Patent Application
20240116998
Incorporated by reference in its entirety is a computer-readable nucleotide/amino acid sequence listing submitted concurrently herewith and identified as follows: 59 kilobytes acii (text) file named “333142seqlist_ST25.txt,” created on Feb. 14, 2022.
Glucagon-like peptide-1 (GLP-1) plays an important role in regulating blood glucose levels in humans. Its actions include stimulation of insulin synthesis and secretion, inhibition of glucagon secretion, and inhibition of food intake. Normally, the body maintains the concentration of glucose in the blood within a range of about 70 to 110 milligrams per deciliter (mg/dL), or 3.9 to 6 1 millimoles per liter (mmol/L). However, conditions can arise where glucose level becomes too low, leading to hypoglycemia. Hypoglycemia is most often caused by drugs taken to control diabetes. Much fewer common causes of hypoglycemia are referred to herein as “atypical hypoglycemia”, and can occur independent of exogenous insulin administration.
Atypical hypoglycemia can occur in people who drink heavily without eating, as alcohol can block the formation of glucose in the liver. In addition, people with advanced liver disease, such as viral hepatitis, cirrhosis, or cancer of the liver may not be able to store and produce sufficient glucose. Atypical hypoglycemia can also result in infants and children that have a congenital mutation that render them hyperinsulinemic.
More recently, over the course of the last decade there has been an increased awareness that atypical hypoglycemia is a complication that can arise after surgical procedures performed for the purpose of reversing extreme forms of obesity. Some patients (less than 10%) receiving Roux-en-Y gastric bypass (RYGB) surgeries subsequently develop hyperinsulinemic hypoglycemia, wherein blood glucose concentrations can become low enough (20-40 mg/dL) to cause seizures, altered mental status, loss of consciousness, cognitive dysfunction, disability, and death.
One approach to treating hyperinsulinemic-induced hypoglycemia is to administer a GLP-1 receptor antagonist. Such peptide antagonists block the ability of inappropriately elevated concentrations of plasma GLP-1 to stimulate insulin secretion, and function to normalize plasma glucose and reduce risk of cognitive impairment, vascular disease and potentially sudden death in patients experiencing atypical hypoglycemia.
Exendin-4 (SEQ ID NO: 1) is a 39 amino acid agonist of the glucagon-like peptide 1 (GLP-1) receptor. Exendin-4 is present in the saliva of the Gila monster, Heloderma suspectum. Ex-4 (9-39)a (SEQ ID NO: 2) is an N-terminal truncated derivative of Exendin-4 that is known to function as a GLP-1 receptor antagonist. However, Ex-4 (9-39)a suffers from two notable limitations regarding its potential use to treat chronic atypical hypoglycemia: its nonhuman amino acid sequence, and its relatively short in vivo duration of action.
In accordance with one embodiment of the present disclosure a set of novel optimized GLP-1 antagonists are provided for use as drug candidates in treatment of atypical hypoglycemia, including hyperinsulinemic induced hypoglycemia resulting after post-bariatric surgical procedures or resulting from congenital mutations.
As disclosed herein compositions and methods are provided for treating patients experiencing atypical hypoglycemia, and more particularly in one embodiment, treating patients who experience hyperinsulinemia induced hypoglycemia. In accordance with one embodiment compositions and methods are provided for treating hyperinsulinemia induced hypoglycemia resulting after post-bariatric surgery. In one embodiment the method comprises the administration of a glucagon-like peptide-1 receptor antagonist (GLP1RA) in an amount effective to elevate blood glucose levels and alleviate associated acute symptoms and chronic outcomes associated with hypoglycemia.
In accordance with one embodiment a GLP-1 receptor antagonist peptide is provided comprising the amino acid sequence
In accordance with one embodiment a GLP-1 receptor antagonist peptide is provided having the amino acid sequence of
wherein
In accordance with one embodiment a GLP-1 receptor antagonist peptide is provided comprising the amino acid sequence
In accordance with one embodiment a GLP-1 receptor antagonist peptide is provided having the amino acid sequence of
wherein
In one embodiment 1 to 3 amino acids are added to the N-terminus of the peptide of SEQ ID NO: 5 or an analog thereof. In one embodiment one of the amino acids comprising the N-terminal extension is an acylated amino acid. In one embodiment the N-terminal extension is a dipeptide, X7X8-, wherein X7 is an acylated lysine, optionally wherein the lysine is in the D-conformation and X8 is any amino acid. In one embodiment the N-terminal extension is a self-cleaving dipeptide linked to the N-terminal alpha amine of a 9-29 exendin4 analog (e.g., a peptide of SEQ ID NO: 5) to form a prodrug of any of the GLP-1 antagonist of the present disclose. One advantage of using a prodrug derivative of a GLP-1 antagonist is that such an approach extends peptide's biological half-life based on a strategy of inhibiting recognition of the prodrug by the GLP-1 receptor. In one embodiment the prodrug derivative comprises a self-cleaving dipeptide (A-B) covalently linked to the GLP-1 antagonist wherein the dipeptide is cleaved under physiological conditions and in the absence of enzymatic activity to restore full activity to the GLP-1 antagonist. In one embodiment the GLP-1 antagonist is modified by the covalent linkage of one or more dipeptides (A-B) to an amine of GLP-1 antagonist, wherein A is an amino acid or a hydroxy acid and B is an N-alkylated amino acid linked to the GLP-1 antagonist through an amide bond between a carboxyl moiety of B and an amine of the GLP-1 antagonist. In one embodiment, A-B comprises the structure:
The present disclosure moreover provides pharmaceutical compositions comprising any of the GLP-1 antagonist peptides and variant peptides described herein and a pharmaceutically acceptable carrier, diluent, or excipient. In one embodiment a method of treating a patient suffering from atypical hypoglycemia is provided wherein the method comprises the step of administering to a patient in need thereof a pharmaceutical composition comprising a GLP-1 antagonist peptide or variant peptides described herein in an amount effective to elevate blood glucose levels.
In accordance with one embodiment a method of treating atypical hypoglycemia is provided wherein the method comprises the steps of administering a GLP-1 receptor antagonist peptide having the amino acid sequence of
In one embodiment a GLP-1 receptor antagonist is provided, wherein the antagonist comprises the amino acid sequence of
wherein
In one embodiment a GLP-1 receptor antagonist is provided wherin the antagonist comprises the amino acid sequence of
wherein
In one embodiment the GLP-1 receptor antagonists of the present disclosure are acylated with a fatty acid or diacid group of sufficient size to bind serum albumin with high affinity, optionally wherein the acylated amino acid is the C-terminal amino acid, and optionally further modified by the linkage of a self-cleaving dipeptide via an amide bond, wherein an amino acid of the dipeptide is optionally acylated with a fatty-acyl group of sufficient size to bind serum albumin with high affinity. In one embodiment an acylated amino acid is added to the C-terminus of SEQ ID NO: 11 at position 40 and optionally the added acylated amino acid is Lys acylated with a C14-C20 fatty acid or fatty diacid, optionally linked to the amino acid side chain via any of the spacers disclosed herein.
In one embodiment the pharmaceutical compositions for treating atypical hypoglycemia comprise any of the GLP-1 receptor antagonist disclosed herein in combination with any existing therapeutics useful for treating hypoglycemia. For example, the pharmaceutical composition may include a GLP-1 receptor antagonist of the present invention and one or more of the following: glucose supplements (e.g., dextrose); glucose-elevating agents such as glucagon and glucagon analogs and inhibitors of insulin secretion (e.g., diazoxide, octreotide).
N-Me, G8, R12, E24, R28) K40[mPEG-γE-C16]
In describing and claiming the invention, the following terminology will be used in accordance with the definitions set forth below.
The term “about” as used herein means greater or lesser than the value or range of values stated by 10 percent but is not intended to designate any value or range of values to only this broader definition. Each value or range of values preceded by the term “about” is also intended to encompass the embodiment of the stated absolute value or range of values.
As used herein the term “amino acid” encompasses any molecule containing both amino and carboxyl functional groups, wherein the amino and carboxylate groups are attached to the same carbon (the alpha carbon). The alpha carbon optionally may have one or two further organic substituents. An amino acid can be designated by its three-letter code, one letter code, or in some cases by the name of its side chain. For example, a non-canonical amino acid comprising a cyclohexane group attached to the alpha carbon is termed “cyclohexane” or “cyclohexyl.” For the purposes of the present disclosure designation of an amino acid without specifying its stereochemistry is intended to encompass either the L or D form of the amino acid, or a racemic mixture. However, in the instance where an amino acid is designated by its three letter code (i.e., Lys), such a designation is intended to specify the native L form of the amino acid, whereas the D form will be specified by inclusion of a lower case d before the three letter code or single code (i.e., dLys or dK).
As used herein the term “hydroxyl acid” refers to amino acids that have been modified to replace the alpha carbon amino group with a hydroxyl group.
As used herein the term “non-coded amino acid” encompasses any amino acid that is not an L-isomer of any of the following 20 amino acids: Ala, Cys, Asp, Glu, Phe, Gly, His, Ile, Lys, Leu, Met, Asn, Pro, Gln, Arg, Ser, Thr, Val, Trp, Tyr.
A “bioactive polypeptide” refers to polypeptides which can exert a biological effect in vitro and/or in vivo.
As used herein a general reference to a peptide is intended to encompass peptides that have modified amino and carboxy termini. For example, an amino acid sequence designating the standard amino acids is intended to encompass standard amino acids at the N- and C-terminus as well as a corresponding hydroxyl acid at the N-terminus and/or a corresponding C-terminal amino acid modified to comprise an amide group in place of the terminal carboxylic acid.
As used herein an “acylated” amino acid is an amino acid comprising an acyl group which is non-native to a naturally occurring amino acid, regardless by the means by which it is produced. Exemplary methods of producing acylated amino acids and acylated peptides are known in the art and include acylating an amino acid before inclusion in the peptide or peptide synthesis followed by chemical acylation of the peptide. In some embodiments, the acyl group causes the peptide to have one or more of (i) a prolonged half-life in circulation, (ii) a delayed onset of action, (iii) an extended duration of action, (iv) an improved resistance to proteases, and (v) increased potency at the GLP-1 receptor.
As used herein, an “alkylated” amino acid is an amino acid comprising an alkyl group which is non-native to a naturally occurring amino acid, regardless of the means by which it is produced. Exemplary methods of producing alkylated amino acids and alkylated peptides are known in the art and including alkylating an amino acid before inclusion in the peptide or peptide synthesis followed by chemical alkylation of the peptide. Without being held to any particular theory, it is believed that alkylation of peptides will achieve similar, if not the same, effects as acylation of the peptides, e.g., a prolonged half-life in circulation, a delayed onset of action, an extended duration of action, an improved resistance to proteases.
As used herein, the term “pharmaceutically acceptable carrier” includes any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions such as an oil/water or water/oil emulsion, and various types of wetting agents. The term also encompasses any of the agents approved by a regulatory agency of the US Federal government or listed in the US Pharmacopeia for use in animals, including humans.
As used herein the term “pharmaceutically acceptable salt” refers to salts of compounds that retain the biological activity of the parent compound, and which are not biologically or otherwise undesirable. Many of the compounds disclosed herein are capable of forming acid and/or base salts by virtue of the presence of amino and/or carboxyl groups or groups similar thereto.
As used herein, the term “hydrophilic moiety” refers to any compound that is readily water-soluble or readily absorbs water, and which are tolerated in vivo by mammalian species without toxic effects (i.e. are biocompatible). Examples of hydrophilic moieties include polyethylene glycol (PEG), polylactic acid, polyglycolic acid, a polylactic-polyglycolic acid copolymer, polyvinyl alcohol, polyvinylpyrrolidone, polymethoxazoline, polyethyloxazoline, polyhydroxyethyl methacrylate, polyhydroxypropyl methacrylamide, polymethacrylamide, polydimethylacrylamide, and derivatized celluloses such as hydroxymethylcellulose or hydroxyethylcellulose and co-polymers thereof, as well as natural polymers including, for example, albumin, heparin and dextran.
As used herein, the term “treating” includes alleviation of the symptoms associated with a specific disorder or condition and/or preventing or eliminating said symptoms. For example, as used herein the term “treating hypoglycemia” will refer in general to maintain or increase blood glucose levels to near normal levels.
As used herein an “effective” amount or a “therapeutically effective amount” of a GLP-1 receptor antagonist refers to a nontoxic but sufficient amount of a GLP-1 antagonist to provide the desired effect. For example, one desired effect would be the prevention or treatment of hypoglycemia. The amount that is “effective” will vary from subject to subject, depending on the age and general condition of the individual, mode of administration, and the like. Thus, it is not always possible to specify an exact “effective amount.” However, an appropriate “effective” amount in any individual case may be determined by one of ordinary skill in the art using routine experimentation.
The term, “parenteral” means not through the alimentary canal but by some other route such as intranasal, inhalation, subcutaneous, intramuscular, intraspinal, or intravenous.
As used herein the term “derivative” is intended to encompass chemical modification to a compound (e.g., an amino acid), including chemical modification in vitro, e.g. by introducing a group in a side chain in one or more positions of a polypeptide, e.g. a nitro group in a tyrosine residue, or iodine in a tyrosine residue, or by conversion of a free carboxylic group to an ester group or to an amide group, or by converting an amino group to an amide by acylation, or by acylating a hydroxy group rendering an ester, or by alkylation of a primary amine rendering a secondary amine or linkage of a hydrophilic moiety to an amino acid side chain. Other derivatives are obtained by oxidation or reduction of the side-chains of the amino acid residues in the polypeptide.
The term “identity” as used herein relates to the similarity between two or more sequences. Identity is measured by dividing the number of identical residues by the total number of residues and multiplying the product by 100 to achieve a percentage. Thus, two copies of exactly the same sequence have 100% identity, whereas two sequences that have amino acid deletions, additions, or substitutions relative to one another have a lower degree of identity. Those skilled in the art will recognize that several computer programs, such as those that employ algorithms such as BLAST (Basic Local Alignment Search Tool, Altschul et al. (1993) J. Mol. Biol. 215:403-410) are available for determining sequence identity.
As used herein, the term “selectivity” of a molecule for a first receptor relative to a second receptor refers to the following ratio: EC50 of the molecule at the second receptor divided by the EC50 of the molecule at the first receptor. For example, a molecule that has an EC50 of 1 nM at a first receptor and an EC50 of 100 nM at a second receptor has 100-fold selectivity for the first receptor relative to the second receptor.
As used herein an amino acid “modification” refers to a substitution of an amino acid, or the derivation of an amino acid by the addition and/or removal of chemical groups to/from the amino acid, and includes substitution with any of the 20 amino acids commonly found in human proteins, as well as atypical or non-naturally occurring amino acids. Commercial sources of atypical amino acids include Sigma-Aldrich (Milwaukee, WI), ChemPep Inc. (Miami, FL), and Genzyme Pharmaceuticals (Cambridge, MA). Atypical amino acids may be purchased from commercial suppliers, synthesized de novo, or chemically modified or derivatized from naturally occurring amino acids.
As used herein an amino acid “substitution” refers to the replacement of one amino acid residue by a different amino acid residue.
As used herein, the term “conservative amino acid substitution” is defined herein as exchanges within one of the following five groups:
Throughout the application, all references to a particular amino acid position by number (e.g., position 28) refer to the amino acid at that position in native Exendin4 (SEQ ID NO: 1) or the corresponding amino acid position in any analogs thereof. For example, a reference herein to “position 28” would mean the corresponding position 27 for an analog of Exendin4 in which the first amino acid of SEQ ID NO: 1 has been deleted. Accordingly 9-39 Exendin4 represents a N-terminally truncated Exendin4 peptide wherein the first 8 amino acids have been deleted. In addition a reference to a position greater than 39 (native Exendin4 only has 39 amino acids) is intended to refer to amino acid position in an analog having a C-terminus amino acid extension after the corresponding position 39 of SEQ ID NO: 1.
As used herein the general term “polyethylene glycol chain” or “PEG chain”, refers to mixtures of condensation polymers of ethylene oxide and water, in a branched or straight chain, represented by the general formula H(OCH2CH2)nOH, wherein n is at least 2. “Polyethylene glycol chain” or “PEG chain” is used in combination with a numeric suffix to indicate the approximate average molecular weight thereof. For example, PEG-5,000 refers to polyethylene glycol chain having a total molecular weight average of about 5,000 Daltons.
As used herein the term “pegylated” and like terms refers to a compound that has been modified from its native state by linking a polyethylene glycol chain to the compound. A “pegylated polypeptide” is a polypeptide that has a PEG chain covalently bound to the polypeptide.
As used herein the term “miniPEG” or “OEG” defines a functionalized polyethylene compound comprising the structure:
As used herein a “linker” or “spacer” is a bond, molecule or group of molecules that binds two separate entities to one another. Linkers may provide for optimal spacing of the two entities or may further supply a labile linkage that allows the two entities to be separated from each other. Labile linkages include photocleavable groups, acid-labile moieties, base-labile moieties, and enzyme-cleavable groups.
As used herein a “dimer” is a complex comprising two subunits covalently bound to one another via a linker. The term dimer, when used absent any qualifying language, encompasses both homodimers and heterodimers. A homodimer comprises two identical subunits, whereas a heterodimer comprises two subunits that differ, although the two subunits are substantially similar with one another.
As used herein the term C16-C20 fatty acid designates the structure: —CO(CH2)14-20CH3 and the term C16-C20 diacid designates the structure: —CO(CH2)14-20COOH, wherein the prefix “C16-C20” designates the variable total number of carbons in the compounds encompassed by the designation. For example, a C18 diacid represents the structure: —CO(CH2)16COOH. As used herein a generic reference to an acylated amino acid encompasses both an amino acid having its side chain acylated with a fatty acid and an amino acid having its side chain acylated with a diacid.
Physiological conditions as disclosed herein are intended to include a temperature of about 35 to 40° C. and a pH of about 7.0 to about 7.4, and more typically include a pH of 7.2 to 7.4 and a temperature of 36 to 38° C. Since physiological pH and temperature are tightly regulated in humans within a highly defined range, the speed of conversion from dipeptide/drug complex (prodrug) to drug will exhibit high intra and interpatient reproducibility.
The term “C1-Cn alkyl” wherein n can be from 1 through 6, as used herein, represents a branched or linear alkyl group having from one to the specified number of carbon atoms. Typical C1-C6 alkyl groups include, but are not limited to, methyl, ethyl, n-propyl, iso-propyl, butyl, iso-Butyl, sec-butyl, tert-butyl, pentyl, hexyl and the like.
The terms “C2-Cn alkenyl” wherein n can be from 2 through 6, as used herein, represents an olefinically unsaturated branched or linear group having from 2 to the specified number of carbon atoms and at least one double bond. Examples of such groups include, but are not limited to, 1-propenyl, 2-propenyl (—CH2—CH═CH2), 1,3-butadienyl, (—CH═CHCH═CH2), 1-butenyl (—CH═CHCH2CH3), hexenyl, pentenyl, and the like.
The term “C2 -Cn alkynyl” wherein n can be from 2 to 6, refers to an unsaturated branched or linear group having from 2 to n carbon atoms and at least one triple bond. Examples of such groups include, but are not limited to, 1-propynyl, 2-propynyl, 1-butynyl, 2-butynyl, 1-pentynyl, and the like.
As used herein the term “aryl” refers to a mono- or bicyclic carbocyclic ring system having one or two aromatic rings including, but not limited to, phenyl, naphthyl, tetrahydronaphthyl, indanyl, indenyl, and the like. The size of the aryl ring and the presence of substituents or linking groups are indicated by designating the number of carbons present. For example, the term “(C1-C3 alkyl)(C6-C10 aryl)” refers to a 5 to 10 membered aryl that is attached to a parent moiety via a one to three membered alkyl chain.
The term “heteroaryl” as used herein refers to a mono- or bi-cyclic ring system containing one or two aromatic rings and containing at least one nitrogen, oxygen, or sulfur atom in an aromatic ring. The size of the heteroaryl ring and the presence of substituents or linking groups are indicated by designating the number of carbons present. For example, the term “(C1-Cn alkyl)(C5-C6 heteroaryl)” refers to a 5 or 6 membered heteroaryl that is attached to a parent moiety via a one to “n” membered alkyl chain
As used herein, the term “halo” refers to one or more members of the group consisting of fluorine, chlorine, bromine, and iodine.
As used herein the term “patient” without further designation is intended to encompass any warm blooded vertebrate domesticated animal (including for example, but not limited to livestock, horses, cats, dogs and other pets) and humans and is not limited to individuals under the direct care of a physician.
The term “isolated” as used herein means having been removed from its natural environment.
The term “purified,” as used herein relates to the isolation of a molecule or compound in a form that is substantially free of contaminants normally associated with the molecule or compound in a native or natural environment and means having been increased in purity as a result of being separated from other components of the original composition. The term “purified peptide” is used herein to describe a peptide which has been separated from other compounds including, but not limited to nucleic acid molecules, lipids and carbohydrates.
As used herein, the term “peptide” encompasses a sequence of 2 or more amino acids and typically less than 50 amino acids, wherein the amino acids are naturally occurring or coded or non-naturally occurring or non-coded amino acids. Non-naturally occurring amino acids refer to amino acids that do not naturally occur in vivo but which, nevertheless, can be incorporated into the peptide structures described herein. “Non-coded” as used herein refer to an amino acid that is not an L-isomer of any of the following 20 amino acids: Ala, Cys, Asp, Glu, Phe, Gly, His, Ile, Lys, Leu, Met, Asn, Pro, Gln, Arg, Ser, Thr, Val, Trp, Tyr.
As used herein, “partly non-peptidic” refers to a molecule wherein a portion of the molecule is a chemical compound or substituent that has biological activity and that does not comprise a sequence of amino acids.
A “peptidomimetic” refers to a chemical compound having a structure that is different from the general structure of an existing peptide, but that functions in a manner similar to the existing peptide, e.g., by mimicking the biological activity of that peptide. Peptidomimetics typically comprise naturally occurring amino acids and/or unnatural amino acids, but can also comprise modifications to the peptide backbone. For example, a peptidomimetic may include a sequence of naturally-occurring amino acids with the insertion or substitution of a non-peptide moiety, e.g. a retroinverso fragment, or incorporation of non-peptide bonds such as an azapeptide bond (CO substituted by NH) or pseudo-peptide bond (e.g. NH substituted with CH2), or an ester bond (e.g., depsipeptides, wherein one or more of the amide (—CONHR—) bonds are replaced by ester (COOR) bonds). Alternatively the peptidomimetic may be devoid of any naturally-occurring amino acids.
As used herein the term “charged amino acid” or “charged residue” refers to an amino acid that comprises a side chain that is negatively charged (i.e., de-protonated) or positively charged (i.e., protonated) in aqueous solution at physiological pH. For example, negatively charged amino acids include aspartic acid, glutamic acid, cysteic acid, homocysteic acid, and homoglutamic acid, whereas positively charged amino acids include arginine, lysine and histidine. Charged amino acids include the charged amino acids among the 20 amino acids commonly found in human proteins, as well as atypical or non-naturally occurring amino acids.
As used herein the term “acidic amino acid” refers to an amino acid that comprises a second acidic moiety (other than the alpha carboxylic acid of the amino acid), including for example, a side chain carboxylic acid or sulfonic acid group.
As used herein, the term “prodrug” is defined as any compound that undergoes chemical modification before exhibiting its full pharmacological effects.
As used herein, a “dipeptide” is the result of the linkage of an α-amino acid or α-hydroxyl acid to another amino acid, through a peptide bond.
As used herein the term “chemical cleavage” absent any further designation encompasses a non-enzymatic reaction that results in the breakage of a covalent chemical bond.
As used herein the term “atypical hypoglycemia” defines a condition of hypoglycemia occurring in a patient independent of exogenous insulin administration.
In accordance with one embodiment of the present disclosure, compositions and methods are provided for treating patients suffering from a hypoglycemic condition that results independently of exogenous insulin administration (i.e., atypical hypoglycemia). In accordance with the present disclosure a composition comprising a GLP-1 antagonist is administered to a patient suffering from atypical hypoglycemia in an amount sufficient to increase blood glucose levels and/or alleviate associated acute symptoms and chronic outcomes associated with hypoglycemia. In one embodiment the patient experiencing atypical hypoglycemia also has a condition of hyperinsulinemia. In one embodiment the hyperinsulinemic condition occurs after the patient has received bariatric surgery.
In accordance with one embodiment a GLP-1 receptor antagonist peptide is provided that is an analog of the peptide DVSSYLEEQAVREFIAWLVKGGPSSGAPPPSK (SEQ ID NO: 3), wherein the GLP-1 receptor antagonist differs from SEQ ID NO: 3 by 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 amino acid modifications, wherein the modifications are selected from amino acid substitutions, additions or modifications to the amino acid structure, including but not limited to acylation and/or amidation of the C terminal amino acid. In one embodiment the amino acid modification are amino acid substitutions at one or more of positions 12, 16, 18, 19, 24, 26, 27 and 28 of the peptide and/or substitution with the d-isomer at one or more of positions 15, 16, 17, 19, 20, 21 and 23 (numbering relative to native Exendin4 (SEQ ID NO: 1). In one embodiment the analog of SEQ ID NO: 3 is further modified by the acylation of the C-terminal amino acid side chain with a C16-C18 fatty acid or diacid, optionally via a spacer.
In accordance with one embodiment a GLP-1 receptor antagonist is provided comprising the amino acid sequence of DVSRYLEEQAVREFlEWLVRGGPSSGAPPPSK (SEQ ID NO: 4), or an amino acid sequence that differs from SEQ ID NO: 4 by 1, 2, 3, 4 or 5 amino acid substitutions while retaining GLP-1 receptor antagonist activity, with the proviso that the GLP-1 antagonist peptide does not comprise the sequence of SEQ ID NO: 3. In one embodiment a peptide is provided that differs from the peptide of SEQ ID NO: 4 by one or more of the following:
In accordance with one embodiment a GLP-1 receptor antagonist is provided comprising the amino acid sequence of R10-DVX11X12YLX15X16QAX19X20EFX23EWLVRGGPSSGAPPPSX40-R20 SEQ ID NO: 23), wherein
In one embodiment only one of positions 7, 12 and 40 of the peptide of SEQ ID NO: 23 comprises an acylated amino acid. In one embodiment two of positions 7, 12 and 40 of the peptide of SEQ ID NO: 23 comprises an acylated amino acid. In one embodiment the acylated amino acids at position 7, 12 and 40 are independently an amino acid comprising a structure of Formula I (optionally, Lys), or Formula II (optionally, Ser), wherein each of Formula I, and II is:
In one embodiment a peptide of SEQ ID NO: 23 is provided wherein R10 is X7X8-, wherein X7 is an acylated Lys or acylated dLys, X12 is Arg and X40 is an acylated Lys. In one embodiment a peptide of SEQ ID NO: 23 is provided wherein R10 is NH2-, X12 is an acylated Lys and X40 is an acylated Lys. In one embodiment a peptide of SEQ ID NO: 23 is provided wherein R10 is NH2-, X12 is Arg and X40 is an acylated Lys. In one embodiment the acylated amino acids of the peptide of SEQ ID NO: 23 are acylated Lys residues, optionally wherein the acylated Lys residues are independently acylated with a C14-C24 fatty acid or fatty diacid, or a C16-C18 fatty acid or fatty diacid, optionally wherein the fatty acid or fatty diacid is linked to the side chain of the Lys residue via any of the spacer molecules disclosed herein.
In accordance with one embodiment a GLP-1 receptor antagonist is provided comprising the amino acid sequence of
wherein
R10 is NH2 or a dipeptide of the structure: X7X8-, wherein X7 is an acylated amino acid, optionally acylated Lys or acylated dLys, and X8 is Gly or a C1-C4 N-alkylated Gly;
X11 is Trp, dTrp or Ser;
In accordance with one embodiment a GLP-1 receptor antagonist is provided comprising the amino acid sequence of
wherein
In accordance with one embodiment a GLP-1 receptor antagonist is provided comprising the amino acid sequence of
wherein
In one embodiment the GLP-1 antagonist peptide comprises an amino acid sequence of DVX11RYLQX15X16AVREFX23EWLVRGGPSSGAPPPSX40-R20 (SEQ ID NO: 25) wherein
In one embodiment the GLP-1 antagonist peptide comprises an amino acid sequence of
In one embodiment the GLP-1 antagonist peptide comprises an amino acid sequence of DVX11RYLEEQAVREFIEWLVRGGPSSGAPPPSX40R20 (SEQ ID NO: 6 or DVWRYLEEQAVREFIEWLVRGGPSSGAPPPSX40R20 (SEQ ID NO: 7) or an amino acid that differs from SEQ ID NO: 6 or SEQ ID NO: 7 by 1 or 2 amino acid substitutions, wherein X11 is Trp or dTrp, X40 is an amino acid having an acyl group of sufficient sized to bind serum albumin with high affinity linked to the side chain of the amino acid, optionally where the acyl group is linked via a spacer, and R20 is COOH or CONH2 optionally with an Aib substitution at any one of positions 16, 18, 19, 24, 26 or 28 relative the numbering of native Exendin4 (SEQ ID NO: 1) and optionally wherein the carboxy group of the C-terminal amino acid is substituted with an amide (i.e., R20 is CONH2). In one embodiment X40 is an amino acid comprising a structure of Formula I (optionally, Lys), Formula II (optionally, Ser), or Formula III (optionally, Cys), wherein each of Formulae I, II, and III, is:
In one embodiment the GLP-1 antagonist peptide comprises an amino acid sequence of
10), wherein X11 is Trp or dTrp, and X40 is an amino acid having an acyl group linked to the side chain of the amino acid, optionally via a spacer. In one embodiment X40 is an acylated Lys.
In accordance with one embodiment a GLP-1 receptor antagonist peptide is provided having the amino acid sequence of
wherein
In yet another aspect, the amino acid at position 1 of any of the GLP-1 receptor antagonists disclosed herein is modified to inhibit protease degradation of the peptide. In one embodiment, inhibition of proteases is accomplished by:
In one embodiment a peptide comprising the sequence of DVX11RYLEEQAVREFIEWLVRGGPSSGAPPPSX40R2 (SEQ ID NO: 6) is provided having up to 3 amino acid modifications relative to SEQ ID NO: 6, wherein XII is Trp or dTrp, X40 is an acylated amino acid, and R20 is COOH or CONH2-, wherein the peptide exhibits antagonist activity at the human GLP-1.
In one embodiment the GLP-1 receptor antagonist comprises a peptide selected from the group consisting of
wherein X40 is an acylated amino acid, optionally a Lys acylated with a C16-C18 fatty acid or diacid, and R20 is COOH or CONH2-, wherein the peptide exhibits antagonist activity at the human GLP-1.
Additional exemplified species of the present disclosure include those listed in Table 1:
γE-C16]-OH
dK(mPeg-γE-DiAcidC18)
K[miniPEG-gE-C16]-OH
dK(mPeg-γE-DiAcidC18)(N-iPr-
EG-gE-C16]-OH
EG-gE-C16]-OH
In one embodiment dimers and multimers comprising two or more GLP-1 receptor antagonist peptides of the present disclosure are prepared including homo- or hetero- multimers or homo- or hetero- dimers. Two or more GLP-1 receptor antagonist peptides can be linked together using standard linking agents and procedures known to those skilled in the art. For example, dimers can be formed between two peptides through the use of bifunctional thiol crosslinkers and bi-functional amine crosslinkers, particularly for GLP-1 receptor antagonist peptides comprising, or substituted with, cysteine, lysine, ornithine, homocysteine or acetyl phenylalanine residues. The dimer can be a homodimer or alternatively can be a heterodimer. In exemplary embodiments, the linker connecting the two (or more) analogs is PEG, e.g., a 5 kDa PEG, 20 kDa PEG. In some embodiments, the linker is a disulfide bond. For example, each monomer of the dimer may comprise a Cys residue (e.g., a terminal or internally positioned Cys) and the sulfur atom of each Cys residue participates in the formation of the disulfide bond. In exemplary aspects, each monomer of the dimer is linked via a thioether bond. In exemplary aspects, an epsilon amine of a Lys residue of one monomer is bonded to a Cys residue, which, in turn, is connected via a chemical moiety to the epsilon amine of a Lys residue of the other monomer.
In some embodiments, the monomers are connected via terminal amino acids (e.g., N-terminal or C-terminal, optionally wherein the amino acid is added to the terminus of a peptide to be dimerized), via internal amino acids, or via a terminal amino acid of at least one monomer and an internal amino acid of at least one other monomer. In some embodiments, the monomers of the multimer are attached together in a “tail-to-tail” orientation in which the C-terminal amino acids of each monomer are attached together. Alternatively, in one embodiment the multimer are attached together in a “head-to-head” orientation in which the N-terminal amino acids of each monomer are attached together.
In one embodiment the C-terminal amino acid of any of the GLP-1 antagonist peptides disclosed herein can be modified to replace the native carboxyl group with an amide. In one embodiment the C-terminal amino acid of any of the GLP-1 antagonist peptides disclosed herein comprises the native amino acid carboxyl group.
Pharmaceutical compositions comprising any of the GLP-1 receptor antagonist peptides, dimers, multimers, or conjugates of the present disclosures (or a combination thereof) and a pharmaceutically acceptable carrier, diluent, or excipient are further provided by the present disclosure. The pharmaceutical compositions are preferably sterile and suitable for parenteral administration.
In accordance with one embodiment a pharmaceutical composition is provided comprising any of the novel GLP-1 receptor antagonists disclosed herein, preferably at a purity level of at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99%, and a pharmaceutically acceptable diluent, carrier or excipient. Such compositions may contain a GLP-1 receptor antagonist as disclosed herein at a concentration of at least 0.1-10 mg/ml, or higher. In one embodiment the pharmaceutical compositions comprise aqueous solutions that are sterilized and optionally stored within various package containers. In other embodiments the pharmaceutical compositions comprise a lyophilized powder. The pharmaceutical compositions can be further packaged as part of a kit that includes a disposable device for administering the composition to a patient. The containers or kits may be labeled for storage at ambient room temperature or at refrigerated temperature. In one embodiment the pharmaceutical composition and/or kit comprises any of the GLP-1 receptor antagonists disclosed herein in combination with any existing therapeutics useful for treating hypoglycemia, including but not limited to glucose supplements (eg, dextrose); glucose-elevating agents such as glucagon and glucagon analogs and inhibitors of insulin secretion (eg, diazoxide, octreotide).
In accordance with one embodiment the pharmaceutical compositions disclosed herein are contemplated for use in methods of treating or preventing conditions of hypoglycemia, and more specifically treating or preventing atypical hypoglycemia, or medical conditions associated with hypoglycemia.
The compositions of the present disclosure can be administered using any standard routes of administration. Formulations suitable for parenteral administration include aqueous and non-aqueous, isotonic sterile injection solutions, which can contain antioxidants, buffers, bacteriostats, and solutes that render the formulation isotonic with the blood of the intended recipient, and aqueous and non-aqueous sterile suspensions that can include suspending agents, solubilizers, thickening agents, stabilizers, and preservatives. The term, “parenteral” means not through the alimentary canal but by some other route such as subcutaneous, intramuscular, intraspinal, or intravenous. In one embodiment a pharmaceutical composition comprising a GLP-1 receptor antagonist of the present disclosure is formulated for subcutaneous administration or intravenous administration. In one embodiment the GLP-1 receptor antagonist of the disclosure, alone or in combination with other suitable components, can be prepared as an aerosol formulation to be administered via inhalation.
In one embodiment the composition is formulated for oral delivery by coformulation of a GLP-1 receptor antagonist of the present disclosure with an absorption enhancer, which can sufficiently augment the absorption of the peptide antagonist. Sodium N-[8-(2-hydroxybenzoyl)amino]caprylate (SNAC) is a delivery agent that has been reported to enhance the permeability of a diverse spectrum of molecules, including peptides, such as insulin, GLP-1, calcitonin, and other macromolecules such as heparin. In accordance with one embodiment pharmaceutical compositions are provided for oral delivery wherein the composition comprises a GLP-1 receptor antagonist of the present disclosure and SNAC, optionally wherein the pharmaceutical composition is formulated as a tablet.
In accordance with one embodiment, any of the peptides, dimers or multimers disclosed herein that exhibit GLP-1 antagonist activity can be further modified to have an improved therapeutic index and an in vivo extended time of action when administered to a warm blooded mammal including, for example, homo sapiens. More particularly, in one embodiment the peptides and dimers disclosed herein are modified by the covalent linkage of an alkyl or acyl group to the side chain of an amino acid, optionally a lysine, serine or cysteine, of the antagonist peptide, wherein the alkyl or acyl group is of sufficient size to bind to serum albumin with high affinity. In one embodiment the alkylated or acylated amino acid is located at the C-terminus of the GLP-1 antagonist peptide or dimer. In one embodiment the GLP-1 antagonist peptide comprises two acylated amino acids. In one embodiment one or more of the amino acids of the GLP-1 receptor antagonist peptide is acylated with a fatty acid or fatty diacid, optionally a C16-C18 fatty acid or C16-C18 fatty diacid. In accordance with one embodiment one or more lysine resides of the GLP-1 antagonist peptide or dimer disclosed herein is modified by the covalent linkage of a C16-C18 fatty acid or C16-C18 fatty diacid the side chain of a lysine, optionally via a spacer. In one embodiment the acylated lysine residue is the C-terminal amino acid of the GLP-1 antagonist peptide. In one embodiment an acylated amino acid is present at position 40 of the GLP-1 antagonist peptide and at a second position selected from position 7 or 12. In embodiments having two or more acylated amino acids, the acylated amino acids can be the same or different, and the linked acyl group can be the same or different, provided the acyl group is of sufficient size to bind serum albumin. In one embodiment the acylated amino acid is a lysine wherein the side chain is linked to a C16-C18 fatty acid or C16-C18 fatty diacid, optionally via a spacer.
In one embodiment, a C16-C18 fatty acid or C16-C18 fatty diacid is linked to the side chain of an amino acid via a spacer, wherein the spacer comprises a miniPEG, a gamma Glu, or any multimer or combination of miniPEG and/or gamma Glu. In one embodiment any of the GLP-1 receptor antagonist peptides disclosed herein may be modified to comprise an acylated amino acid, optionally at a position selected from 7, 12 and 40, in reference to the native sequence of exendin4. In one embodiment the acylated amino acid is a lysine residue having a C16 to C18 fatty acid or C16 to C18 fatty diacid linked to the lysine side chain via a spacer comprising the structure:
In one embodiment the GLP-1 receptor antagonist peptide comprises an acylated Lys, optionally located at the C-terminus of the peptide, wherein the side chain of the Lys is acylated with a C16-C18 diacid, via a spacer comprising the structure: —[COCH2(OCH2CH2)kNH]q-(gamma glutamic acid)p-, wherein
In some embodiments any one of the GLP-1 antagonist peptides disclosed herein is conjugated to an immunoglobulin or portion thereof (e.g. variable region, CDR, or Fc region). Known types of immunoglobulins (Ig) include IgG, IgA, IgE, IgD or IgM. The Fc region is a C-terminal region of an Ig heavy chain, which is responsible for binding to Fc receptors that carry out activities such as recycling (which results in prolonged half-life), antibody dependent cell-mediated cytotoxicity (ADCC), and complement dependent cytotoxicity (CDC).
In some embodiments, any one of the GLP-1 antagonist peptides disclosed herein is conjugated to a hydrophilic moiety. Hydrophilic moieties can be covalently linked to the GLP-1 antagonist peptide under any suitable conditions used to react a protein with an activated polymer molecule. Activating groups which can be used to link the water soluble polymer to one or more proteins include without limitation sulfone, maleimide, sulfhydryl, thiol, triflate, tresylate, azidirine, oxirane, 5-pyridyl, and alpha-halogenated acyl group (e.g., alpha-iodo acetic acid, alpha-bromoacetic acid, alpha-chloroacetic acid). If attached to the peptide by reductive alkylation, the polymer selected should have a single reactive aldehyde so that the degree of polymerization is controlled. See, for example, Kinstler et al., Adv. Drug. Delivery Rev. 54:477-485 (2002); Roberts et al., Adv. Drug Delivery Rev. 54:459-476 (2002); and Zalipsky et al., Adv. Drug Delivery Rev. 16:157-182 (1995).
Suitable hydrophilic moieties include polyethylene glycol (PEG), polypropylene glycol, polyoxyethylated polyols (e.g., POG), polyoxyethylated sorbitol, polyoxyethylated glucose, polyoxyethylated glycerol (POG), polyoxyalkylenes, polyethylene glycol propionaldehyde, copolymers of ethylene glycol/propylene glycol, monomethoxy-polyethylene glycol, mono-(C1-C10) alkoxy- or aryloxy-polyethylene glycol, carboxymethylcellulose, polyacetals, polyvinyl alcohol (PVA), polyvinyl pyrrolidone, poly-1,3-dioxolane, poly-1,3,6-trioxane, ethylene/maleic anhydride copolymer, poly (.beta.-amino acids) (either homopolymers or random copolymers), poly(n-vinyl pyrrolidone)polyethylene glycol, propropylene glycol homopolymers (PPG) and other polyakylene oxides, polypropylene oxide/ethylene oxide copolymers, colonic acids or other polysaccharide polymers, Ficoll or dextran and mixtures thereof. Dextrans are polysaccharide polymers of glucose subunits, predominantly linked by α1-6 linkages. Dextran is available in many molecular weight ranges, e.g., about 1 kD to about 100 kD, or from about 5, 10, 15 or 20 kD to about 20, 30, 40, 50, 60, 70, 80 or 90 kD. In one embodiment the hydrophilic moiety, e.g., polyethylene glycol chain, has a molecular weight selected from the range of about 500 to about 40,000 Daltons. In some embodiments the hydrophilic moiety is a polyethylene glycol chain having a molecular weight selected from the range of about 500 to about 5,000 Daltons, or about 1,000 to about 5,000 Daltons. In another embodiment the hydrophilic moiety, e.g., polyethylene glycol chain, has a molecular weight of about 10,000 to about 20,000 Daltons.
In one embodiment a conjugate derivative of the peptide of SEQ ID NO: 5 or SEQ ID NO: 23 is provided wherein a dipeptide is covalently linked via a peptide bond to the N-terminus of the peptide of SEQ ID NO: 5 or SEQ ID NO: 23, optionally wherein one of the amino acids of the dipeptide is an acylated amino acid. In one embodiment the dipeptide has the structure of X7X8-, wherein X7 is an acylated amino acid and X8 is any amino acid, optionally wherein X7 is an acylated Lys or dLys and X8 is Gly or a C1-C4 N-alkylated Gly, optionally wherein X7 is a Lys or dLys acylated with a C14-C20 fatty acid or fatty diacid and X8 is Gly or a C1-C4 N-alkylated Gly (optionally Gly or Sarcosine), optionally wherein X7 is a Lys acylated with a C14-C20 fatty acid or fatty diacid via any of the spacers disclosed herein and X8 is a C1-C4 N-alkylated Gly (optionally Gly or Sarcosine).
In accordance with one embodiment a conjugate derivative of any of the GLP-1 receptor antagonist peptides is provided wherein a self-cleaving dipeptide is covalently bound to an amino acid side chain amine or the N-terminal alpha amine of a GLP-1 antagonist peptide disclosed herein via an amide bond. In one embodiment the self-cleaving dipeptide is covalently bound to the N-terminal alpha amine of the GLP-1 antagonist peptide.
In exemplary aspects, the self-cleaving dipeptide comprises the structure: A-B wherein A is an amino acid or a hydroxy acid; and B is an N-alkylated amino acid linked to the GLP-1 antagonist peptide through an amide bond between A-B and an amine of the GLP-1 antagonist peptide, optionally wherein the chemical cleavage half-life (t1/2) of A-B from the GLP-1 antagonist peptide is at least about 1 hour to about 1 week in PBS under physiological conditions. As used herein the term “hydroxy acid” refers to an amino acid that has been modified to replace the alpha carbon amino group with a hydroxyl group.
In some embodiments the self-cleaving dipeptide has the general structure of:
In one embodiment the self-cleaving dipeptide has the general structure of:
In accordance with one embodiment any of the GLP-1 antagonist peptides and dimers disclosed herein can be further modified by linkage to a self-cleaving dipeptide wherein an amino acid of the dipeptide is acylated with a fatty-acyl group of sufficient size to bind serum albumin with high affinity.
In one embodiment amino acid “A” of the self-cleaving dipeptide “A-B” is a lysine residue acylated with a C16-C30 fatty acid or C16-C30 diacid. In one embodiment A and B are selected to provide a chemical cleavage half-life (t1/2) of A-B from the GLP-1 antagonist peptides or dimers disclosed herein of at least about 24 hours to about 240 hours, about 48 hours to about 168 hours, or about 48 to about 120 hours, or about 70 to about 100 hours in standard PBS solution under physiological conditions.
In one embodiment the self-cleaving dipeptide has the general structure of :
In one embodiment the self-cleaving dipeptide has the general structure of:
wherein
In accordance with one embodiment the self-cleaving dipeptide A-B comprises an acylated amino acid residue as “A” and an N-alkylated Gly residue as “B”, wherein the “B” amino acid is linked to the N-terminal alpha amine of the GLP-1 receptor antagonist peptide via an amide bond, optionally wherein said Lys residue is in the D-conformation. In one embodiment the acylated amino acid “A” of the A-B dipeptide is an amino acid having the general structure of
wherein n is an integer selected from the range of 1-4 and R50 is selected from the group consisting of NH-CO(CH2)14-20COOH, NH-[spacer]-CO(CH2)14-20COOH, S(CH2)14-20COOH and S-[spacer]-CO(CH2)14-20COOH, wherein the [spacer] is any of the spacers disclosed herein. In one embodiment the acylated amino acid of A is independently selected from lysine, d-lysine, ornithine, cysteine or homocysteine wherein the side chain of said acylated amino acid is covalently linked to a C16-C22 fatty acid or C16-C22 diacid optionally through a spacer comprising an amino acid or dipeptide. In one embodiment the spacer comprises a gamma glutamic acid. In one embodiment the spacer comprises multiple units of gamma glutamic acid and miniPeg polymers in any combination. In one embodiment the optional spacer comprises two gamma glutamic acids, optionally wherein the two gamma glutamic acids are joined to one another via an intervening functionalized miniPEG polymer, [COCH2(OCH2CH2)kHN]q, wherein k and q are each integers independently selected from 1, 2, 3, 4, 5, 6, 7 or 8.
In one embodiment the self-cleaving dipeptide has the general structure of :
wherein
In one embodiment the GLP-1 antagonist peptides and dimers disclosed herein are covalently linked to a self-cleaving dipeptide of the structure:
In a further embodiment the self-cleaving dipeptide has the structure of
In accordance with one embodiment the self-cleaving dipeptide comprises an acylated amino acid as the first amino acid, wherein the side chain of the acylated amino acid is acylated with a C16-C20 fatty acid or C16-C20 diacid, optionally wherein the acylated amino acid is selected from C16-C20 acylated lysine, C16-C20 acylated ornithine, C16-C20 acylated cysteine and C16-C20 acylated homocysteine, optionally wherein the acylated amino acid of the dipeptide is a C16-C20 acylated Lys, optionally wherein the first amino acid of the self-cleaving dipeptide is an amino acid in the D-stereochemical configuration.
In accordance with embodiment 1, a GLP-1 receptor antagonist is provided, wherein said antagonist comprises the amino acid sequence of R10-DVX11X12YLX15X16QAX19X20EFX23EWLVRGGPSSGAPPPSX40-R20 SEQ ID NO: 23), wherein
In accordance with embodiment 2 a GLP-1 antagonist of embodiment 1 is provided wherein said antagonist comprises the amino acid sequence of R10-DVX11X12YLX15X16QAX19X20EFX23EWLVRGGPSSGAPPPSX40-R20 SEQ ID NO: 23), wherein
In accordance with embodiment 3 a GLP-1 antagonist of embodiment 1 or 2 is provided wherein each acylated amino acid of the GLP-1 antagonist is an acylated Lys.
In accordance with embodiment 4 a GLP-1 antagonist of any one of embodiments 1-3 is provided wherein X7 is an acylated Lys and X12 is Arg.
In accordance with embodiment 5 a GLP-1 antagonist of any one of embodiments 1-3 is provided wherein R10 is NH2 and X12 is an acylated Lys.
In accordance with embodiment 6 a GLP-1 antagonist of any one of embodiments 1-3 is provided wherein X7 is NH2 and X12 is Arg.
In accordance with embodiment 7 a GLP-1 antagonist of embodiment 1 is provided the antagonist comprises an amino acid sequence selected from any one of SEQ ID NO: 5 though SEQ ID NO: 96, or any combination thereof.
In accordance with embodiment 8 a GLP-1 antagonist of any one of embodiments 1-7 is provided wherein the acylated amino acids of said GLP-1 antagonist are independently a Lys residue acylated with a C16-C18 fatty acid or C16-C18 fatty diacid directly linked to the Lys side chain or optionally via a spacer comprising a
In accordance with embodiment 9 a GLP-1 antagonist of any one of embodiments 1-8 is provided wherein said antagonist comprises the amino acid sequence of
In accordance with embodiment 10 a GLP-1 antagonist of any one of embodiments 1-9 is provided wherein X11 is Trp or dTrp.
In accordance with embodiment 11 a GLP-1 antagonist of any one of embodiments 1-10 is provided wherein an amino acid at position at any of positions 16, 18, 19, 24, 26 or 28 of SEQ ID NO: 5 is substituted with Aib, optionally wherein an Aib is substituted at position 18.
In accordance with embodiment 12 a GLP-1 antagonist of any one of embodiments 1-11 is provided wherein the amino acid at position 12 is substituted with an acylated Lys.
In accordance with embodiment 13 a GLP-1 antagonist of any one of embodiments 1-11 is provided wherein
In accordance with embodiment 14 a GLP-1 antagonist of any one of embodiments 1-11 is provided wherein
In accordance with embodiment 15 a GLP-1 antagonist of any one of embodiments 1-14 is provided wherein X40 is an amino acid having an acyl group linked to the side chain of the amino acid, optionally via a spacer.
In accordance with embodiment 16 a GLP-1 antagonist of any one of embodiments 1-15 is provided wherein X40 is an amino acid comprising a structure of Formula I (optionally, Lys), Formula II (optionally, Cys), or Formula III (optionally, Ser), wherein each of Formulae I, II, and III, is:
In accordance with embodiment 17 a GLP-1 antagonist of any one of embodiments 1-16 is provided wherein X40 is an acylated lysine.
In accordance with embodiment 18 a GLP-1 antagonist of any one of embodiments 1-17 is provided wherein the acyl group of the acylated amino acid is selected from (C1-C4 alkyl)NH-CO(CH2)14-20CH3-, (C1-C4 alkyl)NH-[spacer]-CO(CH2)14-20CH3-, (C1-C4 alkyl)NH-CO(CH2)14-20COOH or (C1-C4 alkyl)NH-[spacer]-CO(CH2)14-20COOH.
In accordance with embodiment 19 a GLP-1 antagonist of any one of embodiments 1-18 is provided wherein the acyl group of the acylated amino acid is covalently linked to the amino acid side chain of the acylated amino acid via a spacer.
In accordance with embodiment 20 a GLP-1 antagonist of any one of embodiments 1-19 is provided wherein the spacer is an amino acid or dipeptide.
In accordance with embodiment 21 a GLP-1 antagonist of any one of embodiments 1-20 is provided wherein the spacer comprises a
In accordance with embodiment 22 a GLP-1 antagonist of any one of embodiments 1-11 is provided wherein the acylated amino acid is linked to a C16 to C18 fatty acid or C16 to C18 fatty diacid, optionally wherein the acid or diacid is linked via a spacer comprising the structure:
In accordance with embodiment 23 a GLP-1 antagonist of any one of embodiments 1-22 is provided wherein the acylated amino acid is Lys having a C16 to C18 fatty acid linked to the lysine side chain via a spacer comprising the structure:
In accordance with embodiment 24 a GLP-1 antagonist of any one of embodiments 1-23 is provided wherein
In accordance with embodiment 25 a GLP-1 antagonist of any one of embodiments 1-24 is provided wherein R20 is CONH2-.
In accordance with embodiment 26 a derivative of the GLP-1 antagonist of any one of the claims 9-25 is provided further comprising a dipeptide A-B:
In accordance with embodiment 27 a GLP-1 antagonist of embodiments 26 is provided wherein the dipeptide A-B is covalently linked to the N-terminal alpha amine of the GLP-1 antagonist amino acid sequence.
In accordance with embodiment 28 a GLP-1 antagonist of any one of embodiments 26-27 is provided wherein
In accordance with embodiment 29 a GLP-1 antagonist of any one of embodiments 26-27 is provided wherein
In accordance with embodiment 30 a GLP-1 antagonist of any one of embodiments 26-29 is provided wherein
In accordance with embodiment 31 a GLP-1 antagonist of any one of embodiments 26-30 is provided wherein said dipeptide A-B comprises an acylated Lys residue and an N-alkylated Gly residue, wherein said Lys and N-alkylated Gly residues are linked via a peptide bond, optionally wherein said Lys residue is in the D-conformation.
In accordance with embodiment 32 a GLP-1 antagonist of any one of embodiments 26-30 is provided wherein
In accordance with embodiment 33 a pharmaceutical composition comprising a GLP-1 antagonist or derivatives of any one of claims 1-32 and a pharmaceutically acceptable carrier, diluent, or excipient is provided.
In accordance with embodiment 34 a method of treating a patient suffering from atypical hypoglycemia is provided wherein said method comprises the step of administering to a patient in need thereof a pharmaceutical composition of embodiment 33 in an amount effective to elevate blood glucose levels.
Ex-4 (9-39)a (SEQ ID NO: 2) is an established antagonist of the GLP-1 receptor. However, its use as a therapeutic agent in humans is limited due to its nonhuman origin and its relatively short in vivo duration of action. Comparable N-terminal shortening of human GLP-1 lessens agonism but does not provide a high potency antagonist. Through a series of GLP-1/Ex-4 hybrid peptides, the minimal structural changes required to generate a pure GLP-1-based antagonist were identified as Glu16, Val19, and Arg20, yielding an antagonist of approximately 3-fold greater in vitro potency compared with Ex-4 (9-39)a. Site-specific acylation of the human-based antagonist yielded a peptide “9-40 Jant4 K40[C16] (SEQ ID NO: 3) of increased potency as a GLP-1 receptor antagonist and 10-fold greater selectivity relative to the GIP receptor (Patterson, et al, ACS Chem. Biol. 2011, 6, 135-145).
As disclosed herein, variants of 9-40 Jant4-K40 have been prepared to provide a further improved GLP-1 receptor antagonist. Peptide 9-40 Jant4-K40 is acylated at position 40 by direct linkage of a C16 acyl group to the Lys side chain. Variants have been prepared inserting a spacer between the Lys side chain and the C16 acyl group. Table 2 presents the GLP-1 antagonist activity and solubility of these acylation variants.
Various amino acid substitutions were made to the primary sequence of 9-40Jant4-K40 (DVSSYLEEQAVREFIAWLVKGGPSSGAPPPSK;SEQ ID NO: 3) and the GLP-1 antagonist activity and solubility of these variants is provided in Table 3.
Table 4 provides data regarding the effect of Aib substitutions on the activity and solubility of Jant4-K40 (SEQ ID NO: 3) variants. Table 5 provides data regarding the effect of d-AA substitutions on the solubility of Jant4-K40 (C16) (SEQ ID NO: 3) variants and Table 6 presents data regarding Trp substitution at position 3 of Jant4-K40 (SEQ ID NO: 3).
Peptides were prepared by automated Fmoc/t-Bu solid-phase methodology employing a Symphony peptide synthesizer (Peptide Tech-nology, Tucson, AZ) starting with Wang resin (AAPPtec, Louisville, KY) and 6-Cl-HOBt/DIC activation. All conventional residues were purchased from Midwest Biotech (Fisher, IN), 6-Cl-HOBt and DIC was obtained from AAPPtec (Louisville, KY). Peptides were cleaved from the resin and de-protected by treatment with TFA containing 2.5% TIS, 2.5% H2O, 1.5% methanol, 2.5% phenol, 0.5% DODT and 0.5% of dimethylsulfoxide. Peptide was precipitated with cold ethyl ether from a filtered TFA solution according to standard procedure. The fatty-acylation of peptides was performed on resin with tenfold excess of Fmoc-Glu-OtBu/DEPBT/DIEA, repeated for double coupling, followed by tenfold excess of palmitic acid or another fatty acid/DEPBT/DIEA.
Palmitic acid was introduced to synthesized antagonist peptides using an orthoginal solid-phase protection scheme. Boc synthesis was utilized for peptide synthesis, allowing selective introduction of base-sensitive side-chain protected Lys(Fmoc)-OH at Lys40. The fully protected peptides were treated on resin with 20% piperdine inDMF (v/v) for 30 min to remove the Lys40 side-chain Fmoc group. Amide bond formation was facilitated with excess fatty acid and 5 equiv of benzotriazol-1-yl-oxytripyrrolidinophosphonium hexafluorophosphate (PyBOP) (Fluka) in DMF/DIEA (4:1 v/v) for approximately 18 h. Ninhydrin testing was used to monitor reaction progress, and acylation was confirmed after peptide cleavage by ESI mass spectrometry.
Reversed-phase HPLC (RP-HPLC) was used for peptide purification. A C18 stationary phase (Vydac 218TP, 250 mm_22 mm, 10 μm) was employed with a linear acetonitrile gradient in 0.1% trifluoroacetic acid during the preparative RP-HPLC purification. Analytical analysis was performed on peak fractions by employing RP-HPLC with a C8 column (Zorbax 300SB, 4.6 min×50 mm, 3.5 μm). Peptide identity and purity was assessed by analytical RP-HPLC and ESI- or MALDI-mass spectrometry. All peptides were found to have the correct molecular weight and were approximately 95% pure. Lyophilized peptides were stored at 4° C.
GLP-1 Receptor-Mediated cAMP Induction
The ability of peptides to stimulate or block cAMP induction at the GLP-1 receptor was examined by a luciferase-based reporter gene assay. Cotransfection of HEK 293 cells with the human GLP-1 receptor (Open Biosystems) and a cAMPinducible (cAMPresponsive element) luciferase gene constituted the cellular construct where receptor activation could be measured. Bioassays were performed by first serum depriving the cells for 16 h in 0.25% bovine growth serum (HyClone)-supplemented Dulbecco's modified Eagle's medium (Invitrogen) and then adding serial dilutions of the peptides over the appropriate concentration ranges in 96-well poly-D-lysine-coated plates (BD Biosciences). For antagonism assays, a constant concentration of GLP-1 (0.05 nM) was added to the assay plate after the diluted peptides. Incubation continued for 5 h at 37° C., 5% CO2 and was followed by the addition of an equivalent volume (100 μL) of LucLite luminescence substrate reagent (Perkin-Elmer). MicroBeta 1450 liquid scintillation counting (Perkin-Elmer) quantified the luminescence signal in counts per second (cps) after shaking the plate at 600 rpm for 3 min. Data was plotted using Origin software (OriginLab) and the effective concentration 50 (EC50) or inhibitory concentration 50 (IC50) was determined by sigmoidal fitting. Potency was determined by comparative analysis of relative EC50 or IC50 values. Each experiment was repeated at least three times with each sample assayed in duplicate.
C57B1/6 mice were obtained from Jackson Laboratories. Mice were single- or group-housed on a 12:12 h light-dark cycle at 22° C. with free access to food and water. All studies were approved by and performed according to the guidelines of the Institutional Animal Care and Use Committee of the University of Cincinnati.
For the determination of glucose tolerance, mice were subjected to 6 h of fasting and injected intraperitoneally with glucose. Injections consisted of 1.5 g glucose per kg body weight (25% w/v D-glucose (Sigma) in 0.9% w/v saline). Tail blood glucose levels (mg dL-1) were measured using a hand-held glucometer (FreeStyle Freedom Lite) before 0 min and at 15, 30, 60, and 120 min after injection.
Mice received a subcutaneous injection of peptide (in PBS) either 1, 4, 8, 24, 48, 72, or 120 at varying doses before being challenged with an IP injection of dipeptidyl peptidase-IV-protected Ex-4 (0.65 nmol kg−1). A GTT was performed fifteen minutes after the GLP-1 injection. Tail blood glucose values were obtained as described above.
¥ K40[miniPEG-gE-C16]
‡Highly viscous solution
This application claims priority to U.S. Provisional Patent Application No. 63/149,852 filed on Feb. 16, 2021, the disclosure of which is expressly incorporated herein.
| Filing Document | Filing Date | Country | Kind |
|---|---|---|---|
| PCT/US2022/016406 | 2/15/2022 | WO |
| Number | Date | Country | |
|---|---|---|---|
| 63149852 | Feb 2021 | US |
