic rings (a floating substituent on multiple rings). When a substituent is attached to a ring, but not a specific atom (a floating substituent), and a subscript for the substituent is an integer greater than one, the multiple substituents may be on the same atom, same ring, different atoms, different fused rings, different spirocyclic rings, and each substituent may optionally be different. Where a point of attachment of a ring to the remainder of a molecule is not limited to a single atom (a floating substituent), the attachment point may be any atom of the ring and in the case of a fused ring or spirocyclic ring, any atom of any of the fused rings or spirocyclic rings while obeying the rules of chemical valency. Where a ring, fused rings, or spirocyclic rings contain one or more ring heteroatoms and the ring, fused rings, or spirocyclic rings are shown with one more floating substituents (including, but not limited to, points of attachment to the remainder of the molecule), the floating substituents may be bonded to the heteroatoms. Where the ring heteroatoms are shown bound to one or more hydrogens (e.g., a ring nitrogen with two bonds to ring atoms and a third bond to a hydrogen) in the structure or formula with the floating substituent, when the heteroatom is bonded to the floating substituent, the substituent will be understood to replace the hydrogen, while obeying the rules of chemical valency.
Two or more substituents may optionally be joined to form aryl, heteroaryl, cycloalkyl, or heterocycloalkyl groups. Such so-called ring-forming substituents are typically, though not necessarily, found attached to a cyclic base structure. In one embodiment, the ring-forming substituents are attached to adjacent members of the base structure. For example, two ring-forming substituents attached to adjacent members of a cyclic base structure create a fused ring structure. In another embodiment, the ring-forming substituents are attached to a single member of the base structure. For example, two ring-forming substituents attached to a single member of a cyclic base structure create a spirocyclic structure. In yet another embodiment, the ring-forming substituents are attached to non-adjacent members of the base structure.
Two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally form a ring of the formula -T-C(O)—(CRR′)q-U-, wherein T and U are independently —NR—, —O—, —CRR′—, or a single bond, and q is an integer of from 0 to 3. Alternatively, two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula -A-(CH2)r-B-, wherein A and B are independently —CRR′—, —O—, —NR—, —S—, —S(O)—, —S(O)2—, —S(O)2NR′—, or a single bond, and r is an integer of from 1 to 4. One of the single bonds of the new ring so formed may optionally be replaced with a double bond. Alternatively, two of the substituents on adjacent atoms of the aryl or heteroaryl ring may optionally be replaced with a substituent of the formula —(CRR′)s—X′—(C″R″R′″)d—, where s and d are independently integers of from 0 to 3, and X is —O—, —NR′—, —S—, —S(O)—, —S(O)2—, or —S(O)2NR′—. The substituents R, R′, R″, and R′″ are preferably independently selected from hydrogen, substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, and substituted or unsubstituted heteroaryl.
As used herein, the terms “heteroatom” or “ring heteroatom” are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), selenium (Se), and silicon (Si). In embodiments, the terms “heteroatom” or “ring heteroatom” are meant to include oxygen (O), nitrogen (N), sulfur (S), phosphorus (P), and silicon (Si).
A “substituent group,” as used herein, means a group selected from the following moieties:
A “size-limited substituent” or “size-limited substituent group,” as used herein, means a group selected from all of the substituents described above for a “substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted C1-C20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C8 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C6-C10 aryl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl.
A “lower substituent” or “lower substituent group,” as used herein, means a group selected from all of the substituents described above for a “substituent group,” wherein each substituted or unsubstituted alkyl is a substituted or unsubstituted C1-C5 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C7 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted phenyl, and each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 6 membered heteroaryl.
In some embodiments, each substituted group described in the compounds herein is substituted with at least one substituent group. More specifically, in some embodiments, each substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene described in the compounds herein are substituted with at least one substituent group. In other embodiments, at least one or all of these groups are substituted with at least one size-limited substituent group. In other embodiments, at least one or all of these groups are substituted with at least one lower substituent group.
In other embodiments of the compounds herein, each substituted or unsubstituted alkyl may be a substituted or unsubstituted C1-C20 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 20 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C8 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 8 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C6-C10 aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 10 membered heteroaryl. In some embodiments of the compounds herein, each substituted or unsubstituted alkylene is a substituted or unsubstituted C1-C20 alkylene, each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 20 membered heteroalkylene, each substituted or unsubstituted cycloalkylene is a substituted or unsubstituted C3-C5 cycloalkylene, each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 8 membered heterocycloalkylene, each substituted or unsubstituted arylene is a substituted or unsubstituted C6-C10 arylene, and/or each substituted or unsubstituted heteroarylene is a substituted or unsubstituted 5 to 10 membered heteroarylene.
In some embodiments, each substituted or unsubstituted alkyl is a substituted or unsubstituted C1-C8 alkyl, each substituted or unsubstituted heteroalkyl is a substituted or unsubstituted 2 to 8 membered heteroalkyl, each substituted or unsubstituted cycloalkyl is a substituted or unsubstituted C3-C7 cycloalkyl, each substituted or unsubstituted heterocycloalkyl is a substituted or unsubstituted 3 to 7 membered heterocycloalkyl, each substituted or unsubstituted aryl is a substituted or unsubstituted C6-C10 aryl, and/or each substituted or unsubstituted heteroaryl is a substituted or unsubstituted 5 to 9 membered heteroaryl. In some embodiments, each substituted or unsubstituted alkylene is a substituted or unsubstituted C1-C5 alkylene, each substituted or unsubstituted heteroalkylene is a substituted or unsubstituted 2 to 8 membered heteroalkylene, each substituted or unsubstituted cycloalkylene is a substituted or unsubstituted C3-C7 cycloalkylene, each substituted or unsubstituted heterocycloalkylene is a substituted or unsubstituted 3 to 7 membered heterocycloalkylene, each substituted or unsubstituted arylene is a substituted or unsubstituted C6-C10 arylene, and/or each substituted or unsubstituted heteroarylene is a substituted or unsubstituted 5 to 9 membered heteroarylene. In some embodiments, the compound is a chemical species set forth in the Examples section, figures, or tables below.
In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is unsubstituted (e.g., is an unsubstituted alkyl, unsubstituted heteroalkyl, unsubstituted cycloalkyl, unsubstituted heterocycloalkyl, unsubstituted aryl, unsubstituted heteroaryl, unsubstituted alkylene, unsubstituted heteroalkylene, unsubstituted cycloalkylene, unsubstituted heterocycloalkylene, unsubstituted arylene, and/or unsubstituted heteroarylene, respectively). In embodiments, a substituted or unsubstituted moiety (e.g., substituted or unsubstituted alkyl, substituted or unsubstituted heteroalkyl, substituted or unsubstituted cycloalkyl, substituted or unsubstituted heterocycloalkyl, substituted or unsubstituted aryl, substituted or unsubstituted heteroaryl, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, and/or substituted or unsubstituted heteroarylene) is substituted (e.g., is a substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene, respectively).
In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, wherein if the substituted moiety is substituted with a plurality of substituent groups, each substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of substituent groups, each substituent group is different.
In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one size-limited substituent group, wherein if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of size-limited substituent groups, each size-limited substituent group is different.
In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one lower substituent group, wherein if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of lower substituent groups, each lower substituent group is different.
In embodiments, a substituted moiety (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, substituted heteroaryl, substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, if the substituted moiety is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group is different.
In a recited claim or chemical formula description herein, each R substituent or L linker that is described as being “substituted” without reference as to the identity of any chemical moiety that composes the “substituted” group (also referred to herein as an “open substitution” on an R substituent or L linker or an “openly substituted” R substituent or L linker), the recited R substituent or L linker may, in embodiments, be substituted with one or more first substituent groups as defined below.
The first substituent group is denoted with a corresponding first decimal point numbering system such that, for example, R1 may be substituted with one or more first substituent groups denoted by R1.1, R2 may be substituted with one or more first substituent groups denoted by R2.1, R3 may be substituted with one or more first substituent groups denoted by R3.1, R4 may be substituted with one or more first substituent groups denoted by R4.1, R5 may be substituted with one or more first substituent groups denoted by R5.1, and the like up to or exceeding an R100 that may be substituted with one or more first substituent groups denoted by R100.1. As a further example, R1A may be substituted with one or more first substituent groups denoted by R1A.1, R2A may be substituted with one or more first substituent groups denoted by R2A.1, R3A may be substituted with one or more first substituent groups denoted by R3A.1, R4A may be substituted with one or more first substituent groups denoted by R4A.1, R5A may be substituted with one or more first substituent groups denoted by R5A.1 and the like up to or exceeding an R100A may be substituted with one or more first substituent groups denoted by R100A.1. As a further example, L1 may be substituted with one or more first substituent groups denoted by RL1.1, L2 may be substituted with one or more first substituent groups denoted by RL2.1, L3 may be substituted with one or more first substituent groups denoted by RL3.1 L4 may be substituted with one or more first substituent groups denoted by RL4.1, L5 may be substituted with one or more first substituent groups denoted by RL5.1 and the like up to or exceeding an L100 which may be substituted with one or more first substituent groups denoted by RL100.1. Thus, each numbered R group or L group (alternatively referred to herein as RWW or LWW wherein “WW” represents the stated superscript number of the subject R group or L group) described herein may be substituted with one or more first substituent groups referred to herein generally as RWW.1 or RLWW.1 respectively. In turn, each first substituent group (e.g., R1.1, R2.1, R3.1, R4.1, R5.1 . . . R100.1; R1A.1, R2A.1, R3A.1, R4A.1, R5A.1 . . . R100A.1; RL1.1, RL2.1, RL3.1, RL4.1, RL5.1 . . . RL100.1) may be further substituted with one or more second substituent groups (e.g., R1.1, R2.2, R3.2, R4.2, R5.2 . . . R100.2; R1A.2, R2A.2, R3A.2, R4A.2, R5A.2 . . . R100A.2; RL1.2, RL2.2, RL3.2, RL4.2, RL5.2 . . . RL100.2, respectively). Thus, each first substituent group, which may alternatively be represented herein as RWW.1 as described above, may be further substituted with one or more second substituent groups, which may alternatively be represented herein as RWW.2.
Finally, each second substituent group (e.g., R1.2, R2.2, R3.2, R4.2, R5.2 . . . R100.2; R1A.2, R2A.2, R3A.2, R4A.2, R5A.2 . . . R100A.2; RL1.2, RL2.2, RL3.2, RL4.2, RL5.2 . . . RL100.2) may be further substituted with one or more third substituent groups (e.g., R1.3, R2.3, R3.3, R4.3, R5.3 . . . RL100.3; R1A.3, R2A.3, R3A.3, R4A.3, R5A.3 . . . R100A.3; RL1.3, RL2.3, RL3.3, RL4.3, RL5.3 . . . RL100.3; respectively). Thus, each second substituent group, which may alternatively be represented herein as RWW.2 as described above, may be further substituted with one or more third substituent groups, which may alternatively be represented herein as RWW.3. Each of the first substituent groups may be optionally different. Each of the second substituent groups may be optionally different. Each of the third substituent groups may be optionally different.
Thus, as used herein, RWW represents a substituent recited in a claim or chemical formula description herein which is openly substituted. “WW” represents the stated superscript number of the subject R group (1, 2, 3, 1A, 2A, 3A, 1B, 2B, 3B, etc.). Likewise, LWW is a linker recited in a claim or chemical formula description herein which is openly substituted. Again, “WW” represents the stated superscript number of the subject L group (1, 2, 3, 1A, 2A, 3A, 1B, 2B, 3B, etc.). As stated above, in embodiments, each RWW may be unsubstituted or independently substituted with one or more first substituent groups, referred to herein as RWW.1; each first substituent group, RWW.1, may be unsubstituted or independently substituted with one or more second substituent groups, referred to herein as RWW.2; and each second substituent group may be unsubstituted or independently substituted with one or more third substituent groups, referred to herein as RWW.3. Similarly, each LWW linker may be unsubstituted or independently substituted with one or more first substituent groups, referred to herein as RLWW.1; each first substituent group, RLWW.1, may be unsubstituted or independently substituted with one or more second substituent groups, referred to herein as RLWW.2; and each second substituent group may be unsubstituted or independently substituted with one or more third substituent groups, referred to herein as RLWW.3. Each first substituent group is optionally different. Each second substituent group is optionally different. Each third substituent group is optionally different. For example, if RWW is phenyl, the said phenyl group is optionally substituted by one or more RWW.1 groups as defined herein below, e.g., when RWW.1 is RWW.2-substituted or unsubstituted alkyl, examples of groups so formed include but are not limited to itself optionally substituted by 1 or more RWW.2, which RWW.2 is optionally substituted by one or more RWW.3. By way of example when the RWW group is phenyl substituted by RWW.1, which is methyl, the methyl group may be further substituted to form groups including but not limited to:
RWW.1 is independently oxo, halogen, —CXWW.13, —CHXWW.12, —CH2XWW.1, —OCXWW.13, —OCH2XWW.1, —OCHXWW.12, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, RWW.2-substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), RWW.2-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), RWW.2-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), RWW.2-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), RWW.2-substituted or unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or RWW.2-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, RWW.1 is independently oxo, halogen, —CXWW.13, —CHXWW.12, —CH2XWW.1, —OCXWW.13, —OCH2XWW.1, —OCHXWW.12, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). XWW.1 is independently —F, —Cl, —Br, or —I.
RWW.2 is independently oxo, halogen, —CXWW.23, —CHXWW.22, —CH2XWW.2, —OCXWW.23, —OCH2XWW.2, —OCHXWW.22, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, RWW.3-substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), RWW.3-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), RWW.3-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), RWW.3-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), RWW.3-substituted or unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or RWW.3-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, RWW.2 is independently oxo, halogen, —CXWW.23, —CHXWW.22—CH2XWW.2, —OCXWW.23, —OCH2XWW.2, —OCHXWW.22, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). XWW.2 is independently —F, —Cl, —Br, or —I.
RWW.3 is independently oxo, halogen, —CXWW.3, —CHXWW.32, —CH2XWW.3, —OCXWW.3, —OCH2XWW.3, —OCHXWW.32, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). XWW.3 is independently —F, —Cl, —Br, or —I.
Where two different RWW substituents are joined together to form an openly substituted ring (e.g., substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl or substituted heteroaryl), in embodiments the openly substituted ring may be independently substituted with one or more first substituent groups, referred to herein as RWW.1; each first substituent group, RWW.1, may be unsubstituted or independently substituted with one or more second substituent groups, referred to herein as RWW.2; and each second substituent group, RWW.2, may be unsubstituted or independently substituted with one or more third substituent groups, referred to herein as RWW.3; and each third substituent group, RWW.3, is unsubstituted. Each first substituent group is optionally different. Each second substituent group is optionally different. Each third substituent group is optionally different. In the context of two different RWW substituents joined together to form an openly substituted ring, the “WW” symbol in the RWW.1, RWW.2 and RWW.3 refers to the designated number of one of the two different RWW substituents. For example, in embodiments where R100A and R100B are optionally joined together to form an openly substituted ring, RWW.1 is R100B.1, RWW.2 is R100A.2, and RWW.3 is R100A.3. Alternatively, in embodiments where R100A and R100B are optionally joined together to form an openly substituted ring, RWW.1 is R100B.1, RWW.2 is R100B.2, and RWW.3 is R100B.3, RWW.1, RWW.2 and RWW.3 in this paragraph are as defined in the preceding paragraphs.
RLWW.1 is independently oxo, halogen, —CXLWW.13, —CHXLWW.12, —CH2XLWW.1, —OCXLWW.13, —OCH2XLWW.1, —OCHXLWW.12, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, RLWW.2-substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), RLWW.2-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), RLWW.2-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), RLWW.2-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), RLWW.2-substituted or unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or RLWW.2-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, RLWW.1 is independently oxo, halogen, —CXLWW.13, —CHXLWW.12, —CH2XLWW.1, —OCXLWW.13, —OCH2XLWW.1, —OCHXLWW.12, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). XLWW.1 is independently —F, —Cl, —Br, or —I.
RLWW.2 is independently oxo, halogen, —CXLWW.23, —CHXLWW.22, —CH2XLWW.2, —OCXLWW.23, —OCH2XLWW.2, —OCHXLWW.22, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, RLWW.3-substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), RLWW.3-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), RWW.3-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), RLWW.3-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), RLWW.3-substituted or unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or RLWW.3-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). In embodiments, RLWW.2 is independently oxo, halogen, —CXLWW.23, —CHXLWW.22, —CH2XLWW.2, —OCXLWW.23, —OCH2XLWW.2, —OCHXLWW.22, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). XLWW.2 is independently —F, —Cl, —Br, or —I.
RLWW.3 is independently oxo, halogen, —CXLWW.33, —CHXLWW.32, —CH2XLWW.3, —OCXLWW.33, —OCH2XLWW.3, —OCHXLWW.32, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). XLWW.3 is independently —F, —Cl, —Br, or —I.
In the event that any R group recited in a claim or chemical formula description set forth herein (RWW substituent) is not specifically defined in this disclosure, then that R group (RWW group) is hereby defined as independently oxo, halogen, —CXWW3, —CHXWW2, —CH2XWW, —OCXWW3, —OCH2XWW, —OCHXWW2, —CN, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —N3, RWW.1-substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), RWW.1-substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), RWW.1-substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), RWW.1-substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), RWW.1-substituted or unsubstituted aryl (e.g., C6-C12, C6-C10, or phenyl), or RWW.1-substituted or unsubstituted heteroaryl (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). XWW is independently —F, —Cl, —Br, or —I. Again, “WW” represents the stated superscript number of the subject R group (e.g., 1, 2, 3, 1A, 2A, 3A, 1B, 2B, 3B, etc.). RWW.1, RWW.2, and RWW.3 are as defined above.
In the event that any L linker group recited in a claim or chemical formula description set forth herein (i.e., an LWW substituent) is not explicitly defined, then that L group (LWW group) is herein defined as independently a bond, —O—, —NH—, —C(O)—, —C(O)NH—, —NHC(O)—, —NHC(O)NH—, —NHC(NH)NH—, —C(O)O—, —OC(O)—, —S—, —SO2—, —SO2NH—, RLWW.1-substituted or unsubstituted alkylene (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), RLWW.1-substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), RLWW.1-substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), RLWW.1-substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), RLWW.1-substituted or unsubstituted arylene (e.g., C6-C12, C6-C10, or phenyl), or RLWW.1-substituted or unsubstituted heteroarylene (e.g., 5 to 12 membered, 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered). Again, “WW” represents the stated superscript number of the subject L group (1, 2, 3, 1A, 2A, 3A, 1B, 2B, 3B, etc.). RLWW.1, as well as RLWW.2 and RLWW.3 are as defined above.
Certain compounds of the present disclosure possess asymmetric carbon atoms (optical or chiral centers) or double bonds; the enantiomers, racemates, diastereomers, tautomers, geometric isomers, stereoisometric forms that may be defined, in terms of absolute stereochemistry, as (R)- or (S)- or, as (D)- or (L)- for amino acids, and individual isomers are encompassed within the scope of the present disclosure. The compounds of the present disclosure do not include those that are known in art to be too unstable to synthesize and/or isolate. The present disclosure is meant to include compounds in racemic and optically pure forms. Optically active (R)- and (S)-, or (D)- and (L)-isomers may be prepared using chiral synthons or chiral reagents, or resolved using conventional techniques. When the compounds described herein contain olefinic bonds or other centers of geometric asymmetry, and unless specified otherwise, it is intended that the compounds include both E and Z geometric isomers.
As used herein, the term “isomers” refers to compounds having the same number and kind of atoms, and hence the same molecular weight, but differing in respect to the structural arrangement or configuration of the atoms.
The term “tautomer,” as used herein, refers to one of two or more structural isomers which exist in equilibrium and which are readily converted from one isomeric form to another.
It will be apparent to one skilled in the art that certain compounds of this disclosure may exist in tautomeric forms, all such tautomeric forms of the compounds being within the scope of the disclosure.
Unless otherwise stated, structures depicted herein are also meant to include all stereochemical forms of the structure; i.e., the R and S configurations for each asymmetric center. Therefore, single stereochemical isomers as well as enantiomeric and diastereomeric mixtures of the present compounds are within the scope of the disclosure.
Unless otherwise stated, structures depicted herein are also meant to include compounds which differ only in the presence of one or more isotopically enriched atoms. For example, compounds having the present structures except for the replacement of a hydrogen by a deuterium or tritium, or the replacement of a carbon by 13C- or 14C-enriched carbon are within the scope of this disclosure.
The compounds of the present disclosure may also contain unnatural proportions of atomic isotopes at one or more of the atoms that constitute such compounds. For example, the compounds may be radiolabeled with radioactive isotopes, such as for example tritium (3H), iodine-125 (125I), or carbon-14 (14C). All isotopic variations of the compounds of the present disclosure, whether radioactive or not, are encompassed within the scope of the present disclosure.
It should be noted that throughout the application that alternatives are written in Markush groups, for example, each amino acid position that contains more than one possible amino acid. It is specifically contemplated that each member of the Markush group should be considered separately, thereby comprising another embodiment, and the Markush group is not to be read as a single unit.
As used herein, the terms “bioconjugate” and “bioconjugate linker” refer to the resulting association between atoms or molecules of bioconjugate reactive groups or bioconjugate reactive moieties. The association can be direct or indirect. For example, a conjugate between a first bioconjugate reactive group (e.g., —NH2, —COOH, —N-hydroxysuccinimide, or -maleimide) and a second bioconjugate reactive group (e.g., sulfhydryl, sulfur-containing amino acid, amine, amine sidechain containing amino acid, or carboxylate) provided herein can be direct, e.g., by covalent bond or linker (e.g., a first linker of second linker), or indirect, e.g., by non-covalent bond (e.g., electrostatic interactions (e.g., ionic bond, hydrogen bond, halogen bond), van der Waals interactions (e.g., dipole-dipole, dipole-induced dipole, London dispersion), ring stacking (pi effects), hydrophobic interactions and the like). In embodiments, bioconjugates or bioconjugate linkers are formed using bioconjugate chemistry (i.e., the association of two bioconjugate reactive groups) including, but are not limited to nucleophilic substitutions (e.g., reactions of amines and alcohols with acyl halides, active esters), electrophilic substitutions (e.g., enamine reactions) and additions to carbon-carbon and carbon-heteroatom multiple bonds (e.g., Michael reaction, Diels-Alder addition). These and other useful reactions are discussed in, for example, March, ADVANCED ORGANIC CHEMISTRY, 3rd Ed., John Wiley & Sons, New York, 1985; Hermanson, BIOCONJUGATE TECHNIQUES, Academic Press, San Diego, 1996; and Feeney et al., MODIFICATION OF PROTEINS; Advances in Chemistry Series, Vol. 198, American Chemical Society, Washington, D.C., 1982. In embodiments, the first bioconjugate reactive group (e.g., maleimide moiety) is covalently attached to the second bioconjugate reactive group (e.g., a sulfhydryl). In embodiments, the first bioconjugate reactive group (e.g., haloacetyl moiety) is covalently attached to the second bioconjugate reactive group (e.g., a sulfhydryl). In embodiments, the first bioconjugate reactive group (e.g., pyridyl moiety) is covalently attached to the second bioconjugate reactive group (e.g., a sulfhydryl). In embodiments, the first bioconjugate reactive group (e.g., —N-hydroxysuccinimide moiety) is covalently attached to the second bioconjugate reactive group (e.g., an amine). In embodiments, the first bioconjugate reactive group (e.g., maleimide moiety) is covalently attached to the second bioconjugate reactive group (e.g., a sulfhydryl). In embodiments, the first bioconjugate reactive group (e.g., -sulfo-N-hydroxysuccinimide moiety) is covalently attached to the second bioconjugate reactive group (e.g., an amine).
Useful bioconjugate reactive moieties used for bioconjugate chemistries herein include, for example: (a) carboxyl groups and various derivatives thereof including, but not limited to, N-hydroxysuccinimide esters, N-hydroxybenztriazole esters, acid halides, acyl imidazoles, thioesters, p-nitrophenyl esters, alkyl, alkenyl, alkynyl and aromatic esters; (b) hydroxyl groups which can be converted to esters, ethers, aldehydes, etc.; (c) haloalkyl groups wherein the halide can be later displaced with a nucleophilic group such as, for example, an amine, a carboxylate anion, thiol anion, carbanion, or an alkoxide ion, thereby resulting in the covalent attachment of a new group at the site of the halogen atom; (d) dienophile groups which are capable of participating in Diels-Alder reactions such as, for example, maleimido or maleimide groups; (e) aldehyde or ketone groups such that subsequent derivatization is possible via formation of carbonyl derivatives such as, for example, imines, hydrazones, semicarbazones or oximes, or via such mechanisms as Grignard addition or alkyllithium addition; (f) sulfonyl halide groups for subsequent reaction with amines, for example, to form sulfonamides; (g) thiol groups, which can be converted to disulfides, reacted with acyl halides, or bonded to metals such as gold, or react with maleimides; (h) amine or sulfhydryl groups (e.g., present in cysteine), which can be, for example, acylated, alkylated or oxidized; (i) alkenes, which can undergo, for example, cycloadditions, acylation, Michael addition, etc.; (j) epoxides, which can react with, for example, amines and hydroxyl compounds; (k) phosphoramidites and other standard functional groups useful in nucleic acid synthesis; (1) metal silicon oxide bonding; (m) metal bonding to reactive phosphorus groups (e.g., phosphines) to form, for example, phosphate diester bonds; (n) azides coupled to alkynes using copper catalyzed cycloaddition click chemistry; and (o) biotin conjugate can react with avidin or streptavidin to form an avidin-biotin complex or streptavidin-biotin complex.
The bioconjugate reactive groups can be chosen such that they do not participate in, or interfere with, the chemical stability of the conjugate described herein. Alternatively, a reactive functional group can be protected from participating in the crosslinking reaction by the presence of a protecting group. In embodiments, the bioconjugate comprises a molecular entity derived from the reaction of an unsaturated bond, such as a maleimide, and a sulfhydryl group.
“Analog,” “analogue,” or “derivative” is used in accordance with its plain ordinary meaning within Chemistry and Biology and refers to a chemical compound that is structurally similar to another compound (i.e., a so-called “reference” compound) but differs in composition, e.g., in the replacement of one atom by an atom of a different element, or in the presence of a particular functional group, or the replacement of one functional group by another functional group, or the absolute stereochemistry of one or more chiral centers of the reference compound. Accordingly, an analog is a compound that is similar or comparable in function and appearance but not in structure or origin to a reference compound.
The terms “a” or “an”, as used in herein means one or more. In addition, the phrase “substituted with a[n]”, as used herein, means the specified group may be substituted with one or more of any or all of the named substituents. For example, where a group, such as an alkyl or heteroaryl group, is “substituted with an unsubstituted C1-C20 alkyl, or unsubstituted 2 to 20 membered heteroalkyl”, the group may contain one or more unsubstituted C1-C20 alkyls, and/or one or more unsubstituted 2 to 20 membered heteroalkyls.
Moreover, where a moiety is substituted with an R substituent, the group may be referred to as “R-substituted.” Where a moiety is R-substituted, the moiety is substituted with at least one R substituent and each R substituent is optionally different. Where a particular R group is present in the description of a chemical genus (such as Formula (I)), a Roman alphabetic symbol may be used to distinguish each appearance of that particular R group. For example, where multiple R13 substituents are present, each R13 substituent may be distinguished as R13A, R13B, R13C, R13D, etc., wherein each of R13A, R13B, R13C, R13D, etc. is defined within the scope of the definition of R13 and optionally differently.
Descriptions of compounds of the present disclosure are limited by principles of chemical bonding known to those skilled in the art. Accordingly, where a group may be substituted by one or more of a number of substituents, such substitutions are selected so as to comply with principles of chemical bonding and to give compounds which are not inherently unstable and/or would be known to one of ordinary skill in the art as likely to be unstable under ambient conditions, such as aqueous, neutral, and several known physiological conditions. For example, a heterocycloalkyl or heteroaryl is attached to the remainder of the molecule via a ring heteroatom in compliance with principles of chemical bonding known to those skilled in the art thereby avoiding inherently unstable compounds.
The term “pharmaceutically acceptable salts” is meant to include salts of the active compounds that are prepared with relatively nontoxic acids or bases, depending on the particular substituents found on the compounds described herein. When compounds of the present disclosure contain relatively acidic functionalities, base addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired base, either neat or in a suitable inert solvent. Examples of pharmaceutically acceptable base addition salts include sodium, potassium, calcium, ammonium, organic amino, or magnesium salt, or a similar salt. When compounds of the present disclosure contain relatively basic functionalities, acid addition salts can be obtained by contacting the neutral form of such compounds with a sufficient amount of the desired acid, either neat or in a suitable inert solvent. Examples of pharmaceutically acceptable acid addition salts include those derived from inorganic acids like hydrochloric, hydrobromic, nitric, carbonic, monohydrogencarbonic, phosphoric, monohydrogenphosphoric, dihydrogenphosphoric, sulfuric, monohydrogensulfuric, hydriodic, or phosphorous acids and the like, as well as the salts derived from relatively nontoxic organic acids like acetic, propionic, isobutyric, maleic, malonic, benzoic, succinic, suberic, fumaric, lactic, mandelic, phthalic, benzenesulfonic, p-tolylsulfonic, citric, tartaric, oxalic, methanesulfonic, and the like. Also included are salts of amino acids such as arginate and the like, and salts of organic acids like glucuronic or galactunoric acids and the like (see, for example, Berge et al., “Pharmaceutical Salts”, Journal of Pharmaceutical Science, 1977, 66, 1-19). Certain specific compounds of the present disclosure contain both basic and acidic functionalities that allow the compounds to be converted into either base or acid addition salts.
Thus, the compounds of the present disclosure may exist as salts, such as with pharmaceutically acceptable acids. The present disclosure includes such salts. Non-limiting examples of such salts include hydrochlorides, hydrobromides, phosphates, sulfates, methanesulfonates, nitrates, maleates, acetates, citrates, fumarates, proprionates, tartrates (e.g., (+)-tartrates, (−)-tartrates, or mixtures thereof including racemic mixtures), succinates, benzoates, and salts with amino acids such as glutamic acid, and quaternary ammonium salts (e.g., methyl iodide, ethyl iodide, and the like). These salts may be prepared by methods known to those skilled in the art.
The neutral forms of the compounds are preferably regenerated by contacting the salt with a base or acid and isolating the parent compound in the conventional manner. The parent form of the compound may differ from the various salt forms in certain physical properties, such as solubility in polar solvents.
In addition to salt forms, the present disclosure provides compounds, which are in a prodrug form. Prodrugs of the compounds described herein are those compounds that readily undergo chemical changes under physiological conditions to provide the compounds of the present disclosure. Prodrugs of the compounds described herein may be converted in vivo after administration. Additionally, prodrugs can be converted to the compounds of the present disclosure by chemical or biochemical methods in an ex vivo environment, such as, for example, when contacted with a suitable enzyme or chemical reagent.
Certain compounds of the present disclosure can exist in unsolvated forms as well as solvated forms, including hydrated forms. In general, the solvated forms are equivalent to unsolvated forms and are encompassed within the scope of the present disclosure. Certain compounds of the present disclosure may exist in multiple crystalline or amorphous forms. In general, all physical forms are equivalent for the uses contemplated by the present disclosure and are intended to be within the scope of the present disclosure.
A polypeptide, or a cell is “recombinant” when it is artificial or engineered, or derived from or contains an artificial or engineered protein or nucleic acid (e.g., non-natural or not wild type). For example, a polynucleotide that is inserted into a vector or any other heterologous location, e.g., in a genome of a recombinant organism, such that it is not associated with nucleotide sequences that normally flank the polynucleotide as it is found in nature is a recombinant polynucleotide. A protein expressed in vitro or in vivo from a recombinant polynucleotide is an example of a recombinant polypeptide. Likewise, a polynucleotide sequence that does not appear in nature, for example a variant of a naturally occurring gene, is recombinant.
“Co-administer” is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies. The compounds of the invention can be administered alone or can be co-administered to the patient. Co-administration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound). Thus, the preparations can also be combined, when desired, with other active substances (e.g., to reduce metabolic degradation).
A “cell” as used herein, refers to a cell carrying out metabolic or other function sufficient to preserve or replicate its genomic DNA. A cell can be identified by well-known methods in the art including, for example, presence of an intact membrane, staining by a particular dye, ability to produce progeny or, in the case of a gamete, ability to combine with a second gamete to produce a viable offspring. Cells may include prokaryotic and eukaroytic cells. Prokaryotic cells include but are not limited to bacteria. Eukaryotic cells include but are not limited to yeast cells and cells derived from plants and animals, for example mammalian, insect (e.g., Spodoptera) and human cells. Cells may be useful when they are naturally nonadherent or have been treated not to adhere to surfaces, for example by trypsinization.
The terms “treating” or “treatment” refers to any indicia of success in the treatment or amelioration of an injury, disease, pathology or condition, including any objective or subjective parameter such as abatement; remission; diminishing of symptoms or making the injury, pathology or condition more tolerable to the patient; slowing in the rate of degeneration or decline; making the final point of degeneration less debilitating; improving a patient's physical or mental well-being. The treatment or amelioration of symptoms can be based on objective or subjective parameters; including the results of a physical examination, neuropsychiatric exams, and/or a psychiatric evaluation. For example, the certain methods presented herein successfully treat cancer by decreasing the incidence of cancer and or causing remission of cancer. In some embodiments of the compositions or methods described herein, treating cancer includes slowing the rate of growth or spread of cancer cells, reducing metastasis, or reducing the growth of metastatic tumors. The term “treating” and conjugations thereof, include prevention of an injury, pathology, condition, or disease. In embodiments, treating is preventing. In embodiments, treating does not include preventing. In embodiments, the treating or treatment is no prophylactic treatment.
An “effective amount” is an amount sufficient for a compound to accomplish a stated purpose relative to the absence of the compound (e.g., achieve the effect for which it is administered, treat a disease, reduce enzyme activity, increase enzyme activity, reduce signaling pathway, reduce one or more symptoms of a disease or condition. An example of an “effective amount” is an amount sufficient to contribute to the treatment, prevention, or reduction of a symptom or symptoms of a disease, which could also be referred to as a “therapeutically effective amount” when referred to in this context. A “reduction” of a symptom or symptoms (and grammatical equivalents of this phrase) means decreasing of the severity or frequency of the symptom(s), or elimination of the symptom(s). A “prophylactically effective amount” of a drug is an amount of a drug that, when administered to a subject, will have the intended prophylactic effect, e.g., preventing or delaying the onset (or reoccurrence) of an injury, disease, pathology or condition, or reducing the likelihood of the onset (or reoccurrence) of an injury, disease, pathology, or condition, or their symptoms. The full prophylactic effect does not necessarily occur by administration of one dose, and may occur only after administration of a series of doses. Thus, a prophylactically effective amount may be administered in one or more administrations. An “activity decreasing amount,” as used herein, refers to an amount of antagonist required to decrease the activity of an enzyme relative to the absence of the antagonist. A “function disrupting amount,” as used herein, refers to the amount of antagonist required to disrupt the function of an enzyme or protein relative to the absence of the antagonist. An “activity increasing amount,” as used herein, refers to an amount of agonist required to increase the activity of an enzyme relative to the absence of the agonist. A “function increasing amount,” as used herein, refers to the amount of agonist required to increase the function of an enzyme or protein relative to the absence of the agonist. The exact amounts will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (see, e.g., Lieberman, Pharmaceutical Dosage Forms (vols. 1-3, 1992); Lloyd, The Art, Science and Technology of Pharmaceutical Compounding (1999); Pickar, Dosage Calculations (1999); and Remington: The Science and Practice of Pharmacy, 20th Edition, 2003, Gennaro, Ed., Lippincott, Williams & Wilkins).
“Control” or “control experiment” is used in accordance with its plain ordinary meaning and refers to an experiment in which the subjects or reagents of the experiment are treated as in a parallel experiment except for omission of a procedure, reagent, or variable of the experiment. In some instances, the control is used as a standard of comparison in evaluating experimental effects. In some embodiments, a control is the measurement of the activity (e.g., signaling pathway) of a protein in the absence of a compound as described herein (including embodiments, examples, figures, or Tables).
“Contacting” is used in accordance with its plain ordinary meaning and refers to the process of allowing at least two distinct species (e.g., chemical compounds including biomolecules, or cells) to become sufficiently proximal to react, interact or physically touch. It should be appreciated; however, the resulting reaction product can be produced directly from a reaction between the added reagents or from an intermediate from one or more of the added reagents which can be produced in the reaction mixture.
The term “contacting” may include allowing two species to react, interact, or physically touch, wherein the two species may be a compound as described herein and a cellular component (e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, virus, lipid droplet, vesicle, small molecule, protein complex, protein aggregate, or macromolecule). In some embodiments contacting includes allowing a compound described herein to interact with a cellular component (e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, virus, lipid droplet, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule) that is involved in a signaling pathway.
As defined herein, the term “activation,” “activate,” “activating” and the like in reference to a protein refers to conversion of a protein into a biologically active derivative from an initial inactive or deactivated state. The terms reference activation, or activating, sensitizing, or up-regulating signal transduction or enzymatic activity or the amount of a protein decreased in a disease.
The terms “agonist,” “activator,” “upregulator,” etc. refer to a substance capable of detectably increasing the expression or activity of a given gene or protein. The agonist can increase expression or activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to a control in the absence of the agonist. In certain instances, expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or higher than the expression or activity in the absence of the agonist.
As defined herein, the term “inhibition,” “inhibit,” “inhibiting” and the like in reference to a cellular component-inhibitor interaction means negatively affecting (e.g., decreasing) the activity or function of the cellular component (e.g., decreasing the signaling pathway stimulated by a cellular component (e.g., protein, ion, lipid, virus, lipid droplet, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule)), relative to the activity or function of the cellular component in the absence of the inhibitor. In embodiments inhibition means negatively affecting (e.g., decreasing) the concentration or levels of the cellular component relative to the concentration or level of the cellular component in the absence of the inhibitor. In some embodiments, inhibition refers to reduction of a disease or symptoms of disease. In some embodiments, inhibition refers to a reduction in the activity of a signal transduction pathway or signaling pathway (e.g., reduction of a pathway involving the cellular component). Thus, inhibition includes, at least in part, partially or totally blocking stimulation, decreasing, preventing, or delaying activation, or inactivating, desensitizing, or down-regulating the signaling pathway or enzymatic activity or the amount of a cellular component.
The terms “inhibitor,” “repressor,” “antagonist,” or “downregulator” interchangeably refer to a substance capable of detectably decreasing the expression or activity of a given gene or protein. The antagonist can decrease expression or activity by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, or 99% in comparison to a control in the absence of the antagonist. In certain instances, expression or activity is 1.5-fold, 2-fold, 3-fold, 4-fold, 5-fold, 10-fold or lower than the expression or activity in the absence of the antagonist.
The term “modulator” refers to a composition that increases or decreases the level of a target molecule or the function of a target molecule or the physical state of the target of the molecule (e.g., a target may be a cellular component (e.g., protein, ion, lipid, virus, lipid droplet, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule)) relative to the absence of the composition.
The term “expression” includes any step involved in the production of the polypeptide including, but not limited to, transcription, post-transcriptional modification, translation, post-translational modification, and secretion. Expression can be detected using conventional techniques for detecting protein (e.g., ELISA, Western blotting, flow cytometry, immunofluorescence, immunohistochemistry, etc.).
The term “modulate” is used in accordance with its plain ordinary meaning and refers to the act of changing or varying one or more properties. “Modulation” refers to the process of changing or varying one or more properties. For example, as applied to the effects of a modulator on a target protein, to modulate means to change by increasing or decreasing a property or function of the target molecule or the amount of the target molecule.
“Patient” or “subject in need thereof” refers to a living organism suffering from or prone to a disease or condition that can be treated by administration of a pharmaceutical composition as provided herein. Non-limiting examples include humans, other mammals, bovines, rats, mice, dogs, monkeys, goat, sheep, cows, deer, and other non-mammalian animals. In some embodiments, a patient is human.
“Disease” or “condition” refer to a state of being or health status of a patient or subject capable of being treated with the compounds or methods provided herein. In some embodiments, the disease is a disease related to (e.g., caused by) a cellular component (e.g., protein, ion, lipid, nucleic acid, nucleotide, amino acid, protein, particle, organelle, cellular compartment, microorganism, vesicle, small molecule, protein complex, protein aggregate, or macromolecule). In embodiments, the disease is a cancer.
The term “bone condition” as used herein refers to a disease, disorder or condition caused by abnormal bone tissues (e.g., osteoblast, osteoclast, osteocyte, and hematopoietic). In embodiments, the bone condition is caused by, but not limited to, cancerous or noncancerous tissues, infection, osteoporosis, tumor, blood cells, and fibrous tissues, which is developed in various sites of bones of a subject such as thighbone, skull, ribs, pelvis, humerus, shinbone, trunk, sternum, wrist bones, tarsals, spine, shoulder blade, collar bone, radius, ulna, metacarpals, phalanges, kneecap, fibula, metatarsals and phalanges. In certain embodiments, the bone condition may be caused by cancerous bone tissues or noncancerous bone tissues. In certain embodiments, the bone condition may be related to abnormal fibrous tissue development/occurrence in place of normal bone.
As used herein, the term “cancer” refers to all types of cancer, neoplasm or malignant tumors found in mammals (e.g., humans), including leukemia, lymphoma, carcinomas and sarcomas. Exemplary cancers that may be treated with a compound or method provided herein include cancer of the thyroid, endocrine system, brain, breast, cervix, colon, head and neck, liver, kidney, lung, non-small cell lung, melanoma, mesothelioma, ovary, sarcoma, stomach, uterus, medulloblastoma, colorectal cancer, or pancreatic cancer. Additional examples include, Hodgkin's Disease, Non-Hodgkin's Lymphoma, multiple myeloma, neuroblastoma, glioma, glioblastoma multiforme, ovarian cancer, rhabdomyosarcoma, primary thrombocytosis, primary macroglobulinemia, primary brain tumors, cancer, malignant pancreatic insulanoma, malignant carcinoid, urinary bladder cancer, premalignant skin lesions, testicular cancer, lymphomas, thyroid cancer, esophageal cancer, genitourinary tract cancer, malignant hypercalcemia, endometrial cancer, adrenal cortical cancer, neoplasms of the endocrine or exocrine pancreas, medullary thyroid cancer, medullary thyroid carcinoma, melanoma, colorectal cancer, papillary thyroid cancer, hepatocellular carcinoma, or prostate cancer.
The term “leukemia” refers broadly to progressive, malignant diseases of the blood-forming organs and is generally characterized by a distorted proliferation and development of leukocytes and their precursors in the blood and bone marrow. Leukemia is generally clinically classified on the basis of (1) the duration and character of the disease-acute or chronic; (2) the type of cell involved; myeloid (myelogenous), lymphoid (lymphogenous), or monocytic; and (3) the increase or non-increase in the number abnormal cells in the blood-leukemic or aleukemic (subleukemic). Exemplary leukemias that may be treated with a compound or method provided herein include, for example, acute nonlymphocytic leukemia, chronic lymphocytic leukemia, acute granulocytic leukemia, chronic granulocytic leukemia, acute promyelocytic leukemia, adult T-cell leukemia, aleukemic leukemia, a leukocythemic leukemia, basophylic leukemia, blast cell leukemia, bovine leukemia, chronic myelocytic leukemia, leukemia cutis, embryonal leukemia, eosinophilic leukemia, Gross' leukemia, hairy-cell leukemia, hemoblastic leukemia, hemocytoblastic leukemia, histiocytic leukemia, stem cell leukemia, acute monocytic leukemia, leukopenic leukemia, lymphatic leukemia, lymphoblastic leukemia, lymphocytic leukemia, lymphogenous leukemia, lymphoid leukemia, lymphosarcoma cell leukemia, mast cell leukemia, megakaryocytic leukemia, micromyeloblastic leukemia, monocytic leukemia, myeloblastic leukemia, myelocytic leukemia, myeloid granulocytic leukemia, myelomonocytic leukemia, Naegeli leukemia, plasma cell leukemia, multiple myeloma, plasmacytic leukemia, promyelocytic leukemia, Rieder cell leukemia, Schilling's leukemia, stem cell leukemia, subleukemic leukemia, or undifferentiated cell leukemia.
As used herein, the term “lymphoma” refers to a group of cancers affecting hematopoietic and lymphoid tissues. It begins in lymphocytes, the blood cells that are found primarily in lymph nodes, spleen, thymus, and bone marrow. Two main types of lymphoma are non-Hodgkin lymphoma and Hodgkin's disease. Hodgkin's disease represents approximately 15% of all diagnosed lymphomas. This is a cancer associated with Reed-Sternberg malignant B lymphocytes. Non-Hodgkin's lymphomas (NHL) can be classified based on the rate at which cancer grows and the type of cells involved. There are aggressive (high grade) and indolent (low grade) types of NHL. Based on the type of cells involved, there are B-cell and T-cell NHLs. Exemplary B-cell lymphomas that may be treated with a compound or method provided herein include, but are not limited to, small lymphocytic lymphoma, Mantle cell lymphoma, follicular lymphoma, marginal zone lymphoma, extranodal (MALT) lymphoma, nodal (monocytoid B-cell) lymphoma, splenic lymphoma, diffuse large cell B-lymphoma, Burkitt's lymphoma, lymphoblastic lymphoma, immunoblastic large cell lymphoma, or precursor B-lymphoblastic lymphoma. Exemplary T-cell lymphomas that may be treated with a compound or method provided herein include, but are not limited to, cutaneous T-cell lymphoma, peripheral T-cell lymphoma, anaplastic large cell lymphoma, mycosis fungoides, and precursor T-lymphoblastic lymphoma.
The term “sarcoma” generally refers to a tumor which is made up of a substance like the embryonic connective tissue and is generally composed of closely packed cells embedded in a fibrillar or homogeneous substance. Sarcomas that may be treated with a compound or method provided herein include a chondrosarcoma, fibrosarcoma, lymphosarcoma, melanosarcoma, myxosarcoma, osteosarcoma, Abemethy's sarcoma, adipose sarcoma, liposarcoma, alveolar soft part sarcoma, ameloblastic sarcoma, botryoid sarcoma, chloroma sarcoma, chorio carcinoma, embryonal sarcoma, Wilms' tumor sarcoma, endometrial sarcoma, stromal sarcoma, Ewing's sarcoma, fascial sarcoma, fibroblastic sarcoma, giant cell sarcoma, granulocytic sarcoma, Hodgkin's sarcoma, idiopathic multiple pigmented hemorrhagic sarcoma, immunoblastic sarcoma of B cells, lymphoma, immunoblastic sarcoma of T-cells, Jensen's sarcoma, Kaposi's sarcoma, Kupffer cell sarcoma, angiosarcoma, leukosarcoma, malignant mesenchymoma sarcoma, parosteal sarcoma, reticulocytic sarcoma, Rous sarcoma, serocystic sarcoma, synovial sarcoma, or telangiectaltic sarcoma.
The term “melanoma” is taken to mean a tumor arising from the melanocytic system of the skin and other organs. Melanomas that may be treated with a compound or method provided herein include, for example, acral-lentiginous melanoma, amelanotic melanoma, benign juvenile melanoma, Cloudman's melanoma, S91 melanoma, Harding-Passey melanoma, juvenile melanoma, lentigo maligna melanoma, malignant melanoma, nodular melanoma, subungal melanoma, or superficial spreading melanoma.
The term “carcinoma” refers to a malignant new growth made up of epithelial cells tending to infiltrate the surrounding tissues and give rise to metastases. Exemplary carcinomas that may be treated with a compound or method provided herein include, for example, medullary thyroid carcinoma, familial medullary thyroid carcinoma, acinar carcinoma, acinous carcinoma, adenocystic carcinoma, adenoid cystic carcinoma, carcinoma adenomatosum, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma, basal cell carcinoma, carcinoma basocellulare, basaloid carcinoma, basosquamous cell carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma, chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epiermoid carcinoma, carcinoma epitheliale adenoides, exophytic carcinoma, carcinoma ex ulcere, carcinoma fibrosum, gelatiniforni carcinoma, gelatinous carcinoma, giant cell carcinoma, carcinoma gigantocellulare, glandular carcinoma, granulosa cell carcinoma, hair-matrix carcinoma, hematoid carcinoma, hepatocellular carcinoma, Hurthle cell carcinoma, hyaline carcinoma, hypernephroid carcinoma, infantile embryonal carcinoma, carcinoma in situ, intraepidermal carcinoma, intraepithelial carcinoma, Krompecher's carcinoma, Kulchitzky-cell carcinoma, large-cell carcinoma, lenticular carcinoma, carcinoma lenticulare, lipomatous carcinoma, lymphoepithelial carcinoma, carcinoma medullare, medullary carcinoma, melanotic carcinoma, carcinoma molle, mucinous carcinoma, carcinoma muciparum, carcinoma mucocellulare, mucoepidermoid carcinoma, carcinoma mucosum, mucous carcinoma, carcinoma myxomatodes, nasopharyngeal carcinoma, oat cell carcinoma, carcinoma ossificans, osteoid carcinoma, papillary carcinoma, periportal carcinoma, preinvasive carcinoma, prickle cell carcinoma, pultaceous carcinoma, renal cell carcinoma of kidney, reserve cell carcinoma, carcinoma sarcomatodes, schneiderian carcinoma, scirrhous carcinoma, carcinoma scroti, signet-ring cell carcinoma, carcinoma simplex, small-cell carcinoma, solanoid carcinoma, spheroidal cell carcinoma, spindle cell carcinoma, carcinoma spongiosum, squamous carcinoma, squamous cell carcinoma, string carcinoma, carcinoma telangiectaticum, carcinoma telangiectodes, transitional cell carcinoma, carcinoma tuberosum, tuberous carcinoma, verrucous carcinoma, or carcinoma villosum.
As used herein, the terms “metastasis,” “metastatic,” and “metastatic cancer” can be used interchangeably and refer to the spread of a proliferative disease or disorder, e.g., cancer, from one organ or another non-adjacent organ or body part. “Metastatic cancer” is also called “Stage IV cancer.” Cancer occurs at an originating site, e.g., breast, which site is referred to as a primary tumor, e.g., primary breast cancer. Some cancer cells in the primary tumor or originating site acquire the ability to penetrate and infiltrate surrounding normal tissue in the local area and/or the ability to penetrate the walls of the lymphatic system or vascular system circulating through the system to other sites and tissues in the body. A second clinically detectable tumor formed from cancer cells of a primary tumor is referred to as a metastatic or secondary tumor. When cancer cells metastasize, the metastatic tumor and its cells are presumed to be similar to those of the original tumor. Thus, if lung cancer metastasizes to the breast, the secondary tumor at the site of the breast consists of abnormal lung cells and not abnormal breast cells. The secondary tumor in the breast is referred to a metastatic lung cancer. Thus, the phrase metastatic cancer refers to a disease in which a subject has or had a primary tumor and has one or more secondary tumors. The phrases non-metastatic cancer or subjects with cancer that is not metastatic refers to diseases in which subjects have a primary tumor but not one or more secondary tumors. For example, metastatic lung cancer refers to a disease in a subject with or with a history of a primary lung tumor and with one or more secondary tumors at a second location or multiple locations, e.g., in the breast.
The terms “cutaneous metastasis” or “skin metastasis” refer to secondary malignant cell growths in the skin, wherein the malignant cells originate from a primary cancer site (e.g., breast). In cutaneous metastasis, cancerous cells from a primary cancer site may migrate to the skin where they divide and cause lesions. Cutaneous metastasis may result from the migration of cancer cells from breast cancer tumors to the skin.
The term “visceral metastasis” refer to secondary malignant cell growths in the internal organs (e.g., heart, lungs, liver, pancreas, intestines) or body cavities (e.g., pleura, peritoneum), wherein the malignant cells originate from a primary cancer site (e.g., head and neck, liver, breast). In visceral metastasis, cancerous cells from a primary cancer site may migrate to the internal organs where they divide and cause lesions. Visceral metastasis may result from the migration of cancer cells from liver cancer tumors or head and neck tumors to internal organs.
“G protein associated cancer” (also referred to herein as “G-protein related cancer”) refers to a cancer caused by aberrant activity or signaling of G protein or one or more of its subunits (e.g., alpha (α)-, beta (β)-, or gamma (γ) subunits; Gαs, Gβs, or Gγs). In certain embodiments, a “cancer associated with aberrant Gαs activity” (also referred to herein as “Gαs related cancer”) is a cancer caused by aberrant Gαs activity or signaling (e.g., a mutant Gαs). In certain embodiments, a “cancer associated with aberrant Gβs activity” (also referred to herein as “Gβs related cancer”) is a cancer caused by aberrant Gβs activity or signaling (e.g., a mutant Gβs). In certain embodiments, a “cancer associated with aberrant Gγs activity” (also referred to herein as “Gγs related cancer”) is a cancer caused by aberrant Gγs activity or signaling (e.g., a mutant Gγs). In certain embodiments, some cancers that are associated with aberrant activity of one or more of G protein or its subunits (Gαs, Gβs, or Gγs), mutant G protein, or mutants subunits (Gαs, Gβs, or Gγs) are well known in the art and determining such cancers are within the skill of a person of skill in the art. In certain embodiments, some cancers may be sensitive to Gαs inhibition. In certain embodiments, the cancer that may be sensitive to Gαs inhibition may include a solid cancer or a tumor. In certain embodiments, the cancer that may be sensitive to Gαs inhibition may include a pancreatic cancer, a brain tumor, a pituitary tumor, or a bone tumor. In certain embodiments, the Gαs related cancers may include a pancreatic cancer, a brain tumor, a pituitary tumor, or a bone tumor.
“G protein-associated disease” (also referred to herein as “G protein-related disease”) refers to a cancer caused by aberrant activity or signaling of G protein or one or more of its subunits (e.g., alpha (α)-, beta (β)-, or gamma (γ) subunits; Gαs, Gβs, or Gγs). In certain embodiments, a “disease associated with aberrant Gαs activity” (also referred to herein as “Gαs related disease”) is a cancer caused by aberrant Gαs activity or signaling (e.g., a mutant Gαs). In certain embodiments, a “disease associated with aberrant Gβs activity” (also referred to herein as “Gβs related disease”) is a disease caused by aberrant Gβs activity or signaling (e.g., a mutant Gβs). In certain embodiments, a “disease associated with aberrant Gγs activity” (also referred to herein as “Gγs related disease”) is a disease caused by aberrant Gγs activity or signaling (e.g., a mutant Gγs). In certain embodiments, some diseases that are associated with aberrant activity of one or more of G protein or its subunits (Gαs, Gβs, or Gγs), mutant G protein, or mutants subunits (Gαs, Gβs, or Gγs) are well known in the art and determining such diseases are within the skill of a person of skill in the art. In certain embodiments, some diseases may be sensitive to Gαs inhibition.
The term “guanine nucleotide-binding protein” or “G protein” refers to one or more of the family of proteins that are bound to GTP (“on” state) or GDP (“off” state”) so the proteins can regulate their activity involved in signaling pathway of a cell. In certain embodiments, G protein includes subunits, alpha (α)-, beta (β)-, and gamma (γ) subunits (Gαs, Gβs, or Gγs). In particular, the term human “Gαs” as used herein refers to a G-protein-alpha-subunit having nucleotide sequences as set forth or corresponding to Entrez 2778, UniProt Q59FM5, UniProt P63092 (e.g., UniProt P6309-1 and UniProt P63092-2), RefSeq (protein) NP_000507.1, RefSeq (protein) NP_001070956.1, RefSeq (protein) NP_001070957.1, RefSeq (protein) NP_001070958.1, RefSeq (protein) NP_001296769.1, RefSeq (protein) NP_536350.2, or RefSeq (protein) NP_536351.1. In embodiments, the GNAS gene has the nucleic acid sequence set forth in RefSeq (mRNA) NM_000516.5, RefSeq (mRNA) NM_001077488.3, RefSeq (mRNA) NM_001077489.3, RefSeq (mRNA) NM_001077490.2, RefSeq (mRNA) NM_001309840.1, RefSeq (mRNA) NM_080425.3, or RefSeq (mRNA) NM_080426.3. In embodiments, the amino acid sequence or nucleic acid sequence is the sequence known at the time of filing of the present application.
The term “Gαs” includes both the wild-type form of the nucleotide sequences or proteins as well as any mutants thereof. In certain embodiments, the human Gαs refers to the protein including (e.g., consisting of) the amino acid sequence corresponding to UniProt P63092-1 (SEQ ID NO: 1). In embodiments, the human Gαs includes the sequence below with one or more mutations (e.g., R201C and C237S at the underlined position at SEQ ID NO: 1):
In embodiments, the human Gαs has the sequence of residues 7-380 of the short isoform of human Gαs corresponding to UniProt P63092-2 (SEQ ID NO: 2). In embodiments, the human Gαs includes the sequence below with one or more mutations (e.g., at R187 and/or C223 at the underlined position at SEQ ID NO: 2):
An amino acid residue in Gαs “corresponds” to a given residue when it occupies the same essential structural position within the protein as the given residue. For example, a selected residue in a selected protein corresponds to R201 of Gαs protein when the selected residue occupies the same essential spatial or other structural relationship as R201 of Gαs protein. In some embodiments, where a selected protein is aligned for maximum homology with the Gαs protein, the position in the aligned selected protein aligning with R201 is said to correspond to R201. Further, a selected residue in a selected protein corresponds to C237 of Gαs protein when the selected residue occupies the same essential spatial or other structural relationship as C237 of Gαs protein. In some embodiments, where a selected protein is aligned for maximum homology with the Gαs protein, the position in the aligned selected protein aligning with C237 is said to correspond to C237. Instead of a primary sequence alignment, a three dimensional structural alignment can also be used, e.g., where the structure of the selected protein is aligned for maximum correspondence with the Gαs protein and the overall structures compared. In this case, an amino acid that occupies the same essential position as R201 in the structural model is said to correspond to the R201 residue, and an amino acid that occupies the same essential position as C237 in the structural model is said to correspond to the C237 residue. For example, R201 of SEQ ID NO: 1 corresponds to R187 of SEQ ID NO: 2, and C237 of SEQ ID NO: 1 corresponds to C223 of SEQ ID NO: 2.
The term “drug” is used in accordance with its common meaning and refers to a substance which has a physiological effect (e.g., beneficial effect, is useful for treating a subject) when introduced into or to a subject (e.g., in or on the body of a subject or patient). A drug moiety is a radical of a drug.
A “detectable agent,” “detectable compound,” “detectable label,” or “detectable moiety” is a substance (e.g., element), molecule, or composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, magnetic resonance imaging, or other physical means. For example, detectable agents include 18F, 32P, 33P, 45Ti, 47Sc, 52Fe, 59Fe, 62Cu, 64Cu, 67Cu, 67Ga, 68Ga, 77As, 86Y 90Y, 89Sr, 89Zr, 94Tc, 94Tc, 99mTc, 99Mo, 105Pd, 105Rh, 111Ag, 111In 123I, 124I, 125I, 131I, 142Pr, 143Pr, 149Pm 153Sm, 154-1581Gd, 161Tb, 166Dy, 166H, 169Er, 175Lu, 177Lu 186Re, 188Re, 189Re, 194I, 198Au, 199Au, 211At, 211Pb, 212Bi, 212Pb, 213Bi, 223Ra, 225Ac, Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, Lu, 32P, fluorophore (e.g., fluorescent dyes), modified oligonucleotides (e.g., moieties described in PCT/US2015/022063, which is incorporated herein by reference), electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, paramagnetic molecules, paramagnetic nanoparticles, ultrasmall superparamagnetic iron oxide (“USPIO”) nanoparticles, USPIO nanoparticle aggregates, superparamagnetic iron oxide (“SPIO”) nanoparticles, SPIO nanoparticle aggregates, monochrystalline iron oxide nanoparticles, monochrystalline iron oxide, nanoparticle contrast agents, liposomes or other delivery vehicles containing Gadolinium chelate (“Gd-chelate”) molecules, Gadolinium, radioisotopes, radionuclides (e.g., carbon-11, nitrogen-13, oxygen-15, fluorine-18, rubidium-82), fluorodeoxyglucose (e.g., fluorine-18 labeled), any gamma ray emitting radionuclides, positron-emitting radionuclide, radiolabeled glucose, radiolabeled water, radiolabeled ammonia, biocolloids, microbubbles (e.g., including microbubble shells including albumin, galactose, lipid, and/or polymers; microbubble gas core including air, heavy gas(es), perfluorcarbon, nitrogen, octafluoropropane, perflexane lipid microsphere, perflutren, etc.), iodinated contrast agents (e.g., iohexol, iodixanol, ioversol, iopamidol, ioxilan, iopromide, diatrizoate, metrizoate, ioxaglate), barium sulfate, thorium dioxide, gold, gold nanoparticles, gold nanoparticle aggregates, fluorophores, two-photon fluorophores, or haptens and proteins or other entities which can be made detectable, e.g., by incorporating a radiolabel into a peptide or antibody specifically reactive with a target peptide.
Radioactive substances (e.g., radioisotopes) that may be used as imaging and/or labeling agents in accordance with the embodiments of the disclosure include, but are not limited to, 18F, 32P 33P, 45Ti, 47Sc, 52Fe, 59Fe, 62Cu, 64Cu, 67Cu, 67Ga, 68Ga, 77As, 86Y 90Y, 89Sr, 89Zr, 94Tc, 94Tc, 99mTc, 99Mo, 105Pd, 105Rh, 111Ag, 111In, 123I, 124I, 125I, 131I, 142Pr, 143Pr, 149Pm, 153Sm, 154-1581Gd, 161Tb, 166Dy, 166Ho, 169Er, 175Lu, 177Lu, 186Re, 188Re, 189Re, 194I 198Au, 199Au, 211At, 211Pb, 212Bi, 212Pb, 213Bi, 223Ra and 225Ac. Paramagnetic ions that may be used as additional imaging agents in accordance with the embodiments of the disclosure include, but are not limited to, ions of transition and lanthanide metals (e.g., metals having atomic numbers of 21-29, 42, 43, 44, or 57-71). These metals include ions of Cr, V, Mn, Fe, Co, Ni, Cu, La, Ce, Pr, Nd, Pm, Sm, Eu, Gd, Tb, Dy, Ho, Er, Tm, Yb, and Lu.
“Pharmaceutically acceptable excipient” and “pharmaceutically acceptable carrier” refer to a substance that aids the administration of an active agent to and absorption by a subject and can be included in the compositions of the present invention without causing a significant adverse toxicological effect on the patient. Non-limiting examples of pharmaceutically acceptable excipients include water, NaCl, normal saline solutions, lactated Ringer's, normal sucrose, normal glucose, binders, fillers, disintegrants, lubricants, coatings, sweeteners, flavors, salt solutions (such as Ringer's solution), alcohols, oils, gelatins, carbohydrates such as lactose, amylose or starch, fatty acid esters, hydroxymethycellulose, polyvinyl pyrrolidine, and colors, and the like. Such preparations can be sterilized and, if desired, mixed with auxiliary agents such as lubricants, preservatives, stabilizers, wetting agents, emulsifiers, salts for influencing osmotic pressure, buffers, coloring, and/or aromatic substances and the like that do not deleteriously react with the compounds of the invention. One of skill in the art will recognize that other pharmaceutical excipients are useful in the present invention.
The term “preparation” is intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it. Similarly, cachets and lozenges are included. Tablets, powders, capsules, pills, cachets, and lozenges can be used as solid dosage forms suitable for oral administration.
As used herein, the term “about” means a range of values including the specified value, which a person of ordinary skill in the art would consider reasonably similar to the specified value. In embodiments, about means within a standard deviation using measurements generally acceptable in the art. In embodiments, about means a range extending to +/−10% of the specified value. In embodiments, about includes the specified value.
As used herein, the term “administering” is used in accordance with its plain and ordinary meaning and includes oral administration, administration as a suppository, topical contact, intravenous, intraperitoneal, intramuscular, intralesional, intrathecal, intranasal or subcutaneous administration, or the implantation of a slow-release device, e.g., a mini-osmotic pump, to a subject. Administration is by any route, including parenteral and transmucosal (e.g., buccal, sublingual, palatal, gingival, nasal, vaginal, rectal, or transdermal). Parenteral administration includes, e.g., intravenous, intramuscular, intra-arteriole, intradermal, subcutaneous, intraperitoneal, intraventricular, and intracranial. Other modes of delivery include, but are not limited to, the use of liposomal formulations, intravenous infusion, transdermal patches, etc. By “co-administer” it is meant that a composition described herein is administered at the same time, just prior to, or just after the administration of one or more additional therapies, for example cancer therapies such as chemotherapy, hormonal therapy, radiotherapy, or immunotherapy. The compounds of the invention can be administered alone or can be co-administered to the patient. Co-administration is meant to include simultaneous or sequential administration of the compounds individually or in combination (more than one compound). Thus, the preparations can also be combined, when desired, with other active substances (e.g., to reduce metabolic degradation). The compositions of the present invention can be delivered by transdermally, by a topical route, formulated as applicator sticks, solutions, suspensions, emulsions, gels, creams, ointments, pastes, jellies, paints, powders, and aerosols.
The compounds described herein can be used in combination with one another, with other active agents known to be useful in treating a disease associated with cells expressing a disease associated cellular component, or with adjunctive agents that may not be effective alone, but may contribute to the efficacy of the active agent.
In some embodiments, co-administration includes administering one active agent within 0.5, 1, 2, 4, 6, 8, 10, 12, 16, 20, or 24 hours of a second active agent. Co-administration includes administering two active agents simultaneously, approximately simultaneously (e.g., within about 1, 5, 10, 15, 20, or 30 minutes of each other), or sequentially in any order. In some embodiments, co-administration can be accomplished by co-formulation, i.e., preparing a single pharmaceutical composition including both active agents. In other embodiments, the active agents can be formulated separately. In another embodiment, the active and/or adjunctive agents may be linked or conjugated to one another.
“Anti-cancer agent” is used in accordance with its plain ordinary meaning and refers to a composition (e.g., compound, drug, antagonist, inhibitor, modulator) having antineoplastic properties or the ability to inhibit the growth or proliferation of cells. In some embodiments, an anti-cancer agent is a chemotherapeutic. In some embodiments, an anti-cancer agent is an agent identified herein having utility in methods of treating cancer. In some embodiments, an anti-cancer agent is an agent approved by the FDA or similar regulatory agency of a country other than the USA, for treating cancer. In embodiments, an anti-cancer agent is an agent with antineoplastic properties that has not (e.g., yet) been approved by the FDA or similar regulatory agency of a country other than the USA, for treating cancer. Examples of anti-cancer agents include, but are not limited to, MEK (e.g., MEK1, MEK2, or MEK1 and MEK2) inhibitors (e.g., XL518, CI-1040, PD035901, selumetinib/AZD6244, GSK1120212/trametinib, GDC-0973, ARRY-162, ARRY-300, AZD8330, PD0325901, U0126, PD98059, TAK-733, PD318088, AS703026, BAY 869766), alkylating agents (e.g., cyclophosphamide, ifosfamide, chlorambucil, busulfan, melphalan, mechlorethamine, uramustine, thiotepa, nitrosoureas, nitrogen mustards (e.g., mechloroethamine, cyclophosphamide, chlorambucil, meiphalan), ethylenimine and methylmelamines (e.g., hexamethlymelamine, thiotepa), alkyl sulfonates (e.g., busulfan), nitrosoureas (e.g., carmustine, lomustine, semustine, streptozocin), triazenes (decarbazine)), anti-metabolites (e.g., 5-azathioprine, leucovorin, capecitabine, fludarabine, gemcitabine, pemetrexed, raltitrexed, folic acid analog (e.g., methotrexate), or pyrimidine analogs (e.g., fluorouracil, floxouridine, Cytarabine), purine analogs (e.g., mercaptopurine, thioguanine, pentostatin), etc.), plant alkaloids (e.g., vincristine, vinblastine, vinorelbine, vindesine, podophyllotoxin, paclitaxel, docetaxel, etc.), topoisomerase inhibitors (e.g., irinotecan, topotecan, amsacrine, etoposide (VP16), etoposide phosphate, teniposide, etc.), antitumor antibiotics (e.g., doxorubicin, adriamycin, daunorubicin, epirubicin, actinomycin, bleomycin, mitomycin, mitoxantrone, plicamycin, etc.), platinum-based compounds (e.g., cisplatin, oxaloplatin, carboplatin), anthracenedione (e.g., mitoxantrone), substituted urea (e.g., hydroxyurea), methyl hydrazine derivative (e.g., procarbazine), adrenocortical suppressant (e.g., mitotane, aminoglutethimide), epipodophyllotoxins (e.g., etoposide), antibiotics (e.g., daunorubicin, doxorubicin, bleomycin), enzymes (e.g., L-asparaginase), inhibitors of mitogen-activated protein kinase signaling (e.g., U0126, PD98059, PD184352, PD0325901, ARRY-142886, SB239063, SP600125, BAY 43-9006, wortmannin, or LY294002, Syk inhibitors, mTOR inhibitors, antibodies (e.g., rituxan), gossyphol, genasense, polyphenol E, Chlorofusin, all trans-retinoic acid (ATRA), bryostatin, tumor necrosis factor-related apoptosis-inducing ligand (TRAIL), 5-aza-2′-deoxycytidine, all trans retinoic acid, doxorubicin, vincristine, etoposide, gemcitabine, imatinib (Gleevec.RTM.), geldanamycin, 17-N-Allylamino-17-Demethoxygeldanamycin (17-AAG), flavopiridol, LY294002, bortezomib, trastuzumab, BAY 11-7082, PKC412, PD184352, 20-epi-1, 25 dihydroxyvitamin D3; 5-ethynyluracil; abiraterone; aclarubicin; acylfulvene; adecypenol; adozelesin; aldesleukin; ALL-TK antagonists; altretamine; ambamustine; amidox; amifostine; aminolevulinic acid; amrubicin; amsacrine; anagrelide; anastrozole; andrographolide; angiogenesis inhibitors; antagonist D; antagonist G; antarelix; anti-dorsalizing morphogenetic protein-1; antiandrogen, prostatic carcinoma; antiestrogen; antineoplaston; antisense oligonucleotides; aphidicolin glycinate; apoptosis gene modulators; apoptosis regulators; apurinic acid; ara-CDP-DL-PTBA; arginine deaminase; asulacrine; atamestane; atrimustine; axinastatin 1; axinastatin 2; axinastatin 3; azasetron; azatoxin; azatyrosine; baccatin III derivatives; balanol; batimastat; BCR/ABL antagonists; benzochlorins; benzoylstaurosporine; beta lactam derivatives; beta-alethine; betaclamycin B; betulinic acid; bFGF inhibitor; bicalutamide; bisantrene; bisaziridinylspermine; bisnafide; bistratene A; bizelesin; breflate; bropirimine; budotitane; buthionine sulfoximine; calcipotriol; calphostin C; camptothecin derivatives; canarypox IL-2; capecitabine; carboxamide-amino-triazole; carboxyamidotriazole; CaRest M3; CARN 700; cartilage derived inhibitor; carzelesin; casein kinase inhibitors (ICOS); castanospermine; cecropin B; cetrorelix; chlorins; chloroquinoxaline sulfonamide; cicaprost; cis-porphyrin; cladribine; clomifene analogues; clotrimazole; collismycin A; collismycin B; combretastatin A4; combretastatin analogue; conagenin; crambescidin 816; crisnatol; cryptophycin 8; cryptophycin A derivatives; curacin A; cyclopentanthraquinones; cycloplatam; cypemycin; cytarabine ocfosfate; cytolytic factor; cytostatin; dacliximab; decitabine; dehydrodidemnin B; deslorelin; dexamethasone; dexifosfamide; dexrazoxane; dexverapamil; diaziquone; didemnin B; didox; diethylnorspermine; dihydro-5-azacytidine; 9-dioxamycin; diphenyl spiromustine; docosanol; dolasetron; doxifluridine; droloxifene; dronabinol; duocarmycin SA; ebselen; ecomustine; edelfosine; edrecolomab; eflornithine; elemene; emitefur; epirubicin; epristeride; estramustine analogue; estrogen agonists; estrogen antagonists; etanidazole; etoposide phosphate; exemestane; fadrozole; fazarabine; fenretinide; filgrastim; finasteride; flavopiridol; flezelastine; fluasterone; fludarabine; fluorodaunorunicin hydrochloride; forfenimex; formestane; fostriecin; fotemustine; gadolinium texaphyrin; gallium nitrate; galocitabine; ganirelix; gelatinase inhibitors; gemcitabine; glutathione inhibitors; hepsulfam; heregulin; hexamethylene bisacetamide; hypericin; ibandronic acid; idarubicin; idoxifene; idramantone; ilmofosine; ilomastat; imidazoacridones; imiquimod; immunostimulant peptides; insulin-like growth factor-1 receptor inhibitor; interferon agonists; interferons; interleukins; iobenguane; iododoxorubicin; ipomeanol, 4-; iroplact; irsogladine; isobengazole; isohomohalicondrin B; itasetron; jasplakinolide; kahalalide F; lamellarin-N triacetate; lanreotide; leinamycin; lenograstim; lentinan sulfate; leptolstatin; letrozole; leukemia inhibiting factor; leukocyte alpha interferon; leuprolide+estrogen+progesterone; leuprorelin; levamisole; liarozole; linear polyamine analogue; lipophilic disaccharide peptide; lipophilic platinum compounds; lissoclinamide 7; lobaplatin; lombricine; lometrexol; lonidamine; losoxantrone; lovastatin; loxoribine; lurtotecan; lutetium texaphyrin; lysofylline; lytic peptides; maitansine; mannostatin A; marimastat; masoprocol; maspin; matrilysin inhibitors; matrix metalloproteinase inhibitors; menogaril; merbarone; meterelin; methioninase; metoclopramide; MIF inhibitor; mifepristone; miltefosine; mirimostim; mismatched double stranded RNA; mitoguazone; mitolactol; mitomycin analogues; mitonafide; mitotoxin fibroblast growth factor-saporin; mitoxantrone; mofarotene; molgramostim; monoclonal antibody, human chorionic gonadotrophin; monophosphoryl lipid A+myobacterium cell wall sk; mopidamol; multiple drug resistance gene inhibitor; multiple tumor suppressor 1-based therapy; mustard anticancer agent; mycaperoxide B; mycobacterial cell wall extract; myriaporone; N-acetyldinaline; N-substituted benzamides; nafarelin; nagrestip; naloxone+pentazocine; napavin; naphterpin; nartograstim; nedaplatin; nemorubicin; neridronic acid; neutral endopeptidase; nilutamide; nisamycin; nitric oxide modulators; nitroxide antioxidant; nitrullyn; 06-benzylguanine; octreotide; okicenone; oligonucleotides; onapristone; ondansetron; ondansetron; oracin; oral cytokine inducer; ormaplatin; osaterone; oxaliplatin; oxaunomycin; palauamine; palmitoylrhizoxin; pamidronic acid; panaxytriol; panomifene; parabactin; pazelliptine; pegaspargase; peldesine; pentosan polysulfate sodium; pentostatin; pentrozole; perflubron; perfosfamide; perillyl alcohol; phenazinomycin; phenylacetate; phosphatase inhibitors; picibanil; pilocarpine hydrochloride; pirarubicin; piritrexim; placetin A; placetin B; plasminogen activator inhibitor; platinum complex; platinum compounds; platinum-triamine complex; porfimer sodium; porfiromycin; prednisone; propyl bis-acridone; prostaglandin J2; proteasome inhibitors; protein A-based immune modulator; protein kinase C inhibitor; protein kinase C inhibitors, microalgal; protein tyrosine phosphatase inhibitors; purine nucleoside phosphorylase inhibitors; purpurins; pyrazoloacridine; pyridoxylated hemoglobin polyoxyethylerie conjugate; raf antagonists; raltitrexed; ramosetron; ras farnesyl protein transferase inhibitors; ras inhibitors; ras-GAP inhibitor; retelliptine demethylated; rhenium Re 186 etidronate; rhizoxin; ribozymes; RII retinamide; rogletimide; rohitukine; romurtide; roquinimex; rubiginone B1; ruboxyl; safingol; saintopin; SarCNU; sarcophytol A; sargramostim; Sdi 1 mimetics; semustine; senescence derived inhibitor 1; sense oligonucleotides; signal transduction inhibitors; signal transduction modulators; single chain antigen-binding protein; sizofuran; sobuzoxane; sodium borocaptate; sodium phenylacetate; solverol; somatomedin binding protein; sonermin; sparfosic acid; spicamycin D; spiromustine; splenopentin; spongistatin 1; squalamine; stem cell inhibitor; stem-cell division inhibitors; stipiamide; stromelysin inhibitors; sulfinosine; superactive vasoactive intestinal peptide antagonist; suradista; suramin; swainsonine; synthetic glycosaminoglycans; tallimustine; tamoxifen methiodide; tauromustine; tazarotene; tecogalan sodium; tegafur; tellurapyrylium; telomerase inhibitors; temoporfin; temozolomide; teniposide; tetrachlorodecaoxide; tetrazomine; thaliblastine; thiocoraline; thrombopoietin; thrombopoietin mimetic; thymalfasin; thymopoietin receptor agonist; thymotrinan; thyroid stimulating hormone; tin ethyl etiopurpurin; tirapazamine; titanocene bichloride; topsentin; toremifene; totipotent stem cell factor; translation inhibitors; tretinoin; triacetyluridine; triciribine; trimetrexate; triptorelin; tropisetron; turosteride; tyrosine kinase inhibitors; tyrphostins; UBC inhibitors; ubenimex; urogenital sinus-derived growth inhibitory factor; urokinase receptor antagonists; vapreotide; variolin B; vector system, erythrocyte gene therapy; velaresol; veramine; verdins; verteporfin; vinorelbine; vinxaltine; vitaxin; vorozole; zanoterone; zeniplatin; zilascorb; zinostatin stimalamer, Adriamycin, Dactinomycin, Bleomycin, Vinblastine, Cisplatin, acivicin; aclarubicin; acodazole hydrochloride; acronine; adozelesin; aldesleukin; altretamine; ambomycin; ametantrone acetate; aminoglutethimide; amsacrine; anastrozole; anthramycin; asparaginase; asperlin; azacitidine; azetepa; azotomycin; batimastat; benzodepa; bicalutamide; bisantrene hydrochloride; bisnafide dimesylate; bizelesin; bleomycin sulfate; brequinar sodium; bropirimine; busulfan; cactinomycin; calusterone; caracemide; carbetimer; carboplatin; carmustine; carubicin hydrochloride; carzelesin; cedefingol; chlorambucil; cirolemycin; cladribine; crisnatol mesylate; cyclophosphamide; cytarabine; dacarbazine; daunorubicin hydrochloride; decitabine; dexormaplatin; dezaguanine; dezaguanine mesylate; diaziquone; doxorubicin; doxorubicin hydrochloride; droloxifene; droloxifene citrate; dromostanolone propionate; duazomycin; edatrexate; eflornithine hydrochloride; elsamitrucin; enloplatin; enpromate; epipropidine; epirubicin hydrochloride; erbulozole; esorubicin hydrochloride; estramustine; estramustine phosphate sodium; etanidazole; etoposide; etoposide phosphate; etoprine; fadrozole hydrochloride; fazarabine; fenretinide; floxuridine; fludarabine phosphate; fluorouracil; fluorocitabine; fosquidone; fostriecin sodium; gemcitabine; gemcitabine hydrochloride; hydroxyurea; idarubicin hydrochloride; ifosfamide; iimofosine; interleukin I1 (including recombinant interleukin II, or r1L.sub.2), interferon alfa-2a; interferon alfa-2b; interferon alfa-n1; interferon alfa-n3; interferon beta-1a; interferon gamma-1b; iproplatin; irinotecan hydrochloride; lanreotide acetate; letrozole; leuprolide acetate; liarozole hydrochloride; lometrexol sodium; lomustine; losoxantrone hydrochloride; masoprocol; maytansine; mechlorethamine hydrochloride; megestrol acetate; melengestrol acetate; melphalan; menogaril; mercaptopurine; methotrexate; methotrexate sodium; metoprine; meturedepa; mitindomide; mitocarcin; mitocromin; mitogillin; mitomalcin; mitomycin; mitosper; mitotane; mitoxantrone hydrochloride; mycophenolic acid; nocodazoie; nogalamycin; ormaplatin; oxisuran; pegaspargase; peliomycin; pentamustine; peplomycin sulfate; perfosfamide; pipobroman; piposulfan; piroxantrone hydrochloride; plicamycin; plomestane; porfimer sodium; porfiromycin; prednimustine; procarbazine hydrochloride; puromycin; puromycin hydrochloride; pyrazofurin; riboprine; rogletimide; safingol; safingol hydrochloride; semustine; simtrazene; sparfosate sodium; sparsomycin; spirogermanium hydrochloride; spiromustine; spiroplatin; streptonigrin; streptozocin; sulofenur; talisomycin; tecogalan sodium; tegafur; teloxantrone hydrochloride; temoporfin; teniposide; teroxirone; testolactone; thiamiprine; thioguanine; thiotepa; tiazofurin; tirapazamine; toremifene citrate; trestolone acetate; triciribine phosphate; trimetrexate; trimetrexate glucuronate; triptorelin; tubulozole hydrochloride; uracil mustard; uredepa; vapreotide; verteporfin; vinblastine sulfate; vincristine sulfate; vindesine; vindesine sulfate; vinepidine sulfate; vinglycinate sulfate; vinleurosine sulfate; vinorelbine tartrate; vinrosidine sulfate; vinzolidine sulfate; vorozole; zeniplatin; zinostatin; zorubicin hydrochloride, agents that arrest cells in the G2-M phases and/or modulate the formation or stability of microtubules, (e.g., Taxol.™ (i.e., paclitaxel), Taxotere.™, compounds comprising the taxane skeleton, Erbulozole (i.e., R-55104), Dolastatin 10 (i.e., DLS-10 and NSC-376128), Mivobulin isethionate (i.e., as CI-980), Vincristine, NSC-639829, Discodermolide (i.e., as NVP-XX-A-296), ABT-751 (Abbott, i.e., E-7010), Altorhyrtins (e.g., Altorhyrtin A and Altorhyrtin C), Spongistatins (e.g., Spongistatin 1, Spongistatin 2, Spongistatin 3, Spongistatin 4, Spongistatin 5, Spongistatin 6, Spongistatin 7, Spongistatin 8, and Spongistatin 9), Cemadotin hydrochloride (i.e., LU-103793 and NSC-D-669356), Epothilones (e.g., Epothilone A, Epothilone B, Epothilone C (i.e., desoxyepothilone A or dEpoA), Epothilone D (i.e., KOS-862, dEpoB, and desoxyepothilone B), Epothilone E, Epothilone F, Epothilone B N-oxide, Epothilone A N-oxide, 16-aza-epothilone B, 21-aminoepothilone B (i.e., BMS-310705), 21-hydroxyepothilone D (i.e., Desoxyepothilone F and dEpoF), 26-fluoroepothilone, Auristatin PE (i.e., NSC-654663), Soblidotin (i.e., TZT-1027), LS-4559-P (Pharmacia, i.e., LS-4577), LS-4578 (Pharmacia, i.e., LS-477-P), LS-4477 (Pharmacia), LS-4559 (Pharmacia), RPR-112378 (Aventis), Vincristine sulfate, DZ-3358 (Daiichi), FR-182877 (Fujisawa, i.e., WS-9885B), GS-164 (Takeda), GS-198 (Takeda), KAR-2 (Hungarian Academy of Sciences), BSF-223651 (BASF, i.e., ILX-651 and LU-223651), SAH-49960 (Lilly/Novartis), SDZ-268970 (Lilly/Novartis), AM-97 (Armad/Kyowa Hakko), AM-132 (Armad), AM-138 (Armad/Kyowa Hakko), IDN-5005 (Indena), Cryptophycin 52 (i.e., LY-355703), AC-7739 (Ajinomoto, i.e., AVE-8063A and CS-39.HCl), AC-7700 (Ajinomoto, i.e., AVE-8062, AVE-8062A, CS-39-L-Ser.HCl, and RPR-258062A), Vitilevuamide, Tubulysin A, Canadensol, Centaureidin (i.e., NSC-106969), T-138067 (Tularik, i.e., T-67, TL-138067 and TI-138067), COBRA-1 (Parker Hughes Institute, i.e., DDE-261 and WHI-261), H10 (Kansas State University), H16 (Kansas State University), Oncocidin A1 (i.e., BTO-956 and DAIE), DDE-313 (Parker Hughes Institute), Fijianolide B, Laulimalide, SPA-2 (Parker Hughes Institute), SPA-1 (Parker Hughes Institute, i.e., SPIKET-P), 3-IAABU (Cytoskeleton/Mt. Sinai School of Medicine, i.e., MF-569), Narcosine (also known as NSC-5366), Nascapine, D-24851 (Asta Medica), A-105972 (Abbott), Hemiasterlin, 3-BAABU (Cytoskeleton/Mt. Sinai School of Medicine, i.e., MF-191), TMPN (Arizona State University), Vanadocene acetylacetonate, T-138026 (Tularik), Monsatrol, lnanocine (i.e., NSC-698666), 3-IAABE (Cytoskeleton/Mt. Sinai School of Medicine), A-204197 (Abbott), T-607 (Tuiarik, i.e., T-900607), RPR-115781 (Aventis), Eleutherobins (such as Desmethyleleutherobin, Desaetyleleutherobin, lsoeleutherobin A, and Z-Eleutherobin), Caribaeoside, Caribaeolin, Halichondrin B, D-64131 (Asta Medica), D-68144 (Asta Medica), Diazonamide A, A-293620 (Abbott), NPI-2350 (Nereus), Taccalonolide A, TUB-245 (Aventis), A-259754 (Abbott), Diozostatin, (−)-Phenylahistin (i.e., NSCL-96F037), D-68838 (Asta Medica), D-68836 (Asta Medica), Myoseverin B, D-43411 (Zentaris, i.e., D-81862), A-289099 (Abbott), A-318315 (Abbott), HTI-286 (i.e., SPA-110, trifluoroacetate salt) (Wyeth), D-82317 (Zentaris), D-82318 (Zentaris), SC-12983 (NCI), Resverastatin phosphate sodium, BPR-OY-007 (National Health Research Institutes), and SSR-250411 (Sanofi)), steroids (e.g., dexamethasone), finasteride, aromatase inhibitors, gonadotropin-releasing hormone agonists (GnRH) such as goserelin or leuprolide, adrenocorticosteroids (e.g., prednisone), progestins (e.g., hydroxyprogesterone caproate, megestrol acetate, medroxyprogesterone acetate), estrogens (e.g., diethlystilbestrol, ethinyl estradiol), antiestrogen (e.g., tamoxifen), androgens (e.g., testosterone propionate, fluoxymesterone), antiandrogen (e.g., flutamide), immunostimulants (e.g., Bacillus Calmette-Guerin (BCG), levamisole, interleukin-2, alpha-interferon, etc.), monoclonal antibodies (e.g., anti-CD20, anti-HER2, anti-CD52, anti-HLA-DR, and anti-VEGF monoclonal antibodies), immunotoxins (e.g., anti-CD33 monoclonal antibody-calicheamicin conjugate, anti-CD22 monoclonal antibody-pseudomonas exotoxin conjugate, etc.), radioimmunotherapy (e.g., anti-CD20 monoclonal antibody conjugated to 111In, 90Y, or 131I, etc.), triptolide, homoharringtonine, dactinomycin, doxorubicin, epirubicin, topotecan, itraconazole, vindesine, cerivastatin, vincristine, deoxyadenosine, sertraline, pitavastatin, irinotecan, clofazimine, 5-nonyloxytryptamine, vemurafenib, dabrafenib, erlotinib, gefitinib, EGFR inhibitors, epidermal growth factor receptor (EGFR)-targeted therapy or therapeutic (e.g., gefitinib (Iressa™), erlotinib (Tarceva™), cetuximab (Erbitux™), lapatinib (Tykerb™) panitumumab (Vectibix™), vandetanib (Caprelsa™), afatinib/BIBW2992, CI-1033/canertinib, neratinib/HKI-272, CP-724714, TAK-285, AST-1306, ARRY334543, ARRY-380, AG-1478, dacomitinib/PF299804, OSI-420/desmethyl erlotinib, AZD8931, AEE788, pelitinib/EKB-569, CUDC-101, WZ8040, WZ4002, WZ3146, AG-490, XL647, PD153035, BMS-599626), sorafenib, imatinib, sunitinib, dasatinib, or the like. A moiety of an anti-cancer agent is a monovalent anti-cancer agent (e.g., a monovalent form of an agent listed above).
In therapeutic use for the treatment of a disease, compound utilized in the pharmaceutical compositions of the present invention may be administered at the initial dosage of about 0.001 mg/kg to about 1000 mg/kg daily. A daily dose range of about 0.01 mg/kg to about 500 mg/kg, or about 0.1 mg/kg to about 200 mg/kg, or about 1 mg/kg to about 100 mg/kg, or about 10 mg/kg to about 50 mg/kg, can be used. The dosages, however, may be varied depending upon the requirements of the patient, the severity of the condition being treated, and the compound or drug being employed. For example, dosages can be empirically determined considering the type and stage of cancer diagnosed in a particular patient. The dose administered to a patient, in the context of the present invention, should be sufficient to affect a beneficial therapeutic response in the patient over time. The size of the dose will also be determined by the existence, nature, and extent of any adverse side effects that accompany the administration of a compound in a particular patient. Determination of the proper dosage for a particular situation is within the skill of the practitioner. Generally, treatment is initiated with smaller dosages which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under circumstances is reached. For convenience, the total daily dosage may be divided and administered in portions during the day, if desired.
The compounds described herein can be used in combination with one another, with other active agents known to be useful in treating cancer or with adjunctive agents that may not be effective alone, but may contribute to the efficacy of the active agent.
The term “associated” or “associated with” in the context of a substance or substance activity or function associated with a disease (e.g., a protein associated disease, disease associated with a cellular component) means that the disease (e.g., cancer) is caused by (in whole or in part), or a symptom of the disease is caused by (in whole or in part) the substance or substance activity or function or the disease or a symptom of the disease may be treated by modulating (e.g., inhibiting or activating) the substance (e.g., cellular component). As used herein, what is described as being associated with a disease, if a causative agent, could be a target for treatment of the disease.
The term “aberrant” as used herein refers to different from normal. When used to describe enzymatic activity, aberrant refers to activity that is greater or less than a normal control or the average of normal non-diseased control samples. Aberrant activity may refer to an amount of activity that results in a disease, wherein returning the aberrant activity to a normal or non-disease-associated amount (e.g., by administering a compound or using a method as described herein), results in reduction of the disease or one or more disease symptoms.
The term “electrophilic” as used herein refers to a chemical group that is capable of accepting electron density. An “electrophilic substituent,” “electrophilic chemical moiety,” or “electrophilic moiety” refers to an electron-poor chemical group, substituent, or moiety (monovalent chemical group), which may react with an electron-donating group, such as a nucleophile, by accepting an electron pair or electron density to form a bond.
“Nucleophilic” as used herein refers to a chemical group that is capable of donating electron density.
The term “isolated,” when applied to a nucleic acid or protein, denotes that the nucleic acid or protein is essentially free of other cellular components with which it is associated in the natural state. It can be, for example, in a homogeneous state and may be in either a dry or aqueous solution. Purity and homogeneity are typically determined using analytical chemistry techniques such as polyacrylamide gel electrophoresis or high performance liquid chromatography. A protein that is the predominant species present in a preparation is substantially purified.
The term “amino acid” refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, γ-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurring amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid. The terms “non-naturally occurring amino acid” and “unnatural amino acid” refer to amino acid analogs, synthetic amino acids, and amino acid mimetics which are not found in nature.
The term “amino acid side chain” refers to the side chain of an amino acid. For example, if an amino acid has the formula
then -L-R is the amino acid side chain. As an example, D-tyrosine has the formula
and the D-tyrosine side chain is
Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
The terms “polypeptide,” “peptide,” and “protein” are used interchangeably herein to refer to a polymer of amino acid residues, wherein the polymer may in embodiments be conjugated to a moiety that does not consist of amino acids. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurring amino acid polymers and non-naturally occurring amino acid polymers.
An amino acid or nucleotide base “position” is denoted by a number that sequentially identifies each amino acid (or nucleotide base) in the reference sequence based on its position relative to the N-terminus (or 5′-end). Due to deletions, insertions, truncations, fusions, and the like that must be taken into account when determining an optimal alignment, in general the amino acid residue number in a test sequence determined by simply counting from the N-terminus will not necessarily be the same as the number of its corresponding position in the reference sequence. For example, in a case where a variant has a deletion relative to an aligned reference sequence, there will be no amino acid in the variant that corresponds to a position in the reference sequence at the site of deletion. Where there is an insertion in an aligned reference sequence, that insertion will not correspond to a numbered amino acid position in the reference sequence. In the case of truncations or fusions there can be stretches of amino acids in either the reference or aligned sequence that do not correspond to any amino acid in the corresponding sequence.
The terms “numbered with reference to” or “corresponding to,” when used in the context of the numbering of a given amino acid or polynucleotide sequence, refers to the numbering of the residues of a specified reference sequence when the given amino acid or polynucleotide sequence is compared to the reference sequence.
An amino acid residue in a protein “corresponds” to a given residue when it occupies the same essential structural position within the protein as the given residue. For example, a selected residue in a selected protein corresponds to C237 of Gαs protein when the selected residue occupies the same essential spatial or other structural relationship as C237 of Gαs protein. In some embodiments, where a selected protein is aligned for maximum homology with the Gαs protein, the position in the aligned selected protein aligning with C237 is said to correspond to C237. Instead of a primary sequence alignment, a three dimensional structural alignment can also be used, e.g., where the structure of the selected protein is aligned for maximum correspondence with the Gαs protein and the overall structures compared. In this case, an amino acid that occupies the same essential position as C237 in the structural model is said to correspond to the C237 residue.
The term “protein complex” is used in accordance with its plain ordinary meaning and refers to a protein which is associated with an additional substance (e.g., another protein, protein subunit, or a compound). Protein complexes typically have defined quaternary structure. The association between the protein and the additional substance may be a covalent bond. In embodiments, the association between the protein and the additional substance (e.g., compound) is via non-covalent interactions. In embodiments, a protein complex refers to a group of two or more polypeptide chains. Proteins in a protein complex are linked by non-covalent protein-protein interactions. A non-limiting example of a protein complex is the proteasome.
The term “protein aggregate” is used in accordance with its plain ordinary meaning and refers to an aberrant collection or accumulation of proteins (e.g., misfolded proteins). Protein aggregates are often associated with diseases (e.g., amyloidosis). Typically, when a protein misfolds as a result of a change in the amino acid sequence or a change in the native environment which disrupts normal non-covalent interactions, and the misfolded protein is not corrected or degraded, the unfolded/misfolded protein may aggregate. There are three main types of protein aggregates that may form: amorphous aggregates, oligomers, and amyloid fibrils. In embodiments, protein aggregates are termed aggresomes.
In an aspect is provided a compound having the formula:
L1A, L2A, L3A, L4A, L5A, L6A, L7A, L8A, L9A, L10A, L11A, and L12A are independently a bond, substituted or unsubstituted alkylene (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), or substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered).
L5 is
R1A is substituted or unsubstituted aryl (e.g., C6-C10 or phenyl).
R2A and R5A are independently hydrogen, —OH, —NH2, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted aryl (e.g., C6-C10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
R3A, R4A, and R11A are independently hydrogen, —OH, —NH2, —COOH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl3, —OCF3, —OCBr3, —OCI3, —OCHCl2, —OCHBr2, —OCHI2, —OCHF2, —OCH2Cl, —OCH2Br, —OCH2I, —OCH2F, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), or substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered).
R6A is —NH2, —CONH2, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), or substituted or unsubstituted aryl (e.g., C6-C10 or phenyl).
R7A, R8A, and R12A are independently hydrogen, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted aryl (e.g., C6-C10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
R9A is substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-C10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
R10A is hydrogen or substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2).
R1D, R2D, R3D, R4D, R5D, R6D, R7D, R8D, R9D, R10D, R11D, and R12D are independently hydrogen or unsubstituted C1-C8 alkyl.
R5E is hydrogen, —OH, —NH2, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), or substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered).
L16 is a covalent linker.
In embodiments, the compound has the formula:
L1A, L2A, L3A, L4A, L5, L6A, L7A, L8A, L9A, L10A, L11A, L12A, L16, R1A, R2A, R3A, R4A, R6A, R7A, R8A, R9A, R10A, R11A, and R12A are as described herein, including in embodiments.
In embodiments, the compound has the formula:
L1A, L2A, L3A, L4A, L5, L6A, L7A, L8A, L9A, L10A, L11A, L12A, L16, R1A, R2A, R3A, R4A, R6A, R7A, R8A, R9A, R10A, R11A, and R12A are as described herein, including in embodiments.
In embodiments, the compound has the formula:
L1A, L2A, L3A, L4A, L5A, L6A, L7A, L8A, L9A, L10A, L11A, L12A, L16, R1A, R2A, R3A, R4A, R5A, R6A, R7A, R8A, R9A, R10A, R11A, R12A, R1D, R2D, R3D, R4D, R5D, R6D, R7D, R8D, R9D, R10D, R11D, and R12D are as described herein, including in embodiments.
In embodiments, the compound has the formula:
L1A, L2A, L3A, L4A, L5A, L6A, L7A, L8A, L9A, L10A, L11A, L12A, L16, R1A, R2A, R3A, R4A, R5A, R6A, R7A, R8A, R9A, R10A, R11A, and R12A are as described herein, including in embodiments.
In embodiments, the compound has the formula:
L1A, L2A, L3A, L4A, L5A, L6A, L7A, L8A, L9A, L10A, L11A, L12A, L16, R1A, R2A, R3A, R4A, R5A, R6A, R7A, R8A, R9A, R10A, R11A, and R12A are as described herein, including in embodiments.
In embodiments, the compound includes at least one negatively charged amino acid side chain. In embodiments, at least one of R3A, R4A, and R11A is independently —COGH.
In embodiments, -L1A-R1A-L2A-R2A-L3A-R3A-L4A-R4A-L5A-R5A-L6A-R6A-L7A-R7A-L8A-R8A-L9A-R9A-L10A-R10A-L11A-R11A, or -L12A-R12A are independently a natural amino acid side chain or an unnatural amino acid side chain. In embodiments, -L1A-R1A-L2A-R2A-L3A-R3A-L4A-R4A-L5A-R5A-L6A-R6A-L7A-R7A-L8A-R8A-L9A-R9A-L10A-R10A-L11A-R11A, or -L12A-R12A are independently a natural amino acid side chain. In embodiments, -L1A-R1A-L2A-R2A-L3A-R3A-L4A-R4A-L5A-R5A-L6A-R6A-L7A-R7A-L8A-R8A-L9A-R9A-L10A-R10A-L11A-R11A, or -L12A-R12A are independently an unnatural amino acid side chain.
In embodiments, a substituted L1A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L1A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L1A is substituted, it is substituted with at least one substituent group. In embodiments, when L1A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L1A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L2A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L2A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L2A is substituted, it is substituted with at least one substituent group. In embodiments, when L2A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L2A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L3A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L3A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L3A is substituted, it is substituted with at least one substituent group. In embodiments, when L3A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L3A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L4A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L4A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L4A is substituted, it is substituted with at least one substituent group. In embodiments, when L4A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L4A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L5A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L5A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L5A is substituted, it is substituted with at least one substituent group. In embodiments, when L5A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L5A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L6A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L6A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L6A is substituted, it is substituted with at least one substituent group. In embodiments, when L6A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L6A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L7A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L7A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L7A is substituted, it is substituted with at least one substituent group. In embodiments, when L7A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L7A, is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L8A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L8A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L8A is substituted, it is substituted with at least one substituent group. In embodiments, when L8A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L8A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L9A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L9A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L9A is substituted, it is substituted with at least one substituent group. In embodiments, when L9A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L9A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L10A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L10A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L10A is substituted, it is substituted with at least one substituent group. In embodiments, when L10A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L10A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L11A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L11A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L11A is substituted, it is substituted with at least one substituent group. In embodiments, when L11A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L11A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L12A (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L12A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L12A is substituted, it is substituted with at least one substituent group. In embodiments, when L12A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L12A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R11A (e.g., substituted aryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R11A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R11A is substituted, it is substituted with at least one substituent group. In embodiments, when R11A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R11A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R2A (e.g., substituted alkyl, substituted cycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R2A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R2A is substituted, it is substituted with at least one substituent group. In embodiments, when R2A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R2A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R3A (e.g., substituted alkyl and/or substituted heteroalkyl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R3A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R3A is substituted, it is substituted with at least one substituent group. In embodiments, when R3A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R3A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R4A (e.g., substituted alkyl and/or substituted heteroalkyl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R4A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R4A is substituted, it is substituted with at least one substituent group. In embodiments, when R4A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R4A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R5A (e.g., substituted alkyl, substituted cycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R5A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R5A is substituted, it is substituted with at least one substituent group. In embodiments, when R5A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R5A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R6A (e.g., substituted alkyl, substituted heteroalkyl, and/or substituted aryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R6A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R6A is substituted, it is substituted with at least one substituent group. In embodiments, when R6A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R6A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R7A (e.g., substituted alkyl, substituted cycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R7A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R7A is substituted, it is substituted with at least one substituent group. In embodiments, when R7A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R7A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R8A (e.g., substituted alkyl, substituted cycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R8A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R8A is substituted, it is substituted with at least one substituent group. In embodiments, when R8A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R8A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R9A (e.g., substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R9A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R9A is substituted, it is substituted with at least one substituent group. In embodiments, when R9A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R9A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R10A (e.g., substituted alkyl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R10A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R10A is substituted, it is substituted with at least one substituent group. In embodiments, when R10A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R10A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R11A (e.g., substituted alkyl and/or substituted heteroalkyl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R11A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R11A is substituted, it is substituted with at least one substituent group. In embodiments, when R11A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R11A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R12A (e.g., substituted alkyl, substituted cycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R12A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R12A is substituted, it is substituted with at least one substituent group. In embodiments, when R12A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R12A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R5E (e.g., substituted alkyl and/or substituted heteroalkyl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R5E is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R5E is substituted, it is substituted with at least one substituent group. In embodiments, when R5E is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R5E is substituted, it is substituted with at least one lower substituent group.
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L1A is a bond or unsubstituted C1-C4 alkylene. In embodiments, R1A is a substituted aryl. In embodiments,
is a divalent form of a natural amino acid.
In embodiments,
is a divalent form of tyrosine. In embodiments, -L1A-R1A is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L2A is a bond or unsubstituted C1-C4 alkylene. In embodiments, R2A is —OH, —NH2, substituted or unsubstituted alkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of phenylalanine, a divalent form of histidine, a divalent form of alanine, a divalent form of valine a divalent form of threonine, or a divalent form of tyrosine. In embodiments,
is a divalent form of phenylalanine. In embodiments,
is a divalent form of histidine. In embodiments,
is a divalent form of alanine. In embodiments,
is a divalent form of valine. In embodiments,
is a divalent form of threonine. In embodiments,
is a divalent form of tyrosine. In embodiments, -L2A-R2A is
In embodiments, L2A-R2A is
In embodiments, -L2A-R2A is
In embodiments, -L2A-R2A is —CH3. In embodiments, -L2A-R2A is
In embodiments, -L2A-R2A is
In embodiments, -L2A-R2A is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L3A is a bond or unsubstituted C1-C4 alkylene. In embodiments, R3A is —OH, —NH2, —COOH, —CONH2, substituted or unsubstituted alkyl, or substituted or unsubstituted heteroalkyl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of glutamine or a divalent form of glutamic acid. In embodiments,
is a divalent form of glutamine. In embodiments,
is a divalent form of glutamic acid. In embodiments, -L3A-R3A is
In embodiments, -L3A-R3A is
In embodiments, -L3A-R3A is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L4A is a bond or unsubstituted C1-C4 alkylene. In embodiments, R4A is —OH, —COOH, or substituted or unsubstituted alkyl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of serine or a divalent form of aspartic acid. In embodiments,
is a divalent form of serine. In embodiments,
is a divalent form of aspartic acid. In embodiments, -L4A-R4A is
In embodiments, -L4A-R4A is
In embodiments, -L4A-R4A is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L5A is a bond or unsubstituted C1-C4 alkylene. In embodiments, R5A is a hydrogen, or unsubstituted alkyl, or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of isoleucine, a divalent form of tryptophan, or a divalent form of valine. In embodiments,
is a divalent form of isoleucine. In embodiments,
is a divalent form of tryptophan. In embodiments,
is a divalent form of valine. In embodiments, -L5A-R5A is
In embodiments, -L5A-R5A is
In embodiments, -L5A-R5A is
In embodiments, -L5A-R5A is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L6A is a bond or unsubstituted C1-C6 alkylene. In embodiments, R6A is —NH2, —CONH2, substituted or unsubstituted alkyl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
a divalent form of tyrosine or a divalent form of asparagine. In embodiments,
is a divalent form of tyrosine. In embodiments,
is a divalent form of asparagine. In embodiments,
is a divalent form of arginine. In embodiments, -L6A-R6A is
In embodiments, -L6A-R6A is
In embodiments, -L6A-R6A is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L7A is a bond or unsubstituted C1-C4 alkylene. In embodiments, R7A is hydrogen, unsubstituted alkyl, or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of histidine, a divalent form of leucine, a divalent form of isoleucine, or a divalent form of alanine. In embodiments,
is a divalent form of histidine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of isoleucine. In embodiments,
is a divalent form of alanine. In embodiments, -L7A-R7A is
or —CH3. In embodiments, -L7A-R7A is
In embodiments, -L7A-R7A is
In embodiments, -L7A-R7A is
In embodiments, -L7A-R7A is —CH3.
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L8A is a bond or unsubstituted C1-C4 alkylene. In embodiments, R8A is a hydrogen or unsubstituted alkyl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of isoleucine. In embodiments, -L8A-R8A, is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L9A is a bond or unsubstituted C1-C6 alkylene. In embodiments, R9A is an unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of tryptophan. In embodiments, -L9A-R9A is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L10A is a bond or unsubstituted C1-C4 alkylene. In embodiments, R10A is a hydrogen or unsubstituted alkyl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of glycine. In embodiments, -L10A-R10A is —H.
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L11A is a bond or unsubstituted C1-C4 alkylene. In embodiments, R11A is —OH, —COGH, —CONH2, or substituted alkyl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of glutamic acid, a divalent form of threonine, or a divalent form of glutamine. In embodiments,
is a divalent form of glutamic acid. In embodiments,
is a divalent form of threonine. In embodiments,
is a divalent form of glutamine. In embodiments, -L11A-R11A is
In embodiments, -L11A-R11A is
In embodiments, -L11A-R11A is
In embodiments, -L11A-R11A is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L12A is a bond or unsubstituted C1-C6 alkylene. In embodiments, R12A is a hydrogen or unsubstituted alkyl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of leucine. In embodiments, -L12A-R12A is
In embodiments, the compound has the formula:
L16 is as described herein, including in embodiments.
In embodiments, the compound has the formula:
L17 and R17 are as described herein, including in embodiments.
In embodiments, the compound has the formula:
In embodiments, the compound has the formula:
In embodiments, the compound does not have the formula:
In embodiments, the compound has the formula:
In embodiments, the compound has the formula:
In embodiments, the compound has the formula:
In embodiments, the compound has the formula:
In embodiments, the compound of formula (I) is a peptide of
For peptide GN13 of
For peptide 1 of
For peptide 2 of
For peptide 3 of
For peptide 12 of
For peptide 16 of
For peptide 6 of
In embodiments, the compound of formula (I) is a peptide of
For peptide GR6 F2G of
For peptide GR6 F2V of
For peptide GR6 F2Y of
For peptide GR6 I5T of
For peptide GR6 I5P of
-L6A-R6A is a tyrosine side chain; -L7A-R7A is a histidine side chain; -L8A-R8A is an isoleucine side chain; -L9A-R9A is a tryptophan side chain; -L10A-R10A is a glycine side chain; -L11A-R11A is a glutamic acid side chain; and -L12A-R12A is a leucine side chain.
For peptide GR6 H7Y of
For peptide GR6 E11T of
For peptide GR6 E11Q of
For peptide GR6 F2Y_I5P_E11Q of
-L6A-R6A is a tyrosine side chain; -L7A-R7A is a histidine side chain; -L8A-R8A is an isoleucine side chain; -L9A-R9A is a tryptophan side chain; -L10A-R10A is a glycine side chain; -L11A-R11A is a glutamine side chain; and -L12A-R12A is a leucine side chain.
In embodiments, the compound binds a human Gαs protein-GTP complex more strongly than the compound binds a human Gαs protein-GDP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GTP complex at least 2-fold stronger than the compound binds a human Gαs protein-GDP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GTP complex at least 5-fold stronger than the compound binds a human Gαs protein-GDP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GTP complex at least 10-fold stronger than the compound binds a human Gαs protein-GDP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GTP complex at least 20-fold stronger than the compound binds a human Gαs protein-GDP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GTP complex at least 40-fold stronger than the compound binds a human Gαs protein-GDP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GTP complex at least 60-fold stronger than the compound binds a human Gαs protein-GDP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GTP complex at least 80-fold stronger than the compound binds a human Gαs protein-GDP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GTP complex at least 100-fold stronger than the compound binds a human Gαs protein-GDP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GTP complex at least 500-fold stronger than the compound binds a human Gαs protein-GDP complex under identical conditions.
In an aspect is provided a compound having the formula:
R1D, R2D, R3D, R4D, R5D, R6D, R7D, R8D, R9D, R10D, R11D, R12D, and L16 are as described herein, including in embodiments.
L1B, L2B, L3B, L4B, L5B, L6B, L7B, L8B, L9B, L10B, L11B, L12B, and L13B are independently a bond, substituted or unsubstituted alkylene (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), or substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered).
L13 is a bond,
R1B is substituted or unsubstituted aryl (e.g., C6-C10 or phenyl).
R2B, R4B, R5B, R8B, R9B, and R13B are independently hydrogen, —OH, —NH2, —C(O)OH, —C(O)NH2, —NO2, —SO3H, —OSO3H, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-C10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
R3B is hydrogen, —OH, —CN, —NH2, —C(O)NH2, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHOH, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), or substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered).
R6B, R7B, R10B, R1B, and R12B are independently hydrogen, —OH, —NH2, —C(O)OH, —C(O)NH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl3, —OCF3, —OCBr3, —OCI3, —OCHCl2, —OCHBr2, —OCHI2, —OCHF2, —OCH2Cl, —OCH2Br, —OCH2I, —OCH2F, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-C10 or phenyl), or substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
R13D is independently hydrogen or unsubstituted C1-C4 alkyl.
R13E is hydrogen, —OH, —NH2, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered).
In embodiments, the compound has the formula:
L1B, L2B, L3B, L4B, L5B, L6B, L7B, L8B, L9B, L10B, L11B, L12B, L16, R1B, R2B, R3B, R4B, R5B, R6B, R7B, R8B, R9B, R10B, R11B, R12B and R13E are as described herein, including in embodiments.
In embodiments, the compound has the formula:
L1B, L2B, L3B, L4B, L5B, L6B, L7B, L8B, L9B, L10B, L11B, L12B, L16, R1B, R2B, R3B, R4B, R5B, R6B, R7B, R8B, R9B, R10B, R11B, R12B and R13E are as described herein, including in embodiments.
In embodiments, -L1B-R1B, -L2B-R2B, -L3B-R3B, -L4B-R4B, -L5B-R5B, -L6B-R6B, -L7B-R7B, -L8B-R8B-L9B-R9B-L10B-R10B-L11B-R11B-L12B-R12B, or -L13B-R13B are independently a natural amino acid side chain or an unnatural amino acid side chain. In embodiments, -L1B-R1B, -L2B-R2B, -L3B-R3B, -L4B-R4B, -L5B-R5B, -L6B-R6B, -L7B-R7B, -L8B-R8B, -L9B-R9B, -L10B-R10B-L11B-R11B-L12B-R12B, or -L13B-R13B are independently a natural amino acid side chain. In embodiments, -L1B-R1B, -L2B-R2B, -L3B-R3B, -L4B-R4B,-L5B-R5B-L6B-R6B-L7B-R7B, -L8B-R8B-L9B-R9B-L10B-R10B-L11B-R11B-L12B-R12B, or -L13B-R13B are independently an unnatural amino acid side chain.
In embodiments, a substituted L1B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L1B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L1B is substituted, it is substituted with at least one substituent group. In embodiments, when L1B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L1B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L2B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L2B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L2B is substituted, it is substituted with at least one substituent group. In embodiments, when L2B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L2B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L3B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L3B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L3B is substituted, it is substituted with at least one substituent group. In embodiments, when L3B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L3B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L4B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L4B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L4B is substituted, it is substituted with at least one substituent group. In embodiments, when L4B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L4B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L5B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L5B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L5B is substituted, it is substituted with at least one substituent group. In embodiments, when L5B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L5B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L6B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L6B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L6B is substituted, it is substituted with at least one substituent group. In embodiments, when L6B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L6B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L7B, (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L7B, is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L7B, is substituted, it is substituted with at least one substituent group. In embodiments, when L7B, is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L7B, is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L8B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L8B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L8B is substituted, it is substituted with at least one substituent group. In embodiments, when L8B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L8B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L9B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L9B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L9B is substituted, it is substituted with at least one substituent group. In embodiments, when L9B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L9B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L10B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L10B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L10B is substituted, it is substituted with at least one substituent group. In embodiments, when L10B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L10B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L11B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L11B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L11B is substituted, it is substituted with at least one substituent group. In embodiments, when L11B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L11B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L12B(e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L12B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L12B is substituted, it is substituted with at least one substituent group. In embodiments, when L12B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L12B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L13B (e.g., substituted alkylene and/or substituted heteroalkylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L13B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L13B is substituted, it is substituted with at least one substituent group. In embodiments, when L13B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L13B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R1B (e.g., substituted aryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R1B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R1B is substituted, it is substituted with at least one substituent group. In embodiments, when R1B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R1B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R2B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R2B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R2B is substituted, it is substituted with at least one substituent group. In embodiments, when R2B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R2B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R3B (e.g., substituted alkyl and/or substituted heteroalkyl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R3B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R3B is substituted, it is substituted with at least one substituent group. In embodiments, when R3B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R3B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R4B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R4B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R4B is substituted, it is substituted with at least one substituent group. In embodiments, when R4B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R4B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R5B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R5B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R5B is substituted, it is substituted with at least one substituent group. In embodiments, when R5B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R5B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R6B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R6B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R6B is substituted, it is substituted with at least one substituent group. In embodiments, when R6B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R6B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R7B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R7B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R7B is substituted, it is substituted with at least one substituent group. In embodiments, when R7B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R7B, is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R8B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R8B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R8B is substituted, it is substituted with at least one substituent group. In embodiments, when R8B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R8B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R9B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R9B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R9 is substituted, it is substituted with at least one substituent group. In embodiments, when R9B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R9B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R10B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R10B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R10B is substituted, it is substituted with at least one substituent group. In embodiments, when R10B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R10B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R11B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R1B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R1B is substituted, it is substituted with at least one substituent group. In embodiments, when R1B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R1B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R12B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R12B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R12B is substituted, it is substituted with at least one substituent group. In embodiments, when R12B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R12B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R13B (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R13B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R13B is substituted, it is substituted with at least one substituent group. In embodiments, when R13B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R13B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted R13E (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R13E is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R13E is substituted, it is substituted with at least one substituent group. In embodiments, when R13E is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R13E is substituted, it is substituted with at least one lower substituent group.
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L1B is a bond or unsubstituted C1-C4 alkylene. In embodiments, R1B is a substituted aryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of tyrosine. In embodiments, -L1B-R1B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L2B is a bond or unsubstituted C1-C6 alkylene. In embodiments, R2B is hydrogen, —OH, —NH2, —C(O)OH, —C(O)NH2, substituted or unsubstituted alkyl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of lysine, a divalent form of leucine, a divalent form of serine, a divalent form of asparagine, a divalent form of glutamine, a divalent form of histidine, a divalent form of aspartic acid, or a divalent form of glycine. In embodiments,
is a divalent form of lysine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of serine. In embodiments,
is a divalent form of asparagine. In embodiments,
is a divalent form of glutamine. In embodiments,
is a divalent form of histidine. In embodiments,
is a divalent form of aspartic acid. In embodiments,
is a divalent form of glycine. In embodiments, -L2BR2B is
or —H. In embodiments, -L2B-R2B is
In embodiments, -L2B-R2B is
In embodiments, -L2B-R2B is
In embodiments, -L2B-R2B is
In embodiments, -L2B-R2B is
In embodiments, -L2B-R2B is
In embodiments, -L2B-R2B is
In embodiments, -L2B-R2B is —H.
In embodiments
is a divalent form of an unnatural amino acid. In embodiments, L3B is a bond or unsubstituted C1-C6 alkylene. In embodiments, R3B is hydrogen, —NH2, —C(O)NH2, —NHC(NH)NH2, or substituted or unsubstituted alkyl. In embodiments
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of leucine, a divalent form of valine, a divalent form of isoleucine, a divalent form of lysine, a divalent form of glycine, a divalent form of glutamine, or a divalent form of arginine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of valine. In embodiments,
is a divalent form of isoleucine. In embodiments,
is a divalent form of lysine. In embodiments,
is a divalent form of glycine. In embodiments,
is a divalent form of glutamine. In embodiments,
is a divalent form of arginine. In embodiments, -L3B-R3B is
In embodiments, -L3B-R3B is
In embodiments, -L3B-R3B is
In embodiments, -L3B-R3B is
In embodiments, -L3B-R3B is
In embodiments, -L3B-R3B is —H. In embodiments, -L3B-R3B is
In embodiments, -L3B-R3B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L4B is a bond or unsubstituted C1-C6 alkylene. In embodiments, R4B is —OH, —NH2, substituted or unsubstituted alkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of threonine, a divalent form of lysine, a divalent form of leucine, a divalent form of phenylalanine, a divalent form of histidine, or a divalent form of isoleucine. In embodiments,
is a divalent form of threonine. In embodiments,
is a divalent form of lysine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of phenylalanine. In embodiments,
is a divalent form of histidine. In embodiments,
is a divalent form of isoleucine. In embodiments, -L4B-R4B is
In embodiments, -L4B-R4B is
In embodiments, -L4B-R4B is
In embodiments, -L4B-R4B is
In embodiments, -L4B-R4B is
In embodiments, -L4B-R4B is
In embodiments, -L4B-R4B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L5B is a bond or unsubstituted C1-C4 alkylene. In embodiments, R5B is —OH, substituted or unsubstituted alkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of valine, a divalent form of isoleucine, a divalent form of tryptophan, a divalent form of leucine, a divalent form of threonine, or a divalent form of phenylalanine. In embodiments,
is a divalent form of valine. In embodiments,
is a divalent form of isoleucine. In embodiments,
is a divalent form of tryptophan. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of threonine. In embodiments,
is a divalent form of phenylalanine. In embodiments, -L5B-R5B is
In embodiments, -L5B-R5B is
In embodiments, -L5B-R5B is
In embodiments, -L5B-R5B is
In embodiments, -L5B-R5B is
In embodiments, -L5B-R5B is
In embodiments, L5B-R5B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L6B is a bond or unsubstituted C1-C4 alkylene. In embodiments, R6B is —OH, —C(O)NH2, —NHC(NH)NH2, substituted or unsubstituted alkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of tyrosine, a divalent form of leucine, a divalent form of threonine, a divalent form of valine, a divalent form of arginine, a divalent form of isoleucine, a divalent form of asparagine, or a divalent form of tryptophan. In embodiments,
is a divalent form of tyrosine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of threonine. In embodiments,
is a divalent form of valine. In embodiments,
is a divalent form of arginine. In embodiments,
is a divalent form of isoleucine. In embodiments,
is a divalent form of asparagine. In embodiments,
is a divalent form of tryptophan. In embodiments, -L6B-R6B is
In embodiments, -L6B-R6B is
In embodiments, -L6B-R6B is
In embodiments, -L6B-R6B is
In embodiments, L6BR6B is
In embodiments, -L6B-R6B is
In embodiments, -L6B-R6B is
In embodiments, -L6B-R6B is
In embodiments, -L6B-R6B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L7B is a bond or unsubstituted C1-C4 alkylene. In embodiments, R7B is —OH, —C(O)OH, —C(O)NH2, —NHC(NH)NH2, or substituted or unsubstituted alkyl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of glutamic acid, a divalent form of threonine, a divalent form of isoleucine, a divalent form of leucine, a divalent form of arginine, a divalent form of glutamine, or a divalent form of aspartic acid. In embodiments,
is a divalent form of glutamic acid. In embodiments,
is a divalent form of threonine. In embodiments,
is a divalent form of isoleucine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of arginine. In embodiments,
is a divalent form of glutamine. In embodiments,
is a divalent form of aspartic acid. In embodiments, -L7B-R7B is
In embodiments, -L7B-R7B is
In embodiments, -L7B-R7B is
In embodiments, -L7B-R7B, is
In embodiments, -L7B-R7B, is
In embodiments, -L7B-R7B is
In embodiments, -L7B-R7B, is
In embodiments, -L7B-R7B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L8B is a bond or unsubstituted C1-C4 alkylene. In embodiments, R8B is —C(O)OH, —C(O)NH2, substituted or unsubstituted alkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of phenylalanine, a divalent form of valine, a divalent form or tyrosine, a divalent form of asparagine, a divalent form of leucine, a divalent form of glutamic acid, or a divalent form of tryptophan. In embodiments,
is a divalent form of phenylalanine. In embodiments,
is a divalent form of valine. In embodiments,
is a divalent form or tyrosine. In embodiments,
is a divalent form of asparagine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of glutamic acid. In embodiments,
is a divalent form of tryptophan. In embodiments, -L8B-R8B is
In embodiments, -L8B-R8B is
In embodiments, -L8B-R8B is
In embodiments, -L8B-R8B is
In embodiments, -L8B-R8B is
In embodiments, -L8B-R8B is
In embodiments, -L8B-R8B is
In embodiments, -L8B-R8B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L9B is a bond or unsubstituted C1-C4 alkylene. In embodiments, R9B is —C(O)OH, —C(O)NH2, substituted or unsubstituted alkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of leucine, a divalent form of valine, a divalent form of glutamic acid, a divalent form of asparagine, a divalent form of phenylalanine, a divalent form of isoleucine, a divalent form of tryptophan, a divalent form of alanine, or a divalent form of histidine. In embodiments,
divalent form of isoleucine. In embodiments, -L9BR9B is
In embodiments, -L9B-R9B is
In embodiments, -L9B-R9B is
In embodiments, -L9B-R9B is
In embodiments, -L9B-R9B is
In embodiments, -L9B-R9B is
In embodiments, -L9BR9B is
In embodiments, -L9B-R9B is
In embodiments, -L9B-R9B is —CH3. In embodiments, -L9B-R9B is
In embodiments
is a divalent form of an unnatural amino acid. In embodiments, L10B is a bond or unsubstituted C1-C4 alkylene. In embodiments, R10B is —OH, —C(O)OH, —C(O)NH2, —NHC(NH)NH2, substituted or unsubstituted alkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of leucine, a divalent form of phenylalanine, a divalent form of alanine, a divalent form of aspartic acid, a divalent form of arginine, a divalent form of serine, a divalent form of glutamic acid, a divalent form of isoleucine, a divalent form of glutamine, or a divalent form of tryptophan. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of phenylalanine. In embodiments,
is a divalent form of alanine. In embodiments,
is a divalent form of aspartic acid. In embodiments,
is a divalent form of arginine. In embodiments,
is a divalent form of serine. In embodiments,
is a divalent form of glutamic acid. In embodiments,
is a divalent form of isoleucine. In embodiments,
is a divalent form of glutamine. In embodiments,
is a divalent form of tryptophan. In embodiments, -L10B-R10B is
In embodiments, -L10B-R10B is
In embodiments, -L10B-R10B is
In embodiments, -L10B-R10B is —CH3. In embodiments, -L10B-R10B is
In embodiments, -L10B-R10B is
In embodiments, -L10B-R10B is
In embodiments, -L10B-R10B is
In embodiments, -L10B-R10B is
In embodiments, -L10B-R10B is
In embodiments, -L10B-R10B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L11B is a bond or unsubstituted C1-C4 alkylene. In embodiments, R1B is hydrogen, —OH, —C(O)OH, —C(O)NH2, substituted or unsubstituted alkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of glutamic acid, a divalent form of alanine, a divalent form of aspartic acid, a divalent form of glycine, a divalent form of asparagine, a divalent form of histidine, a divalent form of phenylalanine, a divalent form of leucine, a divalent form of serine, or a divalent form of isoleucine. In embodiments,
is a divalent form of glutamic acid. In embodiments,
is a divalent form of alanine. In embodiments,
is a divalent form of aspartic acid. In embodiments,
is a divalent form of glycine. In embodiments,
is a divalent form of asparagine. In embodiments,
is a divalent form of histidine. In embodiments,
is a divalent form of phenylalanine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of serine. In embodiments,
is a divalent form of isoleucine. In embodiments, -L11B-R11B is
In embodiments, -L11B-R11B is
In embodiments, -L11B-R11B is —CH3. In embodiments, -L11B-R11B is
In embodiments, -L11B-R11B is —H. In embodiments, -L11B-R11B is
In embodiments, -L11B-R11B is
In embodiments, -L11B-R11B is
In embodiments, -L11B-R11B is
In embodiments, -L11B-R11B is
In embodiments, -L11B-R11B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L12B is a bond or unsubstituted C1-C6 alkylene. In embodiments, R12B is —OH, —NH2, —C(O)NH2, —NHC(NH)NH2, substituted or unsubstituted alkyl, substituted or unsubstituted aryl, or substituted or unsubstituted heteroaryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of arginine, a divalent form of tyrosine, a divalent form of isoleucine, a divalent form of threonine, a divalent form of lysine, a divalent form of leucine, a divalent form of histidine, a divalent form of asparagine, a divalent form of serine, or a divalent form of valine. In embodiments,
is a divalent form of arginine. In embodiments,
is a divalent form of tyrosine. In embodiments,
is a divalent form of isoleucine. In embodiments,
is a divalent form of threonine. In embodiments,
is a divalent form of lysine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of histidine. In embodiments,
is a divalent form of asparagine. In embodiments,
is a divalent form of serine. In embodiments,
is a divalent form of valine. In embodiments, -L12B-R12B is
In embodiments, -L12B-R12B is
In embodiments, -L12B-R2B is
In embodiments, -L12B-R12B is
In embodiments, -L2B-R2B is
In embodiments, -L12B-R12B is
In embodiments, -L12B-R12B is
In embodiments, -L2B-R12B is
In embodiments, -L2B-R2B is
In embodiments, -L12B-R12B is
In embodiments, -L12B-R12B is
In embodiments,
is a divalent form of an unnatural amino acid. In embodiments, L13B is a bond or unsubstituted C1-C6 alkylene. In embodiments, R13B is —NH2, —C(O)OH, —C(O)NH2, substituted or unsubstituted alkyl, or substituted or unsubstituted aryl. In embodiments,
is a divalent form of a natural amino acid. In embodiments,
is a divalent form of lysine, a divalent form of aspartic acid, a divalent form of tyrosine, a divalent form of leucine, a divalent form of alanine, or a divalent form of asparagine. In embodiments,
is a divalent form of lysine. In embodiments,
is a divalent form of aspartic acid. In embodiments,
is a divalent form of tyrosine. In embodiments,
is a divalent form of leucine. In embodiments,
is a divalent form of alanine. In embodiments,
is a divalent form of asparagine. In embodiments, -L13B-R13B is
In embodiments, -L13B-R13B is
In embodiments, -L13B-R13B is
In embodiments, -L13B-R13B is
In embodiments, -L13B-R13B is
In embodiments, -L13B-R13B is —CH3. In embodiments, -L13B-R13B is
In embodiments, the compound has the formula:
L16 is as described herein, including in embodiments.
In embodiments, the compound has the formula:
L17 and R17 are as described herein, including in embodiments.
In embodiments, the compound has the formula:
In embodiments, the compound has the formula:
In embodiments, the compound has the formula:
L16 is as described herein, including in embodiments.
In embodiments, the compound has the formula:
L17 and R17 are as described herein, including in embodiments.
In embodiments, the compound has the formula:
In embodiments, the compound has the formula:
In embodiments, the compound of formula (II) is a peptide of
For peptide D4 of
For peptide D9 of
For peptide D7 of
For peptide D8 of
For peptide D16 of
For peptide D10 of
For peptide D12 of
For peptide D6 of
For peptide D5 of
For peptide D11 of
For peptide D18 of
For peptide D19 of
For peptide D15 of
For peptide D2 of
For peptide D14 of
For peptide D3 of
For peptide D17 of
For peptide D20 of
For peptide D13 of
For peptide D1 of
In embodiments, the compound binds a human Gαs protein-GDP complex more strongly than the compound binds a human Gαs protein-GTP complex under identical conditions. In embodiments, the compound binds a Gαs protein-GDP complex at least 2-fold stronger than the compound binds a human Gαs protein-GTP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GDP complex at least 5-fold stronger than the compound binds a human Gαs protein-GTP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GDP complex at least 10-fold stronger than the compound binds a human Gαs protein-GTP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GDP complex at least 20-fold stronger than the compound binds a human Gαs protein-GTP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GDP complex at least 40-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GDP complex at least 60-fold stronger than the compound binds a human Gαs protein-GTP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GDP complex at least 80-fold stronger than the compound binds a human Gαs protein-GTP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GDP complex at least 100-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions. In embodiments, the compound binds a human Gαs protein-GDP complex at least 500-fold stronger than the compound binds a human Gαs protein-GTP complex under identical conditions.
In embodiments, a divalent form of an unnatural amino acid is a divalent form of an unnatural phenylalanine derivative. In embodiments, the divalent form of an unnatural
In embodiments, RD is hydrogen. In embodiments, R1D is unsubstituted methyl. In embodiments, R1D is unsubstituted ethyl. In embodiments, R1D is unsubstituted propyl. In embodiments, R1D is unsubstituted butyl. In embodiments, R2D is hydrogen. In embodiments, R2D is unsubstituted methyl. In embodiments, R2D is unsubstituted ethyl. In embodiments, R2D is unsubstituted propyl. In embodiments, R2D is unsubstituted butyl. In embodiments, R3D is hydrogen. In embodiments, R3D is unsubstituted methyl. In embodiments, R3D is unsubstituted ethyl. In embodiments, R3D is unsubstituted propyl. In embodiments, R3D is unsubstituted butyl. In embodiments, R4D is hydrogen. In embodiments, R4D is unsubstituted methyl. In embodiments, R4D is unsubstituted ethyl. In embodiments, R4D is unsubstituted propyl. In embodiments, R4D is unsubstituted butyl. In embodiments, R5D is hydrogen. In embodiments, R5D is unsubstituted methyl. In embodiments, R5D is unsubstituted ethyl. In embodiments, R5D is unsubstituted propyl. In embodiments, R5D is unsubstituted butyl. In embodiments, R6D is hydrogen. In embodiments, R6D is unsubstituted methyl. In embodiments, R6D is unsubstituted ethyl. In embodiments, R6D is unsubstituted propyl. In embodiments, R6D is unsubstituted butyl. In embodiments, R7D is hydrogen. In embodiments, R7D is unsubstituted methyl. In embodiments, R7D is unsubstituted ethyl. In embodiments, R7D is unsubstituted propyl. In embodiments, R7D is unsubstituted butyl. In embodiments, R8D is hydrogen. In embodiments, R8D is unsubstituted methyl. In embodiments, R8D is unsubstituted ethyl. In embodiments, R8D is unsubstituted propyl. In embodiments, R8D is unsubstituted butyl. In embodiments, R9D is hydrogen. In embodiments, R9D is unsubstituted methyl. In embodiments, R9D is unsubstituted ethyl. In embodiments, R9D is unsubstituted propyl. In embodiments, R9D is unsubstituted butyl. In embodiments, R10D is hydrogen. In embodiments, R10D is unsubstituted methyl. In embodiments, R10D is unsubstituted ethyl. In embodiments, R10D is unsubstituted propyl. In embodiments, R10D is unsubstituted butyl. In embodiments, R11D is hydrogen. In embodiments, R11D is unsubstituted methyl. In embodiments, R11D is unsubstituted ethyl. In embodiments, R11D is unsubstituted propyl. In embodiments, R11D is unsubstituted butyl. In embodiments, R12D is hydrogen. In embodiments, R12D is unsubstituted methyl. In embodiments, R12D is unsubstituted ethyl. In embodiments, R12D is unsubstituted propyl. In embodiments, R12D is unsubstituted butyl. In embodiments, R13D is hydrogen. In embodiments, R13D is unsubstituted methyl. In embodiments, R13D is unsubstituted ethyl. In embodiments, R13D is unsubstituted propyl. In embodiments, R13D is unsubstituted butyl.
In embodiments, L16 is a bioconjugate linker. In embodiments, L16 is a substituted or unsubstituted divalent amino acid. In embodiments, L16 is a substituted or unsubstituted divalent δ-amino acid.
In embodiments, a substituted L16 (e.g., substituted divalent amino acid and/or substituted divalent δ-amino acid) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L16 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L16 is substituted, it is substituted with at least one substituent group. In embodiments, when L16 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L16 is substituted, it is substituted with at least one lower substituent group.
In embodiments, L16 is -L16A-L16B-L16C-L16D-L16E-L16F-.
L16A, L16B, L16C, L16D, L16E, and L16F are independently bond, —SS—, —S(O)2—, —OS(O)2—, —S(O)2O—, —NH—, —O—, —S—, —C(O)—, —NHS(O)2—, —S(O)2NH—, —C(O)NH—, —NHC(O)—, —NHC(O)NH—, —NHC(NH)NH—, —C(O)O—, —OC(O)—, substituted or unsubstituted alkylene (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C6-C10 or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
In embodiments, a substituted L16A (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L16A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L16A is substituted, it is substituted with at least one substituent group. In embodiments, when L16A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L16A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L16B (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L16B is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L16B is substituted, it is substituted with at least one substituent group. In embodiments, when L16B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L16B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L16C (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L16C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L16C is substituted, it is substituted with at least one substituent group. In embodiments, when L16C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L16C is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L16D (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L16D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L16D is substituted, it is substituted with at least one substituent group. In embodiments, when L16D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L16D is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L16E (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L16E is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L16E is substituted, it is substituted with at least one substituent group. In embodiments, when L16E is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L16E is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L16F (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L16F is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L16F is substituted, it is substituted with at least one substituent group. In embodiments, when L16F is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L16F is substituted, it is substituted with at least one lower substituent group.
In embodiments, L16A is bond, —SS—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, or substituted or unsubstituted heteroarylene. In embodiments, L16A is bond. In embodiments, L16A is —SS—. In embodiments, L16A is substituted or unsubstituted C1-C4 alkylene. In embodiments, L16A is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L16A is substituted or unsubstituted 3 to 6 membered heteroarylene. In embodiments, L16A is unsubstituted triazolylene. In embodiments, L16A is
In embodiments, L16B is bond, —SS—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, or substituted or unsubstituted heteroarylene. In embodiments, L16B is bond. In embodiments, L16B is —SS—. In embodiments, L16B is substituted or unsubstituted C1-C4 alkylene. In embodiments, L16B is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L16B is substituted or unsubstituted 3 to 6 membered heteroarylene. In embodiments, L16B is unsubstituted triazolylene. In embodiments, L16B is
In embodiments, L16C is bond, —SS—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, or substituted or unsubstituted heteroarylene. In embodiments, L16C is bond. In embodiments, L16C is —SS—. In embodiments, L16C is substituted or unsubstituted C1-C4 alkylene. In embodiments, L16C is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L16C is substituted or unsubstituted 3 to 6 membered heteroarylene. In embodiments, L16C is unsubstituted triazolylene. In embodiments, L16C is
In embodiments, L16D is bond, —SS—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, or substituted or unsubstituted heteroarylene. In embodiments, L16D is bond. In embodiments, L16D is —SS—. In embodiments, L16D is substituted or unsubstituted C1-C4 alkylene. In embodiments, L16D is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L16D is substituted or unsubstituted 3 to 6 membered heteroarylene. In embodiments, L16D is unsubstituted triazolylene. In embodiments, L16D is
In embodiments, L16E is bond, —SS—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, or substituted or unsubstituted heteroarylene. In embodiments, L16E is bond. In embodiments, L16E is —SS—. In embodiments, L16E is substituted or unsubstituted C1-C4 alkylene. In embodiments, L16E is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L16E is substituted or unsubstituted 3 to 6 membered heteroarylene. In embodiments, L16E is unsubstituted triazolylene. In embodiments, L16E is
In embodiments, L16F is bond, —SS—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, or substituted or unsubstituted heteroarylene. In embodiments, L16F is bond. In embodiments, L16F is —SS—. In embodiments, L16F is substituted or unsubstituted C1-C4 alkylene. In embodiments, L16F is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L16F is substituted or unsubstituted 3 to 6 membered heteroarylene. In embodiments, L16F is unsubstituted triazolylene. In embodiments, L16F is
In embodiments, -L16B-L16C-L16D- is —SS—
In embodiments, L16 is —NH-L16B-L16C-L16D-L16E-C(O)—.
In embodiments, L16B is
L17 is -L17A-L17B-L17C-L17D-L17E-L17F-.
L17A, L17B, L17C, L17D, L17E, and L17F are independently bond, —SS—, —S(O)2—, —OS(O)2—, —S(O)2O—, —NH—, —O—, —S—, —C(O)—, —NHS(O)2—, —S(O)2NH—, —C(O)NH—, —NHC(O)—, —NHC(O)NH—, —NHC(NH)NH—, —C(O)O—, —OC(O)—, substituted or unsubstituted alkylene (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkylene (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkylene (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkylene (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted arylene (e.g., C6-C10 or phenylene), or substituted or unsubstituted heteroarylene (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered).
R17 is hydrogen, halogen, —CCl3, —CBr3, —CF3, —CI3, —CHCl2, —CHBr2, —CHF2, —CHI2, —CH2Cl, —CH2Br, —CH2F, —CH2I, —CN, —OH, —NH2, —C(O)H, —C(O)OH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl3, —OCF3, —OCBr3, —OCI3, —OCHCl2, —OCHBr2, —OCHI2, —OCHF2, —OCH2Cl, —OCH2Br, —OCH2I, —OCH2F, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-C10 or phenyl), substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), a monovalent nucleic acid, a monovalent protein, a detectable moiety, or a drug moiety.
In embodiments, L16 is a bond,
L17 and R17 are as described herein, including in embodiments. In embodiments, L16 is a bond. In embodiments, L16 is
L17 and R17 are as described herein, including in embodiments. In embodiments, L16 is
L17 and R17 are as described herein, including in embodiments. In embodiments, L16 is
L17 and R17 are as described herein, including in embodiments. In embodiments, L16 is
L17 and R17 are as described herein, including in embodiments. In embodiments, L16 is
L17 and R17 are as described herein, including in embodiments. In embodiments, L16 is
L17 and R17 are as described herein, including in embodiments. In embodiments, L16 is
L17 and R17 are as described herein, including in embodiments.
In embodiments, L16 is
L17 and R17 are as described herein, including in embodiments.
In embodiments, a substituted L17A (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L17A is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L17A is substituted, it is substituted with at least one substituent group. In embodiments, when L17A is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L17A is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L7B, (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L7B, is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L17B is substituted, it is substituted with at least one substituent group. In embodiments, when L17B is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L17B is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L17C (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L17C is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L17C is substituted, it is substituted with at least one substituent group. In embodiments, when L17C is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L17C is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L7D (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L7D is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L17D is substituted, it is substituted with at least one substituent group. In embodiments, when L17D is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L17D is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L17 (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L7E is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L17E is substituted, it is substituted with at least one substituent group. In embodiments, when L17E is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L17E is substituted, it is substituted with at least one lower substituent group.
In embodiments, a substituted L17F (e.g., substituted alkylene, substituted heteroalkylene, substituted cycloalkylene, substituted heterocycloalkylene, substituted arylene, and/or substituted heteroarylene) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted L17F is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when L17F is substituted, it is substituted with at least one substituent group. In embodiments, when L17F is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when L17F is substituted, it is substituted with at least one lower substituent group.
In embodiments, L17A is a bond, unsubstituted alkylene, or unsubstituted heteroalkylene. In embodiments, L17A is a bond, unsubstituted C1-C6 alkylene, or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17A is a bond. In embodiments, L17A is unsubstituted C1-C6 alkylene. In embodiments, L17A is unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17A is
n is independently an integer from 1 to 100. In embodiments, n is independently an integer from 1 to 5.
In embodiments, L17A is a bond, unsubstituted alkylene, or substituted or unsubstituted heteroalkylene. In embodiments, L17A is a bond, unsubstituted C1-C6 alkylene, or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17A is a bond. In embodiments, L17A is unsubstituted C1-C6 alkylene. In embodiments, L17A is substituted 2 to 6 membered heteroalkylene. In embodiments, L17A is
In embodiments, L17A is
In embodiments, L17A is unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17A is
n is independently an integer from 1 to 100. In embodiments, n is independently an integer from 1 to 5.
In embodiments, L17B, is a bond, —NHC(O)—, —C(O)NH—, substituted or unsubstituted alkylene, or substituted or unsubstituted heteroalkylene. In embodiments, L17B is a bond, —NHC(O)—, —C(O)NH—, substituted or unsubstituted C1-C6 alkylene, or substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17B is a bond. In embodiments, L17B is —NHC(O)—. In embodiments, L17B is —C(O)NH—. In embodiments, L17B is substituted or unsubstituted C1-C6 alkylene. In embodiments, L17B is substituted or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17B is
n is independently an integer from 1 to 100. In embodiments, n is independently an integer from 1 to 10. In embodiments, n is independently an integer from 1 to 5.
In embodiments, L17C is a bond, unsubstituted alkylene, or unsubstituted heteroalkylene. In embodiments, L17C is a bond, unsubstituted C1-C6 alkylene, or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17C is a bond. In embodiments, L17C is unsubstituted C1-C6 alkylene. In embodiments, L17C is unsubstituted methylene. In embodiments, L17C is unsubstituted ethylene. In embodiments, L17C is unsubstituted propylene. In embodiments, L17C is unsubstituted n-propylene. In embodiments, L17C is unsubstituted butylene. In embodiments, L17C is unsubstituted n-butylene. In embodiments, L17C is unsubstituted pentylene. In embodiments, L17C is unsubstituted n-pentylene. In embodiments, L17C is unsubstituted hexylene. In embodiments, L17C is unsubstituted n-hexylene. In embodiments, L17C is unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17C is
n is independently an integer from 1 to 100. In embodiments, n is independently an integer from 1 to 10. In embodiments, n is independently an integer from 1 to 5.
In embodiments, L17D is a bond, —O—, unsubstituted alkylene, or unsubstituted heteroalkylene. In embodiments, L17D is a bond, —O—, unsubstituted C1-C8 alkylene, or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17D is a bond. In embodiments, L17D is —O—. In embodiments, L17D is unsubstituted C1-C8 alkylene. In embodiments, L17D is unsubstituted methylene. In embodiments, L17D is unsubstituted ethylene. In embodiments, L17D is unsubstituted propylene. In embodiments, L17D is unsubstituted n-propylene. In embodiments, L17D is unsubstituted butylene. In embodiments, L17D is unsubstituted n-butylene. In embodiments, L17D is unsubstituted pentylene. In embodiments, L17D is unsubstituted n-pentylene. In embodiments, L17D is unsubstituted hexylene. In embodiments, L17D is unsubstituted n-hexylene. In embodiments, L17D is unsubstituted heptylene. In embodiments, L17D is unsubstituted n-heptylene. In embodiments, L17D is unsubstituted octylene. In embodiments, L17D is unsubstituted octylene. In embodiments, L17D is unsubstituted 2 to 6 membered heteroalkylene.
In embodiments, L17E is a bond, unsubstituted alkylene, or unsubstituted heteroalkylene. In embodiments, L17E is a bond, unsubstituted C1-C8 alkylene, or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17E is a bond. In embodiments, L17E is unsubstituted C1-C8 alkylene. In embodiments, L17E is unsubstituted methylene. In embodiments, L17E is unsubstituted ethylene. In embodiments, L17E is unsubstituted propylene. In embodiments, L17E is unsubstituted n-propylene. In embodiments, L17E is unsubstituted butylene. In embodiments, L17E is unsubstituted butylene. In embodiments, L17E is unsubstituted pentylene. In embodiments, L17E is unsubstituted n-pentylene. In embodiments, L17E is unsubstituted hexylene. In embodiments, L17E is unsubstituted n-hexylene. In embodiments, L17E is unsubstituted heptylene. In embodiments, L17E is unsubstituted n-heptylene. In embodiments, L17E is unsubstituted octylene. In embodiments, L17E is unsubstituted n-octylene. In embodiments, L7E is unsubstituted 2 to 6 membered heteroalkylene.
In embodiments, L17F is a bond, unsubstituted alkylene, or unsubstituted heteroalkylene. In embodiments, L17F is a bond, unsubstituted C1-C8 alkylene, or unsubstituted 2 to 6 membered heteroalkylene. In embodiments, L17F is a bond. In embodiments, L17F is unsubstituted C1-C8 alkylene. In embodiments, L17F is unsubstituted methylene. In embodiments, L17F is unsubstituted ethylene. In embodiments, L17F is unsubstituted propylene. In embodiments, L17F is unsubstituted n-propylene. In embodiments, L17F is unsubstituted butylene. In embodiments, L17F is unsubstituted butylene. In embodiments, L17F is unsubstituted pentylene. In embodiments, L17F is unsubstituted n-pentylene. In embodiments, L17F is unsubstituted hexylene. In embodiments, L17F is unsubstituted n-hexylene. In embodiments, L17F is unsubstituted heptylene. In embodiments, L17F is unsubstituted n-heptylene. In embodiments, L17F is unsubstituted octylene. In embodiments, L17F is unsubstituted n-octylene. In embodiments, L17F is unsubstituted 2 to 6 membered heteroalkylene.
In embodiments, n is independently 1. In embodiments, n is independently 2. In embodiments, n is independently 3. In embodiments, n is independently 4. In embodiments, n is independently 5. In embodiments, n is independently 6. In embodiments, n is independently 7. In embodiments, n is independently 8. In embodiments, n is independently 9. In embodiments, n is independently 10.
In embodiments, L17 is a divalent form of puromycin. In embodiments, L17 is -L17A-(divalent form of puromycin)-L17E-L17F-; L17A, L17E, and L17F are as described herein, including in embodiments. In embodiments, L17 is
In embodiments, L17 is
In embodiments, L17 is
In embodiments, L17 is
In embodiments, -L17B-L17C-L17D- is a divalent form of puromycin. In embodiments, -L17B-L17C-L17D- is
In embodiments, -L17B-L17C-L17D- is
In embodiments, -L17B-L17C-L17D- is
In embodiments, -L17B-L17C-L17D- is
In embodiments, a substituted R17 (e.g., substituted alkyl, substituted heteroalkyl, substituted cycloalkyl, substituted heterocycloalkyl, substituted aryl, and/or substituted heteroaryl) is substituted with at least one substituent group, size-limited substituent group, or lower substituent group; wherein if the substituted R17 is substituted with a plurality of groups selected from substituent groups, size-limited substituent groups, and lower substituent groups; each substituent group, size-limited substituent group, and/or lower substituent group may optionally be different. In embodiments, when R17 is substituted, it is substituted with at least one substituent group. In embodiments, when R17 is substituted, it is substituted with at least one size-limited substituent group. In embodiments, when R17 is substituted, it is substituted with at least one lower substituent group.
In embodiments, R17 is hydrogen, halogen, —CCl3, —CBr3, —CF3, —CI3, —CHCl2, —CHBr2, —CHF2, —CHI2, —CH2Cl, —CH2Br, —CH2F, —CH2I, —CN, —OH, —NH2, —C(O)H, —C(O)OH, —CONH2, —NO2, —SH, —SO3H, —OSO3H, —SO2NH2, —NHNH2, —ONH2, —NHC(O)NHNH2, —NHC(O)NH2, —NHC(NH)NH2, —NHSO2H, —NHC(O)H, —NHC(O)OH, —NHOH, —OCCl3, —OCF3, —OCBr3, —OCI3, —OCHCl2, —OCHBr2, —OCHI2, —OCHF2, —OCH2Cl, —OCH2Br, —OCH2I, —OCH2F, substituted or unsubstituted alkyl (e.g., C1-C8, C1-C6, C1-C4, or C1-C2), substituted or unsubstituted heteroalkyl (e.g., 2 to 8 membered, 2 to 6 membered, 4 to 6 membered, 2 to 3 membered, or 4 to 5 membered), substituted or unsubstituted cycloalkyl (e.g., C3-C8, C3-C6, C4-C6, or C5-C6), substituted or unsubstituted heterocycloalkyl (e.g., 3 to 8 membered, 3 to 6 membered, 4 to 6 membered, 4 to 5 membered, or 5 to 6 membered), substituted or unsubstituted aryl (e.g., C6-C10 or phenyl), substituted or unsubstituted heteroaryl (e.g., 5 to 10 membered, 5 to 9 membered, or 5 to 6 membered), a monovalent nucleic acid, a monovalent protein, or a detectable moiety.
In embodiments, R17 is hydrogen. In embodiments, R17 is —F. In embodiments, R17 is —Cl. In embodiments, R17 is —Br. In embodiments, R17 is —I. In embodiments, R17 is —CCl3. In embodiments, R17 is —CBr3. In embodiments, R17 is —CF3. In embodiments, R17 is —Cl3. In embodiments, R17 is —CHCl2. In embodiments, R17 is —CHBr2. In embodiments, R17 is —CHF2. In embodiments, R17 is —CHI2. In embodiments, R17 is —CH2C1. In embodiments, R17 is —CH2Br. In embodiments, R17 is —CH2F. In embodiments, R17 is —CH2I. In embodiments, R17 is —OH. In embodiments, R17 is —NH2. In embodiments, R17 is substituted or unsubstituted alkyl. In embodiments, R17 is substituted or unsubstituted C1-C6 alkyl. In embodiments, R17 is unsubstituted methyl. In embodiments, R17 is unsubstituted ethyl. In embodiments, R17 is unsubstituted propyl. In embodiments, R17 is unsubstituted n-propyl. In embodiments, R17 is unsubstituted isopropyl. In embodiments, R17 is unsubstituted butyl. In embodiments, R17 is unsubstituted n-butyl. In embodiments, R17 is unsubstituted isobutyl. In embodiments, R17 is unsubstituted tert-butyl. In embodiments, R17 is substituted or unsubstituted heteroalkyl. In embodiments, R17 is substituted or unsubstituted 2 to 6 membered heteroalkyl. In embodiments, R17 is substituted or unsubstituted cycloalkyl. In embodiments, R17 is substituted or unsubstituted C3-C5 cycloalkyl. In embodiments, R17 is substituted or unsubstituted heterocycloalkyl. In embodiments, R17 is substituted or unsubstituted 3 to 8 membered heterocycloalkyl. In embodiments, R17 is substituted or unsubstituted aryl. In embodiments, R17 is substituted or unsubstituted C6-C10 aryl. In embodiments, R17 is substituted or unsubstituted heteroaryl. In embodiments, R17 is substituted or unsubstituted 5 to 10 membered heteroaryl. In embodiments, R17 is a monovalent nucleic acid. In embodiments, R17 is a monovalent protein. In embodiments, R17 is a detectable moiety. In embodiments, R17 is a drug moiety. In embodiments, R17 is a monovalent form of thalidomide.
In embodiments, -L17-R17 is
In embodiments, -L17-R17 is
In embodiments, L16 is —SS—,
In embodiments, L16 is a bond,
In embodiments, L16 is a bond. In embodiments, L16 is
In embodiments, L16 is
In embodiments, L16 is
In embodiments, L16 is
In embodiments, L16 is
In embodiments, L16 is
In embodiments, L16 is
In embodiments, L16 is
In embodiments, when R1A is substituted, R1A is substituted with one or more first substituent groups denoted by R1A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R1A.1 substituent group is substituted, the R1A.1 substituent group is substituted with one or more second substituent groups denoted by R1A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R1A.2 substituent group is substituted, the R1A.2 substituent group is substituted with one or more third substituent groups denoted by R1A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R1A, R1A.1, R1A.2, and R1A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R1A, R1A.1, R1A.2, and R11A.3, respectively.
In embodiments, when R1B is substituted, R1B is substituted with one or more first substituent groups denoted by R1B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R1B.1 substituent group is substituted, the R1B.1 substituent group is substituted with one or more second substituent groups denoted by R1B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R1B.2 substituent group is substituted, the R1B.2 substituent group is substituted with one or more third substituent groups denoted by R1B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R1B, R1B.1, R1B.2, and R1B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R1B, R1B.1, R1B.2, and R1B.3, respectively.
In embodiments, when R2A is substituted, R2A is substituted with one or more first substituent groups denoted by R2A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R2A.1 substituent group is substituted, the R2A.1 substituent group is substituted with one or more second substituent groups denoted by R2A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R2A.2 substituent group is substituted, the R2A.2 substituent group is substituted with one or more third substituent groups denoted by R2A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R2A, R2A.1, R2A.2, and R2A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R2A, R2A.1, R2A.2, and R2A.3, respectively.
In embodiments, when R2B is substituted, R2B is substituted with one or more first substituent groups denoted by R2B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R2B.1 substituent group is substituted, the R2B.1 substituent group is substituted with one or more second substituent groups denoted by R2B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R2B.2 substituent group is substituted, the R2B.2 substituent group is substituted with one or more third substituent groups denoted by R2B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R2B, R2B.1, R2B.2, and R2B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R2B, R2B.1, R2B.2, and R2B.3, respectively.
In embodiments, when R3A is substituted, R3A is substituted with one or more first substituent groups denoted by R3A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R3A.1 substituent group is substituted, the R3A.1 substituent group is substituted with one or more second substituent groups denoted by R3A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R3A.2 substituent group is substituted, the R3A.2 substituent group is substituted with one or more third substituent groups denoted by R3A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R3A, R3A.1, R3A.2, and R3A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW2, and RWW.3 correspond to R3A, R3A.1, R3A.2, and R3A.3, respectively.
In embodiments, when R3B is substituted, R3B is substituted with one or more first substituent groups denoted by R3B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R3B.1 substituent group is substituted, the R3B.1 substituent group is substituted with one or more second substituent groups denoted by R3B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R3B.2 substituent group is substituted, the R3B.2 substituent group is substituted with one or more third substituent groups denoted by R3B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R3B, R3B.1, R3B.2, and R3B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R3B, R3B.1, R3B.2, and R3B.3, respectively.
In embodiments, when R4A is substituted, R4A is substituted with one or more first substituent groups denoted by R4A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R4A.1 substituent group is substituted, the R4A.1 substituent group is substituted with one or more second substituent groups denoted by R4A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R4A.2 substituent group is substituted, the R4A.2 substituent group is substituted with one or more third substituent groups denoted by R4A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R4A, R4A.1, R4A.2, and R4A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R4A, R4A.1, R4A.2, and R4A.3, respectively.
In embodiments, when R4B is substituted, R4B is substituted with one or more first substituent groups denoted by R4B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R4B.1 substituent group is substituted, the R4B.1 substituent group is substituted with one or more second substituent groups denoted by R4B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R4B.2 substituent group is substituted, the R4B.2 substituent group is substituted with one or more third substituent groups denoted by R4B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R4B, R4B.1, R4B.2, and R4B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R4B, R4B.1, R4B.2, and R4B.3, respectively.
In embodiments, when R5A is substituted, R5A is substituted with one or more first substituent groups denoted by R5A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R5A.1 substituent group is substituted, the R5A.1 substituent group is substituted with one or more second substituent groups denoted by R5A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R5A.2 substituent group is substituted, the R5A.2 substituent group is substituted with one or more third substituent groups denoted by R5A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R5A, R5A.1, R5A.2, and R5A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R5A, R5A.1, R5A.2, and R5A.3, respectively.
In embodiments, when R5B is substituted, R5B is substituted with one or more first substituent groups denoted by R5B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R5B.1 substituent group is substituted, the R5B.1 substituent group is substituted with one or more second substituent groups denoted by R5B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R5B.2 substituent group is substituted, the R5B.2 substituent group is substituted with one or more third substituent groups denoted by R5B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R5B, R5B.1, R5B.2, and R5B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R5B, R5B.1, R5B.2, and R5B.3, respectively.
In embodiments, when R5E is substituted, R5E is substituted with one or more first substituent groups denoted by R5E.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R5E.1 substituent group is substituted, the R5E.1 substituent group is substituted with one or more second substituent groups denoted by R5E.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R5E.2 substituent group is substituted, the R5E.2 substituent group is substituted with one or more third substituent groups denoted by R5E3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R5E, R5E.1, R5E.2, and R5E3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R5E, R5E.1, R5E.2, and R5E.3, respectively.
In embodiments, when R6A is substituted, R6A is substituted with one or more first substituent groups denoted by R6A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R6A.1 substituent group is substituted, the R6A.1 substituent group is substituted with one or more second substituent groups denoted by R6A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R6A.2 substituent group is substituted, the R6A.2 substituent group is substituted with one or more third substituent groups denoted by R6A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R6A, R6A.1, R6A.2, and R6A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R6A, R6A.1, R6A.2, and R6A.3, respectively.
In embodiments, when R6B is substituted, R6B is substituted with one or more first substituent groups denoted by R6B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R6B.1 substituent group is substituted, the R6B.1 substituent group is substituted with one or more second substituent groups denoted by R6B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R6B.2 substituent group is substituted, the R6B.2 substituent group is substituted with one or more third substituent groups denoted by R6B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R6B, R6B.1, R6B.2, and R6B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R6B, R6B.1, R6B.2, and R6B.3, respectively.
In embodiments, when R7A is substituted, R7A is substituted with one or more first substituent groups denoted by R7A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R7A.1 substituent group is substituted, the R7A.1 substituent group is substituted with one or more second substituent groups denoted by R7A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R7A.2 substituent group is substituted, the R7A.2 substituent group is substituted with one or more third substituent groups denoted by R7A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R7A, R7A.1, R7A.2, and R7A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R7A, R7A.1, R7A.2, and R7A.3, respectively.
In embodiments, when R7B is substituted, R7B is substituted with one or more first substituent groups denoted by R7B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R7B.1 substituent group is substituted, the R7B.1 substituent group is substituted with one or more second substituent groups denoted by R7B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R7B.2 substituent group is substituted, the R7B.2 substituent group is substituted with one or more third substituent groups denoted by R7B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R7B, R7B.1, R7B.2, and R7B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R7B, R7B.1, R7B.2, and R7B.3, respectively.
In embodiments, when R8A is substituted, R8A is substituted with one or more first substituent groups denoted by R8A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R8A.1 substituent group is substituted, the R8A.1 substituent group is substituted with one or more second substituent groups denoted by R8A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R8A.2 substituent group is substituted, the R8A.2 substituent group is substituted with one or more third substituent groups denoted by R8A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R8A, R8A.1, R8A.2, and R8A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R8A, R8A.1, R8A.2, and R8A.3, respectively.
In embodiments, when R8B is substituted, R8B is substituted with one or more first substituent groups denoted by R8B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R8B.1 substituent group is substituted, the R8B.1 substituent group is substituted with one or more second substituent groups denoted by R8B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R8B.2 substituent group is substituted, the R8B.2 substituent group is substituted with one or more third substituent groups denoted by R8B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R8B, R8B.1, R8B.2, and R8B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R8B, R8B.1, R8B.2, and R8B.3, respectively.
In embodiments, when R9A is substituted, R9A is substituted with one or more first substituent groups denoted by R9A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R9A.1 substituent group is substituted, the R9A.1 substituent group is substituted with one or more second substituent groups denoted by R9A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R9A.2 substituent group is substituted, the R9A.2 substituent group is substituted with one or more third substituent groups denoted by R9A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R9A, R9A.1, R9A.2, and R9A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R9A, R9A.1, R9A.2, and R9A.3, respectively.
In embodiments, when R9B is substituted, R9B is substituted with one or more first substituent groups denoted by R9B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R9B.1 substituent group is substituted, the R9B.1 substituent group is substituted with one or more second substituent groups denoted by R9B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R9B.2 substituent group is substituted, the R9B.2 substituent group is substituted with one or more third substituent groups denoted by R9B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R9B, R9B.1, R9B.2, and R9B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R9B, R9B.1, R9B.2, and R9B.3, respectively.
In embodiments, when R10A is substituted, R10A is substituted with one or more first substituent groups denoted by R10A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R10A.1 substituent group is substituted, the R10A.1 substituent group is substituted with one or more second substituent groups denoted by R10A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R10A.2 substituent group is substituted, the R10A.2 substituent group is substituted with one or more third substituent groups denoted by R10A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R10A, R10A.1, R10A.2, and R10A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R10A, R10A.1, R10A.2 and R10A.3 respectively.
In embodiments, when R10B is substituted, R10B is substituted with one or more first substituent groups denoted by R10B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R10B.1 substituent group is substituted, the R10B.1 substituent group is substituted with one or more second substituent groups denoted by R10B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R10B.2 substituent group is substituted, the R10B.2 substituent group is substituted with one or more third substituent groups denoted by R10B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R10B, R10B.1, R10B.2, and R10B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R10B, R10B.1, R10B.2 and R10B.3 respectively.
In embodiments, when R11A is substituted, R11A is substituted with one or more first substituent groups denoted by R11A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R11A.1 substituent group is substituted, the R11A.1 substituent group is substituted with one or more second substituent groups denoted by R11A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R11A.2 substituent group is substituted, the R11A.2 substituent group is substituted with one or more third substituent groups denoted by R11A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R11A, R11A.1, R11A.2, and R11A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R11A, R11A.1R11A.2 and R11A.3, respectively.
In embodiments, when R11B is substituted, R11B is substituted with one or more first substituent groups denoted by R11B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R11B.1 substituent group is substituted, the R11B.1 substituent group is substituted with one or more second substituent groups denoted by R11B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R11B.2 substituent group is substituted, the R11B.2 substituent group is substituted with one or more third substituent groups denoted by R11B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R11B, R1B.1, R11B.2, and R11B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R11B, R11B.1, R11B.2 and R11B.3 respectively.
In embodiments, when R12A is substituted, R12A is substituted with one or more first substituent groups denoted by R12A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R12A.1 substituent group is substituted, the R12A.1 substituent group is substituted with one or more second substituent groups denoted by R12A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R12A.2 substituent group is substituted, the R12A.2 substituent group is substituted with one or more third substituent groups denoted by R12A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R12A, R12A.1, R12A.2, and R12A.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R12A, R12A.1, R12A.2 and R12A.3 respectively.
In embodiments, when R12B is substituted, R12B is substituted with one or more first substituent groups denoted by R12B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R12B.1 substituent group is substituted, the R12B.1 substituent group is substituted with one or more second substituent groups denoted by R12B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R12B.2 substituent group is substituted, the R12B.2 substituent group is substituted with one or more third substituent groups denoted by R12B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R12B, R12B.1, R12B.2, and R12B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R12B, R12B.1, R12B.2 and R12B.3 respectively.
In embodiments, when R13B is substituted, R13B is substituted with one or more first substituent groups denoted by R13B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R13B.1 substituent group is substituted, the R13B.1 substituent group is substituted with one or more second substituent groups denoted by R13B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R13B.2 substituent group is substituted, the R13B.2 substituent group is substituted with one or more third substituent groups denoted by R13B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R13B, R13B.1, R13B.2, and R13B.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R13B, R13B.1, R13B.2 and R13B.3 respectively.
In embodiments, when R13E is substituted, R13E is substituted with one or more first substituent groups denoted by R13E.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R13E.1 substituent group is substituted, the R13E.1 substituent group is substituted with one or more second substituent groups denoted by R13E.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R13E.2 substituent group is substituted, the R13E.2 substituent group is substituted with one or more third substituent groups denoted by R13E.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R13E, R13E.1, R13E.2, and R13E.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW.2, and RWW.3 correspond to R13E, R13E.1, R13E.2 and R13E.3 respectively.
In embodiments, when R17 is substituted, R17 is substituted with one or more first substituent groups denoted by R17.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R17.1 substituent group is substituted, the R17.1 substituent group is substituted with one or more second substituent groups denoted by R17.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an R17.2 substituent group is substituted, the R17.2 substituent group is substituted with one or more third substituent groups denoted by R17.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, R17, R1?1, R17.2, and R17.3 have values corresponding to the values of RWW, RWW.1, RWW.2, and RWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein RWW, RWW.1, RWW2, and RWW.3 correspond to R17, R17.1, R17.2, and R17.3, respectively.
In embodiments, when L1A is substituted, L1A is substituted with one or more first substituent groups denoted by RL1A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL1A.1 substituent group is substituted, the RL1A.1 substituent group is substituted with one or more second substituent groups denoted by RL1A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL1A.2 substituent group is substituted, the RL1A.2 substituent group is substituted with one or more third substituent groups denoted by RL1A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L1A, RL1A.1, RL1A.2, and RL1A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L1A, RL1A.1, RL1A.2, and RL1A.3, respectively.
In embodiments, when L1B is substituted, L1B is substituted with one or more first substituent groups denoted by RL1B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL1B.1 substituent group is substituted, the RL1B.1 substituent group is substituted with one or more second substituent groups denoted by RL1B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL1B.2 substituent group is substituted, the RL1B.2 substituent group is substituted with one or more third substituent groups denoted by RL1B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L1B, RLB.1, RL1B.2, and RL1B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L1B, RL1B.1, RL1B.2, and RL1B.3, respectively.
In embodiments, when L2A is substituted, L2A is substituted with one or more first substituent groups denoted by RL2A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL2A.1 substituent group is substituted, the RL2A.1 substituent group is substituted with one or more second substituent groups denoted by RL2A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL2A.2 substituent group is substituted, the RL2A.2 substituent group is substituted with one or more third substituent groups denoted by RL2A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L2A, RL2A.1, RL2A.2, and RL2A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L2A, RL2A.1, RL2A.2, and RL2A.3, respectively.
In embodiments, when L2B is substituted, L2B is substituted with one or more first substituent groups denoted by RL2B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL2B.1 substituent group is substituted, the RL2B.1 substituent group is substituted with one or more second substituent groups denoted by RL2B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL2B.2 substituent group is substituted, the RL2B.2 substituent group is substituted with one or more third substituent groups denoted by RL2B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L2B, RL2B.1, RL2B.2, and RL2B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L2B, RL2B.1, RL2B.2, and RL2B.3, respectively.
In embodiments, when L3A is substituted, L3A is substituted with one or more first substituent groups denoted by RL3A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL3A.1 substituent group is substituted, the RL3A.1 substituent group is substituted with one or more second substituent groups denoted by RL3A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL3A.2 substituent group is substituted, the RL3A.2 substituent group is substituted with one or more third substituent groups denoted by RL3A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L3A, RL3A.1, RL3A.2, and RL3A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L3A, RL3A.1, RL3A.2, and RL3A.3, respectively.
In embodiments, when L3B is substituted, L3B is substituted with one or more first substituent groups denoted by RL3B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL3B.1 substituent group is substituted, the RL3B.1 substituent group is substituted with one or more second substituent groups denoted by RL3B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL3B.2 substituent group is substituted, the RL3B.2 substituent group is substituted with one or more third substituent groups denoted by RL3B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L3B, RL3B.1, RL3B.2, and RL3B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L3B, RL3B.1, RL3B.2, and RL3B.3, respectively.
In embodiments, when L4A is substituted, L4A is substituted with one or more first substituent groups denoted by RL4A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL4A.1 substituent group is substituted, the RL4A.1 substituent group is substituted with one or more second substituent groups denoted by RL4A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL4A.2 substituent group is substituted, the RL4A.2 substituent group is substituted with one or more third substituent groups denoted by RL4A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L4A, RL4A.1, RL4A.2, and RL4A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L4A, RL4A.1, RL4A.2, and RL4A.3, respectively.
In embodiments, when L4B is substituted, L4B is substituted with one or more first substituent groups denoted by RL4B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL4B.1 substituent group is substituted, the RL4B.1 substituent group is substituted with one or more second substituent groups denoted by RL4B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL4B.2 substituent group is substituted, the RL4B.2 substituent group is substituted with one or more third substituent groups denoted by RL4B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L4B, RL4B.1, RL4B.2, and RL4B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L4B, RL4B.1, RL4B.2, and RL4B.3, respectively.
In embodiments, when L5A is substituted, L5A is substituted with one or more first substituent groups denoted by RL5A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL5A.1 substituent group is substituted, the RL5A.1 substituent group is substituted with one or more second substituent groups denoted by RL5A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL5A.2 substituent group is substituted, the RL5A.2 substituent group is substituted with one or more third substituent groups denoted by RL5A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L5A, RL5A.1, RL5A.2, and RL5A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L5A, RL5A.1, RL5A.2, and RL5A.3, respectively.
In embodiments, when L5B is substituted, L5B is substituted with one or more first substituent groups denoted by RL5B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL5B.1 substituent group is substituted, the RL5B.1 substituent group is substituted with one or more second substituent groups denoted by RL5B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL5B.2 substituent group is substituted, the RL5B.2 substituent group is substituted with one or more third substituent groups denoted by RL5B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L5B, RL5B.1, RL5B.2, and RL5B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L5B, RL5B.1, RL5B.2, and RL5B.3, respectively.
In embodiments, when L6A is substituted, L6A is substituted with one or more first substituent groups denoted by RL6A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL6A.1 substituent group is substituted, the RL6A.1 substituent group is substituted with one or more second substituent groups denoted by RL6A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL6A.2 substituent group is substituted, the RL6A.2 substituent group is substituted with one or more third substituent groups denoted by RL6A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L6A, RL6A.1, RL6A.2, and RL6A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L6A, RL6A.1, RL6A.2, and RL6A.3, respectively.
In embodiments, when L6B is substituted, L6B is substituted with one or more first substituent groups denoted by RL6B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL6B.1 substituent group is substituted, the RL6B.1 substituent group is substituted with one or more second substituent groups denoted by RL6B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL6B.2 substituent group is substituted, the RL6B.2 substituent group is substituted with one or more third substituent groups denoted by RL6B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L6B, RL6B.1, RL6B.2, and RL6B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L6B, RL6B.1, RL6B.2, and RL6B.3, respectively.
In embodiments, when L7A is substituted, L7A is substituted with one or more first substituent groups denoted by RL7A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL7A.1 substituent group is substituted, the RL7A.1 substituent group is substituted with one or more second substituent groups denoted by RL7A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL7A.2 substituent group is substituted, the RL7A.2 substituent group is substituted with one or more third substituent groups denoted by RL7A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L7A, RL7A.1, RL7A.2, and RL7A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L7A, RL7A.1, RL7A.2, and RL7A.3, respectively.
In embodiments, when L7B is substituted, L7B is substituted with one or more first substituent groups denoted by RL7B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL7B.1 substituent group is substituted, the RL7B.1 substituent group is substituted with one or more second substituent groups denoted by RL7B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL7B.2 substituent group is substituted, the RL7B.2 substituent group is substituted with one or more third substituent groups denoted by RL7B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L7B, RL7B.1, RL7B.2, and RL7B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L7B, RL7B.1, RL7B.2, and RL7B.3, respectively.
In embodiments, when L8A is substituted, L8A is substituted with one or more first substituent groups denoted by RL8A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL8A.1 substituent group is substituted, the RL8A.1 substituent group is substituted with one or more second substituent groups denoted by RL8A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL8A.2 substituent group is substituted, the RL8A.2 substituent group is substituted with one or more third substituent groups denoted by RL8A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L8A, RLA.1, RLA.2, and RL8A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L8A, RLA.1, RLA.2, and RLA.3, respectively.
In embodiments, when L8B is substituted, L8B is substituted with one or more first substituent groups denoted by RLB.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL8B.1 substituent group is substituted, the RL8B.1 substituent group is substituted with one or more second substituent groups denoted by RL8B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL8B.2 substituent group is substituted, the RL8B.2 substituent group is substituted with one or more third substituent groups denoted by RL8B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L8B, RL8B.1, RL8B.2, and RL8B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L8B, RL8B.1, RL8B.2, and RL8B.3, respectively.
In embodiments, when L9A is substituted, L9A is substituted with one or more first substituent groups denoted by RL9A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL9A.1 substituent group is substituted, the RL9A.1 substituent group is substituted with one or more second substituent groups denoted by RL9A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL9A.2 substituent group is substituted, the RL9A.2 substituent group is substituted with one or more third substituent groups denoted by RL9A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L9A, RL9A.1, RL9A.2, and RL9A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L9A, RL9A.1, RL9A.2, and RL9A.3, respectively.
In embodiments, when L9B is substituted, L9B is substituted with one or more first substituent groups denoted by RL9B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL9B.1 substituent group is substituted, the RL9B.1 substituent group is substituted with one or more second substituent groups denoted by RL9B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL9B.2 substituent group is substituted, the RL9B.2 substituent group is substituted with one or more third substituent groups denoted by RL9B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L9B, RL9B.1, RL9B.2, and RL9B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L9B, RL9B.1, RL9B.2, and RL9B.3, respectively.
In embodiments, when L10A is substituted, L10A is substituted with one or more first substituent groups denoted by RL10A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL10A.1 substituent group is substituted, the RL10A.1 substituent group is substituted with one or more second substituent groups denoted by RL10A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL10A.2 substituent group is substituted, the RL10A.2 substituent group is substituted with one or more third substituent groups denoted by RL10A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L10A, RL10A.1, RL10A.2 and RL10A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L10A, RL10A.1, RL10A.2 and RL10A.3, respectively.
In embodiments, when L10B is substituted, L10B is substituted with one or more first substituent groups denoted by RL10B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL10B.1 substituent group is substituted, the RL10B.1 substituent group is substituted with one or more second substituent groups denoted by RL10B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL10B.2 substituent group is substituted, the RL10B.2 substituent group is substituted with one or more third substituent groups denoted by RL10B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L10B, RL10B.1, RL10B.2 and RL10B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L10B, RL10B.1, RL10B.2 and RL10B.3, respectively.
In embodiments, when L11A is substituted, L11A is substituted with one or more first substituent groups denoted by RL11A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL11A.1 substituent group is substituted, the RL11A.1 substituent group is substituted with one or more second substituent groups denoted by RL11A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL11A.2 substituent group is substituted, the RL11A.2 substituent group is substituted with one or more third substituent groups denoted by RL11A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L11A, RL11A.1, RL11A.2 and RL11A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L11A, RL11A.1, RL11A.2 and RL11A.3, respectively.
In embodiments, when L11B is substituted, L11B is substituted with one or more first substituent groups denoted by RL11B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL11B.1 substituent group is substituted, the RL11B.1 substituent group is substituted with one or more second substituent groups denoted by RL11B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL11B.2 substituent group is substituted, the RL11B.2 substituent group is substituted with one or more third substituent groups denoted by RL11B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L11B, RL11B.1, RL11B.2 and RL11B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L11B, RL11B.1, RL11B.2 and RL11B.3, respectively.
In embodiments, when L12A is substituted, L12A is substituted with one or more first substituent groups denoted by RL12A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL12A.1 substituent group is substituted, the RL12A.1 substituent group is substituted with one or more second substituent groups denoted by RL12A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL12A.2 substituent group is substituted, the RL12A.2 substituent group is substituted with one or more third substituent groups denoted by RL12A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L12A, RL12A.1, RL12A.2 and RL12A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L12A, RL12A.1, RL12A.2 and RL12A.3, respectively.
In embodiments, when L12B is substituted, L12B is substituted with one or more first substituent groups denoted by RL12B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL12B.1 substituent group is substituted, the RL12B.1 substituent group is substituted with one or more second substituent groups denoted by RL12B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL12B.2 substituent group is substituted, the RL12B.2 substituent group is substituted with one or more third substituent groups denoted by RL12B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L12B, RL12B.1, RL12B.2 and RL12B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L12B, RL12B.1, RL12B.2 and RL12B.3, respectively.
In embodiments, when L13B is substituted, L13B is substituted with one or more first substituent groups denoted by RL13B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL13B.1 substituent group is substituted, the RL13B.1 substituent group is substituted with one or more second substituent groups denoted by RL13B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL13B.2 substituent group is substituted, the RL13B.2 substituent group is substituted with one or more third substituent groups denoted by RL13B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L13B, RL13B.1, RL13B.2 and RL13B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L13B, RL13B.1, RL13B.2 and RL13B.3, respectively.
In embodiments, when L16 is substituted, L16 is substituted with one or more first substituent groups denoted by RL16.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16.1 substituent group is substituted, the RL16.1 substituent group is substituted with one or more second substituent groups denoted by RL16.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16.2 substituent group is substituted, the RL16.2 substituent group is substituted with one or more third substituent groups denoted by RL16.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L16, RL16.1, RL16.2, and RL16.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L16, RL16.1, RL16.2, and RL16.3, respectively.
In embodiments, when L16A is substituted, L16A is substituted with one or more first substituent groups denoted by RL16A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16A.1 substituent group is substituted, the RL16A.1 substituent group is substituted with one or more second substituent groups denoted by RL16A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16A.2 substituent group is substituted, the RL16A.2 substituent group is substituted with one or more third substituent groups denoted by RL16A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L16A, RL16A.1, RL16A.2 and RL16A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L16A, RL16A.1, RL16A.2 and RL16A.3, respectively.
In embodiments, when L16B is substituted, L16B is substituted with one or more first substituent groups denoted by RL16B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16B.1 substituent group is substituted, the RL16B.1 substituent group is substituted with one or more second substituent groups denoted by RL16B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16B.2 substituent group is substituted, the RL16B.2 substituent group is substituted with one or more third substituent groups denoted by RL16B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L16B, RL16B.1, RL16B.2 and RL16B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L16B, RL16B.1, RL16B.2 and RL16B.3, respectively.
In embodiments, when L16C is substituted, L16C is substituted with one or more first substituent groups denoted by RL16C.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16C.1 substituent group is substituted, the RL16C.1 substituent group is substituted with one or more second substituent groups denoted by RL16C.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16C.2 substituent group is substituted, the RL16C.2 substituent group is substituted with one or more third substituent groups denoted by RL16C.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L16C, RL16C.1, RL16C.2 and RL16C.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L16C, RL16C.1, RL16C.2 and RL16C.1, respectively.
In embodiments, when L16D is substituted, L16D is substituted with one or more first substituent groups denoted by RL16D.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16D.1 substituent group is substituted, the RL16D.1 substituent group is substituted with one or more second substituent groups denoted by RL16D.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16D.2 substituent group is substituted, the RL16D.2 substituent group is substituted with one or more third substituent groups denoted by RL16D.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L16D, RL16D.1, RL16D.2 and RL16D.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L16D, RL16D.1, RL16D.2 and RL16D.3, respectively.
In embodiments, when L16E is substituted, L16E is substituted with one or more first substituent groups denoted by RL16E.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16E.1 substituent group is substituted, the RL16E.1 substituent group is substituted with one or more second substituent groups denoted by RL16E.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16E.2 substituent group is substituted, the RL16E.2 substituent group is substituted with one or more third substituent groups denoted by RL16E.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L16E, RL16E.1, RL16E.2 and RL16E.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L16E, RL16E.1, RL16E.2 and RL16E.3, respectively.
In embodiments, when L16F is substituted, L16F is substituted with one or more first substituent groups denoted by RL16F.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16F.1 substituent group is substituted, the RL16F.1 substituent group is substituted with one or more second substituent groups denoted by RL16F.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL16F.2 substituent group is substituted, the RL16F.2 substituent group is substituted with one or more third substituent groups denoted by RL16F.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L16F, RL16F.1, RL16F.2, and RL16F.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L16F, RL16F.1, RL16F.2 and RL16F.3 respectively.
In embodiments, when L17A is substituted, L17A is substituted with one or more first substituent groups denoted by RL17A.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17A.1 substituent group is substituted, the RL17A.1 substituent group is substituted with one or more second substituent groups denoted by RL17A.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17A.2 substituent group is substituted, the RL17A.2 substituent group is substituted with one or more third substituent groups denoted by RL17A.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L17A, RL17A.1, RL17A.2 and RL17A.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L17A, RL17A.1, RL17A.2 and RL17A.3, respectively.
In embodiments, when L17B, is substituted, L17B, is substituted with one or more first substituent groups denoted by RL17B.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17B.1 substituent group is substituted, the RL17B.1 substituent group is substituted with one or more second substituent groups denoted by RL17B.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17B.2 substituent group is substituted, the RL17B.2 substituent group is substituted with one or more third substituent groups denoted by RL17B.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L17B, RL17B.1, RL17B.2 and RL17B.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L17B, RL17B.1, RL17B.2 and RL17B.3, respectively.
In embodiments, when L17C is substituted, L17C is substituted with one or more first substituent groups denoted by RL17C.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL7C.1 substituent group is substituted, the RL17C.1 substituent group is substituted with one or more second substituent groups denoted by RL17C.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17C.2 substituent group is substituted, the RL17C.2 substituent group is substituted with one or more third substituent groups denoted by RL17C.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L17C, RL17C.1, RL17C.2 and RL17C.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L17C, RL17C.1, RL17C.2 and RL17C.3, respectively.
In embodiments, when L17D is substituted, L17D is substituted with one or more first substituent groups denoted by RL17D.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17D.1 substituent group is substituted, the RL17D.1 substituent group is substituted with one or more second substituent groups denoted by RL17D.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17D.2 substituent group is substituted, the RL17D.2 substituent group is substituted with one or more third substituent groups denoted by RL17D.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L17D, RL17D.1, RL17D.2 and RL17D.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L17D, RL17D.1, RL17D.2 and RL17D.3, respectively.
In embodiments, when L17E is substituted, L17E is substituted with one or more first substituent groups denoted by RL17E.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17E.1 substituent group is substituted, the RL17E.1 substituent group is substituted with one or more second substituent groups denoted by RL17E.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17E.2 substituent group is substituted, the RL17E.2 substituent group is substituted with one or more third substituent groups denoted by RL17E.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L17E, RL17E.1, RL17E.2 and RL17E.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3 respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L17E, RL17E.1, RL17E.2 and RL17E.3 respectively.
In embodiments, when L17F is substituted, L17F is substituted with one or more first substituent groups denoted by RL17F.1 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17F.1 substituent group is substituted, the RL17F.1 substituent group is substituted with one or more second substituent groups denoted by RL17F.2 as explained in the definitions section above in the description of “first substituent group(s)”. In embodiments, when an RL17F.2 substituent group is substituted, the RL17F.2 substituent group is substituted with one or more third substituent groups denoted by RL17F.3 as explained in the definitions section above in the description of “first substituent group(s)”. In the above embodiments, L17F, RL17F.1, RL17F.2, and RL17F.3 have values corresponding to the values of LWW, RLWW.1, RLWW.2, and RLWW.3, respectively, as explained in the definitions section above in the description of “first substituent group(s)”, wherein LWW, RLWW.1, RLWW.2, and RLWW.3 are L17F, RL17F.1, RL17F.2 and RL17F.3 respectively.
In embodiments, the compound contacts the Switch 2 region of human Gαs protein. In embodiments, the human Gαs protein is a human Gαs wildtype protein, a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein. In embodiments, the human Gαs protein is a human Gαs wildtype protein. In embodiments, the human Gαs protein is a human Gαs R201C protein. In embodiments, the human Gαs protein is a human Gαs R201H protein. In embodiments, the human Gαs protein is a human Gαs R201S protein. In embodiments, the human Gαs protein is a human Gαs R201L protein. In embodiments, the human Gαs protein is a human Gαs Q227R protein. In embodiments, the human Gαs protein is a human Gαs Q227H protein. In embodiments, the human Gαs protein is a human Gαs Q227K protein. In embodiments, the human Gαs protein is a human Gαs Q227E protein. In embodiments, the human Gαs protein is a human Gαs Q227L protein.
In embodiments, the compound binds a human Gαs wildtype protein more strongly than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions. In embodiments, the compound binds a human Gαs wildtype protein at least 2-fold stronger than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions. In embodiments, the compound binds a human Gαs wildtype protein at least 5-fold stronger than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions. In embodiments, the compound binds a human Gαs wildtype protein at least 10-fold stronger than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions. In embodiments, the compound binds a human Gαs wildtype protein at least 20-fold stronger than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions. In embodiments, the compound binds a human Gαs wildtype protein at least 40-fold stronger than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions. In embodiments, the compound binds a human Gαs wildtype protein at least 60-fold stronger than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions. In embodiments, the compound binds a human Gαs wildtype protein at least 80-fold stronger than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions. In embodiments, the compound binds a human Gαs wildtype protein at least 100-fold stronger than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions. In embodiments, the compound binds a human Gαs wildtype protein at least 500-fold stronger than the compound binds a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein under identical conditions.
In embodiments, the compound is useful as a comparator compound. In embodiments, the comparator compound can be used to assess the activity of a test compound as set forth in an assay described herein (e.g., in the examples section, figures, or tables).
In embodiments, the compound is a compound as described herein, including in embodiments. In embodiments the compound is a compound described herein (e.g., in the examples section, figures, tables, or claims).
In an aspect is provided a pharmaceutical composition including a compound described herein, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
In embodiments, the pharmaceutical composition includes an effective amount of the compound. In embodiments, the pharmaceutical composition includes a therapeutically effective amount of the compound.
In embodiments, the pharmaceutical composition includes an effective amount of a second agent, wherein the second agent is an anti-cancer agent. In embodiments, the anti-cancer agent is a MEK inhibitor (e.g., XL518, CI-1040, PD035901, selumetinib/AZD6244, GSK1120212/trametinib, GDC-0973, ARRY-162, ARRY-300, AZD8330, PD0325901, U0126, PD98059, TAK-733, PD318088, AS703026, or BAY 869766) or an EGFR inhibitor (e.g., gefitinib (Iressa™), erlotinib (Tarceva™), cetuximab (Erbitux™), lapatinib (Tykerb™) panitumumab (Vectibix™), vandetanib (Caprelsa™), afatinib/BIBW2992, CI-1033/canertinib, neratinib/HKI-272, CP-724714, TAK-285, AST-1306, ARRY334543, ARRY-380, AG-1478, dacomitinib/PF299804, OSI-420/desmethyl erlotinib, AZD8931, AEE788, pelitinib/EKB-569, CUDC-101, WZ8040, WZ4002, WZ3146, AG-490, XL647, PD153035, or BMS—599626).
The pharmaceutical composition may include compositions wherein the active ingredient is contained in a therapeutically effective amount, i.e., in an amount effective to achieve its intended purpose. The actual amount effective for a particular application will depend, inter alia, on the condition being treated.
The dosage and frequency (single or multiple doses) of compounds administered can vary depending upon a variety of factors, including route of administration; size, age, sex, health, body weight, body mass index, and diet of the recipient; nature and extent of symptoms of the disease being treated; presence of other diseases or other health-related problems; kind of concurrent treatment; and complications from any disease or treatment regimen. Other therapeutic regimens or agents can be used in conjunction with the methods and compounds disclosed herein.
As is well known in the art, therapeutically effective amounts for use in humans can also be determined from animal models. For example, a dose for humans can be formulated to achieve a concentration that has been found to be effective in animals. The dosage in humans can be adjusted by monitoring compounds effectiveness and adjusting the dosage upwards or downwards, as described above. Adjusting the dose to achieve maximal efficacy in humans based on the methods described above and other methods is well within the capabilities of the ordinarily skilled artisan.
Dosages may be varied depending upon the requirements of the subject and the compound being employed. The dose administered to a subject, in the context of the pharmaceutical compositions presented herein, should be sufficient to effect a beneficial therapeutic response in the subject over time. The size of the dose also will be determined by the existence, nature, and extent of any adverse side effects. Generally, treatment is initiated with smaller dosages, which are less than the optimum dose of the compound. Thereafter, the dosage is increased by small increments until the optimum effect under circumstances is reached.
Dosage amounts and intervals can be adjusted individually to provide levels of the administered compounds effective for the particular clinical indication being treated. This will provide a therapeutic regimen that is commensurate with the severity of the individual's disease state.
Utilizing the teachings provided herein, an effective prophylactic or therapeutic treatment regimen can be planned that does not cause substantial toxicity and yet is entirely effective to treat the clinical symptoms demonstrated by the particular patient. This planning should involve the careful choice of active compound by considering factors such as compound potency, relative bioavailability, patient body weight, presence and severity of adverse side effects, preferred mode of administration, and the toxicity profile of the selected agent.
In an aspect is provided a method of treating a cancer in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient.
In embodiments, the patient is a human. In embodiments, the cancer is selected from human cancers and carcinomas, sarcomas, adenocarcinomas, lymphomas, leukemias, and the like. In embodiments, the cancer is a solid cancer or tumor. In embodiments, the cancer is pancreatic cancer. In embodiments, the cancer is a pituitary tumor. In embodiments, the cancer is a bone tumor. In embodiments, the cancer is pancreatic cancer, pituitary cancer, or bone cancer.
In an aspect is provided a method of treating a bone condition in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient.
In embodiments, the patient is a human. In embodiments, the bone condition is fibrous dysplasia. In embodiments, the fibrous dysplasia is monostotic fibrous dysplasia or polystotic fibrous dysplasia. In embodiments, the fibrous dysplasia is monostotic fibrous dysplasia. In embodiments, the fibrous dysplasia is polystotic fibrous dysplasia.
In an aspect is provided a method of treating McCune-Albright syndrome in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient. In embodiments, the patient is a human.
In an aspect is provided a method of treating cholera in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient. In embodiments, the patient is a human.
In an aspect is provided a method of treating a G protein-associated disease in a patient in need of such treatment, the method including administering a therapeutically effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof, to the patient.
In embodiments, the patient is a human. In embodiments, the G protein-associated disease is fibrous dysplasia. In embodiments, the fibrous dysplasia is monostotic fibrous dysplasia or polystotic fibrous dysplasia. In embodiments, the fibrous dysplasia is monostotic fibrous dysplasia. In embodiments, the fibrous dysplasia is polystotic fibrous dysplasia. In embodiments, the G protein-associated disease is McCune-Albright syndrome.
In an aspect is provided a method of modulating (e.g., reducing) the activity of a human Gαs protein, the method including contacting the human Gαs protein with an effective amount of a compound described herein, or a pharmaceutically acceptable salt thereof. In embodiments, the activity of Gαs is reduced by about 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold relative to a control (e.g., absence of the compound). In embodiments, the activity of Gαs is reduced by at least 1.5-, 2-, 3-, 4-, 5-, 6-, 7-, 8-, 9-, 10-, 15-, 20-, 25-, 30-, 35-, 40-, 45-, 50-, 60-, 70-, 80-, 90-, 100-, 150-, 200-, 250-, 300-, 350-, 400-, 450-, 500-, 600-, 700-, 800-, 900-, or 1000-fold relative to a control (e.g., absence of the compound).
In embodiments, the human Gαs protein is a human Gαs wildtype protein, a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs R201S protein, a human Gαs R201L protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein. In embodiments, the human Gαs protein is a human Gαs wildtype protein. In embodiments, the human Gαs protein is a human Gαs R201C protein. In embodiments, the human Gαs protein is a human Gαs R201H protein. In embodiments, the human Gαs protein is a human Gαs Q227R protein. In embodiments, the human Gαs protein is a human Gαs Q227H protein. In embodiments, the human Gαs protein is a human Gαs Q227K protein. In embodiments, the human Gαs protein is a human Gαs Q227E protein. In embodiments, the human Gαs protein is a human Gαs Q227L protein.
In embodiments, the human Gαs protein includes an R201 mutation. In embodiments, the human Gαs protein includes a R201C mutation. In embodiments, the human Gαs protein includes a R201H mutation. In embodiments, the human Gαs protein includes a R201S mutation. In embodiments, the human Gαs protein includes a R201L mutation. In embodiments, the human Gαs protein includes a Q227 mutation. In embodiments, the human Gαs protein includes a Q227R mutation. In embodiments, the human Gαs protein includes a Q227H mutation. In embodiments, the human Gαs protein includes a Q227K mutation. In embodiments, the human Gαs protein includes a Q227E mutation. In embodiments, the human Gαs protein includes a Q227L mutation.
In embodiments, the activity of the human Gαs protein is GTPase activity or cellular signaling. In embodiments, the activity of the human Gαs protein is GTPase activity. In embodiments, the activity of the human Gαs protein is cellular signaling.
Embodiment P1. A compound having the formula:
or a pharmaceutically acceptable salt thereof; wherein
Embodiment P2. The compound of embodiment P1, having the formula:
Embodiment P3. The compound of embodiment P2, having the formula:
Embodiment P4. The compound of embodiment P1, having the formula:
Embodiment P5. The compound of embodiment P4, having the formula:
Embodiment P6. The compound of embodiment P5, having the formula:
Embodiment P7. The compound of one of embodiments P1 to P6, wherein -L1A-R1A-L2A-R2A-L3A-R3A-L4A-R4A-L5A-R5A-L6A-R6A-L7A,-R7A-L8A-R8A, -L9A-R9A-L10A-R10A-L11A-R11A, or -L12A-R12A are independently a natural amino acid side chain or an unnatural amino acid side chain.
Embodiment P8. The compound of embodiment P7, wherein -L1A-R1A-L2A-R2A-L3A-R3A-L4A-R4A-L5A-R5A-L6A-R6A-L7A,-R7A-L8A-R8A-L9A-R9A-L10A-R10A-L11A-R11A or -L12A-R12A are independently a natural amino acid side chain.
Embodiment P9. The compound of embodiment P1, having the formula:
Embodiment P10. The compound of one of embodiments P1 to P9, wherein L16 is a bioconjugate linker.
Embodiment P11. The compound of one of embodiments P1 to P9, wherein L16 is a substituted or unsubstituted divalent amino acid.
Embodiment P12. The compound of one of embodiments P1 to P9, wherein L16 is -L16A-L16B-L16C-L16D-L16E-L16F-; and L16A, L16B, L16C, L16D, L16E and L16F are independently bond, —SS—, —S(O)2—, —OS(O)2—, —S(O)2O—, —NH—, —O—, —S—, —C(O)—, —NHS(O)2—, —S(O)2NH—, —C(O)NH—, —NHC(O)—, —NHC(O)NH—, —NHC(NH)NH—, —C(O)O—, —OC(O)—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene.
Embodiment P13. The compound of embodiment P12, wherein L16 is —NH-L16B-L16C-L16D-L16E-C(O)—;
L16C, L16D, and L16E are independently bond, —SS—, —S(O)2—, —OS(O)2—, —S(O)2O—, —NH—, —O—, —S—, —C(O)—, —NHS(O)2—, —S(O)2NH—, —C(O)NH—, —NHC(O)—, —NHC(O)NH—, —NHC(NH)NH—, —C(O)O—, —OC(O)—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene;
Embodiment P14. The compound of embodiment P12, wherein L16 is a bond,
Embodiment P15. The compound of embodiment P12, wherein L16 is a bond,
Embodiment P16. The compound of embodiment P1, having the formula:
wherein
Embodiment P17. The compound of embodiment P1, having the formula:
Embodiment P18. The compound of one of embodiments P1 to P17, wherein said compound binds a human Gαs protein-GTP complex more strongly than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment P19. The compound of embodiment P18, wherein said compound binds a human Gαs protein-GTP complex at least 2-fold stronger than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment P20. The compound of embodiment P18, wherein said compound binds a human Gαs protein-GTP complex at least 5-fold stronger than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment P21. The compound of embodiment P18, wherein said compound binds a human Gαs protein-GTP complex at least 40-fold stronger than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment P22. The compound of embodiment P18, wherein said compound binds a human Gαs protein-GTP complex at least 100-fold stronger than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment P23. A compound having the formula:
or a pharmaceutically acceptable salt thereof; wherein
Embodiment P24. The compound of embodiment P23, wherein -L1B-R1B-L2B-R2B-L3B-R3B-L4B-R4B-L5B-R5B-L6B-R6B-L7B-R7B-L8B-R8B-L9B-R9B-L10B-R10B-L11B-R11B-L12B-R12B or -L13B-R13B are independently a natural amino acid side chain or an unnatural amino acid side chain.
Embodiment P25. The compound of embodiment P24, wherein -L1B-R1B-L2B-R2B-L3B-R3B-L4B-R4B-L5B-R5B-L6B-R6B-L7B-R7B, -L8B-R8B-L9B-R9B-L10B-R10B-L11B-R11B-L12B-R12B or -L13B-R13B are independently a natural amino acid side chain.
Embodiment P26. The compound of embodiment P23, having the formula:
Embodiment P27. The compound of embodiment P26, having the formula.
Embodiment P28. The compound of embodiment P27, having the formula:
Embodiment P29. The compound of one of embodiments P23 to P28, wherein L16 is a bioconjugate linker.
Embodiment P30. The compound of one of embodiments P23 to P28, wherein L16 is a substituted or unsubstituted divalent amino acid.
Embodiment P31. The compound of one of embodiments P23 to P28, wherein L16 is -L6A-L16B-L16C-L16D-L16E-L16F-; and L16A, L16B, L16C, L16D, L16E and L16F are independently bond, —SS—, —S(O)2—, —OS(O)2—, —S(O)2O—, —NH—, —O—, —S—, —C(O)—, —NHS(O)2—, —S(O)2NH—, —C(O)NH—, —NHC(O)—, —NHC(O)NH—, —NHC(NH)NH—, —C(O)O—, —OC(O)—, substituted or unsubstituted alkylene, substituted or unsubstituted heteroalkylene, substituted or unsubstituted cycloalkylene, substituted or unsubstituted heterocycloalkylene, substituted or unsubstituted arylene, or substituted or unsubstituted heteroarylene.
Embodiment P32. The compound of embodiment P31, wherein
Embodiment P33. The compound of embodiment P31, wherein L16 is a bond,
Embodiment P34. The compound of embodiment P31, wherein L16 is a bond,
Embodiment P35. The compound of embodiment P23, having the formula:
Embodiment P36. The compound of embodiment P23, having the formula:
Embodiment P37. The compound of one of embodiments P23 to P36, wherein said compound binds a human Gαs protein-GDP complex more strongly than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment P38. The compound of embodiment P37, wherein said compound binds a human Gαs protein-GDP complex at least 2-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment P39. The compound of embodiment P37, wherein said compound binds a human Gαs protein-GDP complex at least 5-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment P40. The compound of embodiment P37, wherein said compound binds a human Gαs protein-GDP complex at least 40-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment P41. The compound of embodiment P37, wherein said compound binds a human Gαs protein-GDP complex at least 100-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment P42. The compound of one of embodiments P1 to P41, wherein said compound contacts the Switch 2 region of human Gαs protein.
Embodiment P43. The compound of embodiment P42, wherein the human Gαs protein is a human Gαs wildtype protein, a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein.
Embodiment P44. A pharmaceutical composition comprising the compound of one of embodiments P1 to P43, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
Embodiment P45. A method of treating a cancer in a patient in need of such treatment, said method comprising administering a therapeutically effective amount of a compound of one of embodiments P1 to P43 to said patient.
Embodiment P46. The method of embodiment P45, wherein the cancer is pancreatic cancer, pituitary cancer, or bone cancer.
Embodiment P47. A method of treating a bone condition in a patient in need of such treatment, said method comprising administering a therapeutically effective amount of a compound of one of embodiments P1 to P43 to said patient.
Embodiment P48. The method of embodiment P47, wherein the bone condition is fibrous dysplasia.
Embodiment P49. The method of embodiment P48, wherein the fibrous dysplasia is monostotic fibrous dysplasia or polystotic fibrous dysplasia.
Embodiment P50. A method of treating McCune-Albright syndrome in a patient in need of such treatment, said method comprising administering a therapeutically effective amount of a compound of one of embodiments P1 to P43 to said patient.
Embodiment P51. A method of treating cholera in a patient in need of such treatment, said method comprising administering a therapeutically effective amount of a compound of one of embodiments P1 to P43 to said patient.
Embodiment P52. A method of modulating the activity of a human Gαs protein, said method comprising contacting said human Gαs protein with an effective amount of a compound of one of embodiments P1 to P43.
Embodiment P53. The method of embodiment P52, wherein said human Gαs protein is a human Gαs wildtype protein, a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein.
Embodiment 1. A compound having the formula:
or a pharmaceutically acceptable salt thereof;
Embodiment 2. The compound of embodiment 1, having the formula:
Embodiment 3. The compound of one of embodiments 1 to 2, having the formula:
Embodiment 4. The compound of one of embodiments 1 to 3, having the formula:
Embodiment 5. The compound of one of embodiments 1 to 4, having the formula:
Embodiment 6. The compound of one of embodiments 1 to 5, having the formula:
Embodiment 7. The compound of one of embodiments 1 to 6, wherein -L1A-R1A-L2A-R2A-L3A-R3A-L4A-R4A-L5A-R5A-L6A-R6A-L7A,-R7A-L8A-R8A, -L9A-R9A-L10A-R10A-L11A-R11A, or -L12A-R12A are independently a natural amino acid side chain or an unnatural amino acid side chain.
Embodiment 8. The compound of one of embodiments 1 to 7, wherein -L1A-R1A-L2A-R2A-L3A-R3A-L4A-R4A-L5A-R5A-L6A-R6A-L7A,-R7A-L8A-R8A, -L9A-R9A-L10A-R10A-L11A-R11A, or -L12A-R12A are independently a natural amino acid side chain.
Embodiment 9. The compound of one of embodiments 1 to 8, having the formula:
Embodiment 10. The compound of one of embodiments 1 to 9, wherein L16 is a bioconjugate linker.
Embodiment 11. The compound of one of embodiments 1 to 9, wherein L16 is a substituted or unsubstituted divalent amino acid.
Embodiment 12. The compound of one of embodiments 1 to 9, wherein
Embodiment 13. The compound of embodiment 12, wherein
Embodiment 14. The compound of one of embodiments 1 to 9, wherein L16 is a bond
Embodiment 15. The compound of one of embodiments 1 to 9, wherein L16 is a bond,
Embodiment 16. The compound of one of embodiments 1 to 9, having the formula:
Embodiment 17. The compound of one of embodiments 1 to 9, having the formula:
Embodiment 18. The compound of one of embodiments 1 to 17, wherein said compound binds a human Gαs protein-GTP complex more strongly than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment 19. The compound of one of embodiments 1 to 18, wherein said compound binds a human Gαs protein-GTP complex at least 2-fold stronger than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment 20. The compound of one of embodiments 1 to 19, wherein said compound binds a human Gαs protein-GTP complex at least 5-fold stronger than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment 21. The compound of one of embodiments 1 to 20, wherein said compound binds a human Gαs protein-GTP complex at least 40-fold stronger than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment 22. The compound of one of embodiments 1 to 21, wherein said compound binds a human Gαs protein-GTP complex at least 100-fold stronger than said compound binds a human Gαs protein-GDP complex under identical conditions.
Embodiment 23. A compound having the formula:
or a pharmaceutically acceptable salt thereof;
Embodiment 24. The compound of embodiment 23, wherein -L1B-R1B-L2B-R2B-L3B-R3B-L4B-R4B-L5B-R5B-L6B-R6B-L7B-R7B-L8B-R8B-L9B-R9B-L10B-R10B-L11B-R11B-L12B-R12B, or -L13B-R13B are independently a natural amino acid side chain or an unnatural amino acid side chain.
Embodiment 25. The compound of one of embodiments 23 to 24, wherein -L1B-R1B-L2B-R2B-L3B-R3B-L4B-R4B-L5B-R5B-L6B-R6B-L7B-R7B-L8B-R8B-L9B-R9B-L10B-R10B-L11B-R11B-L12B-R12B, or -L13B-R13B are independently a natural amino acid side chain.
Embodiment 26. The compound of one of embodiments 23 to 25, having the formula:
Embodiment 27. The compound of one of embodiments 23 to 26, having the formula:
Embodiment 28. The compound of one of embodiments 23 to 27, having the formula:
Embodiment 29. The compound of one of embodiments 23 to 27, having the formula:
Embodiment 30. The compound of one of embodiments 23 to 29, wherein L16 is a bioconjugate linker.
Embodiment 31. The compound of one of embodiments 23 to 29, wherein L16 is a substituted or unsubstituted divalent amino acid.
Embodiment 32. The compound of one of embodiments 23 to 29, wherein
Embodiment 33. The compound of embodiment 32, wherein
Embodiment 34. The compound of one of embodiments 23 to 29, wherein L16 is a bond,
Embodiment 35. The compound of one of embodiments 23 to 29, wherein L16 is a bond
Embodiment 36. The compound of one of embodiments 23 to 27, having the formula:
Embodiment 37. The compound of one of embodiments 23 to 27, having the formula:
Embodiment 38. The compound of one of embodiments 23 to 27, having the formula:
Embodiment 39. The compound of one of embodiments 23 to 27, having the formula:
Embodiment 40. The compound of one of embodiments 23 to 39, wherein said compound binds a human Gαs protein-GDP complex more strongly than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment 41. The compound of one of embodiments 23 to 40, wherein said compound binds a human Gαs protein-GDP complex at least 2-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment 42. The compound of one of embodiments 23 to 41, wherein said compound binds a human Gαs protein-GDP complex at least 5-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment 43. The compound of one of embodiments 23 to 42, wherein said compound binds a human Gαs protein-GDP complex at least 40-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment 44. The compound of one of embodiments 23 to 43, wherein said compound binds a human Gαs protein-GDP complex at least 100-fold stronger than said compound binds a human Gαs protein-GTP complex under identical conditions.
Embodiment 45. The compound of one of embodiments 1 to 44, wherein said compound contacts the Switch 2 region of human Gαs protein.
Embodiment 46. The compound of embodiment 45, wherein the human Gαs protein is a human Gαs wildtype protein, a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein.
Embodiment 47. A pharmaceutical composition comprising the compound of one of embodiments 1 to 46, or a pharmaceutically acceptable salt thereof, and a pharmaceutically acceptable excipient.
Embodiment 48. A method of treating a cancer in a patient in need of such treatment, said method comprising administering a therapeutically effective amount of a compound of one of embodiments 1 to 46 to said patient.
Embodiment 49. The method of embodiment 48, wherein the cancer is pancreatic cancer, pituitary cancer, or bone cancer.
Embodiment 50. A method of treating a bone condition in a patient in need of such treatment, said method comprising administering a therapeutically effective amount of a compound of one of embodiments 1 to 46 to said patient.
Embodiment 51. The method of embodiment 50, wherein the bone condition is fibrous dysplasia.
Embodiment 52. The method of embodiment 51, wherein the fibrous dysplasia is monostotic fibrous dysplasia or polystotic fibrous dysplasia.
Embodiment 53. A method of treating McCune-Albright syndrome in a patient in need of such treatment, said method comprising administering a therapeutically effective amount of a compound of one of embodiments 1 to 46 to said patient.
Embodiment 54. A method of treating cholera in a patient in need of such treatment, said method comprising administering a therapeutically effective amount of a compound of one of embodiments 1 to 46 to said patient.
Embodiment 55. A method of modulating the activity of a human Gαs protein, said method comprising contacting said human Gαs protein with an effective amount of a compound of one of embodiments 1 to 46.
Embodiment 56. The method of embodiment 55, wherein said human Gαs protein is a human Gαs wildtype protein, a human Gαs R201C protein, a human Gαs R201H protein, a human Gαs Q227R protein, a human Gαs Q227H protein, a human Gαs Q227K protein, a human Gαs Q227E protein, or a human Gαs Q227L protein.
It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.
The GNAS gene encodes the Gαs stimulatory subunit of heterotrimeric G proteins, which mediate G-protein-coupled receptor (GPCR) signaling, a central mechanism by which cells sense and respond to extracellular stimuli. Multiple human cancer types exhibit recurrent gain-of-function mutations in the pathway, most frequently targeting GNAS. The most lethal tumor type where GNAS is frequently mutated is the intraductal papillary mucinous neoplasm (IPMN), a precursor of invasive pancreatic cancer. We have developed, inter alia, state-selective Gαs binding molecules which block adenylyl cyclase (AC) activation. Using the Random non-standard Peptide Integrated Discovery (RaPID) platform, we have selected active state and inactive state preferring cyclic peptides against Gαs. We have solved high resolution X-ray co-crystal structures of our function blocking cyclic peptides which explains their nucleotide state specificity and inhibitory activity.
Selections were performed with thioether-macrocyclic peptide library against GppNHp-bound Gαs using the GDP-bound Gαs as the negative selection. Thioether-macrocyclic peptide libraries were constructed with N-chloroacetyl-D-tyrosine (ClAcDTyr) as an initiator by using the flexible in vitro translation (FIT) system (32). The mRNA libraries, ClAcDTyr-tRNAfMetCAU were prepared as reported (I2). The mRNA library corresponding for the thioether-macrocyclic peptide library was designed to have an AUG initiator codon to incorporate N-chloroacetyl-D-tyrosine (ClAcDTyr), followed by 8-12 NNK random codons (N=G, C, A or U; K=G or U) to code random proteinogenic amino acids, and then a fixed downstream UGC codon to assign Cys. After in vitro translation, a thioether bond formed spontaneously between the N-terminal ClAc group of the initiator DTyr residue and the sulfhydryl group of a downstream Cys residue.
In the first round of selection, the initial cyclic peptide library was formed by adding puromycin ligated mRNA library (225 pmol) to a 150 μL scale flexible in vitro translation system, in the presence of 30 μM of ClAcDTyr-tRNAfMetCAU. The translation was performed 37° C. for 30 min, followed by an extra incubation at 25° C. for 12 min. After an addition of 15 μL of 200 mM EDTA (pH 8.0) solution, the reaction solution was incubated at 37° C. for 30 min to facilitate cyclization. Then the library was reversed transcribed by M-MLV reverse transcriptase (Promega, Cat #3683) at 42° C. for 1 hour and subject to pre-washed Sephadex G-25 (GE Healthcare, Cat #17003201) columns to remove salts. The desalted solution of peptide-mRNA/cDNA was applied to GppNHp-bound Gαs-immobilized Dynabeads M280 streptavidin magnetic beads (Thermo Fisher Scientific, Cat #11206D) and rotated at 4° C. for 1 hour in selection buffer (25 mM HEPES pH 7.5, 150 mM NaCl, 1 mM MgCl2 and 0.05% Tween 20) containing 0.5 mM GppNHp (Sigma, Cat #G0635) and 0.1% acetylated BSA (Nacalai Tesque, Cat #01278-44). Bead amounts were chosen that the final concentration of GppNHp-bound Gαs was 200 nM. This process is referred to as positive selection. The selected peptide-mRNA/cDNAs were isolated from the beads by incubating in 1×PCR reaction buffer heated at 95° C. for 5 min. The amount of eluted cDNAs was measured by quantitative PCR (Roche LightCycler 96). The remaining cDNAs were amplified by PCR, purified and transcribed into mRNAs as a library for the next round of selection.
In the subsequent rounds of selection, ligated mRNA from previous round (7.5 pmol) was added to a 5 μL scale reprogrammed in vitro translation system. This was incubated at 37° C. for 30 min and at 25° C. for 12 min. Then 1 μL of 100 mM EDTA (pH 8.0) was added and incubated at 37° C. for 30 min. After reverse transcription and subject to pre-washed Sephadex G-25 columns to remove salts, negative selection was performed by adding the desalted solution of peptide-mRNA/cDNA to GDP-bound Gαs-immobilized Dynabeads M280 streptavidin magnetic beads and rotated at 4° C. for 30 min in selection buffer containing 0.1% acetylated BSA. This process was repeated several times by removing the supernatant to fresh beads immobilized with GDP-bound Gαs. The supernatant from the last negative selection was then added to beads immobilized with GppNHp-bound Gαs (final conc. 200 nM) and rotated at 4° C. for 30 min in selection buffer containing 0.5 mM GppNHp and 0.1% acetylated BSA. As described in the first round of selection, the cDNA was quantified with qPCR, amplified with PCR, transcribed and ligated to puromycin. The subsequent selection was repeated for several rounds until a significant enrichment of cDNA was observed for GppNHp-bound Gαs. The recovered cDNA was then identified by next generation sequencing (Miseq, Illumina).
In comparison selection, ligated mRNA (7.5 pmol) from last round selection was added to a 5 μL scale reprogrammed in vitro translation system. After translation, cyclization, reverse transcription and prewashed with Sephadex G-25 columns, the desalted solution of peptide-mRNA/cDNA library was split equally into three fractions, and perform three paralleled selections with the same amount of blank, GDP-bound Gαs-immobilized or GppNHp-bound Gαs-immobilized Dynabeads M280 streptavidin magnetic beads, individually. For each of the paralleled selections, the beads were rotate at 4° C. for 30 min, washed three times with selection buffer. The remaining cDNAs were then eluted from the beads, quantified by qPCR, followed by Miseq sequencing. Finally, identified sequences from each paralleled selection were compared by normalization of Miseq abundance of the sequence with the qPCR reads of the paralleled selection.
The G protein-coupled receptor (GPCR) cascade leading to production of the second messenger cAMP is replete with pharmacologically targetable receptors and enzymes with the exception of the Gα subunit, Gαs. GTPases remain largely undruggable given the difficulty of displacing high-affinity guanine nucleotides and the lack of other drug binding sites. We explored a chemical library of 1012 cyclic peptides in order to expand the chemical search for inhibitors of this enzyme class. We identified two macrocyclic peptides, GN13 and GD20, that antagonize the active and inactive states of Gαs, respectively. Both macrocyclic peptides fine-tune Gαs activity with high nucleotide-binding-state selectivity and G protein class-specificity. Co-crystal structures reveal that GN13 and GD20 distinguish the conformational differences within the switch II/α3 pocket and block effector interactions. The Gαs inhibitors showed strong activity in cellular contexts through binding to crystallographically defined pockets. The discovery of cyclic peptide inhibitors targeting Gαs provides a path for further development of state-dependent GTPase inhibitors.
The family of human GTPases represents a vast but largely untapped source of pharmacological targets. They serve as key molecular switches that control cell growth and proliferation through cycling between tightly regulated ON/OFF states. The role of specific GTPase family members across diverse human diseases have been widely established by cancer genome sequencing (e.g., KRAS, GNAS and others) and by familial studies in neurodegenerative disease (e.g., LRRK2, RAB39B) (Prior et al., 2012; O'Hayre et al., 2013; Alessi and Sammler, 2018; Wilson et al., 2014). Despite the widespread recognition of these disease target relationships, only very recently has the first drug targeting a GTPase K-Ras (G12C) achieved clinical proof of principle (Canon et al., 2019; Hallin et al., 2020). The covalent somatic cysteine mutant-specific nature of the K-Ras (G12C) drugs has opened the potential for targeting a GTPase for the first time.
Several peptide-based probes that non-covalently target GTPases have been reported, but they either lack proper drug-like properties or have limited target scope (Takasaki, et al., 2004; Ja and Roberts, 2004; Johnston et al., 2005; Johnston et al., 2005; Johnston et al., 2006; Ja et al., 2006; Austin et al., 2008). Short linear peptides have shown good ability to target the switch II/α3 helix region in the heterotrimeric G protein α-subunit (Ga) with high nucleotide binding state selectivity. However, linear peptides have relatively poor cell-permeability and inherent instability in cells.
Cyclic peptides are promising candidates for GTPase drug development. Like linear peptides, cyclic peptides are also capable of targeting protein-protein interfaces (Sohrabi et al., 2020). Peptide cyclization stabilizes the peptide sequence and constrains the flexible peptide conformations for better cell penetration (Dougherty et al., 2019). Cyclic peptide inhibitors of Gα proteins have been reported: for instance, the macrocyclic depsipeptide natural product YM-254890 targets GDP-bound Gαq with high specificity and potency in cells (Nishimura et al., 2010). Despite the highly conserved structure of G proteins and the recent chemical tractability of fully synthetic YM-254890, efforts to use this natural macrocycle as a scaffold from which to discover inhibitors of other G proteins (Gαs, Gαi) have not been successful (Kaur et al., 2015; Xiong et al., 2016; Zhang et al., 2017), likely because of the limited chemical diversity of available YM-254890 analogs. We therefore reasoned that screening an ultra-large chemical library of cyclic peptides against a given nucleotide binding state of Gαs might allow us to discover Gαs nucleotide-binding-state-selective inhibitors that discriminate between the active and inactive states of Gαs and potentially open the remainder of the GTPase family to pharmacological studies.
The Random nonstandard Peptide Integrated Discovery (RaPID) system (Yamagishi et al., 2011) is an in vitro display system which merges the flexibility of an in vitro translation system (FIT) (Murakami et al., 2006; Murakami et al., 2003., Ramaswamy et al., 2004; Xiao et al., 2008) with mRNA display, enabling the screening of exceptionally large macrocyclic peptide libraries (>1012 molecules) against challenging targets (Passioura and Suga, 2017). Here we report, inter alia, the discovery by the RaPID system of GN13 and GD20, two macrocyclic peptides that are the first known cell-permeable, nucleotide-state-selective inhibitors of Gαs, with high selectivity over other G protein subfamilies and nucleotide binding states.
Selection of state-selective cyclic peptides that bind to the active or inactive state of Gαs. Affinity screening hits emerging from the RaPID cyclic peptide selection process against Gαs could theoretically bind anywhere on the surface of the protein and so might or might not perturb its function. To increase the probability of selecting a function-perturbing hit, we took advantage of the fact that when Gαs switches from the GDP-bound inactive state to the GTP-bound active state significant conformational changes occur on one face of Gαs, comprising the so-called switch I, II and III regions (Lambright et al., 1994), which are known to bind inhibitor or effector protein partners such as Gβγ or adenylyl cyclases (Tesmer et al., 1997; Liu et al., 2019) (
In order to select a Gαs active state binding peptide, we performed the positive selection with wild-type Gαs (WT Gαs) bound to the non-hydrolyzable GTP analogue GppNHp (5′-guanylyl imidodiphosphate) and the negative selection against GDP-bound WT Gαs. A parallel Gαs inactive state binder selection was performed using GDP-bound WT Gαs as the positive selection and GppNHp-bound WT Gαs as the negative selection (
After four rounds of selection (R1-R4), cyclic peptide binders for the GppNHp-bound or GDP-bound Gαs were enriched and identified by next generation sequencing (NGS). The sequences of the top 20 hits were aligned and shown in
Active state binding cyclic peptide GN13 blocks Gαs-mediated adenylyl cyclase activation. In order to determine whether (Gαs/GppNHp) specific binders inhibit Gαs activity, we assayed the ability of Gαs to activate its downstream effector adenylyl cyclase (AC) (
The inhibitory Gα protein, Gαi, is a negative regulator in the cAMP pathway and possesses a structure similar to that of Gαs (Gilman., 1987). To assess whether GN13 was capable of discriminating between Gαs and Gαi, we measured the binding kinetics of GN13 to Gαi and Gαs using biolayer interferometry (BLI). We found that GN13 binds to immobilized GppNHp-bound Gαs with a KD value of 0.19±0.02 μM. By contrast, GN13 showed no detectable binding to GDP-bound Gαs, GDP-bound Gαi1 or GppNHp-bound Gαi1 at the highest concentration tested, confirming the state-selectivity and class-specificity of GN13 for the active state of Gαs.
We sought to test the efficacy of GN13 in B2-adrenergic receptor (β2AR) mediated second messenger stimulation in cell membranes. Membrane anchored GDP-bound Gαs is inhibited by Gβγ in the resting state. It can undergo GPCR mediated GDP to GTP exchange upon agonist stimulation (Weis and Kobilka, 2018). The presence of GN13 could potentially capture the newly generated GTP-bound Gαs and inhibit its activation (
The crystal structure of GppNHp-bound Gαs in complex with GN13. To elucidate how the cyclic peptide GN13 binds to Gαs and inhibits Gαs-mediated adenylyl cyclase activation, we solved a co-crystal structure of the Gαs/GppNHp/GN13 complex. The structure was determined by molecular replacement and refined to 1.57 Å (Table 1). The overall structure is shown in
Structural analysis reveals that residue W9 in GN13 is centrally located within the interface between GN13 and Gαs, contributing three hydrogen bonds as well as hydrophobic interactions with the switch II/α3 pocket (
Structural basis for the nucleotide state-selectivity and the G protein class-specificity of GN13. The Gαs/GppNHp/GN13 complex strongly resembles the Gαs/GTPγS structure (PDB: 1AZT) (Sunahara et al., 1997), suggesting that GN13 recognizes the active state conformation and does not induce significant conformational change upon binding (
GN13 showed excellent G protein class-specificity, although we did not include other Gα proteins, such as Gαi, as a part of the negative selection. To identify the G-protein specificity determinants of GN13, we aligned our structure with the structure of active state Gαi in complex with a Gαi-specific linear peptide, KB1753 (PDB: 2G83) (Johnston et al., 2006). The affinity determinant, IW motif, was presented in both GN13 and KB1573, but Gαs-specific binding of GN13 was mainly determined by charge interactions (
To further assess the cellular specificity of GN13, we designed a GN13-resistant Gαs mutant based on structural analysis. We examined the structures of the Gαs/GN13 complex and Gαs/AC complex and noticed that serine 275 in Gαs makes close contact with GN13, but does not contact adenylyl cyclase (
Inactive state binding cyclic peptide GD20 is a Gαs specific guanine nucleotide dissociation inhibitor (GDI). The activation of G protein signaling is often rapid and temporary. Gα GTPase activity promotes GTP hydrolysis to GDP and rearranges the switch regions to adopt a GDP-bound inactive conformation. This precisely orchestrated nucleotide binding conformation prevents GDP release, which makes GDP dissociation the rate-limiting step of G protein activation (Dror et al., 2015). An inactive state binder could hypothetically modulate GDP-bound Gαs either by inhibiting GDP release as a guanine nucleotide dissociation inhibitor (GDI) or by facilitating GDP to GTP switch as a guanine nucleotide exchange factor (GEF) (Ghosh et al., 2017). In order to understand how inactive state binders control GDP-bound Gαs function, we carried out a multiple turnover assay to evaluate Gαs steady-state GTPase activity in the presence of top hits from the inactive state binder selection (
We determined rate constants for two individual steps in the GTPases cycle, GD20 displayed profound GDI activity towards Gαs by drastically reducing Gαs GDP dissociation rates (koff) and the apparent rate of GTPγS binding (kapp) to Gαs (
The crystal structure of GDP-bound Gαs in complex with GD20. To understand the underlying molecular determinants of how cyclic peptide GD20 favors GDP-bound Gαs and inhibits GDP dissociation. We solved a co-crystal structure of the Gαs/GDP/GD20 complex. The structure was determined by molecular replacement and refined to 1.95 Å (Table 2). The overall structure is shown in
We measured the binding kinetics of GD20 to Gαs using BLI to quantify the binding event. We found that GD20 bound to immobilized GDP-bound Gαs with a KD value of 31.4±0.7 nM (
Structural basis for the binding selectivity and biochemical activity of GD20. The high resolution GD20-bound Gαs complex structure elucidated the molecular mechanism by which GD20 distinguishes GDP-bound Gαs over other protein or nucleotide binding states. First, we aligned our GD20-bound Gαs structure with the structure of active GTPγS-bound Gαs (PDB: 1AZT) (Sunahara et al., 1997). The presence of a rigidified switch II motif in the GTPγS-bound Gαs clashes with GD20 (
The GD20-bound Gαs complex structure also demonstrates the molecular basis of GD20 GDI activity (
When we compared our GD20-bound Gαs structure with another GDP-bound Gαs structure in complex with Gβγ (
A cell permeable GD20 analog, GD20-F10L, inhibits Gαs/Gβγ interaction in HEK293 cells. Receptor coupled G protein signaling releases GTP-bound Gα and free Gβγ to engage their own effectors to transduce downstream signaling. GDP-bound Gα is a functional “OFF” switch by tightly reassociating with obligate Gβγ dimers and masking the effector binding surfaces on both Gαs and Gβγ (Gulati et al., 2018). A potent Gαs Gβγ protein-protein interaction (PPI) inhibitor should potentially block Gαs Gβγ reassociation and further extend the lifetime of free Gβγ (
We first tested the cell permeability of GD20, as peptide-based chemical probes often suffer from poor cell permeability. Several G protein-specific linear peptides exhibit in vitro activities but have no reported cellular efficacy, likely due to their low cell permeability (Ja and Roberts, 2004; Johnston et al., 2005; Johnston et al., 2005; Johnston et al., 2006; Austin et al., 2008). In order to quantitatively evaluate the cell permeability of GD20, we used a recently developed HaloTag-based assay known as a chloroalkane penetration assay (CAPA) (Figure S6I) (Peraro et al., 2018). HeLa cells stably expressing HaloTag localized to the mitochondrial outer membrane were pulsed with chloroalkane-tagged molecules (ct-molecule), washed, chased with chloroalkane-tagged TAMRA fluorophore (ct-TAMRA), and finally analyzed by flow cytometry. A lower ct-TAMRA fluorescent signal indicates competition from a higher cytosolic concentration of ct-molecule. The carboxyl terminus of GD20 (G15) was conjugated with a chloroalkane tag to make ct-GD20 (
We next tested GD20-F10L in HEK 293 cells overexpressing both β2AR and Gαs/Gβγ. Rluc8 was inserted within a flexible loop region between the αB-αC helices of Gαs (
GPCRs and G proteins comprise the largest family of signal transducing proteins in the human genome. Although approximately 35% of approved drugs target GPCRs, directly targeting the downstream integrator G proteins has the potential for broader efficacy via blocking converged pathways shared by multiple GPCRs (Bonacci et al., 2006; Gulati et al., 2018). However, there is a striking absence of drug-like chemical matter that specifically targets the Gα proteins in cells. Cyclic peptides bridge the chemical space between small molecules and biologics, and are therefore capable of recognizing shallow effector binding pockets at PPI interfaces while maintaining optimal pharmacological properties. This is demonstrated here by the development of Gαs selective cyclic peptide inhibitors GN13 and GD20, which specifically recognize the Gαs switch II/α3 pocket, the site where downstream effectors bind. Cyclization of the peptide sequence and introduction of a non-canonical amino acid (D-tyrosine) provide these Gαs inhibitors better cell permeability and chemical stability (
Both GN13 and GD20 bind at the switch II/α3 pocket in Gαs. This pocket is evolutionally conserved and is commonly used for effector binding, with subtle differences conferred by sequence variability between homologous Gα proteins and by binding of different nucleotides (Wall et al., 1995; Tesmer et al., 1997; Slep et al., 2001; Tesmer et al., 2005; Chen et al., 2005; Liu et al., 2019). Our extremely diverse chemical library along with both positive and negative selection enabled us to survey the sequence space of cyclic peptides and discover selective binders that capture specific, subtly different conformations of the switch II/α3 pocket. The resulting Gαs-cyclic peptide recognitions are highly class-specific and state-selective, allowing for a precise modulation of Gαs signaling.
Gαs is one of the most frequently mutated G proteins in human cancer. Hotspot mutations in Gαs (Q227) disrupt its GTPase activity, thereby locking Gαs in the GTP-bound active conformation (Zachary et al., 1990). We found that the cyclic peptide GN13 recognized this particular Gαs conformation and inhibited GTP- and GppNHp-bound Gαs Q227L mutant in the adenylyl cyclase activation assay. To our knowledge, this is the first demonstration of the ligandability of oncogenic Gαs.
The inactive state inhibitors GD20 and GD20-F10L similarly provide lead molecules to probe GDP-bound Gαs and exemplify a new mode of pharmacological intervention in GPCR signaling. The cell-penetrating cyclic peptide GD20-F10L captures a flexible switch-II conformation that is only available when Gαs is in the GDP bound state. This molecular recognition could be useful for developing biosensors directly detecting Gαs/GDP in cells. For example, a fluorescently tagged GD20-F10L could potentially be used for tracking real-time translocation of endogenous Gαs following receptor activation and internalization, which bypasses the need of G protein overexpression or genetic modification (Maziarz et al., 2020; Olsen et al., 2020).
GD20-F10L also offers a new angle to study the role of Gβγ signaling during GPCR stimulation. Gαs-GD20-F10L interaction sterically occludes Gβγ binding to Gαs. After acute stimulation of a Gαs-coupled receptor (β2AR), GD20-F10L functions as a dual-effect G protein PPI inhibitor by sequestering monomeric Gαs and releasing Gβγ from the natural inhibition of Gαs/GDP. As a result, GD20-F10L co-treatment with the β2AR agonist, isoproterenol generates a higher Gβγ concentration, which is comparable to the Gβγ concentration following M2R (a Gαi-coupled receptor) activation (
Our demonstration of the use of the RaPID cyclic peptide platform through both positive and negative selection steps provides proof of principle for a path to discovering other cell-permeable, class-specific and state-selective inhibitors of the remainder of the GTPase family. The state-selective Gαs inhibitors GN13 and GD20 also provide novel pharmacological strategies for understanding and modulating GPCR signaling.
GN13 and GD20-F10L are strong binders to Gαs, with KD values in the nanomolar range. However, there is difficulty in measuring potency due to the competing tight protein-protein interactions in cell membranes and the relatively lower cell penetration of cyclic peptides. Optimizing cyclic peptides with non-canonical residues could potentially improve the potency and cell permeability of GN13 and GD20-F10L to overcome this limitation.
HeLa cells stably expressing the Halo-Tag-GFP-Mito construct were provided by the Kritzer lab (Peraro et al., 2018). Wild-type HEK293, GNAS KO HEK293 were provided by the Inoue lab. These cells are female in origin. Wild-type HEK293, GNAS KO HEK293 and HeLa cells were cultured at 37° C., 5% CO2 in DMEM (Thermo Fisher Scientific, Cat #11995073) supplemented with 10% heat-inactivated FBS (AxeniaBiologix).
WT Gαs, all the mutants of Gαs, the C1 domain (residues 442-658, VC1) of human ADCY5 (adenylyl cyclase V) and the C2 domain (residues 871-1082, IIC2) of human ADCY2 (adenylyl cyclase II) were overexpressed in Escherichia coli BL21(DE3) cultured in Terrific Broth (TB) Medium. Human GNB1 (Go 1) and GNG2 (Gγ2) were co-expressed in Sf9 insect cells cultured in Sf-900 III SFM medium at 28° C.
Proteins used in the adenylyl cyclase assay, the radioactivity assay, and the steady state GTPase asssy. The wild-type and S275L mutant of Gαs, C2 domain of human ADCY2, C1 domain of human ADCY5, and human Gβ1/Gγ2(C68S) complex used in the adenylyl cyclase activity assay were cloned, expressed and purified as described (Hu and Shokat, 2018).
The gene encoding residues 7-380 of the short isoform of human Gαs (GNAS, accession number in PubMed: NP_536351) with an Avi tag and a TEV cleavage site at its N-terminus was cloned into the multiple cloning site 1 of the pETDuet vector. The resulting protein sequence is as follows:
In the same pETDuet plasmid, the gene encoding BirA (accession number in PubMed: NP_418404.1) was inserted between NdeI and XhoI sites of the multiple cloning site 2. This plasmid was transformed into Escherichia coli BL21(DE3). The transformed cells were grown in TB medium supplemented with 50 μg/mL carbenicillin at 37° C. until OD600 reached 0.5, and then cooled to 22° C. followed by addition of 40 μM β-D-thiogalactopyranoside. After overnight incubation, 50 μM biotin was added into the culture for 2 hours. The cells were harvested by centrifugation, resuspended in lysis buffer (150 mM NaCl, 25 mM Tris 8.0, 1 mM MgCl2, 250 μM biotin, protease inhibitor, and then lysed by a microfluidizer. The cell lysate was centrifuged at 14000 g for 1 hour at 4° C. The supernatant was incubated with TALON Resin at 4° C. for 2 hours, then the resin was washed by 500 mM NaCl, 25 mM Tris 8.0, 1 mM MgCl2 and 5 mM imidazole 8.0. Gαs was eluted by 25 mM Tris 8.0, 1 mM MgCl2, 250 mM imidazole 8.0, 10% glycerol and 0.1 mM GDP. After adding 5 mM Dithiothreitol (DTT), the eluate was loaded onto a Source-15Q column. Gαs was eluted by a linear gradient from 100% IEC buffer A (25 mM Tris 8.0, 1 mM MgCl2) to 40% IEC Buffer B (25 mM Tris 8.0, 1 M NaCl, 1 mM MgCl2). The peak fractions were pooled and supplemented with 5 mM DTT. One half of peak fractions was mixed with equal volume of GppNHp exchange buffer (150 mM NaCl, 25 mM HEPES 8.0, 2 mM EDTA, 2 mM GppNHp, 5 mM DTT) for 2 hours, followed by addition of 5 mM MgCl2. GppNHp-bound Gαs and GDP-bound Gαs were concentrated and purified by gel filtration (Superdex 200 increase, 10/30) with SEC buffer (150 mM NaCl, 20 mM HEPES 8.0, 5 mM MgCl2 and 1 mM EDTA-Na 8.0). The peak fractions were pooled and concentrated for biochemical assay.
WT Gαs, Gαs S275L mutant and full-length Gαi used in the TR-FRET assay and the bio-layer interferometry assay. The gene of residues 7-380 of the short isoform of human Gαs (GNAS, accession number in PubMed: NP_536351) with a stop codon at its end was cloned into the NdeI/XhoI site of a modified pET15b vector, in which a Drice cleavage site (AspGluValAsp↓Ala) and an Avi tag were inserted at the N-terminus. The resulting protein sequence after Drice protease cleavage is as follows:
The AviTagged Gαs S275L mutant plasmid was constructed using quick-change mutagenesis from the AviTagged WT Gαs plasmid. The resulting protein sequence after Drice protease cleavage is as follows:
The gene of residues 2-354 of the short isoform of human Gαi1 (GNAI1, accession number in PubMed: NP_002060.4) with a stop codon at its end was cloned into the NdeI/XhoI site of a modified pET15b vector, in which a Drice cleavage site (AspGluValAsp↓Ala) and an Avi tag were inserted at the N-terminus. The resulting protein sequence after Drice protease cleavage is as follows:
The above-mentioned plasmids were transformed into Escherichia coli BL21(DE3), respectively. The transformed cells were grown in TB medium supplemented with 50 μg/mL carbenicillin at 37° C. until OD600 reached 0.4, and then cooled to 22° C. followed by addition of 100 μM IPTG. After overnight incubation, the cells were harvested by centrifugation, resuspended in lysis buffer (150 mM NaCl, 25 mM Tris 8.0, 1 mM MgCl2, protease inhibitor cocktail), and then lysed by a microfluidizer. The cell lysate was centrifuged at 14000 g for 1 hour at 4° C. The supernatant was incubated with TALON resin at 4° C. for 1 hour, then the resin was washed by 500 mM NaCl, 25 mM Tris 8.0, 1 mM MgCl2 and 5 mM imidazole 8.0. G protein was eluted by 25 mM Tris 8.0, 1 mM MgCl2, 250 mM imidazole 8.0, 10% glycerol and 0.1 mM GDP. After adding 5 mM Dithiothreitol (DTT), the eluate was incubated with Drice protease at 4° C. overnight to remove the hexahistidine tag. Purified BirA (A gift from the Wells lab) and biotin were added at 4° C. until LC-MS showed complete biotinylation. G protein was loaded onto a Source-15Q column and eluted by a linear gradient from 100% IEC buffer A (25 mM Tris 8.0, 1 mM MgCl2) to 40% IEC Buffer B (25 mM Tris 8.0, 1 M NaCl, 1 mM MgCl2). The peak fractions were pooled, nucleotide exchanged, and supplemented with 5 mM DTT and 0.1 mM nucleotide, and then concentrated and purified by gel filtration (Superdex 200 increase, 10/30) with SEC buffer (150 mM NaCl, 20 mM HEPES 8.0, 5 mM MgCl2 and 1 mM EDTA-Na 8.0). The peak fractions were pooled and concentrated for biochemical assay.
Selections were performed with thioether-macrocyclic peptide library against biotinylated Gαs. Thioether-macrocyclic peptide libraries were constructed with N-chloroacetyl-D-tyrosine (ClAcDTyr) as an initiator by using the flexible in vitro translation (FIT) system (Goto et al., 2011). The mRNA libraries, ClAcDTyr-tRNAfMetCAU were prepared as reported (Yamagishi et al., 2011). The mRNA library corresponding for the thioether-macrocyclic peptide library was designed to have an AUG initiator codon to incorporate N-chloroacetyl-D-tyrosine (ClAcDTyr), followed by 8-12 NNK random codons (N=G, C, A or U; K=G or U) to code random proteinogenic amino acids, and then a fixed downstream UGC codon to assign Cys. After in vitro translation, a thioether bond formed spontaneously between the N-terminal ClAc group of the initiator DTyr residue and the sulfhydryl group of a downstream Cys residue.
In the first round of selection, the initial cyclic peptide library was formed by adding puromycin ligated mRNA library (225 pmol) to a 150 μL scale flexible in vitro translation system, in the presence of 30 μM of ClAcDTyr-tRNAfMetCAU. The translation was performed 37° C. for 30 min, followed by an extra incubation at 25° C. for 12 min. After an addition of L of 200 mM EDTA (pH 8.0) solution, the reaction solution was incubated at 37° C. for 30 min to facilitate cyclization. Then the library was reversed transcribed by M-MLV reverse transcriptase at 42° C. for 1 hour and subject to pre-washed Sephadex G-25 columns to remove salts. The desalted solution of peptide-mRNA/cDNA was applied to Gαs (positive selection state)-immobilized Dynabeads M280 streptavidin magnetic beads and rotated at 4° C. for 1 hour in selection buffer (25 mM HEPES pH 7.5, 150 mM NaCl, 1 mM MgCl2 and 0.05% Tween 20) containing 0.5 mM corresponding nucleotide and 0.1% acetylated BSA. Bead amounts were chosen that the final concentration of Gαs protein was 200 nM. This process is referred to as positive selection. The selected peptide-mRNA/cDNAs were isolated from the beads by incubating in 1×PCR reaction buffer heated at 95° C. for 5 min. The amount of eluted cDNAs was measured by quantitative PCR. The remaining cDNAs were amplified by PCR, purified and transcribed into mRNAs as a library for the next round of selection.
In the subsequent rounds of selection, ligated mRNA from previous round (7.5 pmol) was added to a 5 μL scale reprogrammed in vitro translation system. This was incubated at 37° C. for 30 min and at 25° C. for 12 min. Then 1 μL of 100 mM EDTA (pH 8.0) was added and incubated at 37° C. for 30 min. After reverse transcription and subject to pre-washed Sephadex G-25 columns to remove salts, negative selection was performed by adding the desalted solution of peptide-mRNA/cDNA to Gαs (negative selection state)-immobilized Dynabeads M280 streptavidin magnetic beads and rotated at 4° C. for 30 min in selection buffer containing 0.1% acetylated BSA. This process was repeated several times by removing the supernatant to fresh beads immobilized with Gαs (negative selection state). The supernatant from the last negative selection was then added to beads immobilized with the positive selection state of Gαs (final conc. 200 nM) and rotated at 4° C. for 30 min in selection buffer containing 0.5 mM corresponding nucleotide and 0.1% acetylated BSA. As described in the first round of selection, the cDNA was quantified with qPCR, amplified with PCR, transcribed and ligated to puromycin. The subsequent selection was repeated for several rounds until a significant enrichment of cDNA was observed for positive selection state. The recovered cDNA was then identified by next generation sequencing (Miseq, Illumina).
In comparison selection, ligated mRNA (7.5 pmol) from last round selection was added to a 5 μL scale reprogrammed in vitro translation system. After translation, cyclization, reverse transcription and prewashed with Sephadex G-25 columns, the desalted solution of peptide-mRNA/cDNA library was split equally into three fractions, and perform three paralleled selections with the same amount of blank, GDP-bound Gαs-immobilized or GppNHp-bound Gαs-immobilized Dynabeads M280 streptavidin magnetic beads, individually. For each of the paralleled selections, the beads were rotate at 4° C. for 30 min, washed three times with selection buffer. The remaining cDNAs were then eluted from the beads, quantified by qPCR, followed by Miseq sequencing. Finally, identified sequences from each paralleled selection were compared by normalization of Miseq abundance of the sequence with the qPCR reads of the paralleled selection.
BLI experiments were performed using an OctetRED384 instrument from ForteBio. All experiments were performed at 25° C. using BLI buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 1 mM MgCl2, 0.05% Tween-20, 0.1% DMSO, 0.2 mM GppNHp or GDP). Cyclic peptides were diluted to a series of concentrations in BLI buffer plus 10 μM Biotin. Assays were conducted in Greiner 384well, black, flat bottom polypropylene plates containing the protein solutions, BLI buffer plus 10 μM Biotin for dissociation, and serial dilutions of cyclic peptides to be tested.
Biotinylated proteins were immobilized on Streptavidin biosensors by dipping sensors into plate wells containing protein solutions at a concentration of 100-150 nM. Protein loading is around 2-3 nm. Sensors loaded with proteins were moved and dipped into wells with BLI buffer plus 10 μM Biotin to block unlabeled Streptavidin. Association-dissociation cycles of compounds were started by moving and dipping sensors to cyclic peptides dilutions and BLI buffer plus 10 μM Biotin wells alternatively. Association and dissociation times were carefully determined to ensure full association and dissociation.
Raw kinetic data collected were processed with the Data Analysis software provided by the manufacturer using single reference subtraction in which buffer-only reference was subtracted (For GN13 analysis). Because GD20 analogs have a low level of background binding, we used a double reference subtraction (buffer-only reference and non-protein-loading reference) method to calculate their kinetics values. The resulting data were analyzed based on a 1:1 binding model from which kon and koff values were obtained and then Kd values were calculated.
Cyclic peptides dose dependent inhibition (
Cyclic peptides GN1, GN3, GN6, GN7, GN8, GN10, GN11, GN13, GN15 (4 mM stock in DMSO) were diluted to 4× stocks with a series of concentrations (0, 1.56, 3.12, 6.25, 12.5, 25, 50, 100 μM) in reaction buffer (1× PBS 7.4, 0.1% BSA). WT Gαs at a concentration of 8.5 mg/mL (about 190 μM) in 20 mM HEPES 8.0, 150 mM NaCl, 5 mM MgCl2, 1 mM EDTA-Na 8.0 was diluted to 0.5 μM in dilution buffer (1× PBS 7.4, 0.1% BSA, 1 mM EDTA-Na 8.0, 2 mM DTT, 0.1 mM MgCl2) plus 1 mM GppNHp. After incubation at room temperature for 1 hour to allow nucleotide exchange, 2.5 μL of Gαs dilution was mixed with 1 μL MgCl2 stock (20 mM MgCl2, 1× PBS 7.4, 0.1% BSA) in an OptiPlate-384, White Opaque 384-well Microplate to lock Gαs in GppNHp-bound state. 2 μL of adenylyl cyclase stock (2 μM VC1, 2 nM IIC2, 150 μM FSK, 1× PBS 7.4, 0.1% BSA) was added, followed by addition of 2.5 μL 4× cyclic peptides stock. Reaction mixture was further incubated at room temperature for 2 hours and placed on ice for 5 minutes. cAMP production was initiated by addition of 2 L of ATP stock (1 mM ATP, 1× PBS 7.4, 0.1% BSA). The reaction was carried out at 30° C. for 10 minutes in a PCR machine and stopped by heating at 95° C. for 3 minutes. The cAMP concentrations were measured by the LANCE Ultra cAMP kit.
GN13 inhibition of Gαs proteins at various concentrations (
WT Gαs and S275L mutant at a concentration of 8.5 mg/mL (about 190 μM) in 20 mM HEPES 8.0, 150 mM NaCl, 5 mM MgCl2, 1 mM EDTA-Na 8.0 were diluted to a series of concentrations (4 μM, 1.33 μM, 0.44 μM, 0.15 μM, 49.4 nM, 16.5 nM, 5.5 nM, 0 nM) in dilution buffer (1×PBS 7.4, 0.1% BSA, 1 mM EDTA-Na 8.0, 2 mM DTT, 0.1 mM MgCl2) plus 1 mM GppNHp. After incubation at room temperature for 1 hour to allow nucleotide exchange, 2.5 μL of each sample was then mixed with 1 μL of MgCl2 stock (20 mM MgCl2, 1× PBS 7.4, 0.1% BSA) in an OptiPlate-384, White Opaque 384-well Microplate. 2 μL of adenylyl cyclase/Gβγ stock (2 μM VC1, 2 nM IIC2, 150 μM FSK, 1× PBS 7.4, 0.1% BSA, 10 μM Gβ1/γ2(C68S)) was added, followed by addition of 2.5 μL 25 μM GN13 stock in 1× PBS 7.4, 0.1% BSA. Reaction mixture was further incubated at room temperature for 2 hours and placed on ice for 5 minutes. cAMP production was initiated by addition of 2 μL of ATP stock (1 mM ATP, 1× PBS 7.4, 0.1% BSA). The reaction was carried out at 30° C. for 10 minutes in a PCR machine and stopped by heating at 95° C. for 3 minutes. The cAMP concentrations were measured by the LANCE Ultra cAMP kit.
GN13 inhibition of Gαs proteins in HEK293 cell membranes (
a. Cell membrane preparation: HEK293cells, GNAS KO HEK293 cells were plated two day before transfection at a density of 1M cells per 10 cm plate. One plate of GNAS KO HEK293 cells was transfected with 4 μg of GNAS WT or GNAS S275L plasmids. After overnight transfection, cells were lifted with TypLE, washed, resuspended in stimulation buffer (1× PBS, protease inhibitor cocktail, 5 mM MgCl2). Cell membranes were disrupted by using the Dounce homogenizer for 25 strokes. Nuclei and unbroken cells were removed by centrifugation for 5 min at 500 g. The supernatant suspension was carefully removed and centrifuged for 30 min at 45K g. Cell membranes were suspended in stimulation buffer. The protein concentrations were measured using BCA, and were normalized to 750 μg/mL. A final concentration of 0.1% BSA was added into the cell membrane suspension. b: Adenylyl cyclase activity assay in cell membranes: 600 μL of cell membrane suspension was mixed with 60 μL of GTP/GDP stock (stock concentration: 10 mM/1 mM). 5.5 μL of the mixture from last step was mixed with 5.5 μL of GN13 and incubated at room temperature. After 2 hours, membrane/cyclic peptide mixture was transferred on ice for 5 minutes, followed by the addition of 2 μL of IBMX/ISO/ATP or IBMX/DMSO/ATP stock (5 mM IBMX, 0.2 mM ISO or DMSO, 2.5 mM ATP in stimulation buffer with 0.1% BSA). The reaction was carried out at 30° C. for 30 minutes in a PCR machine and stopped by heating at 95° C. for 3 minutes. The cAMP concentrations were measured by the LANCE Ultra cAMP kit.
cAMP concentrations measurement by the LANCE Ultra cAMP kit.
A cAMP standard curve was generated in the same plate using the 50 μM cAMP standard in the kit. Before the measurement, the samples were diluted by stimulation buffer (1× PBS 7.4, 0.1% BSA) to 1/60, 1/120, 1/240 or 1/480 to make sure the cAMP concentrations were in the dynamic range of the cAMP standard curve. 10 μL of each diluted sample was mixed with 5 μL of 4× Eu-cAMP tracer and 5 μL of 4× ULight-anti-cAMP in a white, opaque Optiplate-384 microplate, incubated for 1 hour at room temperature, and the time-resolved fluorescence resonance energy transfer (TR-FRET) signals were read on a Spark 20M plate reader. The cAMP standard curve was fitted by the software GraphPad Prism using the following equation in which “Y” is the TR-FRET signal and “X” is the log of cAMP standard concentration (M):
After obtained the values of the four parameters “Bottom”, “Top”, “LogIC50” and “HillSlope”, we used this equation to convert the TR-FRET signals of the samples into cAMP production values. The cyclic peptides dose dependent inhibition curves were fitted by the following equation to calculate the IC50 of each cyclic peptide:
in which “Y” is the cAMP production value, “X” is the log of cyclic peptide concentration (M).
Cyclic peptides GN13 (4 mM stock in DMSO) were diluted to 5× stocks with a series of concentrations (0, 0.0034, 0.0102, 0.0305, 0.0914, 0.274, 0.823, 2.47, 7.41, 22.2, 66.7, 200 μM) in 1×PBS 7.4, 0.1% BSA, 2 mM DTT, 2 mM MgCl2. WT Gαs and Gαs S275L mutant at a concentration of 4.6 mg/mL (about 100 μM) in 20 mM HEPES 8.0, 150 mM NaCl, 5 mM MgCl2 were diluted to 4 μM in EDTA GppNHp buffer (1× PBS 7.4, 0.1% BSA, 2 mM EDTA-Na 8.0, 2 mM DTT, 0.1 mM MgCl2, 1 mM GppNHp). After incubation at room temperature for 1 hour to allow nucleotide exchange, Gαs dilutions were mixed with equal volume of MgCl2 stock (3.8 mM MgCl2, 1× PBS 7.4, 0.1% BSA, 2 mM DTT) to lock Gαs in GppNHp-bound state. GppNHp-bound Gαs proteins were then diluted to 500 nM (5× stocks) in 1×PBS 7.4, 0.1% BSA, 2 mM DTT, 2 mM MgCl2 plus 0.5 mM GppNHp. In an OptiPlate-384 White Opaque 384-well Microplate, 5× Gαs proteins were mixed with 5× GN13 serial dilution stocks, 5× streptavidin XL665 stock (125 nM), 5× adenylyl cyclase stock (VC1:100 nM, IIC2:200 nM, FSK 0.5 mM) and 5× anti-6His-Tb cryptate stock (0.26 g/mL) in 1×PBS 7.4, 0.1% BSA, 2 mM DTT, 2 mM MgCl2 for 1 hour at room temperature. The plate was read on a TECAN Spark 20 M plate reader using the TR-FRET mode with the following parameters: Lag time: 70 s, Integration time: 500 s, Read A: Ex 320(25) nm (filter), Em 610(20) nm (filter), Gain 130, Read B: Ex 320(25) nm (filter), Em 665(8) nm (filter), Gain 165. FRET Signal was calculated as the ratio of [Read B]/[Read A].
WT Gαs was diluted to 6 μM (4×) in GTPase assay buffer (20 mM HEPES 7.5, 150 mM NaCl, 1 mM MgCl2). The protein was 1:1 (v:v) diluted with 4× cyclic peptide stock in GTPase assay buffer, and incubated at 37° C. for an hour. The samples were then 1:1 (v:v) diluted with reaction buffer (20 mM HEPES 7.5, 150 mM NaCl, 1 mM MgCl2, and 1 mM GTP) and incubated at 37° C. After 30, 50, 70, 90 minutes, 50 μL of the sample was removed to measure the inorganic phosphate (Pi) concentration by PiColorLock™ Phosphate Detection kit. A standard curve was made using the 0.1 mM Pi stock in the kit.
Gα proteins were diluted to 400 nM in the EDTA buffer (20 mM HEPES 7.5, 150 mM NaCl, 1 mM EDTA-Na 8.0, 2 mM DTT). [3H]GDP (1 mCi/mL, 25.2 μM) was added to a final concentration of 1.2 μM, followed by cyclic peptides addition. After incubation at 20° C. for 30 minutes, the same volume of assay buffer (20 μM HEPES-Na 7.5, 150 mM NaCl, 2 mM MgCl2, and 1 mM GDP) was added to initiate [3H]GDP dissociation. At various points, L of the sample was removed and mixed with 390 μL of ice-cold wash buffer (20 mM HEPES 7.5, 150 mM NaCl, 20 mM MgCl2). The mixture was immediately filtered through a mixed cellulose membrane (25 mm, 0.22 μm) held by a microanalysis filter holder (EMD Millipore). The membrane was washed by ice-cold wash buffer (500 μL×3), put in a 6-mL plastic vial and air-dried (room temperature 1.5 h). 5 mL of CytoScint-ES Liquid Scintillation Cocktail was added to each vial. After incubation overnight at room temperature, the vial was used for liquid scintillation counting with a LS 6500 Multi-Purpose Scintillation Counter.
The GDP dissociation curves were fitted by the software GraphPad Prism using the following equation to calculate the dissociation rates (koff):
in which “Y” is the radioactivity (Counts per minute) of the sample at time “X” (minutes), and Y0 is the calculated radioactivity of the sample at the time point 0.
Gα proteins were diluted to 10 μM with dilution buffer (20 mM HEPES 7.5, 150 mM NaCl, 1 mM MgCl2, 2 mM DTT, and 20 μM GDP) and incubated with 5× stocks of cyclic peptides at room temperature for 2 hours. GTPγS binding was initiated by mixing with the reaction buffer at room temperature (50 nM [35S]GTPγS and 100 μM GTPγS in dilution buffer) at room temperature. At various time points, 10 μL of the sample was removed and mixed with 390 μL of ice-cold wash buffer (20 mM HEPES 7.5, 150 mM NaCl, 20 mM MgCl2). The mixture was filtered through a mixed cellulose membrane (25 mm, 0.22 μm). The membrane was washed by ice-cold wash buffer (500 μL×3), put in a 6-mL plastic vial and air-dried (room temperature 1.5 h). 5 mL of CytoScint-ES Liquid Scintillation Cocktail (MP Biomedicals) was added to each vial. After incubation overnight at room temperature, the vial was used for liquid scintillation counting with a LS 6500 Multi-Purpose Scintillation Counter. A standard curve was generated using [35S]GTPγS. The radioactive activity (Counts per minute) of the samples were converted to the GTPγS concentration. The GTPγS binding curves were fitted by the software GraphPad Prism using the following equation to calculate the apparent GTPγS binding rates (kapp):
in which “Y” is the concentration of GTPγS that bound to Gα protein at time “X” (minutes).
Biotinylated avi-Gαs (6-end, WT) and avi-Gαi (FL, WT) were diluted to 32 nM (8×) using assay buffer (1× PBS 7.4, 2 mM DTT, 0.1% BSA, 2 mM MgCl2, 0.05% Tween plus 0.5 mM GDP), followed by mixing with a same volume of 8× streptavidin XL665 stock (32 nM in the assay buffer). 8× His-Gβ/γ (C68S) stock (16 nM) and 8× anti-6His-Tb cryptate stock (0.4 μg/mL) were added into the Gα/XL665 mixtures. Finally, 2× stocks of cyclic peptides were added with the protein mixtures. After incubation at room temperature for 2 hour at room temperature. The plate was read on a TECAN Spark 20 M plate reader using the TR-FRET mode with the following parameters: Lag time: 70 s, Integration time: 500 s, Read A: Ex 320(25) nm (filter), Em 610(20) nm (filter), Gain 130, Read B: Ex 320(25) nm (filter), Em 665(8) nm (filter), Gain 165. FRET Signal was calculated as the ratio of [Read B]/[Read A].
GN13/GppNHp/Gαs complex: Wild type Gαs (residues 7-380) that was preloaded with GppNHp and purified by gel filtration was concentrated to 10 mg/mL. The protein was then mixed with 1 mM of GppNHp (50 mM stock in H2O) and 0.42 mM of the cyclic peptide GN13 (14 mM stock in DMSO). For crystallization, 0.2 μL of the protein sample was mixed with 0.2 μL of the well buffer containing 0.1 M HEPES 7.2, 20% PEG4000, 10% v/v 2-propanol. Crystals were grown at 20° C. in a 96-well plate using the hanging-drop vapour-diffusion method, transferred to a cryoprotectant solution (0.1 M HEPES 7.2, 20% PEG4000, 10% v/v 2-propanol, 150 mM NaCl, 20 mM HEPES 8.0, 5 mM MgCl2, 1 mM GppNHp, 25% v/v glycerol), and flash-frozen in liquid nitrogen.
GD20/GDP/Gαs complex: Wild type Gαs (NCBI Reference Sequence: NP_536351.1, residues 35-380) was preloaded with GDP, purified by gel filtration and then concentrated to 11.6 mg/mL. Before crystallization, the protein was mixed with 5 mM of Dithiothreitol (0.5 M stock in H2O), 1 mM of GDP (50 mM stock in H2O) and 0.76 mM of the cyclic peptide GD20 (42.6 mM stock in DMSO). For crystallization, 1.5 μL of the protein sample was mixed with 1.5 μL of the well buffer containing 0.1 M Tris 8.2, 26% PEG4000, 0.8 M LiCl. Crystals were grown at 20° C. in a 15-well plate using the hanging-drop vapour-diffusion method, and flash-frozen in liquid nitrogen.
The data set was collected at the Advanced Light Source beamline 8.2.1 with X-ray at a wavelength of 0.999965 Å. Then the data set was integrated using the HKL2000 package (Otwinowski and Minor, 1997), scaled with Scala (Evans., 2006) and solved by molecular replacement using Phaser (McCoy et al., 2007) in CCP4 software suite (Winn et al., 2011). The crystal structure of GDP-bound human Gαs R201C/C237 mutant (PDB code: 6AU6) was used as the initial model. The structure was manually refined with Coot (Emsley et al., 2010) and PHENIX (Adams et al., 2010). Data collection and refinement statistics are shown in Table 1 and Table 2.
The cell lines used for CAPA were HeLa cell lines, generated by Chenoweth and co-workers, that stably express HaloTag exclusively in the cytosol (Peraro et al., 2018). Cells were seeded in a 96-well plate the day before the experiment at a density of 4×104 cells per well. The day of the experiment the media was aspirated, and 100 μL of cyclic peptide dilutions in DMEM were added to the cells. Plate was incubated for 19.5 h at 37° C. with 5% CO2. The contents of the wells were aspirated off, and wells were washed using fresh Opti-MEM for 15 min. The wash was aspirated off, and the cells were chased using 5 μM ct-TAMRA for 15 min, except for the No-ct-TAMRA control wells, which were incubated with Opti-MEM alone. The contents of the wells were aspirated and washed with fresh Opti-MEM for 30 min. After aspiration, cells were rinsed once with phosphate-buffered saline (PBS). The cells were then trypsinized, quenched with DMEM, resuspended in PBS, and analyzed using a benchtop flow cytometer (CytoFLEX, Beckman).
The plasmids encoding M2R was a gift from Dr. Roderick Mackinnon. The plasmids encoding Gα-RLuc8, Gβ1, and Gγ1-GFP2 were gifts from Dr. Bryan Roth. The plasmid encoding Gγ2-GFP2 was generated by replacing the Gγ1 sequence of pcDNA3.1-GGammal-GFP2 by digestion with BamHI/XbaI and subsequent insertion of the Gγ2 sequence (MASNNTASIAQARKLVEQLKMEANIDRIKVSKAAADLMAYCEAHAKEDPLLTPVP ASENPFREKKFFCAIL (SEQ ID NO: 9)). All plasmids were sequenced to ensure their identities.
The BRET2 assay was conducted as reported (Olsen et al., 2020). Cells were plated in 10 cm dishes at 3 million cells per dish the night before transfection. Cells were transfected using a 6:6:3:1 DNA ratio of receptor:Gα-RLuc8:Gβ:Gγ-GFP2 (750:750:375:125 ng for 10 cm dishes). Transit 2020 was used to complex the DNA at a ratio of 3 μL Transit per μg DNA, in OptiMEM (Gibco-ThermoFisher) at a concentration of 10 ng DNA per μl OptiMEM. 16 hours after transfection, cells were harvested from the plate using TrypLE and plated in poly-D-lysine-coated white, clear-bottom 96-well assay plates (Greiner Bio-One) at a density of 30,000 cells per well.
8 hours after plating in 96-well assay plates, media was replaced with 100 μL of cyclic peptide dilutions in DMEM with 1% dialyzed FBS. 16 hours after drug treatment at 37° C. with 5% CO2, white backings (PerkinElmer) were applied to the plate bottoms, and growth medium was carefully aspirated and replaced immediately with 60 μL of drug dilutions in assay buffer (1×Hank's balanced salt solution (HBSS)+20 mM HEPES, pH 7.4), followed by a 10 μl addition of freshly prepared 50 μM coelenterazine 400a. After a 5 min equilibration period, cells were treated with 30 μL of GPCR agonist or DMSO dilutions in assay buffer for an additional 5 min. Plates were then read in a TECAN Spark 20 M plate reader with 395 nm (RLuc8-coelenterazine 400a) and 510 nm (GFP2) emission filters, at integration times of 1 s per well. Plates were read serially six times, and measurements from the fourth read were used in all analyses. BRET2 ratios were computed as the ratio of the GFP2 emission to RLuc8 emission.
Chemical Stability Assay in DMEM with 10% FBS or Human Plasma
These assays were conducted by Pharmaron Beijing CO., Ltd. Cyclic peptides working solutions were prepared at 10 μM in DMEM with 10% FBS (Avantor, Cat #76294-180) or human plasma (Pooled, Male & Female, BioIVT, Cat #HMN666664). The assays were performed in duplicate. Vials were incubated at 37° C. at 60 rpm in a water bath and taken at designated time points including 0, 480, 1080 and 1440 min. For each time point, the initiation of the reaction was staggered so all the time points were terminated with cold acetonitrile containing internal standards (IS, 100 nM alprazolam, 200 nM labetalol, 200 nM Imipramine and 2 μM ketoplofen) at the same time. Samples were vortexed then centrifuged at 4° C. to remove proteins. The supernatants from centrifugation were diluted by ultra-pure H2O and used for LC-MS/MS analysis. All calculations were carried out using GraphPad Prism. Remaining percentages of parent compounds at each time point were estimated by determining the peak area ratios from extractedion chromatograms.
Macrocyclic peptides (25 μmol scale) were synthesized by a standard Fmoc solid phase peptide synthesis method using a Syro Wave automated peptide synthesizer (Biotage) (Morimoto et al., 2012). After addition of a chloroacetyl group onto the N-terminal amide group (for the formation of cyclic peptide), peptides were cleaved from the NovaPEG Rink Amide resin (Novabiochem) by a solution of 92.5% trifluoroacetic acid (TFA), 2.5% 3,6-Dioxa-1,8-octanedithiol ethanedithiol (DODT), 2.5% triisopropylsilane (TIPS) and 2.5% water and precipitated by diethyl ether. To conduct the macrocyclization reaction, the peptide pellet was dissolved in 10 ml DMSO containing 10 mM tris(2-carboxyethyl)phosphine hydrochloride (TCEP), adjusted to pH>8 by addition of triethylamine (TEA) and incubated at 25° C. for 1 hour. This cyclization reaction was quenched by acidification of the solution with TFA. The crude products were purified by reverse-phase HPLC (RP-HPLC) (Shimadzu) with a Chromolith RP-18 100-25 prep column. Molecular masses were verified by a time-of-flight mass spectrometer (Waters Xevo G2-XS), and the purity was verified by analytical HPLC on a Waters Acquity UPLC BEH C18 1.7 μm column.
In this work, we prepared a chloroalkane tag (ct) that has been previously used with the HaloTag system (Neklesa et al., 2011). Instead of using the Rink amide resin, peptides were synthesized using the Fmoc-Wang resin (Anaspec, AS-20058) to generate a carboxylate at the C-terminus. To cap the C-terminus with the chloroalkane tag (ct), 10 equiv of chloroalkane tag (ct), 5 equiv of HATU, and 20 equiv of DIPEA were dissolved in DMF and stirred for 1 hour at room temperature. Crude peptides were purified by reverse-phase HPLC (Waters XBridge C18 column 5 m particle size 30×250 mm, 5-95% acetonitrile-water+0.1% formic acid, 40 min, 20 mL/min) to afford the chloroalkane tagged peptides.
GN13: HRMS (ESI): Calcd for (C79H106N16O21S+2H)2+:824.3798, Found: 824.3973.
GD20: HRMS (ESI): Calcd for (C90H126N22O20S+2H)2+:934.4698, Found: 934.4844.
GD20-F10L: HRMS (ESI): Calcd for (C87H128N22O20S+2H)2+:917.4776, Found: 917.4901.
GD20-F5A: HRMS (ESI): Calcd for (C84H128N22O20S+2H)2+:896.4542, Found: 896.4604.
GD20-F10L/F5A: HRMS (ESI): Calcd for (C81H124N22O20S+2H)2+:879.4620, Found: 879.4648.
ct-GN13-E3Q: HRMS (ESI): Calcd for (C89H126ClN17O22S+2H)2+:926.9416, Found: 926.9422.
ct-GD20: HRMS (ESI): Calcd for (C100H145ClN22O22S+2H)2+:1037.5235, Found: 1037.5303.
ct-GD20-F10L: HRMS (ESI): Calcd for (C97H147ClN22O22S+2H)2+:1020.5313, Found: 1020.5193.
Absorbance was recorded at 280 nm.
All of the curves in Figures except those from the BLI experiments were fitted by GraphPad Prism. Raw kinetic data collected from the BLI experiments were processed with the Data Analysis software provided by the manufacturer. All the details can be found in the figure legends and in the Method Details. The data collection and refinement statistics of the crystal structures can be found in Table 1 and Table 2 (related to
aValues in parentheses are for highest-resolution shell.
aValues in parentheses are for highest-resolution shell.
a Values represent 95% confidence intervals. The data were analyzed from two independent replicates.
a Values represent 95% confidence intervals. The data were analyzed from two independent replicates.
This application claims the benefit of U.S. Provisional Application No. 63/179,958, filed Apr. 26, 2021, which is incorporated herein by reference in its entirety and for all purposes.
This invention was made with government support under grant no. R01 CA244550 awarded by The National Institutes of Health. The government has certain rights in the invention.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/US2022/026346 | 4/26/2022 | WO |
| Number | Date | Country | |
|---|---|---|---|
| 63179958 | Apr 2021 | US |
